2YXSA

Crystal sturcture of n-terminal domain of human galectin-8 with d-lactose
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
150
structure length
150
Chain Sequence
b'LQNIIYNPVIPYVGTIPDQLDPGTLIVICGHVPSDADRFQVDLQNGSSVKPRADVAFHFNPRFKRAGCIVCNTLINEKWGREEITYDTPFKREKSFEIVIMVLKDKFQVAVNGKHTLLYGHRIGPEKIDTLGIYGKVNIHSIGFSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Galectin-8 variant
publication title Crystal Sturcture of N-terminal domain of human galectin-8 with D-lactose
rcsb
source organism Homo sapiens
molecule tags Sugar binding protein
total genus 30
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2007-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2yxsA00
3AZWA 2OUJA 5JOWA 3PMEA 1CQ9A 4AVSA 3M3OA 3AYEA 2ERFA 5E88A 5CB7A 1S0IA 4RA0A 2D6NA 4XIKA 1AX0A 4U2AA 4Q27A 4YM2A 4ZXKA 3SH4A 3N3HA 3FLTA 3SH5A 2AENA 3WUCA 1OQ1A 1SLLA 1MS0A 1UKGA 1S0CA 4Q8KA 4YW5A 1FNYA 1O4ZA 1MACA 1DQ2A 1LULA 1QDOA 2V73A 2XG3A 3OBTA 4SLIA 5F9TA 2ZKNA 3AZYA 5JOZA 3LCPA 1F31A 4M00A 4XOGA 4FPFA 5GZEA 2ARXA 1DGLA 4XMAA 4FPKA 1LEDA 2ZGOA 2ES3A 4YW3A 3QCWA 3C2UA 2SLIA 1Q8QA 2HYKA 1LEMA 3T1LA 1AXZA 4M01A 1GNZA 1ENQA 1WW4A 3N36A 2W08A 3N7KA 1RITA 4AVTA 4YZ1A 4NO4A 3AYAA 1MS9A 4W65A 1LOFA 2ZGUA 4FPCA 3B00A 4MYEA 1BJQA 2D3SA 4YGCA 1AVBA 2DURA 3NV3A 1MS5A 2TEPA 5GLUA 3OY8B 1GV9A 1BQPA 3VKNA 4XIOA 1BXHA 4RL7A 1CONA 5CAZA 2NP0A 1G9BA 3POSA 2GN7A 4Y22A 1JOJA 1RINA 5EYXA 2WQZC 2CYFA 4I30A 4M3CA 5FRAA 1MS3A 5E89A 4FPLA 4YZ4A 5DUXA 5GLZA 2E51A 3D5OA 1W0PA 1MZ6A 4YW4A 4ZKTB 2WLQA 2Z42A 1LGBA 3MW3A 3N7MA 1GZ9A 1HQWA 1LJ7A 1OFSA 2ZGMA 1LU1A 1XQNA 4FP3A 1PZ9A 1V6OA 3M3EA 1A8DA 4DFSA 3B9CA 2OW4A 3M1HA 3BODA 4ITCA 5IK7A 4XTPA 5EXOA 3R05A 2NM1A 3ENRA 2ZHMA 2DUPA 1GYKA 1V6LA 4TZDA 2ZBJA 5H9QA 5IK4A 2NN8A 3HR9A 3JUUA 1SBDA 3SISA 5IUQA 2GNTA 2CY6A 4XMIA 4Y1YA 4ATFA 3ZVXA 5IT6A 1ULEA 1N3QA 1R1ZA 3AX4A 3R4SA 2ZACA 4U36A 1QGLA 4Y24A 1W6QA 2D3PA 3RRDA 4FPOB 1PZ7A 3O5SA 4YW1A 2DYCA 4DS0A 1S0FA 3AFKA 5HCAA 4GXLA 5GZGA 4Y1UA 3ILFA 3N35A 3N7JA 2DTYA 1PZ8A 2VY0A 1Q8SA 2A3WA 2PHFA 3H0OA 5T54A 2VXRA 5IK8A 4DPNA 1V6IA 2R0FA 5EWSA 3OJBA 3USUA 5JVVA 2GMEA 5DG1A 3BIWE 1H9WA 4HL0A 1MR5A 1V00A 4Q2FA 1IS5A 2DVFA 2LTNA 3FLPA 3KQRA 3ZSJA 2PHXA 1LOCA 1W6NA 4LBNA 1S0DA 4BMEA 4YFWA 1GZWB 1G9DA 2R1BA 4AGRA 4DQAA 2OUHA 1ENSA 3RS6A 1AJOA 4R9DA 1WLCA 4UW6A 3ILRA 1CN1A 1N1TA 3WG2A 3HN1A 2JJ6A 4YZ5A 1ULCA 3M3QA 1SBEA 2WT2A 4JRAA 2UWCA 1C4RA 1W6PA 5DUWA 1TEIA 1SBFA 1DQ1A 2D3RA 2PELA 2ARBA 1JUIA 1WBFA 3LSDA 1LECA 3AYCA 1G86A 2C9AA 4LBQB 1CESA 1JYCA 4M3CE 3IM0A 2VW2A 3B01A 5CNAA 4FOWA 1AF9A 2A6ZA 3WDVA 1G8WA 1KITA 1HQLA 4Z8BA 3I4IA 1UZZA 2D6MA 4ATEA 2EXIA 2RHPA 1IS6A 3BTAA 2DUOA 3V0BA 2ZHLA 1WCSA 5GJ6A 4WV8A 1LESA 4ISRA 4CZSA 1DQ0A 1W6MB 3QLQA 1LOBA 5DUVA 5LK5A 5GZFA 4FPGA 2ZMKA 3AJYA 4UW3A 1IS4A 5T5OA 2YXSA 4Y20B 4Y1XA 2W39A 1S0EA 1KDKA 1N1SA 2YMZA 3WUDA 2FMDA 3FFZA 1QOSA 2UURA 1ENRA 1EPWA 4FQ4A 3SLIA 4R9AA 4P14A 1KJLA 2CWMA 1Z0HA 1LGNA 1GLHA 1W6NB 2JECA 2D6OX 2A3YA 1D2SA 2A6YA 1NXD1 1LHVA 1URXA 2R0HA 2WKKA 4PBOA 4WVVA 4XHBA 1LENA 1YI7A 4FVVA 1ULGA 1H30A 4BQ1A 1WW6A 4Y26A 2ZGPA 2ZHKA 1FATA 4FOQA 3WDXA 2R16A 3V0AA 5T50A 1W6PB 1JHNA 1UZYA 2AH2A 2D6PA 4TYSA 4DRVA 1FV3A 2GMPA 2Q5TA 1B09A 3SNMA 1V6JA 2JE9A 2I2SA 1QDCA 1JW6A 1LHWA 2E53A 3ATGA 3UL2A 1AJKA 2ZGLA 2GN3A 2W52A 3PVOA 1Q56A 4Q8LA 4UW4A 3GALA 3AXDA 3W59A 2GALA 4JCKA 4R9BA 2DVAA 1LHOA 2UWBA 2NMOA 1N47A 2R1DA 1FYUA 3V0BB 3RMYA 4LBJA 1A78A 3NV2A 4M3CF 1MVEA 4NOTA 4WVWA 5GZDA 1I3HA 3VUOA 1CPMA 3OYWA 2VUAA 5T5JA 1LCLA 1UL9A 1WUVA 1A3KA 2P2KA 1QOTA 1SCRA 5DUUA 5DZFA 5KXDA 2YZ4A 4AGVA 1YIFA 4YW2A 2ZGTA 1GBGA 2G4IA 3AYDA 5F5QA 1S0JA 3O0VA 2D44A 2YV8A 2ZGQA 4YM1A 3RQ0A 2EIGA 1FAYA 2VU9A 4YGEA 4AWDA 3AK0A 1LOAA 5GZCA 2YY1A 2EXHA 3PVEA 4FPHA 4LBKA 4UW5A 1ONAA 1VLNA 2PHTA 1SLBA 1Q8PA 5GALA 3TAYA 4P9YA 1IKQA 4AYUA 4XBNA 3D6EA 1CPNA 1F5FA 2ZGKA 3VKFC 1Z78A 1MS8A 1VAMA 4F83A 5KXEA 1AZDA 2A75A 2DU0A 4XILA 3AJZA 2SBAA 3BOPA 2WT1A 3NWKA 5JOYA 4KBBA 1QKQA 1VAVA 2C5DA 4HANA 3O0XA 1AX2A 4K1YA 1HKDA 3ZXLA 1MS1A 1G9AA 4GKYA 2JKBA 2VH9A 1WLWA 5SV8A 3IPVA 4FOVA 5T52A 3AP9A 4AVVA 4P9WA 5T55A 1KJRA 2A7AA 2ZA9A 3OGGA 4BM8A 1WW7A 1GKBA 2EAKA 1QNWA 4Y22B 1SFYA 2GNBA 5CA6A 4FOYA 4M3CB 3W58A 1VALA 3VKOA 1IOAA 4XBQA 2EXKA 1VIWB 2W68A 1IS3A 1GICA 5L73A 3ZSLA 2P3KA 1DIWA 4WZFA 3V64A 5AVAA 3WG3A 1AXKA 2JE7A 1FNZA 1QMJA 2VW0A 1SLIA 4K1ZA 2D6KA 2WSVA 4Q1PA 1LU2A 1W0OA 2P3IA 5DZEA 1CIWA 1SLAA 1V6NA 4LBQD 4AGGA 2AREA 2GDFA 3HMYA 1ZA4A 2DWRA 4ASMB 2DU1A 4BLJA 3DUIA 2DVBA 1WD3A 3DGTA 3RMXA 1G9CA 2PHWA 2ZGSA 2A5ZA 4ISQA 3WHTA 1W6QB 3AP5A 3PVNA 1U0AA 3L2YA 3SH3A 1QNYA 3ZYPA 4JC1A 3A0NA 4XJZA 5T5PA 1S0GA 5JMCA 1KQRA 3WZ1A 2H0BA 4LBLA 2CWSA 3IN9A 5DXDA 4YZ2A 1DFQA 3WG1A 3AZZA 5IK5A 1RIRA 3B3QE 1GZCA 1WD4A 4FPJA 4IQPA 3AXEA 3MW2A 4XXAA 2UU8A 3VKLA 2D43A 1S0BA 4XHXA 3RG0A 1DBNA 2A6XA 3NV4A 4BOWA 3AP6A 1C1LA 3ASIA 3I8TA 3USUB 2D6LX 4XJWA 2ZAAA 4H55A 1CJPA 5JLVA 1SCSA 4K21A 1UMZA 4L8QA 3ZSKA 3OY8A 1MS4A 1BYHA 3AP4A 2DVGA 1G7YA 3AZXA 3KM5A 1JXNA 4C1WA 4YFZA 1Q8OA 2OVUA 4GWNA 1N1VA 3AZVA 3ZPYA 2NYYA 1CR7A 4BMBA 3UJOA 4YG0A 3V65A 1LTEA 4DRRA 3WDUA 2ZMNA 4XZPA 3NV1A 3POYA 3WDWA 2JDZA 5H9PA 5HCFA 1G9FA 5BYNA 2GNMA 2AGSA 4YG6A 1J1TA 1WLDA 3T2TA 2EXJA 1UN1A 1JN2P 2EF6A 5HCBA 1SACA 2WJSA 3FUQA 4D69A 3A0KA 3OBRA 4FPEA 5GM0A 1HLCA 1HDKA 2V5YA 4XYXA 1Y7BA 2A71A 1DQ5A 4YM3A 3O0WA 4XE9A 3ILNA 1D0HA 5JOXA 1AXYA 2EALA 1C57A 1DLLA 1SLTA 2ZGRA 5DG2A 5H9SA 3SITA 4CTEA 1GNHA 2VW1A 3AP7A 3GNEA 1X50A 1OKQA 3ZXEA 4GWMA 1FX5A 1LOEA 1FV2A 3O12A 3ZXJA 2FHRA 2R49A 3MPPG 3POWA 2NZ9A 2P34A 2A70A 1LOFC 3LSEA 4YLZA 4BPZA 3MW4A 2YROA 1V6KA 1S1AA 2WSUA 3WG4A 1GSLA 1IKPA 3FLRA 1KDMA 4PCRA 4GKXA 3WDYA 1YYNA 2WNEA 4Q1RA 2CTVA 2ENRA 4P9XA 1DQ4A 5KXBA 1DQ6A 1KRIA 2GMMA 2ZABA 5EYYA 2A6WA 1LODA 3TB0A 4YG3A 5JDBA 3CNAA 1W6OA 3V0AB 3WOGA 3N7LA 5GLVA 1AX1A 3JU9A 3VV1A 3WVJA 1SLCA 3WLUA 3Q9OA 1GZWA 2DV9A 1WW5A 2B7YA 1DYPA 1DZQA 1QU0A 1ULDA 2P3JA 5H9RA 3WV6A 3RSJA 1Q8VA 4FQZA 3ZXFA 4YGBA 3M2MA 4LBMA 5DZGA 5T5LA 4OZXA 4Q26A 4XTMA 3WCRA 1N1YA 1YXWA 2E7QA 4XBLA 2E7TA 1UX6A 3B69A 2DTWA 3IKWA 4YZ3A 3UJQA 3UK9A 3ZYRA 2ZHNA 2ZGNA 2A3XA 3APBA 4XXPA 1UPSA 4YM0A 2CL2A 3OYWB 3OPZA 2PHUA 3PJQA 4LBQA 4PF5A 3ZXKA 1C1FA 1BKZA 2DUQA 5GLTA 3T1MA 1NLSA 1LOGA 3WNXA 2UWAA 2JD4A 3VKMA 2A6VA 2AUYA 2GNDA 5CBLA 5KXCA 1V6MA 1YO8A 1DHKB 1JYIA 4GALA 2LALA 3FBYA 1W6MA 1ZM1A 4K20A 3WHUA 2D7FA 3ZSMA 4XDQA 1WBLA 2CNAA 5E8AA 1O4YA 4XJUA 2XB6C 4Y20A 1LHUA 4Y1ZA 1DYKA 4XJ8A 1LHNA 1YRZA 3R4UA 2ZZJA 2ZMLA 1GANA 1W6OB 1QF3A 2KM2A 1MVQA 4R9CA 4XJAA 2BQPA 3M3CA 1I1EA 3WCSA 4PBPA 1H9PA 4PQ9A 2NMNA 1F9KA 1MZ5A 3MEPA 3WDTA 4CRQA 1N3PA 5FREA 1QOOA 3IPVB 1CVNA 2WT0A 4FP2A 3FUOA 2P37A 1BZWA 3U4XA 1ULFA 2DVDA 3INAA 2AYHA 1N3OA 4FPYA 3IMNA 4Y1VA 1LGCA 4YGDA 5GLWA 4XJ9A 1UAIA 4BLIA 4GA9A 1APNA 2E6VA 2PHRA 4C1XA 3D4KA 1JBCA 3A4UA 2AR6A 4LBOA
chains in the Genus database with same CATH superfamily
3AZWA 2GC0A 4K6BA 4MX3A 1BEV2 5I8TA 3RI9A 2XL9A 1RUF3 5J96B 2UY8A 3O1SA 3DEMA 1OMIA 1CQ9A 3M3OA 5CB7A 4QB6A 2Q30A 5J1XA 4XIKA 2Q1ZB 3ZFEB 1OOPB 4N53C 3VZNA 1B35C 3FLTA 5FXXA 3SH5A 3WUCA 3THCA 3I7DA 1UKGA 1O8PA 1W9WA 1XNBA 2YGMA 1NOVA 1O4ZA 1DQ2A 4FFIA 1EY2A 4ZONA 2ATFA 3ZDSA 3O1PA 4QB2A 3AZYA 3KV4A 4DEQA 3AL5A 2MEV1 2HWF1 2ES3A 3T1LA 5C3SA 4HN0A 1LEMA 1GNZA 1ENQA 2EIEA 4QGLA 4UYBA 2VOXA 3ZLIA 3N7KA 1W8NA 1PX4A 4NO4A 1RUI2 2MNGA 1ZYBA 2HWC1 5FMBA 2F4PA 2VMIA 1LOFA 2WBKA 5L7OC 1BJQA 4XUPA 2D3SA 5EFUA 1VR3A 3MV11 1MQTB 3FWEA 1XPWA 2DURA 3NV3A 3MZHA 4IGOA 5KWRA 3KF5A 3PUAA 3WP6A 3ST7A 5GLUA 2ARCA 1TVGA 3OY8B 1JODA 5LA1A 4CSWA 4I09A 1E5HA 1FMD1 1FPN1 4JRLA 5EHDA 2PHDA 4Y22A 3UGGA 1RINA 2WQZC 1AR62 1PGSA 4I30A 3I2OA 5FRAA 3CJIB 1MS3A 2R041 2PFWA 4FPLA 1EV12 3I2GA 5DUXA 3ZN5A 4AFCA 3ZR5A 5ERLA 2FD8A 4HZFA 4AQ2A 4ASLA 2XLAA 3JD71 1LJ7A 2FDKA 4LHLA 2ZGMA 1V9U2 3LGRA 4QHZA 1DYOA 1RUJ1 4FP3A 1PZ9A 4NUBA 4CXXA 4D0QA 4BDVB 1PGW1 3HQUA 1G6NA 4ITCA 5BNNA 5IK7A 3OCPA 4XTPA 1RUI3 1V70A 4ZZ5A 3MDPA 2UY9A 2DUPA 2ZEZA 5FZ4A 2ZBJA 3HR9A 4Q4V1 3SISA 3JB4C 1QQP1 3V56A 1AYN1 2CY6A 4XMIA 4Y1YA 4A41A 3ZFGC 3ZVXA 1ULEA 1US2A 4HSJA 3ECQA 4FFHA 1N3QA 3R4SA 2J1UA 2ZACA 3PUHA 4U36A 4CDQA 3CJXA 2VECA 4XF4A 2D3PA 1JH5A 1GQHA 1TME2 2WR9A 3I3BA 3NNFA 4E2GA 4DS0A 2QZ3A 3T0DA 4GXLA 1JZ8A 2B42B 3ILFA 5A3WA 5IVCA 5D21A 5C8CB 3N7JA 5AVPA 3RPQA 1VBB3 1EV13 1MZFA 1UQXA 2PHFA 3CLPA 4NMIA 2VXRA 1PIV3 5DAQA 3AMMA 5IK8A 1US3A 5LEKA 1WCQA 1V9U3 4Q4X2 2XLFA 5FZIA 3AMHA 3RYPA 4IXLA 3IIIA 1CX1A 1PK6A 5JVVA 4QKBA 3BIWE 1XU1A 5BV6A 3LAGA 4NRMA 1IS5A 2PQQA 3G7DA 2RMU1 3KQRA 4FXGB 4NHMA 4LTAA 1LOCA 1I5ZA 3HNYM 1HW5A 1WCUA 4XQDA 5A7WA 4MG2A 4YFWA 4W6YA 1HRV1 4AGRA 4DQAA 1O7FA 4XUOA 2YGLA 5BNNB 2HH9A 3ILRA 4NHXA 2WL1A 2JJ6A 3HN1A 4IEPA 4YZ5A 3GGLA 2ZPXA 4JRAA 3GJBA 4ZZ8A 1C4RA 4EZHA 3FFQA 2PAMA 2R071 4UFJA 5FQ0B 3HQRA 1QJU3 2PELA 2ARBA 2WNVA 1JUIA 3ZFEC 4TN7A 1H0BA 1LAJA 1JYCA 2GC3A 4M3CE 4DXSA 2V72A 2WC2A 3B01A 2YG0A 4GWIA 5CNAA 3ABZA 1W8TA 2A6ZA 4JDOA 5F3CA 5F2SA 1BVVA 2C24A 4IEUA 4YW6A 3I4IA 1UZZA 1OLME 2D6MA 2RHPA 4NPMA 3VD5A 3B02A 4AI0A 4Q4X3 4RN5A 4MGKE 4K8FA 4JAAA 4ISRA 4QXCA 3SQOA 2WRAA 4UFMA 4JKKA 5LK5A 1ENXA 2VMDA 2HBTA 5GZFA 4FPGA 5KHHA 4UW3A 3AJYA 1IS4A 4Y1XA 2W39A 3MIFA 3LA7A 4AHYA 2FMDA 5F3GA 4DO0A 2UURA 3D0JA 3CU7A 4WBBA 4BQ3A 4JV4A 1SFNA 4P14A 2XGXA 5FPXA 2Y60A 1MQTC 2JECA 2WKKA 5A7WB 1D2SA 1NXD1 1URXA 1IQDC 2ZX1A 5FYSA 1OH3A 2WNOA 3RZJA 1ULGA 5C33A 2Y6LA 4ZXEA 5FZOB 1WW6A 4P9IA 2ZHKA 2XL7A 1UIJA 1Y9GA 2TNFA 3ZXGA 2Q0AA 3LIGA 2XONA 1PMHX 1RMU3 2D6PA 4Q0SA 4L2NA 1FV3A 2GMPA 2Q5TA 3FHQA 3CJIC 4K9SA 4CDWB 2I2SA 2XWBB 1QDCA 1JW6A 2E53A 3VN4A 1AJKA 3VBFA 5KHJA 2W52A 3K46A 1DZRA 3GALA 1VBC2 3AXDA 3S57A 5FZ0A 1HV0A 4R9BA 3BU7A 3VBUB 1KEXA 2E7AA 2WIIB 1N47A 4PI0A 1FYUA 4EJRA 1A78A 4TZDA 5GZDA 1R092 1H1MA 1FI2A 5FYHA 4XEZA 1OC1A 1YQ6A 3ZYGA 1WGPA 1ZZ6A 1A3KA 2P2KA 1QOTA 1SCRA 2AACA 4QPWA 4Z82A 2YZ4A 5FO8B 3S6PA 5A1LA 2G4IA 1DP0A 3HOBA 1REEA 1RHI3 2OX0A 2GAUA 4BK4A 3UETA 4Q0PA 2VXJA 3RQ0A 4A6OA 3S7IA 1LOAA 1RXGA 5FKBA 3WD5A 4LBKA 5C8CC 5HBAA 3OGRA 1NG0A 4QU1A 5JCTA 3TAYA 2Z79A 1IKQA 3GDBA 3GBWA 4A44A 3UT0A 3D6EA 2KA3A 2ZGKA 4XDOA 3VKFC 3NO8A 2O1QA 2VO5A 3OGJA 4FO9A 5A3UA 1QJY3 4IEWA 1UZ0A 2E9QA 3H42B 3AJZA 4XILA 5A33A 2O8OA 2JDNA 3AMPA 2JENA 1XNKA 2O8QA 3BOPA 3NWKA 1I6XA 1U5IA 5JOYA 1QKQA 1VAVA 5A1AA 1R093 3VBFB 3POJA 4MHUA 3TYJA 4GH4B 5A6ZA 1KJRA 5BNNC 5BXXA 4BM8A 2YBPA 2CGNA 5LA2A 4PF1A 1IHMA 4JGZB 3SXWA 4CDUB 3FC0A 5C8WA 1PHMA 3W58A 1AR92 4X8PA 3VKOA 5FKCA 4XBQA 4CU9A 2BUKA 4XFFA 2W68A 1GICA 3ZSLA 3BTYA 1SPPA 1NUKA 1RUE2 5AVAA 3H8RA 2OZ6A 3ES4A 4MSVA 4DB5A 2D98A 2ZX4A 2FQPA 3FE5A 4BWOA 4OHXA 2VBPA 1FNZA 2O14A 4NN0A 2VW0A 5FYTA 5FAXA 3K4ZA 4MXVA 2WSVA 3LKJA 5IVYA 5K9YA 4Q1PA 3UV9A 2JE8A 3A23A 4RS5B 2QQPA 1RUOA 2W1SA 4LBQD 3R0RA 2VG9A 4YYOA 4ASMB 5A1FA 4V1PA 1NY72 5FY9A 1UZWA 2DU1A 5I0SA 1NCQA 4XAEA 4HOOA 3IDEA 1NQDA 3DGTA 2Q8EA 1BK0A 5FYBA 2A5ZA 1W39A 4FSJA 1JZ7A 1W6QB 3KVAA 1VE0A 4OUSA 4FTEA 3L2YA 2WNUA 1QNYA 1UYZA 2P6CA 4EN6B 5FK7A 2D5HA 1VBD2 1S0GA 3RVHA 1KQRA 2H0BA 5DXDA 4AEJA 3B5LB 2XOMA 3AZZA 2XQXA 4PT6A 2VQ0A 3U37A 3KCCA 1NA1A 1RL3A 2DCJA 3MW2A 4PDWB 4AVAA 3IBMA 3QH7A 3RG0A 1PGL2 1RUE3 1DBNA 1W3XA 4ZPIA 2QTWB 3H8OA 3ASIA 1C1LA 3VBRA 1JI6A 1RUC2 1V0AA 1ZBA3 3FL7A 4CUGA 5IFPA 4D6SA 2BGPA 4CDWC 2JDYA 3H1WA 4AFBA 5JLVA 3U10A 2QQIA 2VQAA 2WA3A 1JS9A 1JHJA 3FHAA 3L9JT 2WZR1 2XPJA 1BBT3 3QACA 4WM8A 5FJKA 5JUVA 4LPLA 3BN6A 3SCGA 4YFZA 2DVGA 1G7YA 3KM5A 3RJ2X 5CADA 1AR72 1UWWA 2NYYA 4N7IA 3VBUC 3AMNA 4MGIE 5KBFA 1C8NA 3I3DA 3WDUA 5ACA1 1YWKA 4QPIA 3POYA 4LMFA 1G9FA 2QQVA 4TXWA 5CKMA 4LJHA 1EAH2 3T0BA 4D7TA 1VBD3 4DY5A 1WLDA 4BQYA 2EXJA 3WP3A 1VRH2 2WO2A 4HKOA 1UPIA 5FZKA 4CU8A 4O61A 4LO8A 3A0KA 3WT3A 4D69A 1ALYA 2X10A 1JTZX 5JXJA 2WNUB 1F35A 3EB7A 3O0WA 4XE9A 1HIXA 3OPTA 4YRDA 1C5HA 3JQXA 4LBOA 4QKFA 1RUC3 3LQCA 2OS2A 2EALA 3RNSA 1SLTA 2W47A 2RDSA 4Q0VA 1GNHA 1COV2 1UOFA 1HV1A 2ZX0A 1X50A 4IV1A 1FX5A 1YIPA 3O12A 2Y6KA 2OYZA 3UGHA 2EIDA 2BBAA 2JDUA 2YC0A 2A70A 1AR73 4BPZA 4CCKA 1IG3A 2YROA 1V6KA 2R062 3I49A 3HNBM 3FLRA 3VBFC 1UO9A 1YQ8A 4GKXA 4CCJA 4XUNA 4Q1RA 2CTVA 2RR12 4GH4C 4C90A 4QPGB 4BU2A 1DQ4A 3CEWA 2HWD2 1LODA 2BVVA 3TB0A 1HB4A 4JGZC 4OUMA 1JZ2A 3FBMA 4LO7A 4CDUC 5FFOC 2DCYA 2RS13 1XNCA 5GLVA 3VV1A 4AQ6A 1SLCA 3Q9OA 3VZOA 1WW5A 2B7YA 1DZQA 3J8F2 1BCXA 4NHLA 2OQ6A 5FLIA 2HWB1 5H9RA 3P6BA 5EV7A 1BLZA 3NSTA 5FLHA 3ZPOA 4BB3A 4A7KA 5CFCA 1YJLA 4YGBA 1COV3 4LE4A 4JZRA 4BQ5A 1QWRA 2YPJA 5DDJ3 2E7QA 1YXWA 2RM21 4N43A 4XBLA 5FYMA 3AM2A 3B69A 5FZ8A 3UJQA 4BK5A 3I2KA 3PU8A 4XF3A 4GAZA 3O14A 2ZGNA 2VMCA 3APBA 3NJXA 4RS5C 4Q4Y2 4IEQA 4YM0A 4WM7B 3PJQA 4R8HA 5A7PA 4LBQA 2X5IA 5JSOA 4I3PA 1NLSA 3PU3A 3GXUA 4XW3A 4JHTA 4C8DA 2RJLA 3NJVA 4HK8A 2JD4A 2A1XA 3JQWA 2LUWA 3HT2A 4KWKA 3I59A 2C0ZA 2A6VA 4NE9A 5KXCA 2P3YA 1WWYA 4IV3B 1W0NA 2VMHA 1JYIA 1R081 4LHNA 1POV1 1CX4A 4OLLA 5FXZA 1XE7A 1PVC2 3VHOA 2D7FA 3ACHA 3WXPA 2CNAA 1O4YA 2XUEA 2ETEA 2CV6A 2XQRA 4Y20A 1RUG2 4PDWC 4W6WA 1LHNA 1YRZA 5FZGA 2ZZJA 1QJX3 3I2JA 1XC6A 2WFF1 2CDPA 2FCTA 3LEIA 3M3CA 3ZO0B 1E5IA 4KG0A 1LKNA 4QXHA 1U12A 2NMNA 1F9KA 1FOD2 1MZ5A 2UYAA 2VMEA 3MEPA 1N3PA 4AAXA 2RS31 3CKHA 4Q4Y3 4C0BA 1JYNA 4QQPA 2D93A 1CVNA 1OLQA 1I9RA 5FZHA 4IGQA 1TMF1 2WO1A 3T4HB 4CEWB 1RVF2 5A6QA 2K0GA 4I02A 1ULFA 2VOWA 5LBBA 4HG6B 4FPYA 4XF1A 4Y1VA 1LGCA 1F4AA 4Y33A 2X5IB 4MGQA 1C8M3 3U78A 5CU1A 2YB7A 1APNA 2PHRA 1ND3B 2DCKA 4AI3A 3RWKX 4NWWA 4UFKA 3A4UA 1NCRA 4AE2A 5FWEA 3TNPB 1AL21 1RUG3 3S5AA 4F3JA 2WNUC 3AYEA 1HRI1 3VBSB 2ZTNA 4QKNA 3ZFFA 4E27A 1S0IA 2CSGA 1AX0A 3MHZA 4ZXKA 3SH4A 4DXZA 2AENA 1ZVFA 4AEDB 1JZ5A 5F6KA 1S0CA 1FNYA 1MACA 1LULA 2VCAA 3OTFA 3OBAA 5BNQA 1W03A 1T2XA 2ZKNA 3DV8A 5LY1A 1S2EA 5J48A 4FPFA 3MGUA 1DGLA 4XMAA 5ISLA 3WOGA 2VUJA 3PIGA 4YW3A 3C2UA 1Q8QA 1W06A 2XHNA 1JUHA 4M01A 2XH6A 1XYNA 1RUD2 4JGYA 4P08A 4Q0UA 4L99A 4YARA 1X36A 1QY4A 4QPGC 1CAWB 1VB2A 2RJKA 4GMP0 4IW3A 3T09A 3W5NA 1VBA2 4EN7B 3B00A 4MYEA 1SDWA 3KT1A 2Y33A 5DABA 5I0DA 4GB32 5F2WA 2R7EB 4S2FA 1AVBA 3WINE 3GYDA 1MS5A 1ZZBA 5A6XA 1TQ5A 1YFXA 2D97A 5LB6A 3MBWA 1NQJA 2J1AA 1NE6A 5APAA 1C5IA 1BQPA 1GV9A 5G04L 2W1UA 3VKNA 1C28A 4XIOA 5J36A 5FP9A 5CAZA 4RQPA 2NP0A 1G9BA 1BMV2 3A7QA 3B7MA 4OUEA 4YVWB 2BWAA 3T3YA 4CUCA 1OI6A 2G19A 3NAPA 4M3CA 2NLRA 1VP6A 1KGYA 2XUMA 5GLZA 2GZWA 3WX5A 1M06G 1W0PA 4WM7C 4YW4A 1DCSA 3BPSA 4RFRB 1D4M3 1LGBA 1TG7A 4RR3A 1OLMA 1OFSA 5JR2A 1U5ZA 1LU1A 4KG8A 3M3EA 3IDCB 2OW4A 2YUEA 5AFBA 1GU3A 1W05A 3TWIA 1NXMA 4LT5A 5E6HA 2ZHMA 1JOBA 1GYKA 4IV3C 1AR83 1VBA3 1LR5A 4XPVA 5C9AB 2VGDA 3JZVA 4D3WA 4WVMB 2W46A 2H0VA 2CDOA 3HBZA 4NWVA 2FDGA 5IUQA 2GNTA 4JGYB 3T2PA 4ATFA 1OPOA 4A42A 4Y24A 5F5AA 2RS52 4HKLA 1QGLA 2CHHA 3JXSA 4W6XA 4RGKA 5IWFA 3S7EA 2Q8OA 3H3UA 3RRDA 3PUSA 1PZ7A 4AFMA 3SEEA 2LS6A 2KXLA 4LA2A 3WQ7A 5IYYA 4Y1UA 1QH7A 4XFGA 4AQSA 1ASJ1 1UXXX 1S55A 2DTYA 2JIJA 3JB8A 4MZUA 1LNSA 5T54A 4JQRA 5C70A 4DPNA 4K3UA 2R0FA 2HWE1 1EUTA 4HFSA 4CEWC 1H4GA 1T6BX 4LR4A 4W50A 5IJRA 3USUA 2VZQA 5DG1A 4A3ZA 1MR5A 2VOKA 2VOVA 1YHFA 1Z7S1 2LTNA 4Q2FA 3ZSJA 1HX6A 2MEV2 4BQWA 2X5IC 4RR3B 4N9HA 4CDXB 3LEMA 3TOJA 5CEHA 1ZA7A 4PJYA 4MADA 1ENSA 2YBKA 5JXHA 1ND3C 4FTSA 2ZEXA 1WLCA 4TWTA 4P9JA 1CN1A 4UW6A 3ACGA 3MIHA 1POQA 1SBEA 2QQOA 2RS53 2UWCA 3LF7A 1W6PA 1GFF2 5CVRA 1Y9QA 1O8SA 3VBSC 3OSDA 2D3RA 4HXCA 2QQJA 1WBFA 3LSDA 3AYCA 1EP0A 2C9AA 3VLBB 3IM0A 3SHRA 4COYA 2Y0IA 2VJXA 3VGIA 3WDVA 2JDHA 4AEDC 2PLV3 1FMD2 1FPN2 1KITA 2GH8A 2W9XA 4OI2A 4CA9A 5EPAA 3ZYHA 4Z8BA 2EXIA 1IS6A 3ZN4A 1OLRA 3L2HA 3P3NA 2FDJA 3BTAA 4DMIA 2ZHLA 3W9AA 1Y9MA 2JG8B 2R042 2VR4A 4URTA 4WV8A 4TTGA 3KHCA 1W8HA 4BE3A 1UOGA 4RFT0 5FMDA 4QGNA 3JD72 3CL1A 2P6HA 3WNOA 3Q8AA 4CXYA 5LZ6A 1RUJ2 1HXS1 2PAKA 5T5OA 4BHPA 3MUZ1 1S0EA 1PGW2 4I01A 1U5YA 3VBHA 4CU7A 1QOSA 3DKWA 1EPWA 4K7JA 2VVDA 4OULA 4ZU5A 1W8ZA 3WW1A 4YSFA 2BFUS 3GHMA 3SLIA 1H8TB 1TE1B 3FHIB 5D1IA 1JZ6A 2CWMA 4S2HA 3R6SA 5DMYA 2Q8DA 4Q4V2 1K5JA 1LHVA 5IVEA 1QQP2 4A7ZA 3ZM8A 3ZN6A 5LCWL 2OA2A 1H6XA 1JMUB 3TN91 1H30A 4BQ1A 4LKDA 5AC93 5A3PA 3MIGA 1FATA 1WCKA 1NZCA 4FOQA 3WDXA 1W8OA 2R16A 4YVWC 3V0AA 5T50A 1W6PB 1JHNA 2VAUA 1CAVA 3F2ZA 1W9TA 2YC2A 4GIQA 2PQSA 3J7NA 5FY1A 4DRVA 3ZYBA 1OKOA 2YFUA 3IB3A 3KT7A 2R30A 4DUXA 5DAVA 1DF0A 1BEV3 1X33A 4LUKA 2FMYA 2R043 4SBVA 2X05A 3UL2A 3VDBA 3Q8BA 1RUF1 3PVOA 3CIHA 2JG9A 1OHFA 4B29A 4KI5M 3PTRB 2LM3A 2IC1A 3EBRA 3W59A 2GALA 2FBEA 1RUJ3 2NMOA 2R1DA 3RMYA 1HJGA 1IPSA 3C7GA 1A8MA 1MVEA 4UT5A 4RHV1 3MIEA 4QQHA 2RMU2 3KV6A 5C9AC 3OYWA 1H6YA 5T5JA 3P5BA 4FFGA 2CU5A 3H7YA 3OOXA 4JGYC 4KMQA 1HRV2 4KL1A 4Q4V3 1WUVA 4FBFA 5FBJA 5FP3A 5DZFA 5DUUA 4COVA 2A73B 4C91A 1OURA 4TLFA 2ZGTA 2VMGA 4Y4RA 4AQTA 5A32A 1UYYA 3K51A 1OUSA 4N7UA 3OEBA 1ND2A 1S0JA 3O1OA 4KGGA 4IE6A 4LKSA 2Y6GA 2XJVA 2PA7A 2R072 3ORJA 2BNMA 4NIHA 4P9LA 3AK0A 4IE0A 5GZCA 4FPHA 3K3NA 3PVEA 4DXTA 5HXMA 2BERA 1ONAA 3O1UA 2PHTA 3I97A 2B46X 1H2KA 1Q8PA 4P9YA 4QD2A 4AYUA 2RV9A 2YDEA 3ZDVA 4LOTA 5BNPA 2XKPA 1F5FA 4F83A 5KXEA 2FDHA 2WO3A 4QWNA 3IDBB 4QXBA 1EUUA 4V2VA 5FXVA 1CAVB 2L9LA 5BNOA 5JI7A 5A3LA 5DQ0A 3RZZA 4KBBA 4K1YA 4XACA 4LO5B 2VMFA 1AX2A 3MICA 4YVSA 5BPXA 3BTZA 4RR3C 1MS1A 1OQEA 1AR63 5D8AA 3CZUA 3POFA 2XJUA 2X29A 1DGWX 4AI1A 4GMP3 4HBNA 5SV8A 4AVBA 4P9WA 4XQ4A 1ZZ7A 2QQKA 4H14A 4EE2A 2EAKA 3M3IA 5FMOS 1Q43A 1XJAA 5HV4A 4BXFA 1QNWA 1DG6A 1S2BA 2HYXA 4Y22B 4Y3OA 3MI8A 3KLSA 2PYTA 2GNBA 2VOTA 1X7NA 4PHZA 4AI9A 5FDBA 2K9ZA 1VALA 1IOAA 2R073 4Y5TA 4LUMA 2VZ3A 3ZSEA 1VIWB 5I93A 2XDVA 2ARAA 4URAA 3WG3A 1DIWA 4WZFA 3V64A 1WMDA 3AVSA 3S0MA 1ZBE1 2PXJA 4XUQA 3E6CC 4L9BA 3I2IA 3T1MA 4PLMA 4EN8B 3FZ3A 4MVTA 1SLIA 1NZIA 2W91A 5HI0A 2B4KA 1LU2A 2JG8C 1W0OA 2P3IA 2XMLA 4DUVA 3PIJA 2IXJA 1CIWA 1V6NA 2X09A 3U11A 1TME3 4AGGA 2GDFA 2DWRA 1W8UA 1YLLA 3AKPA 1WD3A 1OA3A 1PM7A 2HEWF 4KWUA 1D7PM 2PHWA 2I07B 1G9CA 3CO2A 1GZTA 4ISQA 4CDQB 1W3VA 5C6CA 3WHTA 1UXZA 1VBB1 4IEXA 3PVNA 5CIRA 1H8TC 3MV01 3RI8A 2QBXA 5C7GA 4EYUA 1PIV1 4JC1A 4XJZA 5T5PA 3WP5A 5D8AB 3IN9A 1V9U1 2HBUA 3WG1A 1OUXA 5CISA 2ADDA 1RIRA 2G9ZA 3H3ZA 3B3QE 5FZ1A 4OZOA 1WD4A 4FPJA 2LROA 2VNRA 3LDBA 3ZMOA 3VD3A 1UU5A 3OF1A 2N7GA 3LDRA 3NV4A 3AP6A 3I8TA 1PK6B 2D6LX 1S2KA 4BYYA 1GP5A 4H55A 3RJRA 1CJPA 1SCSA 1UY4A 1ULPA 3WQBA 2Z5WA 5JIUA 1MS4A 1BYHA 2LRPA 3EXUA 2OVUA 2C6SA 3N9MA 4GWNA 3BVCA 5E16A 1QJU1 3WW3A 4LLFA 1LTEA 4DRRA 4XZPA 5KC5A 4XFCA 2JDZA 3F95A 5L9BA 3SC7X 1KFXL 2OIIA 3MF6A 4CCLA 4G9SB 3TRSB 1H2NA 3T2TA 2WNVB 2YYOA 2JIGA 2AEZA 1JN2P 1O5LA 5I0UA 5HCBA 1SACA 2ORXA 2WJSA 5FYIA 3OBRA 4FPEA 5GM0A 2HEYF 3GF6A 3QD6A 4G3YC 2ZEYA 3LFIA 1DQ5A 4BXSV 5AFEA 5F7UA 2WWSA 3IT8A 2Z69A 1D0HA 4B4RA 1XE0A 5FYCA 1AXYA 4HN1A 1K42A 3KHBA 1C57A 1DLLA 3BIEA 2ZGRA 4BH9A 5H9SA 4CTEA 3HIFA 1PO21 4DZGA 3GZUC 3WNPA 1OKQA 1OA4A 2EAAA 5B4NA 5ABJA 4PLNA 2TUNA 2VC9A 3POWA 4R4XA 2NZ9A 4UFHA 4KH9A 4S2GA 2P34A 4TSVA 3ZKUA 1J59A 2FCUA 1LOFC 3ZIWA 5LBEA 1W04A 1PX3A 2WQ4A 3VD7A 1QXPA 4ES9A 3LFMA 1U5XA 5J09A 4UFLA 2FCVA 4NIGA 4Q4W1 1YQ2A 4AHZA 1RMU1 2OQ7A 3MLKA 1QHDA 4OI0A 4Z07A 2F17A 3UESA 5EYYA 5JXGA 2XVGA 2ILMA 1ZZCA 4DEVA 4YG3A 3QH6A 3CNAA 2VUDA 2C4XA 1VBC3 3E5UA 3KMHA 3UKVA 1AX1A 3JU9A 1DGRN 3WVJA 5C3OA 5I91A 4HPKA 1GZWA 4ZS3A 1DYPA 2R32A 2WO7A 4QQLA 4UWDA 3VDDA 4LOSA 1IZ3A 3WV6A 2WZ8A 3S5QA 3LOIA 2IFRA 5FZDA 4K8RB 5DZGA 4LBMA 5T5LA 2XVLA 4OZXA 4XTMA 4UF0A 5JPMB 1AL0G 4JHZA 3IKWA 3ZYRA 2DTWA 3UK9A 2ZHNA 4JKLA 5LA9A 4C0HA 2ORZA 4GWJA 4Z2AA 3OPZA 4LITA 2PHUA 4PF5A 2WZR2 3ZXKA 1RHI1 1VJ2A 1YJKA 3KV5A 3WNXA 2UWAA 2ZCWA 4CCMA 4MGSA 1XB9A 4RGGA 3WNNA 2H6BA 1OBNA 2BZDA 2GNDA 4CDQC 1ZRDA 2G1MA 3NNLA 5JPNB 4DINB 1V6MA 3ZKYA 4O7XA 5ACA2 4PI2A 4GALA 2WAOA 1W6MA 4K20A 3OUIA 5D8AC 1H8VA 3SKJE 4AXOA 2DCZA 1QJY1 5LA0A 3Q8EA 2E33A 5LY2A 3J7LA 3D0SA 2VTXJ 1OVPA 2B9UA 2VCMA 1WKYA 5DPNA 2BP6A 3JBG2 1AYM2 5JR7B 1RUH1 1GANA 4MGZE 2KM2A 2WDBA 1HJFA 1PK6C 1MVQA 5A33B 5FZBA 1EPZA 4HPKB 3DPRA 2VQTA 5A7OA 2BNNA 5C3PA 4PQ9A 4OHWA 4FTBA 3WDTA 1T6GC 3WF2A 1E5RA 1QOOA 2X53S 3LWCA 1AR93 4UF0B 2WA4A 3J4UH 5A3MA 3DECA 3KSCA 5IAXA 4LQRA 3INAA 5EJ3A 2AYHA 1PMJX 5IVVA 3KZ4C 2Y0OA 4XQWA 2W1QA 2QQWA 3KF3A 2WNVC 2HLEA 2JWPA 3RZMA 4YNIA 3U07A 1CAUA 1SPPB 3D4KA 1TZOA 1JBCA 2V5DA 3DKQA 3FN9A 5CKNA 3KCXA 4NHYA 3PMEA 3JBG3 1AYM3 3KCYA 3U1XA 5FUNA 3RWNA 3A21A 2ERFA 3HT1A 1ZZ8A 5E88A 3EMRA 2BRTA 4RA0A 1GWKA 2D6NA 3H8XA 1WA6X 4U2AA 2B39A 3C7EA 4YM2A 1RGSA 2WUHA 3MO4A 3N3HA 1Y43B 2HWB2 2XBO1 5LK7B 4IEOA 1NCQB 1OQ1A 1DLCA 5F8PA 4Q8KA 2AC1A 2ZOEB 3OBTA 2RM22 2QQUA 2IUWA 2XG3A 1QXRA 1UMIA 3GCXA 4P5HA 4SLIA 3VL8A 3VZJA 3DPRB 5FUIA 1ZREA 3LCPA 1F31A 2JDMA 3KQ4B 3ETPA 4XOGA 5GZEA 2ARXA 3KGZA 4FPKA 4JKMA 3QCWA 2HYKA 1MPXA 2DBIA 1AXZA 1J1LA 4W4ZA 4P5YA 5EQUA 5FOBB 2W08A 1ZBA1 1RITA 1W8FA 2YU1A 4AVTA 4YZ1A 4AHXA 1KXGA 1NA1B 1W99A 5FY5A 5JZGA 3LPGA 1BBT1 3VBRB 5FZ9A 1R082 1WZXA 3H9AA 2K46A 4QX3A 2TEPA 3T2OA 3URFA 3ZR6A 4CEYA 3THTA 4CUBA 3HQXA 1XU2A 4WM8B 1ODNA 1BXHA 1CONA 4HVOA 4M4PA 3POSA 5JWPA 3N9QA 2JDPA 1EAH3 2F6BA 4HT1T 3LOBA 1F4HA 1UNBA 1VBE2 1VRH3 2DCTA 3BOWA 3Q8FA 1IPJA 5LRRA 1HB1A 4GQ7A 4CP2A 2RM23 3D82A 4INDA 4QPIB 5E89A 2Y6HA 4XUTA 2OZJA 2P1BA 2E51A 1Y3TA 2JB4A 3D5OA 5BUVA 2IWGB 2WLQA 2Z42A 3N7MA 5A3TA 1W2TA 3PTYA 2RS32 1HQWA 4CPBD 4EZ4A 2O0OA 1L7QA 1V6OA 3M1HA 1TMF2 3BODA 1GWLA 4Y5SA 3R05A 2BV4A 2NM1A 3ENRA 5F37A 1O59A 2XKOA 1O6UA 1YQ5A 1SZBA 2NN8A 2YPDA 3E1F1 1VMFA 5LWBA 1TNRA 1POV3 2D40A 5C4WA 4META 3N4MA 2R063 2VBBA 5FYYA 5JI9A 4IV1B 2ET7A 3TEZA 2WFPA 1AL22 3VHNA 3PJYA 3TBDA 5K0UA 4PIYA 5FZCA 2VL4A 2EVXA 2RR13 2VQUA 3O5SA 4IL7A 1J3RA 1S0FA 3C7OA 5IW0A 4XC9A 3UKNA 1HRI2 1OD3A 1VBE3 2W3JA 5CYYA 4CEYB 2MHFA 2UYBA 2HWD3 2XJRA 2JICA 3RZHA 1PZ8A 2VY0A 2A3WA 4XFIA 2IVJA 3IIAA 4DNYA 3GHNA 3I2FA 2RS11 5EWSA 3OJBA 5F32A 4DUWA 2RE9A 3J8F3 1OPMA 3THPA 3BKZA 1H9WA 1OF3A 2DBNA 1PNFA 3FLPA 4N8MA 3ETQA 5F1RA 5FOJB 2PHXA 3CHXA 4QM9A 1W6NA 1BVP1 4LBNA 1LB2A 1NX9A 2J42A 5CFDA 4BMEA 4D7SA 5IFTA 5DDJ1 4D7YA 1G9DA 2R1BA 2WQ8A 2RDNA 1H1IA 3VBOA 4V2WA 3MUY1 3VZMA 3WF3A 5CFCB 2C9KA 5JAXA 4BIFA 2P4EA 1ULCA 3SEPA 5A6YA 3RFRA 1VMHA 4N43B 2BDRA 3U75A 4AZZA 3MFAA 2XJQA 5DUWA 1SBFA 1R1A1 1WMFA 4HSLA 4CP1A 5C4WB 3HAGA 3K4DA 1LECA 3POGA 4LBQB 1CESA 2OT7A 5A70A 4QMAA 4TLGA 1PVXA 4QGMA 5J37A 2GU9A 1NCQC 1PVC3 1AF9A 3OBZA 1HQLA 3WQ1A 4NAOA 3HNMA 3MPBA 3I59B 4ATEA 1O5UA 1MEC2 4KWJA 3V0BA 4AEKA 3DPRC 5GJ6A 5EP9A 1GOFA 1LESA 4CZSA 4N53A 1CJDA 4OCTA 3QLQA 3N9OA 5DUVA 3NW4A 1X8MA 1XE8A 2Q1FA 1K12A 3GZAA 3KVBA 3PUQA 4NVPA 1QJX1 3VHRA 2YXSA 3MIDA 1HN0A 4Y20B 5IATA 1NA1C 3H1YA 4LHKA 1FOD3 5FZ3A 1ENRA 4FQ4A 1D0GA 3IAPA 1OVSA 3NNJA 4R9AA 1O3RA 3VDCA 3VBRC 1LGNA 1W6NB 4AFAA 4RSUA 2A3YA 2A6YA 4XHBA 2R0HA 1RVF3 2YC4A 3BYWA 4PBOA 4WVVA 1OXCA 1SDDB 5LASA 1LENA 2BFUL 4ARYA 4ZU7A 1O3QA 1REFA 3ZOIA 4WM8C 2ZGPA 5T3NA 5FPUA 4Z1VA 5LATA 3O1TA 3C7HA 3H7JA 1YC61 2P5BA 1C8M1 4XFBA 2AH2A 4TYSA 3ZMNA 4QPIC 1V6JA 3SNMA 2JE9A 4B1LA 1MEC3 5FLJA 2ZJCA 4QX0A 1ASJ2 1RUG1 3ES1A 3WQ0A 1RYYA 4CPBA 4FAHA 3DCQA 1DZTA 4DXRA 1P8JA 2JKXA 4Q8LA 4UW4A 4AG4A 3LA3A 2HWE2 4JCKA 2P17A 1ODMA 1NCRB 2Z4FA 3CQOA 4OVEA 3V0BB 1Y4WA 4LBJA 3NV2A 3UYJA 1Z7S2 4EV0A 1I3HA 5B4XA 2RDQA 2QVSB 4LXLA 1SMVA 2VUAA 1X8EA 1GOGA 3ZFFB 1LCLA 3VDAA 5KHGA 1TNFA 1IG0A 4AI2A 3K48A 4N9IA 4Q29A 5KXDA 1J84A 4AGVA 4YW2A 1WCDJ 4ORFA 4IV1C 1GBGA 1GMMA 4UFIA 2BJSA 5SV5A 3T30A 2K2SA 3UKTA 1XXNA 2WINB 1RUD3 3O0VA 1QXJA 1XNDA 4BQ2A 3O1VA 2ZGQA 4YM1A 1UIKA 4YGEA 1ZX5A 4CEYC 4NIIA 5JMOA 1JZ3A 2EXHA 4FCAA 3KV9A 4QM8A 3ZFGA 1J83A 4OQ9A 1SLBA 3S30A 3WW4A 2FDFA 5GALA 3W5MA 4GB33 3MFCA 5FPAA 1ASJ3 3LA2A 3BGAA 4XBNA 4Q5OA 5LBFA 1CAXA 1YFWA 3O1MA 1Z78A 3OB8A 1SEFA 2A75A 2DU0A 1H4HA 4IEVA 4KBZA 3OD4A 2SBAA 5EJZB 4HANA 3ZXLA 1HKDA 1GNYA 5L9RA 2RDRA 3GJAA 1YFYA 2JKBA 4GKYA 4H2AA 4AVVA 3IPVA 4FOVA 5T52A 2JX9A 4AHWA 1HXS2 4QDQA 2ZA9A 5CFCC 4RQPB 1WW7A 3VZKA 1XSRA 3ROUA 1D4M1 1SFPA 3OUHA 4LKFA 4N43C 1SFYA 4BQXA 5CA6A 4M4RA 5KHKA 3WR0A 3NAPB 4M3CB 3SKVA 5FMOL 3IWZA 1DU3D 5C4WC 4IEYA 2EXKA 2ZXQA 1S4CA 3D8CA 2HWF2 5C3QA 1H1AA 5L73A 4MGYE 3TN92 4FXKB 3VB9A 4A4AA 1AR81 1VBA1 1J3PA 2EA7A 2W95A 3DF0A 1E57A 3FX3A 4AFDA 3THDA 1YI9A 3C8XA 2WWJA 5C5UA 1PMIA 1W28A 3V65A 2HWC2 4EN9B 4K1ZA 5EIYB 4XAAA 4FT8A 5J3UA 4I3GA 5DZEA 1REDA 3ZFEA 3NL1A 2ZKLA 1OOPA 1SLAA 4B3NA 3TEXA 2DFBA 1GOHA 2AREA 1QJZA 3HMYA 1ACCA 1ZA4A 4BLJA 1RUF2 2WS91 2V09A 3DUIA 5FK8A 5CZKA 2ADEA 1DGRA 3EO6A 3P3PA 4XCBA 1WLTA 3HEIA 3WNLA 5B2GB 2XJSA 1W9FA 3MYXA 3W21A 2OPKA 3PL0A 1U0AA 3SH3A 4RHV2 4ET7A 3M70A 4ARXA 3P1IA 3I2DA 3J7MA 4QX2A 1BK1A 1ZRIA 4LBLA 1DFQA 1JYWA 1RB8G 1JYTA 4R4ZA 4G4FA 5IK5A 2IZWA 3AMQA 2MEV3 2HWF3 2D43A 3PMSA 4XHXA 2D5FA 2PN5A 3QBQA 1VB4A 2A6XA 2Y64A 4GULA 3USUB 4XETA 1OD5A 4E4HA 1MQTA 2ZAAA 3RZGA 4PLOA 4HKWA 2B5HA 2HWC3 2WYSA 3PVBB 5A7NA 3CF6E 4HLTA 3NQHA 1PO11 2Q4SA 2QCSB 4L8QA 3ZSKA 3OY8A 2BBVA 1QJEA 4BA6A 5K8SA 3T08A 1AYN2 4UXAA 2VZRA 2Q1MA 2X8KA 3AZVA 4XVHA 5FP7A 3ZXDA 1NCRC 4KU8A 4BMBA 3UJOA 4B7EA 2JDKA 1GQGA 1UU4A 2E31A 3CJIA 1XYOA 2EICA 2ZMNA 3MLJA 3NV1A 4I0WB 5L36A 3WDWA 1FMD3 1FPN3 5HCFA 2XWJB 3ZFFC 5BYNA 2GNMA 2PLV1 4RHV3 3Q8CA 4YG6A 2JEMA 5FZAA 2I74A 1UN1A 4J25A 3NJZA 2EF6A 3FUQA 2QJVA 1HLCA 2V5YA 4QDRA 3JD73 3DXUA 1Y7BA 2HKXA 4WVZA 1UZVA 4YM3A 4MV2A 2VUCA 3ILNA 4W8JA 4I0BA 4QX5A 1L7LA 5FPBA 3B9IA 5DG2A 3AP7A 2YHJA 3GNEA 3ZXEA 3ZXJA 3TEYA 4BCUA 1FV2A 3BB6A 1ZBE2 2FHRA 3W20A 4UOJA 2VD7A 3VBHB 1QQP3 1NAEA 1AYN3 2HJIA 1W9SA 1L3JA 1YCIA 3SCFA 3WSOA 2GH2A 4L97A 2FZ1A 5AC91 3LZZA 5C8CA 3WG4A 1JU3A 4PCRA 1IKPA 3B94A 4AOCA 5KHIA 1OT5A 2WNEA 3ZN6B 3KD4A 2ENRA 4P9XA 4AR2A 1DQ6A 3EJKA 4QU2A 2ZABA 4RQPC 2W2IA 5IVBA 1BEV1 2A6WA 4EQVA 5LRSA 1KRIA 3HVDA 1VBB2 3V0AB 1KD7A 2J1SA 4E4SA 1PIV2 2J1RA 2DFCA 3ITQA 1W8WA 5FCCA 3NAPC 2Z2SB 4F7ZA 5J98B 5FY0A 1CIYA 1QU0A 1ULDA 2VTXA 5JXIA 3BUCA 1OQDA 2RMU3 2G9GA 4ZY9A 4CP0A 3ZXFA 2JG9B 1E5SA 3K2OA 3M2MA 3LEKA 3PHMA 4EWAA 2JB8A 5EJ1B 3BTXA 3TNQA 1N1YA 4LLOA 1HRV3 1ZBE3 2WLPA 4NJ4A 5CG9A 1CZVA 2J1EA 3KGLA 1GP4A 5FQ0A 3WNKA 2XJTA 3NJYA 5LEJA 2CL2A 3OYWB 4FI9A 4OHVA 5F5CA 3IDAA 2R6QA 3I2HA 1C1FA 2W5FA 2DUQA 4JDNA 5ANNA 4ZS2A 5GLTA 2OKXA 1LOGA 3MIBA 3HN3A 4LIUA 4NPRA 4QXKA 4YW7A 3ZYFA 5IHRA 1RUI1 3POIA 4CCOA 4LORA 5FZMA 4FFFA 5D2AA 1LRHA 2AUYA 1QJU2 2V4AA 5A32B 4YPJA 4LNVA 4J6GA 1ND2B 1DHKB 1WA4A 3GBGA 4B4PA 2LALA 3HPNA 4UBHA 2E26A 2QUOA 3T4VA 2DDUA 1IGOA 2VCCA 4XJUA 1LHUA 3DYOA 3WY6A 1DYKA 4CP9A 3USSA 4XJ8A 3E97A 3M4FA 5FMCA 5BNPB 1YFUA 3ACFA 3E6DA 1AR61 3DYPA 3NKGA 2B45X 2WWUA 2JXAA 4GMP1 4R9CA 5BNOB 2BQPA 1I1EA 3WCSA 3PNAA 2VVFA 1EV11 3A22A 3I54A 4KU7A 2WN3A 1CZSA 4YVSB 1ZRRA 5FZEA 4A6SA 4A7YA 5C5TA 4X6RB 1PO22 5FYVA 4B7KA 1X82A 5FZOA 5FREA 1UKRA 4UI9L 3VL9A 3PDQA 3FUOA 2OPWA 4FP2A 1BZWA 4XFHA 1F8VA 4HVQA 4O65A 3U0ZA 4OMCA 5FZLA 2QQMA 3H3LA 4CDWA 2QFEA 1N3OA 1X9TA 2QDRA 2VE1A 3IMNA 4B1MA 1OOPC 3ZIXA 4YGDA 4OQ8A 3OEAA 5GLWA 4E2SA 4XJ9A 5FO9B 4Q4W2 4GA9A 1DGWA 1QH6A 1ULOA 1RMU2 1UY1A 2E6VA 4LEJA 4AL9A 4C1XA 5L9VA 5FBZA 3VBUA 4OHZA 4LE3A 2OUJA 3J26N 3ON7A 4MH0E 2QDNA 1TME1 4IGPA 4MOAA 5JOWA 2BGCA 4AVSA 5DN2A 4O9GA 3GZEA 4Q27A 1FT9A 1GP6A 3KT4A 4CDXC 4OI4A 4AK3A 2WYFA 2Y6JA 4DY3A 5FO7B 4CP9B 4CYDA 1PO23 3ELNA 1SLLA 1YQCA 1MS0A 5FY7A 4Q4X1 4YW5A 3VBHC 1Q5OA 2V73A 1POV0 3AKTA 3EHKA 1QDOA 3OGVA 5F9TA 2BYVE 3HBKA 5JOZA 4M00A 1OFNA 5FYZA 3N9LA 1HB3A 1LEDA 2ZGOA 1K3IA 1ZZ9A 1F2NA 1STMA 2SLIA 4D8MA 4FAGA 3UNPA 1O4TA 1RHI2 2E63A 1WW4A 3N36A 4HMZA 3ALQA 3AYAA 1MS9A 5FJHA 4Q4W3 4D6RA 4W65A 2ZGUA 2VZTA 4FPCA 5F5IA 1UCXA 1ZNPA 4AAPA 1L7RA 3AC0A 4B4QA 4E4DX 1VMJA 4YGCA 5DAWA 5FZ7A 5FP8A 5IVJA 1QJY2 4GH4A 4QX8A 3K75B 2OXBA 3RZKA 4L0PA 2G9FA 2QE3A 5F39A 2VZUA 4RL7A 5EZWA 2JG9C 4CCCA 3TEWA 1JU4A 3H1MA 2GN7A 4Q0QA 4E4ZA 4JGZA 1JOJA 3JCIA 1FXZA 1RUH2 5EYXA 5CKQA 4CDUA 2CYFA 2E32A 2TBVA 5HPOA 2ZEWA 2VZPA 3RZLA 4F8AA 4IETA 1RJ7A 1WMEA 4YZ4A 1MZ6A 4ZKTB 3WF0A 3AKRA 4JTNA 3MW3A 2CAUA 1GZ9A 3OD0A 4XURA 1XQNA 1A8DA 4DFSA 1RUNA 3B9CA 5BY5A 4I2OA 1PNGA 2Y38A 1VRBA 5EXOA 1K45A 4KGQA 3LDKA 3AB0A 2J1TA 1CZTA 1KS4A 1W2AX 1ND2C 1V6LA 4COZA 4RS5A 1UU6A 1RJ8A 2CGOA 4LHSA 2VULA 5IK4A 1O3TA 3JUUA 1SBDA 2BWCA 3J7HA 3O7OA 1VAKA 5IT6A 5A3OA 3K3OA 3GM8A 3AFGA 4NRQA 2ZZQA 1JYXA 1R1ZA 3AX4A 5ABJB 5BNPC 3IAQA 4PIZA 1W6QA 4MHRA 1K5MA 2PHLA 4FPOB 5M0TA 4YW1A 2DYCA 5BNOC 3AFKA 5HCAA 2C1FA 1RUH3 5GZGA 2FDIA 1OSGA 4Y4YA 3N35A 5JIAA 4Z2WA 4YVSC 1KFUL 1OH4A 1Q8SA 2XBO2 3H0OA 2H6CA 2VZSA 4PDWA 3VHPA 1VBC1 5I0TA 2B9VA 1V6IA 5FWJA 5G05L 3NNGA 3DYMA 3NRUA 2GMEA 4HL0A 3RYRA 1V00A 1F5JA 2BPA2 2DVFA 1R091 2LW8A 2KR2A 1UX7A 1W2NA 1S0DA 5DAPA 1GZWB 2WAAA 4MUVA 2BNOA 2OUHA 5I0RA 1ZBA2 3VDDB 4NIDA 3RS6A 1AJOA 4R9DA 4S2DA 3WG2A 1N1TA 2NQYA 1XSQA 5F3IA 4EN0A 3LE0A 2WZR3 4QQ2A 3M3QA 3BI3A 1MZEA 2WT2A 1J58A 1NYWA 1BBT2 4ZHNA 2GC2A 3OG2A 4AI8A 3ZXAC 4JQTA 1TEIA 3FMGA 1DQ1A 2W94A 4IEZA 1XRUA 3I3MA 1G86A 4GJYA 5IAVA 1UMHA 3HWJA 5ACA3 3AKQA 2VW2A 3HD8B 4XZUG 5FZ6A 2F4LA 2IFWA 4FOWA 2XBO3 1EYBA 1G8WA 3K77A 1K5MB 3GZTB 4I0AA 4OI1A 4JVAA 1ST8A 4X6QB 5J7MA 2W1WA 2DUOA 2BGOA 1WCSA 5C3RA 4IESA 2BTVC 2WZEA 1DQ0A 3RGBA 1W6MB 4LULA 1LOBA 2JD9A 4LA3A 5HXVA 1ZRCA 5F6LB 2BU9A 3WEZA 2ZMKA 3RYKA 4XF0A 1KDKA 1N1SA 2CAVA 2YMZA 3H8UA 4NPLA 3WUDA 3WW2A 3ZYJB 2Y26A 3G6JB 3FFZA 1CWPA 1M4WA 2DF7A 2GC1A 3M8LA 1KJLA 3BCWA 1Z0HA 4M0HA 1GLHA 2IXIA 4H3WA 4P00B 3BALA 2D6OX 5H9QA 4QAWA 1D4VB 1AR91 2VNGA 3CMGA 5FY8A 3LEGA 5FP4A 2RVAA 4GJZA 5L19A 1YI7A 3CBNA 4FVVA 2ET1A 2W0XA 4QPGA 4R52A 4Y26A 1RUE1 3D3AA 2V4VA 4IE7A 4Z92B 3KB5A 4BISA 1VPHA 5TSWA 1H2MA 1HN1A 4BJ0A 2XHKA 1UZYA 3ACIA 1JOPA 5KR7A 2GP5A 1B09A 4QPYA 3ACLA 4XDPA 1OF4A 1LHWA 3ATGA 3ME2A 1NKGA 1NY71 1WMXA 2ZGLA 2GN3A 3E5QA 5FPVA 1Q56A 3JBG1 1AYM1 2VNOA 2ID4A 2B8MA 2RS12 1CAUB 2XVKA 1AHSA 2DVAA 1LHOA 2UWBA 2HWB3 1UOJA 4NR1A 4QX7A 4M3CF 4GZ9A 4NOTA 3VUOA 4WVWA 1SG3A 1CPMA 5HV0A 1UD1A 1VBD1 4O9EA 4WM7A 4CUAA 4NIAA 2WFF2 1NE4A 1UL9A 1XYPA 5JSPA 5DDJ2 1PM4A 4KNCA 3NVCA 1YIFA 1W2OA 4QDSA 4DOUA 4NAMA 5ABJC 3AYDA 2QNKA 2AEYA 4AVCA 1PGL1 1GWMA 4LO4B 5F5QA 4IV3A 1RUC1 2D44A 2QQNA 2YV8A 4RGAA 5LBCA 2WZPP 4DIQA 2XLGA 2EIGA 1FAYA 2VU9A 4AWDA 4CU6A 1YUDA 1R1A2 2C26A 1GR3A 4D94A 2YY1A 1JZ4A 4BIOA 4UW5A 1ZRFA 1RXFA 1VLNA 5FIXA 4P02B 1R083 4QKDA 4X8NA 2BVBA 1CPNA 4CCDA 1AR71 1MS8A 1VAMA 1C3HA 1UY3A 3HJRA 1AZDA 3BU0A 2ZX2A 1UF2C 2MPFA 4P9GA 5JZGB 3ZYIB 3FJSA 3R4DB 4E8DA 2VNVA 4XF9A 1NT0A 2WT1A 5K4LA 3SCHA 3T0AA 1W90A 2C5DA 1O91A 3O0XA 3OUJA 2JDAA 3C7FA 4BQ4A 1G9AA 1EAH1 2PMWB 2W87A 3SMHA 2IXHA 1WLWA 2VH9A 1VRH1 1QJX2 1XNTA 2WFF3 3AP9A 5FV3A 5T55A 3VDDC 4ES8A 3VD4A 4AEMA 2A7AA 3OGGA 4CEWA 1QJFA 1GKBA 3NKTA 2RS33 1BHGA 3K4AA 4XABA 3IZOA 1CGPA 4FOYA 1TMF3 4OHYA 3POEA 3UGFA 4IE4A 3O1RA 1R1A3 1IS3A 1COV1 1ND3A 2I45A 1F15A 1UY2A 2P3KA 1DDLA 2BW8A 1AXKA 2JE7A 3AL6A 2GP3A 4E2QA 1K5MC 3E5XA 3OPWA 4COUA 1QMJA 1C8M2 2IXLA 2D6KA 5E1RA 3PLQA 3VBSA 2R061 3AKSA 4YWAA 1AL23 3QOPA 4IUGA 3IMMA 4EWDA 3KWVA 2PTMA 2Y8KA 4XFAA 4CCEA 5FY4A 2RR11 1HRI3 2DVBA 5FPZA 4AEDA 3OGSA 1VBE1 3RMXA 4B8EA 5LW9A 3U14A 2HWD1 4AF9A 2ZGSA 3POBA 5A7QA 3AP5A 1QIQA 1I5PA 5K0UB 4CCNA 1IPKA 3ZYPA 3EYPA 3A0NA 4QHBA 5JMCA 3WZ1A 4IERA 4YZ2A 2CWSA 5A80A 3J8F1 5A3NA 3DN7A 4HETA 5FZFA 1B35A 1GZCA 1CAWA 4IQPA 3AXEA 4XXAA 2UU8A 1SQ4A 3VKLA 1RTVA 1S0BA 2RG4A 2VZOA 2VTFA 2VZVA 4LO6B 5DAXA 4BOWA 1A6CA 4M0NA 1HQNA 2GSYA 3EQEA 4XJWA 4N90A 4H7LA 5FR3A 4LK7A 4K21A 1UMZA 4Q4Y1 2FZ2A 5GKAC 3MLLA 5FUPA 5CFDB 1H2LA 4CXWA 5I8SA 1UYXA 1Q3EA 1W9YA 4HK9A 3AP4A 3AZXA 3MF9A 3NMBA 5FTTC 1JXNA 2ZS6B 3CDZB 1Q8OA 2WN2A 3KS7A 3VBOB 4C1WA 4E8CA 1JYVA 1N1VA 2IXKA 4YVWA 3ZPYA 4HONA 1CR7A 2J22A 5CG8A 1O3SA 4YG0A 2J1VA 5A7SA 2ZAHA 5L7OA 1OA2A 4XCAA 5H9PA 1PVC1 3LD8A 3RDIA 2AGSA 1IQAA 5I8YA 4J1WA 3WP4A 1J1TA 4MLOA 1J3QA 4UAPA 3ZX7A 1UW8A 4QT6A 3E6BA 4K40A 1CD3G 4GD4A 2YBSA 1HDKA 4PQQA 4XYXA 1D4M2 2A71A 1UOBA 5C9AA 2EIBA 4WZCA 4A45A 4WVMA 5C71A 5JOXA 1HB2A 4KWLA 4J1XA 1FOD1 2XR4A 2NPIA 3CZJA 2Y34A 1B35B 4LK6A 4N53B 2VW1A 3SITA 3VZLA 4JDMA 4MO3M 2PAEA 4GWMA 1LOEA 1AR82 3N9PA 2VCBA 2R49A 3MPPG 3LB9A 1RVF1 1UY0A 5JZGC 3M7AA 4COWA 2KD7A 3LSEA 4YLZA 5HCHA 3H50A 1R64A 3MW4A 1S1AA 2WSUA 2Q8CA 5K7PA 1GSLA 1KDMA 1XOYA 4LKEA 3WDYA 1YYNA 2HEVF 4RYDA 2WS92 2VPVA 4NRPA 5FXWA 5KXBA 1MEC1 2GMMA 3LIHA 5F3EA 5L7OB 5JDBA 4MXWA 1W6OA 3VD9A 4HVRA 3N7LA 4QB1A 4A2UA 2HWE3 3I3EA 4CDXA 3WLUA 2DV9A 2P3JA 3N9NA 1Z7S3 3RSJA 2QZ2A 1SHWB 1Q8VA 4FQZA 4E9KA 3DXTA 4Q26A 5KC6A 3WCRA 2E7TA 1UX6A 4YZ3A 2BOIA 2Y6FA 3C3VA 4CVUA 1QEXA 2IVIB 1XNAA 2A3XA 4XXPA 1UPSA 1YNAA 1PO12 4A3XA 1NLQA 2ZX3A 1NLRA 4Y5Z0 1BKZA 3I3QA 3U4SA 1RUD1 2W92A 2VBDA 4ZU4A 4OMDA 2WS93 4UBGA 3WNMA 2CGPA 2IXCA 2J7MA 3VKMA 2BEOA 4QQOA 4ASKA 5CBLA 1GUIA 2VM9A 1YO8A 2JG8A 3PUIA 5K0UC 4GB31 4PIXA 3FBYA 3WHUA 1ZM1A 4CE8A 2XXZA 2PLV2 5ANQA 4KQ7A 3ZSMA 4XDQA 1WBLA 4OYUA 3BPZA 5E8AA 3ZFGB 2XB6C 1X9PA 2XJPA 4Y1ZA 2QQLA 2AZ5A 1W2UA 3J9SA 3R4UA 4EWEA 1CAXB 1BMV1 4EROA 3LPFA 4MGTA 2ZMLA 4L11A 1H8TA 1W6OB 3GBFA 1QF3A 4MXWB 1HXS3 4XJAA 1XBFA 5FYUA 4PBPA 4AW7A 1AUYA 2RJ2A 3DL3A 1H9PA 2BOJA 4H7MA 3X29B 4CRQA 3GCWA 4IE5A 4RD7A 5CFDC 5IVFA 1RC6A 1PO13 3IPVB 2WT0A 5FPLA 3VBOC 2P37A 2WABA 1KS5A 2VZ1A 4JX0A 4NHKA 3U4XA 4IDZA 2DVDA 3PURA 3TN93 4BZ4A 1D2QA 4NROA 4QX1A 3WF4A 3NNMA 3T2QA 5AC92 4ONUA 1YEWA 3WF1A 5JSRA 4QHOA 4LIVA 1UAIA 4BLIA 4D6QA 3AVRA 2QKDA 4OFGA 4L92A 2VVEA 1A34A 3B93A 4JTOA 2YFZA 2YU2A 1UYPA 2RS51 2AR6A 1GQPA
chains in the Genus database with same CATH topology
3AZWA 2GC0A 4K6BA 4MX3A 1BEV2 5I8TA 3RI9A 2XL9A 1RUF3 5J96B 2UY8A 1OMIA 1CQ9A 3M3OA 5CB7A 2Q30A 4XIKA 2Q1ZB 3ZFEB 1OOPB 4N53C 3VZNA 1B35C 3FLTA 3SH5A 3WUCA 3I7DA 1UKGA 1XNBA 2YGMA 1NOVA 1O4ZA 1DQ2A 1EY2A 2ATFA 3ZDSA 3AZYA 2MEV1 2HWF1 2ES3A 3T1LA 4HN0A 1LEMA 1GNZA 1ENQA 4QGLA 2VOXA 3N7KA 4NO4A 1RUI2 2MNGA 1ZYBA 2HWC1 2F4PA 2VMIA 1LOFA 5L7OC 1BJQA 5EFUA 2D3SA 1VR3A 1MQTB 3FWEA 2DURA 3NV3A 3MZHA 5KWRA 3WP6A 3ST7A 5GLUA 3OY8B 4I09A 1FMD1 1FPN1 4JRLA 2PHDA 4Y22A 1RINA 2WQZC 1AR62 1PGSA 4I30A 5FRAA 3CJIB 1MS3A 2R041 2PFWA 4FPLA 1EV12 3ZN5A 5DUXA 4AFCA 4HZFA 4AQ2A 4ASLA 2XLAA 3JD71 1LJ7A 4LHLA 2ZGMA 1V9U2 3LGRA 1RUJ1 4FP3A 1PZ9A 1PGW1 1G6NA 4ITCA 5BNNA 5IK7A 3OCPA 4XTPA 1RUI3 1V70A 3MDPA 2UY9A 2DUPA 2ZBJA 3HR9A 4Q4V1 3SISA 3JB4C 1QQP1 3V56A 1AYN1 2CY6A 4XMIA 4Y1YA 3ZFGC 3ZVXA 1ULEA 4HSJA 3ECQA 1N3QA 3R4SA 2ZACA 4U36A 4CDQA 3CJXA 2VECA 4XF4A 2D3PA 1JH5A 1GQHA 1TME2 4E2GA 4DS0A 2QZ3A 4GXLA 2B42B 3ILFA 5C8CB 3N7JA 5AVPA 3RPQA 1VBB3 1EV13 1MZFA 2PHFA 3CLPA 2VXRA 1PIV3 3AMMA 5IK8A 5LEKA 1V9U3 4Q4X2 2XLFA 3RYPA 3AMHA 4IXLA 1PK6A 5JVVA 3BIWE 1XU1A 5BV6A 3LAGA 1IS5A 2PQQA 3G7DA 2RMU1 3KQRA 4FXGB 4NHMA 4LTAA 1LOCA 1I5ZA 4XQDA 1HW5A 4YFWA 4W6YA 1HRV1 4AGRA 4DQAA 1O7FA 2YGLA 5BNNB 3ILRA 2WL1A 2JJ6A 3HN1A 4IEPA 4YZ5A 2ZPXA 4JRAA 1C4RA 3FFQA 2PAMA 2R071 5FQ0B 1QJU3 2PELA 2ARBA 2WNVA 1JUIA 3ZFEC 1H0BA 1JYCA 2GC3A 4M3CE 2WC2A 3B01A 5CNAA 2A6ZA 4JDOA 1BVVA 4IEUA 3I4IA 1UZZA 2D6MA 2RHPA 4AI0A 3B02A 4Q4X3 4MGKE 4K8FA 4JAAA 4ISRA 5LK5A 1ENXA 5GZFA 4FPGA 5KHHA 4UW3A 3AJYA 1IS4A 4Y1XA 2W39A 3MIFA 3LA7A 4AHYA 2FMDA 2UURA 3D0JA 3CU7A 4WBBA 4JV4A 1SFNA 4P14A 2XGXA 5FPXA 1MQTC 2JECA 2WKKA 1D2SA 1NXD1 1URXA 2ZX1A 1ULGA 5C33A 1WW6A 4P9IA 2ZHKA 2XL7A 1UIJA 2TNFA 3ZXGA 2Q0AA 1RMU3 2D6PA 4Q0SA 4L2NA 1FV3A 2GMPA 2Q5TA 3CJIC 4K9SA 4CDWB 2I2SA 2XWBB 1QDCA 1JW6A 2E53A 3VN4A 1AJKA 3VBFA 5KHJA 2W52A 1DZRA 3GALA 1VBC2 3AXDA 1HV0A 4R9BA 3BU7A 3VBUB 2E7AA 2WIIB 1N47A 4EJRA 1FYUA 1A78A 4TZDA 5GZDA 1R092 1H1MA 1FI2A 4XEZA 3ZYGA 1WGPA 1ZZ6A 1A3KA 2P2KA 1QOTA 1SCRA 4Z82A 5FO8B 2YZ4A 3S6PA 2G4IA 1REEA 1RHI3 2GAUA 4Q0PA 3RQ0A 3S7IA 1LOAA 3WD5A 4LBKA 5C8CC 5HBAA 1NG0A 5JCTA 3TAYA 2Z79A 1IKQA 3GBWA 3D6EA 2KA3A 2ZGKA 3VKFC 3NO8A 2O1QA 3OGJA 4FO9A 1QJY3 4IEWA 2E9QA 4XILA 3AJZA 5A33A 2O8OA 3AMPA 2JENA 1XNKA 2O8QA 3BOPA 3NWKA 1I6XA 1U5IA 5JOYA 1QKQA 1VAVA 1R093 3VBFB 3TYJA 4GH4B 1KJRA 5BNNC 5BXXA 4BM8A 2CGNA 1IHMA 4JGZB 3SXWA 4CDUB 3FC0A 5C8WA 1PHMA 3W58A 1AR92 4X8PA 3VKOA 4XBQA 2BUKA 4XFFA 2W68A 1GICA 3ZSLA 1RUE2 5AVAA 2OZ6A 3ES4A 4MSVA 4DB5A 2D98A 2ZX4A 2FQPA 3FE5A 4BWOA 4OHXA 1FNZA 4NN0A 2VW0A 5FAXA 4MXVA 5K9YA 2WSVA 3LKJA 4Q1PA 3UV9A 4RS5B 2QQPA 1RUOA 4LBQD 3R0RA 2VG9A 4YYOA 4ASMB 4V1PA 1NY72 2DU1A 5I0SA 1NCQA 3IDEA 1NQDA 3DGTA 2A5ZA 1W39A 4FSJA 1W6QB 4OUSA 4FTEA 3L2YA 2WNUA 1QNYA 4EN6B 2D5HA 1VBD2 1S0GA 1KQRA 2H0BA 5DXDA 4AEJA 3B5LB 3AZZA 2VQ0A 3KCCA 1NA1A 1RL3A 2DCJA 3MW2A 4PDWB 4AVAA 3IBMA 3QH7A 3RG0A 1PGL2 1RUE3 1DBNA 3ASIA 1C1LA 3VBRA 1ZBA3 1RUC2 4CDWC 5JLVA 3H1WA 4AFBA 3U10A 2WA3A 2VQAA 3L9JT 2WZR1 2XPJA 1BBT3 3QACA 4WM8A 3SCGA 4YFZA 2DVGA 1G7YA 3KM5A 3RJ2X 5CADA 1AR72 2NYYA 4N7IA 3VBUC 3AMNA 4MGIE 5KBFA 1C8NA 3WDUA 5ACA1 1YWKA 4QPIA 3POYA 1G9FA 1EAH2 4D7TA 1VBD3 4DY5A 1WLDA 2EXJA 3WP3A 1VRH2 4HKOA 1UPIA 4LO8A 3A0KA 3WT3A 4D69A 1ALYA 1JTZX 2WNUB 3O0WA 4XE9A 1HIXA 4YRDA 1C5HA 3JQXA 1RUC3 2EALA 3RNSA 1SLTA 4Q0VA 1GNHA 1COV2 1HV1A 2ZX0A 1X50A 4IV1A 1FX5A 1YIPA 3O12A 2OYZA 2YC0A 2A70A 1AR73 4BPZA 2YROA 1V6KA 2R062 3VBFC 3FLRA 4GKXA 4Q1RA 2CTVA 2RR12 4GH4C 4C90A 4QPGB 1DQ4A 3CEWA 2HWD2 1LODA 2BVVA 3TB0A 4JGZC 4OUMA 3FBMA 4LO7A 4CDUC 5FFOC 2DCYA 2RS13 1XNCA 5GLVA 3VV1A 4AQ6A 1SLCA 3Q9OA 3VZOA 1WW5A 2B7YA 1DZQA 3J8F2 1BCXA 4NHLA 5FLIA 2HWB1 5H9RA 5EV7A 3NSTA 5FLHA 4A7KA 5CFCA 1YJLA 4YGBA 1COV3 4LE4A 1QWRA 2YPJA 5DDJ3 2E7QA 1YXWA 2RM21 4N43A 4XBLA 3AM2A 3B69A 3UJQA 4XF3A 3O14A 2ZGNA 3APBA 4RS5C 4Q4Y2 4IEQA 4YM0A 4WM7B 3PJQA 4R8HA 4LBQA 2X5IA 5JSOA 4I3PA 1NLSA 4XW3A 2RJLA 4HK8A 2JD4A 3JQWA 2LUWA 3HT2A 4KWKA 3I59A 2C0ZA 2A6VA 5KXCA 4IV3B 2VMHA 1JYIA 1R081 4LHNA 1POV1 1CX4A 4OLLA 1XE7A 1PVC2 3VHOA 2D7FA 3WXPA 2CNAA 1O4YA 2ETEA 2CV6A 4Y20A 1RUG2 4PDWC 4W6WA 1LHNA 1YRZA 2ZZJA 1QJX3 2WFF1 3M3CA 3ZO0B 4KG0A 1LKNA 1U12A 2NMNA 1F9KA 1FOD2 1MZ5A 2UYAA 3MEPA 1N3PA 2RS31 4Q4Y3 4C0BA 4QQPA 2D93A 1CVNA 1OLQA 1I9RA 1TMF1 4CEWB 1RVF2 2K0GA 4I02A 1ULFA 2VOWA 4FPYA 4XF1A 4Y1VA 1LGCA 2X5IB 1C8M3 5CU1A 1APNA 2PHRA 1ND3B 2DCKA 4AI3A 4NWWA 3A4UA 1NCRA 4AE2A 3TNPB 1AL21 1RUG3 4F3JA 2WNUC 3AYEA 1HRI1 3VBSB 2ZTNA 3ZFFA 4E27A 1S0IA 1AX0A 4ZXKA 3SH4A 4DXZA 2AENA 1ZVFA 4AEDB 5F6KA 1S0CA 1FNYA 1MACA 1LULA 3OTFA 5BNQA 2ZKNA 3DV8A 5J48A 4FPFA 3MGUA 1DGLA 4XMAA 3WOGA 2VUJA 4YW3A 3C2UA 1Q8QA 1JUHA 4M01A 2XH6A 1XYNA 1RUD2 4JGYA 4Q0UA 4L99A 4YARA 1X36A 1QY4A 4QPGC 1CAWB 1VB2A 2RJKA 4GMP0 1VBA2 4EN7B 3B00A 4MYEA 1SDWA 3KT1A 4GB32 4S2FA 1AVBA 3WINE 3GYDA 1MS5A 1ZZBA 1TQ5A 1YFXA 2D97A 1NQJA 1NE6A 1C5IA 1BQPA 1GV9A 3VKNA 1C28A 4XIOA 5J36A 5CAZA 2NP0A 4RQPA 1G9BA 1BMV2 3B7MA 4YVWB 2BWAA 1OI6A 3NAPA 4M3CA 2NLRA 1VP6A 2XUMA 5GLZA 2GZWA 3WX5A 1M06G 1W0PA 4WM7C 4YW4A 1D4M3 1LGBA 4RR3A 1OFSA 1U5ZA 1LU1A 4KG8A 3M3EA 3IDCB 2OW4A 2YUEA 5AFBA 3TWIA 1NXMA 4LT5A 2ZHMA 1GYKA 4IV3C 1AR83 1VBA3 1LR5A 4XPVA 5C9AB 2VGDA 3JZVA 4D3WA 4WVMB 2H0VA 3HBZA 4NWVA 5IUQA 2GNTA 4JGYB 4ATFA 1OPOA 4Y24A 2RS52 4HKLA 1QGLA 4W6XA 3S7EA 2Q8OA 3H3UA 3RRDA 1PZ7A 4AFMA 2KXLA 4LA2A 3WQ7A 4Y1UA 1QH7A 4XFGA 4AQSA 1ASJ1 2DTYA 1S55A 4MZUA 3JB8A 5T54A 4JQRA 4DPNA 4K3UA 2R0FA 2HWE1 4HFSA 4CEWC 1H4GA 3USUA 4LR4A 5DG1A 1MR5A 2VOKA 2VOVA 1YHFA 1Z7S1 2LTNA 4Q2FA 3ZSJA 1HX6A 2MEV2 2X5IC 4RR3B 4N9HA 4CDXB 3TOJA 4PJYA 1ENSA 1ND3C 4FTSA 1WLCA 4TWTA 4P9JA 1CN1A 4UW6A 3MIHA 1SBEA 2RS53 2UWCA 1W6PA 1GFF2 5CVRA 1Y9QA 3VBSC 2D3RA 1WBFA 3LSDA 3AYCA 1EP0A 2C9AA 3VLBB 3IM0A 3SHRA 4COYA 2Y0IA 3VGIA 3WDVA 4AEDC 2PLV3 1FMD2 1FPN2 1KITA 2GH8A 4OI2A 4Z8BA 2EXIA 1IS6A 3ZN4A 1OLRA 3L2HA 3P3NA 4DMIA 3BTAA 2ZHLA 3W9AA 2JG8B 2R042 4URTA 4WV8A 4BE3A 4RFT0 4QGNA 3JD72 3CL1A 1RUJ2 1HXS1 2PAKA 5T5OA 4BHPA 1S0EA 1PGW2 4I01A 1U5YA 3VBHA 1QOSA 3DKWA 1EPWA 4K7JA 2VVDA 4OULA 4ZU5A 3WW1A 4YSFA 2BFUS 3GHMA 3SLIA 1H8TB 1TE1B 3FHIB 5D1IA 2CWMA 4S2HA 3R6SA 4Q4V2 1LHVA 1QQP2 4A7ZA 3ZN6A 2OA2A 3TN91 1H30A 4BQ1A 5AC93 3MIGA 1FATA 1WCKA 1NZCA 4FOQA 3WDXA 2R16A 4YVWC 3V0AA 5T50A 1W6PB 1JHNA 4BH9A 1CAVA 4DRVA 4GIQA 3KT7A 2R30A 1DF0A 1BEV3 1X33A 4LUKA 2FMYA 2R043 4SBVA 3UL2A 1RUF1 3PVOA 2JG9A 1OHFA 4B29A 2LM3A 2IC1A 3EBRA 3W59A 2GALA 2FBEA 1RUJ3 2NMOA 2R1DA 3RMYA 1A8MA 1MVEA 4RHV1 3MIEA 4QQHA 2RMU2 5C9AC 3OYWA 5T5JA 3H7YA 4JGYC 1HRV2 4KL1A 4Q4V3 1WUVA 4FBFA 5DZFA 5DUUA 4COVA 2A73B 4C91A 4TLFA 2ZGTA 2VMGA 4AQTA 5A32A 3K51A 4N7UA 1ND2A 1S0JA 4KGGA 2XJVA 2PA7A 2R072 2BNMA 4P9LA 3AK0A 5GZCA 4FPHA 3PVEA 1ONAA 2PHTA 2B46X 1H2KA 1Q8PA 4P9YA 4QD2A 4AYUA 2YDEA 5BNPA 2XKPA 1F5FA 4F83A 5KXEA 3IDBB 1CAVB 5BNOA 5JI7A 5A3LA 3RZZA 4KBBA 4K1YA 4LO5B 4YVSA 1AX2A 3MICA 5BPXA 4RR3C 1MS1A 1OQEA 1AR63 5D8AA 4AI1A 4CDXC 2XJUA 2X29A 1DGWX 4GMP3 4HBNA 5SV8A 4AVBA 4P9WA 4XQ4A 1ZZ7A 4H14A 2EAKA 3M3IA 5FMOS 1Q43A 1QNWA 1DG6A 1S2BA 4Y22B 3MI8A 3KLSA 2PYTA 2GNBA 1X7NA 5FDBA 2K9ZA 1VALA 1IOAA 2R073 4LUMA 3ZSEA 5I93A 1VIWB 3S0MA 3WG3A 1DIWA 4WZFA 3V64A 1WMDA 3E6CC 1ZBE1 4L9BA 4PLMA 4EN8B 3FZ3A 4MVTA 1SLIA 5HI0A 1LU2A 2JG8C 1W0OA 2P3IA 2IXJA 1CIWA 1V6NA 3U11A 1TME3 4AGGA 2GDFA 2DWRA 1YLLA 3AKPA 1WD3A 1OA3A 1PM7A 2HEWF 1G9CA 2PHWA 2I07B 3CO2A 4ISQA 4CDQB 5C6CA 3WHTA 4IEXA 1VBB1 5CIRA 3PVNA 1H8TC 3RI8A 1PIV1 4JC1A 4XJZA 5T5PA 3WP5A 5D8AB 3IN9A 1V9U1 3WG1A 1RIRA 3H3ZA 3B3QE 1WD4A 4FPJA 2VNRA 3ZMOA 1UU5A 3OF1A 2N7GA 3NV4A 3AP6A 3I8TA 1PK6B 2D6LX 1S2KA 4BYYA 4H55A 3RJRA 1CJPA 1SCSA 2Z5WA 5JIUA 1MS4A 1BYHA 3EXUA 2OVUA