2YXSA

Crystal sturcture of n-terminal domain of human galectin-8 with d-lactose
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
150
structure length
150
Chain Sequence
LQNIIYNPVIPYVGTIPDQLDPGTLIVICGHVPSDADRFQVDLQNGSSVKPRADVAFHFNPRFKRAGCIVCNTLINEKWGREEITYDTPFKREKSFEIVIMVLKDKFQVAVNGKHTLLYGHRIGPEKIDTLGIYGKVNIHSIGFSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Galectin-8 variant
publication title Crystal Sturcture of N-terminal domain of human galectin-8 with D-lactose
rcsb
source organism Homo sapiens
molecule tags Sugar binding protein
total genus 30
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2007-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2yxsA00
4XXPA 2DUOA 3OBRA 1ENRA 2RHPA 4LBQD 3ZXEA 1V6OA 3POWA 4YZ1A 1IOAA 1CJPA 1CR7A 2VH9A 3WG2A 1JUIA 1RITA 5L73A 2GNBA 3ZSKA 1IKQA 3POSA 5EXOA 1BYHA 1DBNA 4YZ3A 3T1MA 3KQRA 2P3IA 3AZVA 3USUB 2R0HA 1Q8SA 2OUHA 5FRAA 4XHBA 1YXWA 4M3CF 4FOQA 1SBFA 2SBAA 1Q56A 3WDVA 1JYIA 2DURA 2ZMKA 2Z42A 5IUQA 1VAVA 4BOWA 2SLIA 3PJQA 2ES3A 4Y20A 3Q9OA 1WW4A 3SH5A 1QOOA 1FNYA 1DHKB 2EF6A 4YGBA 5T55A 4BMEA 3B00A 2CWSA 1JXNA 2ZAAA 3AZZA 2WLQA 3PVNA 2ZMNA 5IK5A 2ZHNA 3RS6A 1S0CA 1WCSA 1BJQA 2ZGRA 4BPZA 1Q8OA 3VV1A 2D6MA 3V0AA 1V6KA 1ZM1A 2VU9A 1Z0HA 3POYA 5E89A 3QCWA 5KXEA 3WHUA 1N47A 1ULFA 3APBA 3OPZA 2A6VA 3WG4A 1WW6A 1F9KA 2YY1A 1W6OB 4Q2FA 5EYYA 3SITA 2D43A 2VY0A 2GN7A 3TAYA 1ULDA 5CAZA 4FQ4A 2GMPA 3USUA 1SLBA 4NOTA 4BLJA 4DRVA 4AWDA 3M3CA 4GWNA 4ATFA 1JHNA 2JECA 5GALA 2NP0A 2JE7A 3N7MA 4AGVA 1LESA 4D69A 1D0HA 1LHOA 3MW2A 1C57A 2D3SA 1LHUA 4ASMB 1DYPA 2W39A 4GKXA 2YV8A 3N7JA 1D2SA 1HKDA 1LOFA 3IPVB 4P14A 4Y1XA 1CQ9A 1GANA 4LBQB 4GALA 3ENRA 5T5PA 3WUDA 1LODA 3HR9A 3AYAA 5HCBA 1YIFA 1Q8VA 5JVVA 3WDTA 1G9DA 1Y7BA 1QU0A 4ISRA 3AYDA 1QOSA 3WDYA 3C2UA 1EPWA 4LBJA 4XJ8A 3VKLA 5CA6A 5GZGA 3OBTA 4FOVA 5HCFA 1W6OA 2PHWA 3BOPA 2DU1A 1DQ0A 1UL9A 3R4UA 5DG1A 4AGGA 2NN8A 4Q26A 3ZSMA 3ZXLA 2AGSA 1MS4A 1GV9A 2YMZA 4YG3A 3ZSLA 4AYUA 5FREA 2P3JA 4XXAA 2UWAA 1AJOA 2ZBJA 1GZWB 1KJLA 4FPLA 4AGRA 1YI7A 4IQPA 5DG2A 3RMXA 3INAA 5GZFA 3UJQA 3SH4A 3FUOA 2DYCA 3IPVA 2E53A 3WCRA 1IS6A 3HN1A 1G9AA 4FPHA 2GN3A 1GZ9A 5KXCA 3A0KA 4CTEA 3IN9A 2R49A 3N36A 2WT0A 4HL0A 4U2AA 4WVWA 4RL7A 3RQ0A 4YW1A 3OY8A 2DV9A 4YFWA 1QF3A 2GMMA 2VUAA 2NYYA 2W08A 5DXDA 1DQ5A 5E88A 3ZVXA 5GLZA 1YO8A 2A6XA 3AXEA 1QGLA 2D6LX 3RRDA 5IT6A 1C4RA 1ULCA 4BQ1A 1V6JA 5F5QA 3IKWA 3VKMA 4PCRA 2GNTA 1VAMA 2A7AA 2ZGOA 3HMYA 1KDKA 4YFZA 1Q8QA 3ZPYA 3ILFA 4TZDA 3AZXA 3B01A 4Q1RA 4YW5A 3NV3A 3PMEA 1DQ4A 1AJKA 1W6PB 2OVUA 3AP6A 1UX6A 1MS3A 3D6EA 2PELA 1ZA4A 2ZHKA 1QKQA 1LHNA 4CRQA 2A6WA 4DPNA 2ZHLA 3CNAA 2ZHMA 4Y1ZA 1MS5A 1YRZA 3AFKA 4ISQA 4P9WA 3DGTA 2CWMA 3KM5A 4FP2A 1W6MB 4Q27A 4UW6A 5IK7A 2NMOA 3WOGA 2P37A 4K20A 2GNMA 5GJ6A 1WW5A 4YGEA 4YLZA 2DVAA 3FLRA 4YM1A 3IMNA 1MVEA 3LCPA 4XTPA 5GM0A 1V6IA 3FBYA 3DUIA 3AZWA 1LOGA 1W6NB 5SV8A 1PZ7A 4FPKA 3MPPG 5T5JA 3O12A 2D3PA 4R9DA 1W0PA 2FMDA 4M3CA 1DYKA 4DS0A 1DFQA 2DVBA 2JD4A 1FATA 1WBLA 1LEDA 2E51A 1MACA 1WW7A 2ENRA 4OZXA 1IS5A 1JBCA 1GKBA 1G8WA 2A5ZA 4Q8LA 1LOCA 4UW5A 2NM1A 3ZXFA 2CL2A 3AP7A 3OJBA 5KXDA 1JW6A 5JDBA 1B09A 1FYUA 1FNZA 3WV6A 1W0OA 1AX0A 2XB6C 2EAKA 1G86A 4FPJA 2V73A 1WBFA 1LGNA 4I30A 4CZSA 2A70A 1MZ6A 3B69A 5IK4A 1H30A 4XJAA 5T5OA 4WZFA 3NWKA 1S0FA 3OGGA 3VKFC 2D3RA 2UURA 1LGBA 3NV2A 2W52A 4C1XA 3MW4A 1W6MA 2I2SA 2D6NA 1S0IA 2TEPA 2D6KA 3N3HA 2DUPA 1QDCA 3O0VA 4PBOA 2ERFA 1U0AA 1AXYA 4K1YA 1F31A 1FV2A 2Q5TA 2H0BA 4PBPA 3W58A 2E6VA 1N1VA 3A0NA 3WUCA 2GALA 4AVVA 2ZA9A 1OKQA 1QNWA 1MS9A 3FUQA 4M00A 2C5DA 4XILA 4M01A 1N3QA 5LK5A 2CTVA 2WKKA 3U4XA 1QOTA 3FLTA 3ZXJA 1SFYA 2AENA 5GLWA 2A6ZA 2UWCA 1SLLA 3WLUA 1RIRA 1H9WA 1AX1A 4Z8BA 2UU8A 2ZGQA 4LBKA 4XZPA 1G9BA 2JJ6A 3AX4A 1N3PA 1ONAA 2DVDA 3AP5A 3N7KA 4YM2A 2ZGMA 3AXDA 5T5LA 5DZGA 2AR6A 2NMNA 1KRIA 2UWBA 2VW1A 1LEMA 4YGCA 4H55A 1LULA 1O4ZA 1A3KA 1OFSA 1FAYA 1BKZA 2VW2A 1LHVA 1LENA 3AYEA 3ILNA 2EALA 1MVQA 1SCSA 3JU9A 1J1TA 4FVVA 4PF5A 4WV8A 4ZXKA 3VKOA 1HDKA 4RA0A 1WLWA 2DUQA 1V6LA 4XJZA 2V5YA 4FP3A 4Y26A 5JOYA 2KM2A 1V6MA 2ZGPA 4NO4A 1SBDA 1GNHA 4XJ9A 1CN1A 2ZABA 4XTMA 1LTEA 1JYCA 3B3QE 2D44A 3O0WA 4YGDA 3UJOA 1IS3A 3LSDA 1C1FA 1AXZA 1YYNA 5E8AA 1CPMA 3JUUA 4GWMA 5CNAA 2PHTA 2VXRA 1DQ6A 4XBQA 2E7TA 5JOXA 1MS0A 2DTYA 3AP9A 2YROA 3M3OA 1SCRA 4FPGA 1LGCA 1KQRA 4FOWA 5GZEA 4PQ9A 4LBQA 1SLIA 2LALA 1DIWA 1AXKA 1UPSA 1BQPA 1UN1A 5H9PA 1WD3A 2ZZJA 4Y22B 1ULGA 4GA9A 2D7FA 3M3QA 4XJWA 3TB0A 4ATEA 1GNZA 4Y1UA 3GALA 5DUVA 1HQLA 1AX2A 2CY6A 2WSVA 2JDZA 2ZMLA 3ILRA 4AVTA 1S0EA 5BYNA 4JRAA 4AVSA 1R1ZA 1A78A 1V6NA 3R4SA 3VKNA 1IS4A 1LHWA 1QMJA 3IM0A 1F5FA 3NV1A 3RG0A 4FPEA 3D5OA 4KBBA 1FX5A 1DQ1A 1H9PA 1X50A 1N1SA 3V0BB 1WLCA 1MS8A 4FOYA 5T54A 4FQZA 4Y1YA 1KJRA 2R16A 3M3EA 1KITA 4DRRA 5JLVA 2EIGA 2DTWA 3BTAA 4Y24A 1GZWA 5AVAA 5HCAA 1GLHA 1A8DA 3M1HA 3WDUA 4C1WA 5GLTA 1VALA 3ATGA 1GYKA 3WG3A 2E7QA 1LOBA 3R05A 4JCKA 2WT1A 2ZACA 1UAIA 1LECA 2DVFA 3MEPA 3OYWB 4XIKA 1I3HA 2WSUA 4K21A 4YG6A 4Y22A 1DZQA 2D6OX 2XG3A 1G9FA 1G9CA 3FLPA 2WQZC 3GNEA 4P9XA 3O5SA 5H9RA 3V0AB 2VW0A 1TEIA 1N3OA 2P3KA 2BQPA 3ZYPA 4F83A 3AP4A 4FPCA 1MR5A 1LOFC 1O4YA 1Q8PA 1WUVA 3N7LA 4R9CA 3SLIA 2R1DA 4LBNA 2GDFA 4YM3A 1W6PA 1S0JA 1W6QB 3MW3A 1PZ9A 1SLTA 1DLLA 1AF9A 2AREA 2HYKA 5JOZA 3PVOA 3V0BA 3UL2A 1ENQA 1VIWB 4YW4A 2WJSA 1APNA 3NV4A 3WCSA 1BXHA 3V64A 4M3CE 3AK0A 4Y1VA 5IK8A 1LOEA 1FV3A 5JOWA 1RINA 4YW2A 1CIWA 1N1TA 2A75A 4BMBA 3AZYA 2CNAA 3SISA 4R9AA 1LU2A 1JN2P 4YZ4A 5T52A 3D4KA 3WDXA 1UMZA 2EXKA 3I4IA 5T50A 4FPFA 4DFSA 3OYWA 4FPYA 1QDOA 1SACA 1W6NA 1CVNA 3QLQA 2ZGNA 1WLDA 1S1AA 1XQNA 2AUYA 2PHUA 1LU1A 4XMIA 3RSJA 3SNMA 1AVBA 2ZGSA 3RMYA 1SBEA 2ZKNA 5H9SA 5GZCA 2JKBA 3VUOA 4XJUA 2PHRA 3A4UA 1N1YA 4YZ2A 5GZDA 1W6QA 3AYCA 1ULEA 1LOAA 1DQ2A 1UZZA 4L8QA 5GLUA 1KDMA 4XBNA 1CONA 5DUUA 2YXSA 4LBLA 3ZXKA 5DZEA 4YG0A 1UZYA 3I8TA 4Q1PA 4WVVA 3AJZA 1Z78A 4R9BA 2D6PA 5KXBA 2G4IA 3T2TA 4BLIA 1C1LA 2PHXA 1LJ7A 4XE9A 3SH3A 5CBLA 4FPOB 5CB7A 1SLAA 4UW4A 5EYXA 3OY8B 1LCLA 4DQAA 4GXLA 2DVGA 2NZ9A 3BIWE 2A3XA 1G7YA 1GBGA 1MZ5A 1NXD1 3L2YA 2ZGLA 1QNYA 3BODA 5DUXA 2A71A 4XDQA 4XIOA 1S0BA 4GKYA 4ZKTB 1GZCA 2EXJA 4Q8KA 2EXIA 3LSEA 2R1BA 5DZFA 3WHTA 3UK9A 1ENSA 2WT2A 2ARXA 2CYFA 1OQ1A 2OW4A 1HQWA 1MS1A 1NLSA 4K1ZA 2A3WA 3O0XA 2A6YA 4U36A 4XHXA 4XOGA 2WNEA 1S0GA 1HLCA 1WD4A 1BZWA 4YM0A 2LTNA 2ZGTA 2ZGKA 3ASIA 3WNXA 3FFZA 1URXA 3H0OA 2P34A 1CESA 3WG1A 3AJYA 2EXHA 2PHFA 3WDWA 1PZ8A 3ZYRA 1I1EA 3W59A 5GLVA 1CPNA 3ZSJA 4HANA 1GICA 4LBOA 5EWSA 2FHRA 3PVEA 2JE9A 1JOJA 4SLIA 3WZ1A 2B7YA 4BM8A 3N35A 4XBLA 1SLCA 2YZ4A 3WVJA 1IKPA 1V00A 2DU0A 4M3CB 4LBMA 1DGLA 2ARBA 4MYEA 1S0DA 4P9YA 5JMCA 5F9TA 2DWRA 4ITCA 2P2KA 3B9CA 4Y20B 4YZ5A 2OUJA 1VLNA 2A3YA 2C9AA 2R0FA 1AZDA 2ZGUA 4YW3A 4TYSA 2GNDA 1GSLA 2W68A 4UW3A 4XYXA 2GMEA 3M2MA 5H9QA 3V65A 4W65A 2AYHA 5DUWA 3T1LA 4XMAA 1UKGA 2AH2A 4JC1A
chains in the Genus database with same CATH superfamily
5FLJA 2DUOA 3OBRA 4QAWA 2RHPA 2HWF1 4LBQD 1ZBA3 3I2KA 3ZXEA 1OLQA 2BBAA 1JI6A 4CDXC 2XUMA 3JD71 3WG2A 1JUIA 1SPPA 2GNBA 4RFT0 1VBE1 4XUTA 4QX1A 2ZX4A 1HXS1 4FT8A 3FZ3A 2Y26A 3HJRA 4XABA 4FFIA 3QH7A 1TMF2 1UY3A 1FPN2 2YGMA 4M3CF 1NLQA 5KR7A 1SBFA 4YRDA 1BK0A 1WA6X 3BIEA 2V09A 1K45A 3CEWA 2VNOA 3CL1A 4AVBA 2RS31 1FT9A 4LHKA 5BNNB 3LA2A 2DURA 3IBMA 4CDQB 2V4AA 4B8EA 5CFCB 5IUQA 2IXKA 4BYYA 2RS51 2Y0IA 2BGCA 5BV6A 2SLIA 3PJQA 5D1IA 1WW4A 3POEA 1UU5A 4IE6A 4GH4B 2Q8OA 2PXJA 4UFIA 4BMEA 1QH6A 2JDYA 1COV1 5EJ3A 3PVNA 5FPXA 2ZMNA 5IK5A 2GU9A 1CX4A 4P5YA 3LPGA 4XF4A 3VBHA 2QTWB 1PGL1 4A4AA 1CAXB 1ZM1A 2VU9A 4OI4A 4RHV3 3QCWA 4QD2A 2HBUA 2MEV1 1UXZA 5A3LA 5FQ0B 4CDWC 3OF1A 3APBA 2VZOA 5FZBA 3WG4A 5LRSA 1F9KA 2BNNA 4V2WA 2F17A 4N7UA 2GN7A 4YNIA 4YVWC 5FXXA 3TNPB 2J1AA 2XJPA 1OOPC 1YUDA 3USUA 4BLJA 4P9IA 1NAEA 1JZ6A 4QQLA 1IG0A 5FP4A 4YSFA 4GWNA 4ATFA 3TN91 1XNKA 2JECA 4A7ZA 5KBFA 1SZBA 2J1UA 1LESA 1JHJA 1UZ0A 4AI2A 4ASMB 1OC1A 1LOFA 3MFAA 2X5IB 4I0AA 3ZFEC 3VBSC 3NJZA 4DXRA 5T5PA 3WUDA 2C6SA 1OT5A 4LQRA 5FBJA 3EO6A 4ZY9A 2F6BA 2VUJA 1Q8VA 1Y7BA 2BU9A 3JCIA 4ISRA 2VO5A 4ZZ8A 2Y8KA 5CVRA 1CIYA 2XLFA 4DIQA 1YQ8A 4Q4X2 2W95A 4XJ8A 1PO13 3LWCA 4HLTA 5GZGA 5APAA 3ZN6B 5HCFA 4QKDA 1W6OA 1ZZBA 2EAAA 1W8WA 2YB7A 1AR61 5K0UA 4INDA 1UL9A 5DG1A 3Q8AA 2WWSA 5TSWA 1E5SA 3ZXLA 1TVGA 4UXAA 5FBZA 5BXXA 2RS13 1RUI1 4YG3A 1JYVA 5IFPA 2R062 3NRUA 2UWAA 1DYOA 2ZBJA 1GZWB 4FPLA 5I0DA 2R071 4CEWC 4IQPA 5DG2A 3RMXA 3UJQA 4EN6B 1SFNA 3DPRC 4XFHA 1OVPA 1PVC3 3IPVA 3MGUA 3J9SA 3H1MA 4UBHA 5KWRA 2GN3A 1VBC3 4GWIA 2YG0A 5F2SA 4WVWA 3IAPA 4HL0A 4RL7A 3RQ0A 1R082 4RQPB 2WN2A 4FFGA 3NJYA 4MXWA 3RVHA 4OHYA 1XSRA 2VNRA 4NAMA 1LB2A 3MI8A 3ZVXA 4D6RA 2DBNA 3MV01 3HEIA 4MGKE 4DZGA 5K7PA 4TTGA 1QGLA 4MHRA 3LEKA 4UFKA 3QACA 3TEXA 3DYMA 4IV3B 1ULCA 1UQXA 5DAPA 4YVSC 3ZDSA 3NW4A 2WFPA 3IKWA 4FAHA 1R091 1YJLA 2GNTA 2I74A 2VTXJ 3LGRA 2ORXA 5FZFA 1Q8QA 2BYVE 2VVEA 3ZPYA 3H8XA 3AZXA 2WNVC 2RR13 2WZR2 1JU3A 4MADA 1MQTA 3PMEA 2OVUA 4EQVA 3VD9A 2PELA 4XFCA 5JXGA 1QKQA 2I45A 5F5CA 2VVDA 1DGRA 1HRV1 4DPNA 2EIBA 3HNYM 3BTZA 2ZHMA 1EPZA 1GP5A 2RJLA 1UNBA 2Y60A 1W9FA 4GB31 4Q27A 5LB6A 2VMEA 5DAXA 3VBOA 3ZDVA 2P37A 2PMWB 2VZPA 3NNFA 1T6BX 4P9JA 4I01A 1YQ2A 3FLRA 5FZIA 2WYFA 1V6IA 3FBYA 4DEVA 1BEV1 1AR83 4I3PA 5F6KA 4ZXEA 1QH7A 4FPKA 2LRPA 1BMV1 1ST8A 4R9DA 4BQ3A 2OPKA 3K4AA 4CPBD 2VZ3A 1RUJ2 2MPFA 1IG3A 2WS92 5FJHA 3I54A 4LORA 3SHRA 1IS5A 1GKBA 4QT6A 2ZJCA 4A6SA 2YFZA 4AVCA 1J3PA 4OUEA 3MFCA 2NM1A 2VCCA 3OBZA 4NRQA 4XPVA 1PGSA 4FO9A 5KXDA 1JW6A 5JDBA 2G9ZA 1FNZA 4YWAA 1UCXA 1UW8A 4AE2A 3O1SA 3UYJA 4FPJA 4V1PA 1DP0A 3VBRA 1PGW1 3LIGA 1MZ6A 3B69A 1HJGA 3VGIA 5FYCA 2VJXA 5IK4A 5IVCA 1RUNA 3O1UA 4CP1A 4LEJA 4QPIA 4IXLA 3OGGA 3VKFC 5ABJA 2W52A 4FBFA 1XE8A 1GFF2 1UPIA 1W6MA 2D6NA 4IEZA 1QJU1 2VL4A 2VZVA 2DCKA 5FV3A 2TEPA 2D6KA 4MLOA 2AZ5A 2N7GA 4ZS2A 2PLV1 1I5PA 3O0VA 1ND2C 2Q30A 4AAXA 1U0AA 4Q29A 4CCEA 2H0BA 4QDSA 5IAXA 1AL0G 1M06G 4Y5Z0 1MS9A 2C5DA 5BNNA 3SKJE 1N3QA 2J7MA 3WNPA 3HQXA 2DFCA 3K4DA 4CDQA 1OLMA 5FCCA 3ZXJA 1SFYA 4LE4A 3DXUA 2PQQA 1NCRC 1F5JA 1OPMA 5CG9A 1F8VA 1REFA 1RUD3 4Y4RA 3HWJA 3U78A 3JZVA 4NHKA 1OH4A 2UU8A 4GH4A 4XZPA 5LATA 4B4PA 2JJ6A 3AX4A 1N3PA 1G9BA 3AKSA 3LA7A 5FYVA 3U4SA 4PIYA 1OF3A 1UY4A 3ELNA 1KS4A 5JIAA 4LPLA 1TNRA 2BP6A 2UWBA 1AYM3 2JDNA 3PHMA 1CAXA 3PL0A 4RS5C 4YGCA 4ASKA 5KHJA 2PAKA 4Q4Y3 4QQHA 5FQ0A 2R7EB 3T0DA 1YQ5A 3M8LA 3VKOA 1O59A 5K4LA 5L19A 4Q0QA 2BFUS 1UMHA 4LKEA 5LEKA 2RJ2A 4NIDA 4Y26A 5JOYA 2HWD3 2KM2A 2ZGPA 1SBDA 3VDDC 3U75A 5JXHA 1JH5A 2O8QA 2QQUA 2VOTA 4XJ9A 1LTEA 1W3VA 3J7LA 2WFF1 5BNPC 1IS3A 4NVPA 5CYYA 3PU8A 3ZIWA 1C1FA 1DF0A 3AM2A 5E8AA 1CPMA 1XYOA 1ZVFA 3JUUA 2YPJA 1QJX3 4GWMA 4HFSA 4KU7A 3I97A 4QX0A 5DDJ2 1DQ6A 4IE7A 4CCOA 2X5IA 2HWC3 5IVFA 2YYOA 4K7JA 4GMP0 3OGSA 1AR93 1AXKA 1U12A 3RPQA 5IVJA 2ZZJA 1JODA 4FTSA 2XBO3 3TB0A 1GNZA 1VBD1 1HRI2 2WINB 1AX2A 2CY6A 4M4PA 2JG8C 2WN3A 4GWJA 5C3PA 3ILRA 1S0EA 3PU3A 5FZ4A 2RDSA 5D8AC 3R4SA 4TN7A 5FYUA 3HIFA 3IM0A 4G9SB 3J26N 2K2SA 3PTRB 5IAVA 4KBBA 3D5OA 4CPBA 2YDEA 3V0BB 3T08A 1D2QA 1MS8A 4FOYA 2R16A 5L36A 3B5LB 2ZOEB 2EIGA 5LEJA 1HN0A 3BTAA 5FR3A 1GZWA 3BYWA 1GLHA 2XKOA 3J8F2 4GMP3 1TE1B 1VALA 1RUG3 4MOAA 1GYKA 1W9YA 1H8TB 3T4VA 2J1SA 3O14A 3WG3A 1LOBA 5JI7A 4NR1A 3OTFA 3POJA 1NYWA 4O7XA 5AC91 1LECA 1QJY2 2DVFA 4XIKA 2HBTA 4RQPA 1RHI2 1QHDA 4DINB 2Y6GA 4ZU5A 4MX3A 2XG3A 1G9FA 5H9RA 2VW0A 3E5XA 1N3OA 2P3KA 3ZSEA 4IV3A 3OEAA 3ZIXA 1LAJA 1JZ2A 2ZX2A 3OD0A 3W21A 1W03A 2K46A 4Q5OA 4QX5A 2ZAHA 3BPZA 1O4YA 3FC0A 4IGOA 5BNOC 1GU3A 4R9CA 4B1LA 1W2NA 5C71A 4PIZA 4LBNA 4W50A 1K42A 5FY1A 1OLRA 1XXNA 2AREA 5FO8B 4QGMA 4YW4A 1FOD3 4QB2A 2JDHA 1GQHA 1PNGA 3WCSA 1BXHA 2W1QA 4Y4YA 3KCCA 3H42B 1WKYA 3FHIB 3WQ7A 4IDZA 1ZZ9A 1N1TA 4LO6B 3AZYA 5A6XA 4HKOA 2BW8A 2PYTA 1W8UA 4YZ4A 3CJIA 3J7NA 1R1A1 2EXKA 2CV6A 3I4IA 3VB9A 1F4AA 2AACA 3UGFA 4BK4A 3RZGA 1OQDA 4W6YA 3ZXGA 3P6BA 3QLQA 5FUPA 4JKMA 2QNKA 1W9WA 2WC2A 4J25A 1H2NA 5FPZA 2XDVA 1RMU3 3ZMNA 1US2A 1JUHA 5ISLA 3DCQA 5SV5A 4LKFA 3LDBA 2PHUA 4XMIA 5C9AC 3SNMA 1AVBA 2QQLA 2ZKNA 1Z7S2 4XFIA 2JKBA 3L9JT 3VUOA 2VMFA 1YIPA 2YPDA 4HVOA 2PHRA 3LQCA 1HV0A 1M4WA 2XVKA 4PLMA 4WM7C 3DV8A 5GZDA 2QQVA 1W6QA 2HKXA 1RB8G 4UOJA 1LOAA 1DQ2A 2QFEA 2X05A 4L8QA 3N9NA 5FPLA 2GSYA 4XBNA 3K48A 1ZRFA 2WBKA 1DU3D 3ORJA 3ZXKA 2Q1MA 1MEC3 1UZYA 3I8TA 4CDWB 4WVVA 1WGPA 1YWKA 1AYM2 1POQA 2CDPA 4NHYA 2VPVA 5KXBA 4GAZA 4ES9A 3T2TA 2LM3A 1LJ7A 3WF4A 2EIDA 4QM8A 4FPOB 5CB7A 4UW4A 2DF7A 5EYXA 2XMLA 4FXKB 2XKPA 3LFMA 3ES1A 2HWD2 1EUTA 3ACFA 3DN7A 2X29A 2QUOA 1UY1A 3D3AA 1G7YA 4N9HA 3C7FA 1SHWB 4OYUA 1QNYA 2RS11 1NY71 4XDQA 5C6CA 5LCWL 4B1MA 1GZCA 3O1TA 1NOVA 4QKFA 1PMHX 4JRLA 5JSPA 4OI0A 2EXIA 2FDHA 2R1BA 2BUKA 5EP9A 3ZFGC 1PIV2 4KNCA 1ENSA 1RUE3 1CZSA 4UWDA 4I2OA 4IE4A 1G6NA 1ZBE2 5FWJA 1IZ3A 2F4PA 4KMQA 1VBC1 1W0NA 3BI3A 2Z5WA 2HH9A 4S2DA 4XOGA 1XU2A 2WNEA 4HG6B 1HLCA 2ZGTA 2RM21 3ASIA 4FFFA 2IZWA 1URXA 3CMGA 3AB0A 4JGYC 4XF3A 5D21A 5J09A 3WDWA 1C5HA 1PZ8A 5LBEA 3VBFC 5EHDA 3S57A 5GLVA 1CPNA 1OPOA 2O0OA 2JE9A 3AMNA 4IEUA 4LIVA 5G05L 5A32B 3GZEA 5KHIA 3RI9A 3WZ1A 2Y38A 2VNVA 5JWPA 2R041 3POFA 3BN6A 1V00A 2W5FA 3WNMA 4P9YA 5DQ0A 1E5IA 4CU8A 4ITCA 4J1XA 4LUMA 5E16A 4NIAA 5FTTC 1FMD1 3OCPA 2RDRA 2R0FA 2C9AA 4D7SA 4JQTA 1AZDA 1F15A 4LKSA 1OUXA 1GSLA 2W68A 4UW3A 4XYXA 3WNOA 1C5IA 2D5HA 1VBB1 5H9QA 4B7KA 4W65A 2VECA 4P5HA 4EZ4A 2OZ6A 4JC1A 4LOSA 4HT1T 1V6OA 1YFXA 2X53S 3NJXA 5A3NA 2FDFA 4E9KA 3ACLA 4YZ1A 3UESA 1EAH3 4QKNA 4B4RA 1J1LA 3NQHA 1IKQA 2CHHA 1VRH2 3LAGA 1BYHA 1DBNA 1NCQC 1TMF3 1FPN3 1H4GA 3DF0A 3I2HA 3NAPC 1WCKA 3OBAA 5KHHA 4QHOA 4IEYA 3USUB 2OA2A 1UX7A 2C4XA 2TNFA 4A7KA 3LKJA 4XHBA 1YXWA 3KLSA 4IE0A 3UETA 3E5QA 4Y5SA 2HLEA 3WDVA 3WR0A 1JYIA 5JSOA 1REEA 4JX0A 4JZRA 2VZSA 1R64A 3MF6A 4XUQA 4CP0A 4NN0A 5IVBA 3JD72 4O61A 1H8TA 4MHUA 2HEYF 1IPSA 1QOOA 1FNYA 1VBE2 1DHKB 3TBDA 2EF6A 4YGBA 5A3PA 1BVVA 1GUIA 1HXS2 3B00A 1W8NA 1JXNA 4MGIE 1ULPA 4ORFA 2Q8EA 5FK7A 5C3QA 3FL7A 4NHXA 2ZHNA 3RS6A 1JMUB 1BJQA 1AYN1 1KS5A 1H8VA 2CAUA 3VV1A 2D6MA 2VMDA 3POYA 4N90A 5JAXA 2RS32 3OUIA 3WHUA 2YBPA 1W2OA 3OPZA 1GOHA 2QQNA 4UI9L 1MPXA 2YY1A 1W6OB 2B5HA 4PIXA 5EYYA 3WNNA 2D43A 2RS52 5IYYA 1O91A 3WEZA 3W5NA 2VY0A 1W2TA 3TAYA 5C70A 5CAZA 2NPIA 1SLBA 4NOTA 4O9EA 5CFDC 4XQDA 2CDOA 3MIBA 1HX6A 1VB4A 3RYPA 1Y9QA 4DRVA 2YU2A 5A33B 1DLCA 4HOOA 1VP6A 3I2DA 2WIIB 5GALA 4R52A 2GH2A 2JE7A 3MUZ1 1PGL2 2WA4A 3EBRA 1H1IA 3N7MA 1D0HA 3WF2A 1LHOA 3TOJA 1C57A 3PIJA 2O14A 3DL3A 4IETA 4UF0B 2B45X 1XB9A 1PO21 3IPVB 3OOXA 1C28A 1GWLA 1UYYA 2D93A 1D7PM 1JZ3A 1CWPA 3IDBB 1CQ9A 3CJXA 4LBQB 1ND2B 2UYAA 4ASLA 3RZZA 4UBGA 5ANNA 4MXWB 3UKTA 5CZKA 1YIFA 5JVVA 3TNQA 2NLRA 3AYDA 1OH3A 2XJUA 4KBZA 4M4RA 4Q4V1 3WDYA 4D8MA 4LBJA 3TN92 4XAAA 3VKLA 5CG8A 4GULA 3OBTA 4H14A 2P5BA 3I3BA 3VZLA 4C0BA 5BNQA 4SBVA 4URTA 2E32A 3JQWA 3KHCA 4PLNA 3WX5A 4AAPA 3VHRA 3MIGA 4QQ2A 3BU7A 1RJ8A 5FY7A 1FI2A 2HWC1 4HSJA 4L11A 2R063 3D82A 4XZUG 1V9U2 2BEOA 3ZSLA 2VOXA 1Y4WA 2YFUA 3NNMA 2YC2A 3PUSA 4R8HA 2VG9A 4XXAA 3OG2A 1AJOA 2GC1A 4E2GA 4CDWA 5HBAA 5LRRA 3SH4A 1L7QA 3VBOB 1R083 1IS6A 3HN1A 3LEGA 4FPHA 4JHZA 3ZFFC 1WWYA 2JG9C 4PDWC 4UFMA 3B93A 4CTEA 3N36A 5KXCA 1UOGA 1AR62 2FD8A 1QJEA 2DV9A 4L92A 3IB3A 4EWDA 1S2EA 3FBMA 5BNPB 4IV1C 5E88A 1DQ5A 4ES8A 1RUI2 2A6XA 2LROA 3FHAA 3RRDA 1C4RA 2WZR3 5FIXA 3VKMA 2GC3A 4PCRA 4LK7A 2A7AA 2ZGOA 3HMYA 1KDKA 3H1YA 4TSVA 1UD1A 1UYZA 3ZFEA 3VBSA 2GP3A 2XLGA 4YW5A 2XHKA 1J58A 5A7OA 3I3DA 4IEOA 1W6PB 1AJKA 2JIGA 2BVVA 1POV0 2P4EA 3SEPA 2BGOA 1ZZ8A 4H7LA 4XDPA 4X8PA 1O3TA 1LHNA 2X8KA 4CRQA 3THCA 2IXIA 4DXTA 3U1XA 4EWEA 2VR4A 2ZHLA 4Y1ZA 4QPIB 2A73B 2JG8B 5EFUA 4GIQA 1YRZA 1RUF3 3AFKA 5ABJB 4P9WA 1JU4A 1W6MB 2KA3A 2Q1FA 4OVEA 2NMOA 4XF0A 4CCJA 1JYNA 3DYPA 3U14A 4CEYB 3BB6A 4AFAA 1EAH2 2BERA 2RDQA 5A7WA 3H3UA 4YW6A 4YGEA 4E8CA 3MIFA 3LCPA 5JPNB 5A32A 1PM7A 3AZWA 5J98B 3OUJA 1RUJ3 3NVCA 4QDQA 1PZ7A 2WS93 5T5JA 3P5BA 3V56A 3O12A 1W0PA 2FMDA 4AI9A 3T30A 4XF9A 2QE3A 2VUDA 1WMDA 1WBLA 1X82A 1HRV2 2RJKA 1WW7A 2JENA 2RMU2 1HB1A 1X9PA 2ENRA 1JBCA 3KGZA 4M0NA 4OZXA 2A5ZA 1E5RA 3PTYA 3O1OA 1RUC1 1POV3 2BRTA 3I2GA 4KWKA 3AP7A 2P3YA 3OJBA 3O1PA 2PA7A 1B09A 1FYUA 3Q8BA 1XYPA 2ADDA 5JPMB 3LB9A 2VMIA 2XB6C 3NJVA 3WW2A 2Q8CA 4AHZA 2QQPA 4MGSA 2V73A 1WBFA 2F4LA 2VXJA 1LGNA 5C8CB 1BEV2 3N4MA 2DCTA 1H30A 1GQPA 3IDCB 5FMOL 1BMV2 5T5OA 2RVAA 3CIHA 4HPKB 5FZ6A 5J3UA 4BIOA 5J1XA 2YHJA 4N53C 5JZGB 2HWE1 5FXZA 3MW4A 2ET7A 2BZDA 3P3NA 4QU1A 4LTAA 3D0SA 1XYNA 4JGZA 4L2NA 5M0TA 2ZPXA 3CKHA 2WNVA 1AXYA 1I5ZA 4K1YA 4PBPA 3WUCA 3A0NA 1C8M3 4A6OA 3FE5A 3KWVA 4M01A 3VHNA 2UY8A 3VBUB 1ZRCA 3FHQA 2VQ0A 1S4CA 2ARCA 3DXTA 4HN1A 3AKQA 1SLLA 2HYXA 3WLUA 4XAEA 5HCHA 3EMRA 1RUH1 1QJU2 3U0ZA 1ZZCA 2PLV2 4NIHA 5IVVA 2ZGMA 3AXDA 1PX4A 3EXUA 1TME2 1W2AX 3ETPA 4Q0UA 4AZZA 1K3IA 2OQ6A 1I6XA 3HOBA 2VW1A 1LEMA 3WP5A 4CP2A 5FLIA 1D4M1 1LHVA 1HB4A 4JGZB 3JU9A 4FVVA 5C4WB 4Q0SA 3T0BA 5FZMA 4BK5A 1WLWA 2DUQA 1V6LA 4XJZA 2V5YA 3USSA 1YFUA 3X29B 3MUY1 3KHBA 4FI9A 4XTMA 5IJRA 3O0WA 3UJOA 1UYXA 5A33A 3NNGA 1HV1A 5DDJ3 2ZX1A 3LSDA 1VMJA 1AXZA 1YYNA 4QPWA 4A2UA 1NE6A 2VTXA 3SKVA 3ST7A 1QY4A 1QQP1 2B9UA 3ZXAC 3VD4A 4AEKA 1CZVA 4UF0A 1EUUA 1XOYA 5JOXA 1RXFA 2FCUA 2YUEA 4COWA 1LGCA 2VE1A 1CAVB 5FMBA 1SMVA 2VTFA 5IVEA 2BGPA 5CU1A 4LBQA 1ND2A 1SLIA 2BV4A 4W6WA 5FMOS 1W8FA 1HRI3 3KT1A 1ULGA 4Q4W1 2E26A 4GA9A 4UYBA 4Z92B 2WFF2 5C3SA 2WSVA 5FPVA 1WA4A 2JDZA 2ZMLA 3BUCA 3KV5A 5BYNA 4HMZA 3J7HA 4AHYA 4AVSA 1ZYBA 3R4DB 4NROA 3OPWA 3VKNA 1IS4A 1LHWA 5DN2A 3ZFGB 1DZTA 1VE0A 1VR3A 4QGNA 1H9PA 3POGA 1JZ8A 3LEMA 1H4HA 1WLCA 4FQZA 4Y1YA 3M3EA 4MSVA 4DRRA 3J8F3 4LNVA 4HZFA 1JTZX 2XUEA 3PURA 3SCHA 3ZYIB 5JLVA 1WCQA 5J36A 5AVAA 5FYYA 5JR2A 5F3EA 4XETA 1YQ6A 3HBZA 1PMIA 3M1HA 3WDUA 1XE0A 5GLTA 4JGYB 3U07A 1OHFA 1QJY3 4OI2A 2B8MA 1RUF2 2E7QA 3CJIB 3FN9A 1RHI3 4JCKA 3IMMA 4EWAA 2WAOA 3VDDA 1BBT1 1OURA 1TMF1 1FPN1 1HB2A 2D97A 2GP5A 3HNBM 3MLLA 4D94A 1ASJ3 2WSUA 4IESA 5BNPA 4Y22A 1T2XA 2BFUL 2D6OX 2QQIA 3GBGA 3GGLA 1AR72 3H7YA 3LA3A 2OKXA 3RJRA 3ROUA 3GNEA 4FFHA 5CEHA 1TEIA 4PI0A 1UU6A 5ACA1 3MLJA 2WZEA 2W1WA 3EJKA 4EN7B 2BQPA 1GOFA 5C8WA 3P1IA 1DGWA 5F7UA 1MR5A 4MGYE 5LA2A 1LOFC 1OD3A 1IPJA 1WMXA 1HN1A 2KXLA 3QBQA 4AEJA 1K5MC 2GDFA 5FZ7A 4YM3A 1W6PA 1NKGA 1W6QB 3MW3A 4K40A 4QXCA 3WP6A 4GJZA 3VHPA 2DCJA 5AC92 2R32A 1ENQA 1OA4A 2BOIA 1APNA 1U5YA 1NQDA 4LXLA 3V64A 1UU4A 1H2LA 2BDRA 3AK0A 3ME2A 5AVPA 3MLKA 2JG8A 1NA1B 1LOEA 4AG4A 5KC6A 5JOWA 5EIYB 2VCMA 5DMYA 1W8OA 1S2BA 4BMBA 1CIWA 3THTA 3KB5A 4R9AA 1XJAA 1NCQB 2ZX0A 3NAPB 4CEYA 3PUIA 1UWWA 1UMZA 3HD8B 3WDXA 2ILMA 2ZEYA 5FXVA 4FPFA 1OMIA 3FFQA 3JBG2 1UOBA 5C3RA 1QDOA 4CCMA 5AFBA 1WLTA 5FPUA 4Z07A 1J3RA 1S1AA 1Z7S3 4CU6A 1UY0A 1AHSA 1C8M2 2AUYA 1XNCA 3RSJA 4TLGA 1VBA1 2ZGSA 1SBEA 3I3QA 5H9SA 3HN3A 3UNPA 4XJUA 1R1A2 4P9GA 2L9LA 3VDAA 1ULEA 4AFBA 3M7AA 4UFJA 4NRPA 3ZLIA 5C8CA 1CONA 4NPMA 4BB3A 4Q4X1 5A7NA 5F39A 4HPKA 3AJZA 3ZN5A 5JZGA 3ZKUA 3NMBA 3SEEA 1WCUA 3JQXA 2P17A 2G4IA 2WWJA 4BLIA 1C1LA 2PHXA 4XE9A 5FY8A 5BNOA 3S5QA 5CBLA 4LULA 4WM8B 2H6BA 4AVAA 3AKTA 3OY8B 2XONA 4NHLA 2JDKA 2NZ9A 3WP3A 3GM8A 4RR3B 5LW9A 4E4ZA 1GBGA 1AL21 3VBUA 2HWB1 1QJZA 2ZGLA 1OF4A 1PIV3 3BODA 4ZKTB 1Y3TA 3T2PA 1ZBE3 1XBFA 3K77A 5L7OB 2FDGA 1NQJA 2VZ1A 1H2MA 2VQAA 3WHTA 3UK9A 1ALYA 2CYFA 3OEBA 1OQ1A 1R081 4KH9A 3J7MA 4K1ZA 2XR4A 3LDRA 4RSUA 3KS7A 3O0XA 5CADA 1WCDJ 2G9GA 2UY9A 2VMHA 4G4FA 1GQGA 4U36A 2WO3A 3WNKA 3EB7A 4JKLA 4DB5A 1C3HA 2LTNA 3GHNA 3ITQA 4NIIA 3WNXA 5A1FA 4DXSA 2Q1ZB 4IEVA 1DDLA 4NUBA 2QDNA 1RYYA 3KCYA 3WT3A 3WG1A 1NY72 3S0MA 2PHFA 1E57A 2XGXA 3IDEA 5C4WA 4BQWA 4P00B 4C8DA 2QDRA 1YHFA 3W59A 1I1EA 4AEDB 2WZR1 2ID4A 3HNMA 1J83A 3ZSJA 1O3QA 4COUA 2YU1A 1JOJA 4SLIA 4K3UA 4CCDA 5JIUA 4JDNA 5FP7A 4TWTA 2B7YA 2W92A 3NNLA 4BM8A 3VBRC 1Y43B 1RVF1 1IKPA 2DU0A 3T09A 5F37A 5LA0A 1DGLA 3ECQA 3RDIA 4FTEA 4OQ8A 1NG0A 2RM22 4FXGB 4KU8A 1ZBA1 4QX7A 5FP3A 5F1RA 3I3MA 3M4FA 5FUNA 4YZ5A 4NPLA 1EV12 1VLNA 2A3YA 2J22A 2OUJA 2VULA 2ZGUA 1CAVA 2V4VA 4TYSA 1LNSA 3RWKX 2GNDA 1NZCA 2JG9B 4PDWB 4YW7A 1X7NA 1OUSA 1PNFA 3PMSA 4KGGA 5DUWA 3WQ0A 4KG8A 4AQSA 3W5MA 4DEQA 3RMYA 4A42A 5EPAA 3WD5A 5AFEA 5FO9B 5A7PA 1ASJ2 2R042 1VRH3 1VPHA 5J48A 3AMPA 3NSTA 3POBA 5EJ1B 5KHKA 1IOAA 1CJPA 5CFCC 1H2KA 4MV2A 1H6XA 4Y33A 2IXHA 5L73A 4EN8B 3S7EA 2QBXA 2W1SA 3ZFGA 3KQRA 5LWBA 2HEWF 2VOVA 2P3IA 3AZVA 4LOTA 1Q8SA 2DCZA 3KT7A 5FZ9A 5FRAA 5FZLA 1VBB2 1QXRA 4FOQA 4N43C 4QPGC 5FMCA 2SBAA 1W28A 4RFRB 3JD73 2PTMA 4CP9A 1O3SA 4CDXB 3HBKA 2C24A 2ZMKA 1VBE3 2H0VA 4RHV1 3H8OA 1HXS3 1VAVA 1W99A 2ETEA 2IFRA 4JGYA 4A7YA 4BOWA 4Y20A 3Q9OA 3VBFA 4QX3A 4BIFA 3RWNA 3BGAA 3SH5A 4LO5B 1YJKA 2Y33A 2ZAAA 3AZZA 4GJYA 5IWFA 4BXFA 2WR9A 3CU7A 2XJVA 1S0CA 2ZGRA 2RS33 4BPZA 2JX9A 4F3JA 3VDBA 4GZ9A 4AHWA 2ORZA 3SQOA 4W4ZA 5LBBA 1Z0HA 4OHWA 2RS53 4WBBA 5KXEA 3LE0A 2KD7A 1N47A 3N9MA 3PIGA 3ZYGA 4Q2FA 4Q0PA 1BK1A 2XVLA 1QIQA 5C5TA 1TNFA 4DY5A 1PM4A 4GQ7A 4AQ6A 3GHMA 4ET7A 2Q0AA 3E1F1 2OPWA 3JXSA 3M3CA 2J1VA 1AYN2 2NP0A 4E4DX 3VL9A 4AGVA 1NA1A 1OLME 4A41A 3C7OA 2ARAA 3MW2A 2D3SA 1B35C 4LO7A 3KT4A 1LHUA 2ZS6B 1DYPA 2W39A 4GKXA 4N53B 3N7JA 1D2SA 3PUAA 1PO11 3LOIA 1DZRA 5FUIA 5A1AA 1NCQA 3NAPA 5FYZA 5LA9A 2PFWA 4YVWB 4XFAA 4XURA 4GALA 1OOPB 1J3QA 3ENRA 4XFFA 1LODA 3HR9A 3AYAA 5HCBA 4F7ZA 2ZEWA 4JTNA 3TN93 1G9DA 4QQPA 1QU0A 1REDA 3U10A 3C2UA 4XC9A 5FY5A 1JYWA 4MGQA 1UY2A 3CBNA 2W2IA 4XCAA 5I8SA 4ARYA 4PQQA 2W0XA 2PHWA 3BOPA 3KV4A 4BJ0A 3ZFEB 1PO22 3VBSB 5F6LB 1PVC1 1V9U3 4RGAA 4AI8A 5DABA 4ZS3A 3IDAA 1TQ5A 2V72A 3AKPA 4Q26A 1O6UA 3WQBA 3Q8FA 4AGGA 5KHGA 4CUGA 4HK9A 1MS4A 4AQ2A 2XWBB 1HRI1 5FAXA 3THDA 3OGVA 2BOJA 3E6DA 3ACHA 5FZ1A 3K51A 4Q4V2 1YI7A 4LUKA 4IV3C 1GWMA 3INAA 5GZFA 1AR63 3FUOA 2DYCA 4OUMA 4ONUA 4EN9B 1CAUB 4DUVA 1DGWX 5LBCA 2FCVA 4WM8A 5A7WB 3IN9A 1W04A 2R49A 2WT0A 4LMFA 1SDWA 3JB8A 4DNYA 4NWVA 3OY8A 4YFWA 4YW1A 1RUI3 2RR11 4NWWA 3T3YA 1QF3A 2GMMA 2VUAA 3VD7A 2NYYA 4ZU4A 4FCAA 4CXWA 4RR3A 3OSDA 2R073 1O3RA 3MZHA 3MIDA 3GJAA 3O1VA 3J8F1 3KCXA 3DEMA 4CEWB 4BQ1A 1V6JA 3DPRB 2E33A 5F5QA 5L7OA 5FZAA 4BWOA 4CCCA 3C7GA 1VAMA 1PHMA 3PUQA 3ILFA 4TZDA 2FDIA 1QJY1 3NV3A 1QEXA 3WINE 2XJQA 4MGZE 1DQ4A 2J1EA 3AP6A 1RHI1 5FO7B 1H0BA 1MS3A 1UX6A 2NQYA 3MICA 5BPXA 5L9BA 2ZHKA 2B46X 1GR3A 5I0SA 2A6WA 1AR81 2VBDA 3ZYFA 3T4HB 1UF2C 3GF6A 3H50A 4XUPA 3NKGA 1MS5A 4YVSB 4W6XA 1O4TA 3DGTA 2CWMA 3KM5A 4UW6A 4XUOA 2B4KA 1Y9MA 2GAUA 4K20A 4AEDA 2GNMA 5GJ6A 2WNVB 1Q5OA 2XJTA 4NPRA 3H3LA 3QH6A 4YLZA 2DVAA 3HT1A 3J4UH 1MVEA 4XTPA 1H6YA 4JVAA 3DUIA 4E4SA 1W6NB 1HRV3 5SV8A 2RMU3 3VDCA 2D3PA 4DS0A 3O7OA 3GZAA 4CVUA 3H7JA 5F3IA 2HWF2 3MYXA 1FATA 1MACA 4A44A 1YEWA 4RN5A 4Q8LA 2ZZQA 3AC0A 1LOCA 4UW5A 3WF0A 1W06A 2CL2A 2FMYA 2IWGB 3ZFFA 2JG9A 4PDWA 4AF9A 4AI1A 1BEV3 2CU5A 3RZKA 1UIKA 3PUHA 3C3VA 1AX0A 2LW8A 3E6BA 4BE3A 1G86A 4EN0A 3ZO0B 4IV1A 4D6SA 5C7GA 2VQTA 2JDUA 2VMGA 1ENXA 2VMCA 4QPYA 4XJAA 4LKDA 4WZFA 4BU2A 4COZA 1S0FA 5HXMA 3IIIA 1Q3EA 4C1XA 4E8DA 4OUSA 3N3HA 4PF1A 1QDCA 4PBOA 1RUD1 3BTYA 1F31A 2QVSB 3W58A 1COV2 2E6VA 2GALA 4AVVA 1IQAA 2ZA9A 5C3OA 5D2AA 3FUQA 4LHNA 3I7DA 5LK5A 2CTVA 1DCSA 4CDXA 3N9QA 4LLFA 3U4XA 1AYM1 3FLTA 2MEV2 5FYMA 1QJU3 5JR7B 5B4XA 2AENA 3N9LA 4Q4Y1 3HQRA 5GLWA 2UWCA 2PLV3 4L97A 2XOMA 3W20A 1D4VB 1RIRA 1H9WA 2HWE2 1IHMA 2C9KA 2TBVA 3PDQA 1TME3 4Z8BA 1JZ7A 2ZGQA 1W39A 4LBKA 1ONAA 1BVP1 2R6QA 3AP5A 1VB2A 1O8PA 2HWD1 3N7KA 4OZOA 2WZ8A 3WW1A 2BNOA 3T2OA 5T5LA 4HONA 2NMNA 3KGLA 4HKWA 1NT0A 4OMDA 1KRIA 5CKMA 1J59A 1LULA 3K46A 2WQ4A 1UO9A 2ZXQA 2VW2A 1FAYA 3MPBA 1NCRB 1LENA 3ILNA 3B94A 2B9VA 1SCSA 2EALA 1QJX1 2XJRA 3BCWA 4ZXKA 3RYRA 3WW3A 3MO4A 1HDKA 1F35A 4NAOA 4BQ5A 1OXCA 1RUH2 2JE8A 4R4ZA 4TLFA 4AEMA 3A22A 4EROA 1CN1A 1OA2A 2ZABA 3OGRA 5FOBB 1AR91 1JYCA 1NXMA 4YGDA 3I2IA 4RS5B 1BHGA 5EZWA 1ZRDA 4MGTA 2XBO1 1JZ4A 2EVXA 1EYBA 2VXRA 4CUBA 4N53A 1H1MA 4K9SA 2E7TA 2DTYA 1D4M2 3THPA 3M3OA 1SCRA 4FPGA 4WVMB 2FZ1A 5K8SA 2WNUC 4I0BA 4YVWA 5B2GB 2Y6KA 4PQ9A 5GZEA 1SDDB 2LALA 3VDDB 1OOPA 3Q8CA 3VLBB 2WFF3 1UPSA 1BQPA 5FYTA 3AMQA 5H9PA 2VVFA 5I8TA 2IFWA 4CDUC 4Y22B 3ES4A 2D7FA 3M3QA 4IE5A 4XJWA 1HQLA 4AVTA 1IGOA 4NJ4A 4JRAA 2R072 5FOJB 1R1ZA 4E27A 1GP6A 1QQP2 1V6NA 4B7EA 4EZHA 3AMHA 1QMJA 3NV1A 1F5FA 1H8TC 1T6GC 4GMP1 5KC5A 1RUG1 3RG0A 3ZN4A 4FPEA 3PVBB 4S2HA 2WA3A 1P8JA 5T54A 5HV0A 4IGQA 1KJRA 2GZWA 3I59B 4QB1A 5FZKA 3ZKYA 3RYKA 4Q4W2 4QU2A 5FLHA 1UYPA 2DTWA 2OIIA 4Y24A 5G04L 4DUWA 5HCAA 1A34A 1YQCA 3I3EA 1ZA7A 2HJIA 4C1WA 2B39A 2QKDA 5D8AB 5EV7A 3B9IA 3H8UA 2E31A 2A1XA 1E5HA 1CAUA 1R092 2CGOA 3R05A 1NZIA 3NL1A 3RNSA 1AR73 2G1MA 2ZACA 4AFCA 2OZJA 1K12A 3MEPA 3M3IA 5FYBA 1I3HA 4YG6A 1DZQA 4NE9A 1G9CA 2WQZC 1NLRA 3V0AB 4JAAA 1FOD1 2BVBA 4IEPA 2WLPA 4CEWA 4I09A 4F83A 3DPRA 3AP4A 4GB32 3UT0A 4AW7A 5AC93 4BHPA 3SC7X 1Q8PA 3GJBA 3N7LA 3LOBA 3SLIA 3C8XA 5ANQA 2G19A 2WQ8A 2W91A 2OYZA 2DCYA 1S0JA 1PZ9A 5FYSA 1DLLA 1AF9A 4S2GA 1BBT2 2W46A 4HVQA 5C5UA 3UL2A 5JOZA 1VIWB 4UT5A 5FKCA 5A80A 1KGYA 2VAUA 2W3JA 4BQ2A 1QXJA 1PX3A 1WZXA 3L2HA 4YVSA 2ADEA 5LBFA 3PNAA 5JCTA 2QQOA 3DYOA 4YW2A 5ACA2 1RMU1 5LK7B 2CNAA 3JBG3 3SISA 5BNOB 3KF3A 1MZEA 1ND3C 2JB4A 4PI2A 1DGRN 4P02B 3D4KA 1BLZA 3N9PA 3D0JA 2O1QA 4DFSA 2BPA2 5IFTA 1JYXA 3ACGA 3OYWA 4FPYA 4A45A 4QPGB 1SACA 1W6NA 1CVNA 2JDPA 4N43B 4ZU7A 2D40A 4KWLA 3AMMA 1DG6A 2ZGNA 1PGW2 1WLDA 2H6CA 2OX0A 1SEFA 1XQNA 4O9GA 3CHXA 5FZDA 3ZYBA 3MIEA 3HT2A 2P6HA 2OS2A 3A23A 4I3GA 5CKQA 1QXPA 5FZ0A 5IVYA 1JZ5A 3AVSA 4X6QB 1MEC1 5LZ6A 1V70A 1R1A3 3WP4A 1RL3A 1LRHA 2BWAA 4M0HA 4AHXA 5FKBA 2EIEA 1N1YA 4AI3A 2OT7A 4RD7A 3TEWA 5GLUA 1KDMA 3DKQA 4KG0A 4ARXA 1XPWA 4L0PA 3MHZA 4JTOA 3N9OA 4N7IA 5DZEA 3IWZA 4LJHA 5F5AA 4YG0A 2FZ2A 5FWEA 5C9AB 2PQSA 3GBFA 2J1TA 3GXUA 4Q0VA 4R9BA 2RE9A 4JHTA 4Z82A 1PK6C 5FMDA 1VBA2 3A7QA 1KEXA 3HAGA 4MH0E 3T0AA 4X8NA 5I0TA 4DOUA 2Z2SB 3VD5A 5A3WA 1K5MA 3CO2A 4WM7B 1RUE1 5IW0A 4CCNA 3RI8A 4ZZ5A 1V9U1 2UYBA 4DQAA 3IIAA 4GXLA 4LITA 2DVGA 5C33A 4I02A 3RZJA 1UOJA 1J84A 1W9SA 4XIOA 4UAPA 1S0BA 1B35B 2D5FA 3ZPOA 2VBPA 3LSEA 5BUVA 5FZEA 2E9QA 2GC2A 3AL5A 3AVRA 2WT2A 3WQ1A 4GD4A 4CU7A 3W9AA 2W47A 4JQRA 2OW4A 1HQWA 1MS1A 3KF5A 2BWCA 2XWJB 2DFBA 4PJYA 3MDPA 4QX2A 2A6YA 3WNLA 1JOBA 2YBKA 4XHXA 3AFGA 3H9AA 1CX1A 4J6GA 1S0GA 5FZ8A 4YM0A 1QJFA 2W9XA 4WZCA 5JMOA 1OSGA 3S5AA 1AL22 1KXGA 2P34A 5FY9A 1CESA 2HWB2 1NCRA 3H1WA 5HPOA 2TUNA 3VZOA 3LDKA 2VC9A 3LZZA 4UFHA 2K0GA 2Q4SA 1SG3A 1X8MA 4IGPA 1GICA 4LBOA 3BTXA 3VZJA 4ZONA 2FHRA 2PHLA 2W94A 3VBHC 4XQWA 1U5ZA 2RM23 3DECA 2MHFA 3E5UA 2IXJA 4RS5A 3KD4A 3N35A 4XBLA 1SLCA 3F2ZA 2Z79A 4M3CB 1VBD2 1EV13 2X09A 4LBMA 3WVJA 1K5JA 1S0DA 3OB8A 5HV4A 1OFNA 5JMCA 5F9TA 3K75B 1XC6A 3BALA 4D0QA 2P2KA 4KWUA 4Y20B 3VBFB 4YW3A 4LO4B 1EAH1 3KZ4C 3RZMA 4WVMA 4JGZC 4CE8A 3S30A 2WL1A 3WXPA 1CAWB 1GZTA 2GMEA 2Y6FA 2G9FA 1OD5A 5FZOB 3BU0A 2R043 5FZ3A 1RGSA 3T1LA 4MG2A 2AH2A 3EQEA 3AL6A 4XXPA 2QQMA 1ENRA 1YFWA 3LFIA 3WSOA 1FMD3 1RVF2 2RMU1 3POWA 1CR7A 2VH9A 1JOPA 1RITA 4C91A 4C0HA 3ZSKA 4CU9A 1ZBA2 3EHKA 1C8NA 3POSA 5EXOA 4IEXA 1VBB3 4YZ3A 3T1MA 5LA1A 1US3A 2ET1A 5FP9A 4L99A 2ZX3A 2R0HA 5T3NA 1EP0A 3PLQA 2OUHA 1W8ZA 3KMHA 1XRUA 3I59A 2VCAA 4KGQA 1Q56A 4OULA 1LKNA 3BKZA 4Y5TA 1SQ4A 5E6HA 1GP4A 2K9ZA 5A6YA 1W8TA 2Z42A 1L7RA 2E7AA 1OQEA 5D8AA 4H2AA 2ES3A 2VOWA 3U11A 3UGHA 4XW3A 1W05A 5K0UC 5T55A 2CWSA 3ALQA 3GZUC 4G3YC 4P08A 1OBNA 2WLQA 5DAVA 4QB6A 4COVA 1WCSA 4D6QA 1Q8OA 1VMHA 2VGDA 1XU1A 2O8OA 3UKVA 4W8JA 3V0AA 1V6KA 2DDUA 2VZTA 3NO8A 5E89A 3TWIA 4KI5M 5J37A 3B02A 2XH6A 1ULFA 5FFOC 2A6VA 1WW6A 5GKAC 4LA2A 1X9TA 3VN4A 4RHV2 3SITA 3M70A 4WVZA 4FSJA 2XL9A 3VZMA 2WNOA 1Y9GA 1ULDA 4FTBA 2VZUA 1KFUL 2GMPA 1AYN3 1U5IA 4FQ4A 4LIUA 4OHVA 4AQTA 4CXYA 2XQXA 3POIA 1TME1 5FYHA 5A3UA 5L9VA 4XACA 4AWDA 1JHNA 2Y6LA 2PHDA 3ZM8A 5FZHA 2EICA 2JKXA 5F3GA 4QMAA 4D69A 2WWUA 2FDJA 2GC0A 5A3TA 5CFCA 2ZEZA 4HBNA 4YPJA 1EY2A 2CAVA 2YV8A 1HKDA 4DO0A 3RZHA 4DMIA 4P14A 4Y1XA 4DXZA 4IERA 4AXOA 2VZQA 1RXGA 5FYIA 1GANA 4IW3A 5JI9A 5CFDB 1MQTC 1XSQA 2FCTA 5FXWA 5CIRA 2V5DA 4B4QA 4QPGA 1ZZ6A 4N43A 3WDTA 2R061 3D8CA 1UZWA 1QOSA 2ZTNA 3TEYA 5DAWA 1EPWA 4QX8A 4BH9A 1PO23 2Y34A 5CA6A 4ZHNA 4FOVA 1WMEA 1KFXL 2OXBA 3VBOC 3HPNA 2WUHA 1PO12 4QHZA 5FP8A 3SMHA 1CD3G 1DQ0A 2DU1A 1ZNPA 2JICA 2CGNA 4IEQA 2WABA 3R4UA 1XE7A 4K6BA 2FBEA 2NN8A 3EYPA 3ZSMA 3GDBA 2AGSA 5A1LA 4Q4V3 1GV9A 2YMZA 4QHBA 4AYUA 5FREA 2P3JA 3FJSA 4Z1VA 4AGRA 1KJLA 4E2SA 1XNDA 3ZXDA 5C9AA 2RS12 4D7YA 3Q8EA 4FAGA 5LY2A 3E97A 4E4HA 4K8FA 2E53A 4JDOA 3WCRA 5FZCA 4BDVB 1G9AA 1GZ9A 3A0KA 4WM7A 1YC61 4U2AA 5FDBA 1PVC2 4AR2A 1I9RA 2PAEA 3LF7A 1VBC2 4ZPIA 2W08A 5DXDA 2IXLA 1X36A 5I0UA 5GLZA 4AOCA 1YO8A 2XVGA 3AXEA 4XDOA 2D6LX 4HKLA 1CJDA 1YLLA 4QPIC 5IT6A 1B35A 2YC4A 4JKKA 1UKRA 5ABJC 3ZN6A 3VD3A 1GMMA 1RUF1 2Y6HA 4BQXA 4YFZA 5EQUA 1O8SA 1VRBA 2VOKA 1S55A 2WNUB 2D98A 3ZFFB 4CEYC 4YARA 4NIGA 3B01A 4Q1RA 3ZR6A 1W8HA 1W3XA 1MZFA 1VJ2A 1W9TA 2YC0A 3WY6A 5K9YA 4LT5A 5J7MA 3D6EA 4OFGA 1GWKA 1ZA4A 2QZ3A 2XLAA 4LHLA 1AR71 4IV1B 3WF1A 2RR12 4CDUB 4RYDA 1OI6A 3ZX7A 2WO7A 5BNNC 1RUJ1 2WO2A 1L7LA 2WS91 3CNAA 3K4ZA 4CDQC 3BOWA 4ISQA 4MO3M 4FP2A 2XQRA 2QQWA 1CZTA 3G7DA 3SCGA 5IK7A 1FMD2 3WOGA 2KR2A 5F32A 2GH8A 4GH4C 2LUWA 1WW5A 4HK8A 1POV1 4UFLA 4YM1A 4H3WA 3IMNA 1UOFA 5GM0A 5F3CA 2HWF3 3KV6A 3QD6A 4MZUA 2XXZA 1LOGA 4MVTA 3CZJA 5C8CC 3MPPG 4M3CA 1DYKA 5DAQA 1AR82 1DFQA 2DVBA 2JD4A 1LEDA 2E51A 3DKWA 4A3ZA 5FJKA 3HVDA 5JZGC 4CCLA 1G8WA 4PT6A 4BZ4A 3ZXFA 4XQ4A 4D7TA 2FQPA 4IL7A 1CAWA 3JBG1 2MNGA 5FZOA 5CISA 3UKNA 3WV6A 1F2NA 1OVSA 1RJ7A 1W0OA 1OA3A 1PMJX 2EAKA 4RGKA 2XL7A 3MIHA 4NMIA 4I30A 4CZSA 2A70A 2QCSB 1HW5A 3LD8A 1C8M1 2Y0OA 4CUCA 1XNAA 3VBUC 3NWKA 1ULOA 2D3RA 2UURA 1LGBA 3FWEA 3NV2A 3VHOA 1RUC3 3K2OA 1PVXA 4BXSV 4C90A 5JXIA 2I2SA 3URFA 5J96B 1JYTA 1S0IA 2JWPA 2X5IC 1COV3 4COYA 3O1RA 2DUPA 4BA6A 2ERFA 1FV2A 2Q5TA 4LHSA 1N1VA 1UZVA 3MF9A 4BCUA 4XFBA 1HQNA 1OKQA 1QNWA 2MEV3 4M00A 3ON7A 4XILA 2PN5A 2E63A 2WKKA 2HWE3 1QOTA 5IATA 4META 4F8AA 4CCKA 1ZREA 1ZZ7A 2Y64A 2A6ZA 2QQKA 5C4WC 2C1FA 1ND3B 3GCWA 2DBIA 2OQ7A 1AX1A 4QGLA 4Y3OA 2WO1A 2CSGA 3G6JB 1VAKA 2DVDA 4JDMA 1RUD2 4YM2A 3AKRA 4LE3A 5DZGA 2AR6A 2WDBA 1NE4A 3QOPA 5F8PA 2XHNA 1O4ZA 3GZTB 4H55A 5DDJ1 5I91A 2BTVC 4AI0A 4CUAA 1A3KA 1OFSA 3WW4A 1BKZA 1RUH3 3AYEA 1ZRRA 2IUWA 4TXWA 5A3MA 1MVQA 3ABZA 1J1TA 4AFMA 4PF5A 4WV8A 3VZNA 3H8RA 4Q4Y2 4RA0A 1QWRA 4FP3A 4NO4A 1V6MA 4QM9A 3S7IA 1GNHA 2JIJA 5A7QA 1O5LA 3ETQA 4RQPC 3B3QE 3C7HA 2D44A 4XCBA 3HQUA 4OLLA 3BPSA 4MXVA 4XEZA 3FMGA 4B3NA 4AFDA 4BQ4A 1D4M3 1YFYA 4B29A 5CNAA 1ZX5A 2PHTA 2JB8A 2RDNA 4I0WB 4XBQA 3KSCA 2WZPP 1MS0A 3AP9A 1PK6B 2YROA 1KQRA 4FOWA 1HIXA 1QJX2 4N8MA 4CSWA 3C7EA 3OD4A 5CFDA 1DIWA 4MUVA 1UN1A 1Q43A 2HWC2 1WD3A 3CZUA 5B4NA 1AR92 1IQDC 4ATEA 4Y1UA 3IT8A 2QJVA 2C0ZA 1QQP3 3GALA 4R4XA 1XNTA 5DUVA 3LEIA 2AC1A 4HETA 2XBO2 1EV11 1ODNA 1SPPB 1A78A 1GNYA 4IUGA 3CF6E 2JD9A 1W2UA 1W90A 3CJIC 1NUKA 3B7MA 1FX5A 1DQ1A 1X50A 2Z4FA 4Q4W3 4CP9B 1N1SA 4V2VA 1F4HA 2ZCWA 2J1RA 4XVHA 2Z69A 1KITA 2ZEXA 1ASJ1 4EV0A 1HJFA 5LASA 2IVJA 1R093 5ERLA 1A8DA 3ZYJB 1X33A 2WYSA 4LA3A 4JV4A 3ATGA 1H1AA 5FY0A 4PHZA 5JUVA 3OUHA 4XFGA 1V0AA 5BY5A 2WT1A 1RUG2 1UAIA 4KQ7A 3IZOA 2WRAA 4LO8A 3PJYA 3OYWB 4L9BA 3I2FA 1U5XA 4K21A 3U37A 3VBHB 2BJSA 3WF3A 1STMA 3FLPA 4XF1A 4P9XA 4CYDA 3O5SA 4EJRA 4J1WA 4QXHA 4GB33 2JEMA 1NA1C 2QZ2A 3K3NA 3ZYPA 5A6ZA 4FPCA 3TEZA 4URAA 2FDKA 1BCXA 2WAAA 1WUVA 1BBT3 2WNUA 2R1DA 3VL8A 4OHXA 4OI1A 4A3XA 2EA7A 1SLTA 1ZRIA 4BISA 5A70A 2HYKA 2ATFA 3PVOA 4CDUA 4S2FA 3V0BA 3K3OA 2WJSA 1WMFA 5FPBA 2RG4A 2J42A 3NV4A 5ACA3 2VUCA 4M3CE 4Y1VA 2LS6A 4LR4A 5IK8A 3RFRA 4X6RB 1FV3A 1FOD2 3UGGA 1RINA 1TZOA 1Z7S1 4CA9A 2A75A 3I2JA 4O65A 5A6QA 5JSRA 1UXXX 3SXWA 1LU2A 1JN2P 2HEVF 5T52A 3TYJA 3NNJA 3RZLA 1CGPA 1RUC2 1K5MB 5E1RA 5T50A 2PAMA 2AEYA 1HB3A 5JXJA 3UV9A 3NKTA 1YI9A 1RUOA 4DY3A 2JDAA 3GYDA 3IAQA 1ODMA 3E6CC 1YCIA 4HVRA 2W1UA 1LU1A 1X8EA 4LK6A 3ZMOA 4QKBA 4DUXA 5GZCA 4OQ9A 1RMU2 4NRMA 2Q8DA 4OHZA 5K0UB 4WM8C 3A4UA 4YZ2A 3KV9A 5I8YA 3LIHA 2XJSA 1RC6A 1RTVA 2YGLA 3AYCA 3KQ4B 1D0GA 1UZZA 5A3OA 3MBWA 2JDMA 5DUUA 3ZOIA 2YXSA 3ACIA 3LPFA 1A8MA 2VM9A 1AUYA 4LBLA 4RR3C 1VBA3 5FPAA 5CKNA 2P1BA 3CDZB 4QWNA 4Q1PA 2BBVA 1Z78A 1S2KA 2VBBA 1PIV1 2D6PA 2RV9A 5I0RA 2B42B 3RJ2X 5L7OC 3I2OA 5EJZB 1ZBE1 5F2WA 3SH3A 1MEC2 5I93A 3BVCA 3R0RA 3R6SA 1IPKA 4QXKA 3GBWA 1SLAA 1O5UA 5FZGA 4Z2WA 2VNGA 4QDRA 1LCLA 5FK8A 4IEWA 4Q4X3 4HXCA 1UMIA 3BIWE 2A3XA 5HI0A 5LY1A 2VQUA 1MZ5A 3A21A 1NXD1 3L2YA 2AEZA 5L9RA 5DUXA 5IHRA 2A71A 4GKYA 1L3JA 2EXJA 4Q8KA 3SCFA 4RGGA 5DZFA 1ND3A 3OGJA 1SFPA 1YNAA 2Y6JA 3H3ZA 2ARXA 4OMCA 2QQJA 4AEDC 4P9LA 2R30A 1MQTB 1NLSA 2A3WA 4PLOA 4KL1A 4QXBA 1RUE2 4D3WA 4HN0A 1AL23 2IVIB 2HWB3 1VMFA 1WD4A 1BZWA 3KVBA 3ZR5A 2ZGKA 3VZKA 3F95A 4NHMA 3FFZA 3H0OA 1UIJA 4EYUA 3AJYA 1KD7A 2EXHA 3FX3A 5F5IA 1A6CA 3RGBA 3ZYRA 2C26A 2P6CA 4HANA 3T2QA 4H7MA 3GCXA 4AK3A 5EWSA 3I49A 3O1MA 4CXXA 3PVEA 2IC1A 1VBD3 3S6PA 1NX9A 3CQOA 2VZRA 2I07B 1OKOA 4OCTA 2VCBA 3CLPA 2X10A 4KWJA 3OPTA 3P3PA 2XPJA 2YZ4A 1XNBA 4YYOA 4MYEA 2ZKLA 2ARBA 1O7FA 5DPNA 1FXZA 4E2QA 3MV11 4BQYA 2CGPA 2DWRA 4K8RB 4AL9A 1VRH1 3KVAA 4Z2AA 3B9CA 4XUNA 1PK6A 2JXAA 2W87A 4HSLA 3JB4C 5FY4A 2YBSA 4LLOA 3M2MA 3V65A 4EE2A 1ACCA 1GOGA 1LR5A 2IXCA 5A7SA 1JS9A 2AYHA 1TG7A 2BNMA 4N9IA 4XMAA 1UKGA 5HXVA 3TRSB 3ZYHA 1RVF3 2VD7A 3VBRB 4QQOA
chains in the Genus database with same CATH topology
5FLJA 2DUOA 3OBRA 2RHPA 2HWF1 4LBQD 1ZBA3 3ZXEA 1OLQA 4CDXC 2XUMA 3JD71 3WG2A 1JUIA 2GNBA 4RFT0 1VBE1 2ZX4A 1HXS1 4FT8A 3FZ3A 2Y26A 3QH7A 1TMF2 1FPN2 2YGMA 4M3CF 1SBFA 4YRDA 2V09A 3CEWA 3CL1A 2VNOA 4AVBA 2RS31 1FT9A 4LHKA 5BNNB 3LA2A 2DURA 3IBMA 4CDQB 4B8EA 5CFCB 5IUQA 2IXKA 4BYYA 2RS51 2Y0IA 2BGCA 5BV6A 2SLIA 3PJQA 5D1IA 1WW4A 1UU5A 4BMEA 4GH4B 2Q8OA 1QH6A 1COV1 5EJ3A 3PVNA 5FPXA 2ZMNA 5IK5A 2GU9A 1CX4A 4XF4A 3VBHA 1PGL1 1CAXB 1ZM1A 2VU9A 4OI4A 4RHV3 3QCWA 4QD2A 2MEV1 5A3LA 5FQ0B 4CDWC 3OF1A 3APBA 3WG4A 5LRSA 1F9KA 2BNNA 4N7UA 2GN7A 4YNIA 4YVWC 3TNPB 2XJPA 1OOPC 1YUDA 3USUA 4BLJA 4P9IA 4QQLA 4YSFA 4GWNA 4ATFA 3TN91 1XNKA 2JECA 4A7ZA 5KBFA 1LESA 4AI2A 4ASMB 1LOFA 3MFAA 2X5IB 4I0AA 3ZFEC 3VBSC 3NJZA 5T5PA 3WUDA 3EO6A 2F6BA 2VUJA 1Q8VA 1Y7BA 3JCIA 4ISRA 5CVRA 2XLFA 4Q4X2 4XJ8A 1PO13 3LWCA 4HLTA 5GZGA 3ZN6B 5HCFA 1W6OA 1ZZBA 2EAAA 1AR61 5K0UA 4INDA 1UL9A 5DG1A 2WWSA 5TSWA 3ZXLA 4UXAA 5FBZA 5BXXA 2RS13 1RUI1 4YG3A 2R062 2UWAA 2ZBJA 1GZWB 4FPLA 2R071 4CEWC 4IQPA 5DG2A 3RMXA 3UJQA 4EN6B 1SFNA 3DPRC 4XFHA 3MGUA 1PVC3 3IPVA 4UBHA 3J9SA 3H1MA 5KWRA 2GN3A 1VBC3 4WVWA 4HL0A 4RL7A 3RQ0A 1R082 4RQPB 4MXWA 4OHYA 2VNRA 1LB2A 3MI8A 3ZVXA 5K7PA 4MGKE 4DZGA 1QGLA 3QACA 4IV3B 1ULCA 4YVSC 3ZDSA 3NW4A 2WFPA 3IKWA 4FAHA 1R091 1YJLA 2GNTA 2I74A 3LGRA 1Q8QA 2BYVE 2VVEA 3ZPYA 3AZXA 2WNVC 2RR13 2WZR2 1MQTA 3PMEA 2OVUA 2PELA 4XFCA 1QKQA 2I45A 2VVDA 1DGRA 1HRV1 4DPNA 2ZHMA 1EPZA 2RJLA 4GB31 4Q27A 3VBOA 2P37A 4P9JA 4I01A 3FLRA 1V6IA 3FBYA 1BEV1 1AR83 4I3PA 5F6KA 1QH7A 4FPKA 1BMV1 4R9DA 2OPKA 1RUJ2 2MPFA 2WS92 3I54A 3SHRA 1IS5A 1GKBA 4QT6A 2ZJCA 4AVCA 1J3PA 3MFCA 2NM1A 4XPVA 1PGSA 4FO9A 5KXDA 1JW6A 5JDBA 1FNZA 1UCXA 1UW8A 4AE2A 4FPJA 4V1PA 3VBRA 1PGW1 1MZ6A 3B69A 3VGIA 5IK4A 1RUNA 4CP1A 4LEJA 4QPIA 4IXLA 3OGGA 3VKFC 5ABJA 2W52A 4FBFA 1XE8A 1GFF2 1UPIA 1W6MA 2D6NA 4IEZA 1QJU1 5JI7A 2DCKA 2TEPA 2D6KA 4MLOA 2AZ5A 2N7GA 2PLV1 3O0VA 1ND2C 2Q30A 1U0AA 4Q29A 2H0BA 1AL0G 1M06G 4Y5Z0 1MS9A 2C5DA 5BNNA 1N3QA 3HQXA 2DFCA 4CDQA 5FCCA 3ZXJA 1SFYA 4LE4A 2PQQA 1NCRC 1F5JA 1OPMA 5CG9A 1F8VA 1REFA 1RUD3 3HWJA 3JZVA 4NHKA 4GH4A 2UU8A 4XZPA 4B4PA 1G9BA 2JJ6A 3AX4A 1N3PA 3AKSA 3LA7A 4PIYA 3ELNA 1KS4A 5JIAA 1TNRA 2UWBA 1AYM3 3PHMA 4RS5C 1CAXA 4YGCA 5KHJA 2PAKA 4Q4Y3 4QQHA 5FQ0A 3M8LA 3VKOA 5L19A 4Q0QA 2BFUS 5LEKA 4Y26A 5JOYA 2HWD3 2KM2A 2ZGPA 1SBDA 3VDDC 1JH5A 2O8QA 4XJ9A 1LTEA 2WFF1 5BNPC 1IS3A 4NVPA 3ZIWA 1C1FA 1DF0A 3AM2A 5E8AA 1CPMA 1XYOA 1ZVFA 3JUUA 2YPJA 1QJX3 4GWMA 4HFSA 4KU7A 5DDJ2 1DQ6A 2X5IA 2HWC3 2YYOA 4K7JA 4GMP0 1AR93 1AXKA 1U12A 3RPQA 2ZZJA 4FTSA 2XBO3 3TB0A 1GNZA 1VBD1 1HRI2 2WINB 1AX2A 2CY6A 2JG8C 3ILRA 1S0EA 5D8AC 3R4SA 3HIFA 3IM0A 4G9SB 3J26N 2K2SA 4KBBA 3D5OA 2YDEA 3V0BB 1D2QA 1MS8A 4FOYA 2R16A 5L36A 3B5LB 2ZOEB 2EIGA 5LEJA 3BTAA 1GZWA 1GLHA 2XKOA 3J8F2 4GMP3 1TE1B 1VALA 1RUG3 1GYKA 1H8TB 3O14A 3WG3A 1LOBA 4NR1A 3OTFA 5AC91 1NYWA 1LECA 1QJY2 2DVFA 4XIKA 4RQPA 1RHI2 1QHDA 4DINB 4ZU5A 4MX3A 2XG3A 1G9FA 5H9RA 2VW0A 3E5XA 1N3OA 2P3KA 3ZSEA 4IV3A 3ZIXA 2ZX2A 3OD0A 4QX5A 2ZAHA 3BPZA 1O4YA 3FC0A 5BNOC 4R9CA 4PIZA 4LBNA 1OLRA 1XXNA 2AREA 5FO8B 4QGMA 4YW4A 1FOD3 1GQHA 1PNGA 3WCSA 1BXHA 4Y4YA 3KCCA 3FHIB 3WQ7A 1ZZ9A 1N1TA 4LO6B 3AZYA 4HKOA 2BW8A 2PYTA 4YZ4A 3CJIA 1R1A1 2EXKA 2CV6A 3I4IA 1OQDA 4W6YA 3ZXGA 3QLQA 2QNKA 2WC2A 1H2NA 5FPZA 1RMU3 3ZMNA 1JUHA 5SV5A 2PHUA 4XMIA 5C9AC 3SNMA 1AVBA 2ZKNA 1Z7S2 4XFIA 2JKBA 3L9JT 3VUOA 1YIPA 4HVOA 2PHRA 1HV0A 1M4WA 2XVKA 4PLMA 4WM7C 3DV8A 5GZDA 1W6QA 2HKXA 1RB8G 1LOAA 1DQ2A 2QFEA 4L8QA 2GSYA 4XBNA 3K48A 1ZRFA 1DU3D 3ZXKA 2Q1MA 1MEC3 1UZYA 3I8TA 4CDWB 4WVVA 1WGPA 1YWKA 1AYM2 2VPVA 5KXBA 4ES9A 3T2TA 2LM3A 1LJ7A 4QM8A 4FPOB 5CB7A 4UW4A 2DF7A 5EYXA 4FXKB 2XKPA 3ES1A 2HWD2 3DN7A 2X29A 2QUOA 1G7YA 4N9HA 1QNYA 2RS11 1NY71 4XDQA 5C6CA 1GZCA 1NOVA 5JSPA 4OI0A 4JRLA 2EXIA 2R1BA 2BUKA 3ZFGC 1PIV2 4KNCA 1ENSA 1RUE3 1G6NA 1ZBE2 1IZ3A 2F4PA 1VBC1 2Z5WA 4S2DA 4XOGA 1XU2A 2WNEA 1HLCA 2ZGTA 2RM21 3ASIA 2IZWA 1URXA 3AB0A 4JGYC 4XF3A 5J09A 3WDWA 1C5HA 1PZ8A 3VBFC 5GLVA 1CPNA 1OPOA 2O0OA 2JE9A 3AMNA 4IEUA 5A32B 5KHIA 3RI9A 3WZ1A 2Y38A 5JWPA 2R041 1V00A 4P9YA 4ITCA 4J1XA 4LUMA 5E16A 5FTTC 1FMD1 3OCPA 2R0FA 2C9AA 4D7SA 1AZDA 1GSLA 2W68A 4UW3A 4XYXA 1C5IA 2D5HA 1VBB1 5H9QA 4B7KA 4W65A 2VECA 4P5HA 2OZ6A 4JC1A 4HT1T 1V6OA 1YFXA 2X53S 4E9KA 3ACLA 4YZ1A 1EAH3 4B4RA 1J1LA 1IKQA 1VRH2 3LAGA 1BYHA 1DBNA 1NCQC 1TMF3 1FPN3 1H4GA 3DF0A 3NAPC 4JGZB 1WCKA 5KHHA 4IEYA 3USUB 2OA2A 2TNFA 4A7KA 3LKJA 4XHBA 1YXWA 3KLSA 3E5QA 3WDVA 3WR0A 1JYIA 5JSOA 1REEA 3MF6A 4CP0A 4NN0A 3JD72 1H8TA 2HEYF 1QOOA 1FNYA 1VBE2 1DHKB 3TBDA 2EF6A 4YGBA 1BVVA 1HXS2 3B00A 1JXNA 4MGIE 4ORFA 2ZHNA 3RS6A 1BJQA 1AYN1 1KS5A 1H8VA 2CAUA 3VV1A 2D6MA 3POYA 4N90A 5JAXA 2RS32 3WHUA 3OPZA 2YY1A 5EYYA 1W6OB 2B5HA 4PIXA 2D43A 2RS52 1O91A 2VY0A 3TAYA 5CAZA 2NPIA 1SLBA 4NOTA 4O9EA 5CFDC 4XQDA 3MIBA 1HX6A 1VB4A 3RYPA 1Y9QA 4DRVA 5A33B 1VP6A 3I2DA 2WIIB 5GALA 4R52A 2GH2A 2JE7A 1PGL2 2WA4A 3EBRA 1H1IA 3N7MA 1D0HA 1LHOA 3TOJA 1C57A 3DL3A 4IETA 2B45X 1PO21 3IPVB 1C28A 2D93A 3IDBB 1CQ9A 3CJXA 4LBQB 1ND2B 2UYAA 4ASLA 3RZZA 4UBGA 4MXWB 3UKTA 1YIFA 5JVVA 3TNQA 2NLRA 3AYDA 2XJUA 4Q4V1 3WDYA 4LBJA 3TN92 5CG8A 3VKLA 4GULA 3OBTA 4H14A 3VZLA 5BNQA 4C0BA 4SBVA 4URTA 3JQWA 4PLNA 3WX5A 3VHRA 3MIGA 4QQ2A 3BU7A 1RJ8A 1FI2A 2HWC1 4HSJA 4L11A 2R063 3D82A 1V9U2 2BEOA 3ZSLA 2VOXA 4R8HA 2VG9A 4XXAA 1AJOA 2GC1A 4E2GA 4CDWA 5HBAA 5LRRA 3SH4A 3VBOB 1R083 1IS6A 3HN1A 4FPHA 3ZFFC 2JG9C 4PDWC 5KXCA 3B93A 4CTEA 3N36A 1AR62 2DV9A 4L92A 4EWDA 3FBMA 5BNPB 4IV1C 5E88A 1DQ5A 4ES8A 1RUI2 2A6XA 3RRDA 1C4RA 2WZR3 3VKMA 2GC3A 4PCRA 2A7AA 2ZGOA 3HMYA 1KDKA 3H1YA 4TSVA 1UD1A 3ZFEA 3VBSA 2XLGA 4YW5A 2XHKA 1J58A 4IEOA 1W6PB 1AJKA 2BVVA 1POV0 1ZZ8A 4H7LA 4X8PA 1O3TA 1LHNA 2X8KA 4CRQA 2IXIA 4EWEA 2ZHLA 4Y1ZA 5EFUA 4QPIB 2A73B 2JG8B 4GIQA 1YRZA 1RUF3 3AFKA 5ABJB 4P9WA 1W6MB 2KA3A 4OVEA 4XF0A 2NMOA 4CEYB 3BB6A 4AFAA 1EAH2 3H3UA 4YGEA 3MIFA 3LCPA 5JPNB 5A32A 1PM7A 3AZWA 5J98B 1RUJ3 3NVCA 1PZ7A 2WS93 5T5JA 3V56A 3O12A 1W0PA 2FMDA 4XF9A 2QE3A 1WMDA 1WBLA 1X82A 1HRV2 2RJKA 1WW7A 2JENA 2RMU2 2ENRA 3KGZA 4M0NA 1JBCA 4OZXA 2A5ZA 3PTYA 1RUC1 1POV3 4KWKA 3AP7A 3OJBA 2PA7A 1B09A 1FYUA 5JPMB 1XYPA 3LB9A 2VMIA 2XB6C 3WW2A 4AHZA 2QQPA 2V73A 1WBFA 5C8CB 1LGNA 1BEV2 3N4MA 2DCTA 1H30A 3IDCB 5FMOL 1BMV2 5T5OA 5J3UA 4HPKB 4BIOA 2YHJA 4N53C 5JZGB 2HWE1 3MW4A 2ET7A 3P3NA 4LTAA 3D0SA 1XYNA 4JGZA 4L2NA 2ZPXA 2WNVA 1AXYA 1I5ZA 4K1YA 4PBPA 3WUCA 3A0NA 1C8M3 3FE5A 4M01A 3VHNA 2UY8A 3VBUB 1ZRCA 2VQ0A 4HN1A 3AKQA 1SLLA 3WLUA 1RUH1 1QJU2 3U0ZA 1ZZCA 2PLV2 2ZGMA 3AXDA 3EXUA 1TME2 4Q0UA 1I6XA 2VW1A 1LEMA 3WP5A 4CP2A 5FLIA 1D4M1 1LHVA 3JU9A 4FVVA 5C4WB 4Q0SA 1WLWA 2DUQA 1V6LA 4XJZA 2V5YA 3USSA 1YFUA 3X29B 4XTMA 3O0WA 3UJOA 5A33A 1HV1A 5DDJ3 2ZX1A 3LSDA 1AXZA 1YYNA 4A2UA 1NE6A 3ZXAC 3ST7A 1QY4A 1QQP1 2B9UA 4AEKA 5JOXA 2YUEA 4COWA 1LGCA 1CAVB 1SMVA 5CU1A 4LBQA 1ND2A 1SLIA 4W6WA 5FMOS 1HRI3 3KT1A 1ULGA 4Q4W1 4GA9A 4Z92B 2WFF2 2WSVA 1WA4A 2JDZA 2ZMLA 5BYNA 4HMZA 4AVSA 4AHYA 1ZYBA 3R4DB 3VKNA 1IS4A 1LHWA 3ZFGB 1DZTA 1VR3A 4QGNA 1H9PA 1H4HA 1WLCA 4FQZA 4Y1YA 3M3EA 4MSVA 4DRRA 3J8F3 4LNVA 4HZFA 1JTZX 3SCHA 5JLVA 3ZYIB 5J36A 5AVAA 4XETA 3HBZA 1PMIA 3M1HA 3WDUA 5GLTA 4JGYB 3U07A 1OHFA 1QJY3 4OI2A 2B8MA 1RUF2 2E7QA 3CJIB 1RHI3 4JCKA 4EWAA 3VDDA 1BBT1 1TMF1 2D97A 1FPN1 3MLLA 4D94A 1ASJ3 2WSUA 4IESA 5BNPA 4Y22A 2BFUL 2D6OX 3GBGA 3RJRA 3H7YA 1AR72 3ROUA 3LA3A 3GNEA 1TEIA 1UU6A 5ACA1 3MLJA 3EJKA 5C8WA 4EN7B 2BQPA 1DGWA 1MR5A 4MGYE 1LOFC 1IPJA 2KXLA 3QBQA 4AEJA 1K5MC 2GDFA 4YM3A 1W6PA 1W6QB 5AC92 3MW3A 4K40A 3WP6A 3VHPA 2DCJA 2R32A 1ENQA 1OA4A 1APNA 1U5YA 1NQDA 3V64A 1UU4A 1H2LA 3AK0A 3ME2A 5AVPA 3MLKA 2JG8A 1NA1B 1LOEA 4AG4A 5KC6A 5JOWA 1S2BA 4BMBA 1CIWA 3THTA 3KB5A 4R9AA