2YXUA

Human pyridoxal kinase
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
310
structure length
306
Chain Sequence
EECRVLSIQSHVIRGYVGNRAATFPLQVLGFEIDAVNSVQFSNHTGYAHWKGQVLNSDELQELYEGLRLNNMNKYDYVLTGYTRDKSFLAMVVDIVQELKQQNPRLVYVCDPVLGDKWDGEGSMYVPEDLLPVYKEKVVPLADIITPNQFEAELLSGRKIHSQEEALRVMDMLHSMGPDTVVITSSDLPSPQGSNYLIVLGSQRRGSVVMERIRMDIRKVDAVFVGTGDLFAAMLLAWTHKHPNNLKVACEKTVSTLHHVLQRTIQCAKAQAGEGVRPSPMQLELRMVQSKRDIEDPEIVVQATVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of human pyridoxal kinase: structural basis of M(+) and M(2+) activation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Pyridoxal kinase
total genus 102
structure length 306
sequence length 310
chains with identical sequence B
ec nomenclature ec 2.7.1.35: Pyridoxal kinase.
pdb deposition date 2007-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08543 Phos_pyr_kin Phosphomethylpyrimidine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1190.20 Alpha Beta 3-Layer(aba) Sandwich UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 2yxuA00
3CQDA 3IE7A 4E69A 3IH0A 2QHPA 5B6AA 3RTBA 1VI9A 4KAHA 5CM5A 1RKDA 3K9EA 4XCKA 4X8FA 4C5LA 3H49A 1BX4A 3NL3A 1V1BA 1WYEA 2RBCA 3RSFA 3B1PA 3H74A 5COJA 3LKIA 4C5JA 1GC5A 3I3YA 3NL6A 3DRWA 2C49A 4E8WA 4LC4A 1TZ6A 3RU3A 1RFUA 3B1NA 3RTEA 3RU2A 1V1AA 5BYEA 1JXIA 3IKHA 4DU5A 1YHJA 4O1LA 1GQTA 1YGKA 2XTBA 3GO7A 3RQ8A 1KYHA 1VK4A 5BYCA 5C40A 2F7KA 2R3EA 3KTNA 3LHXA 3UMPA 4S1IA 2AB8A 2AFBA 3LJSA 4N08A 3RQQA 3RTAA 4EOHA 3UQDA 1LHPA 4K8TA 4C5MA 2DDOA 3B1QA 1EKKA 1YGJA 2ABQA 2PKKA 3NM3A 4LBGA 1LIOA 2VARA 3RPHA 3RSGA 3OTXA 4C5KA 4E84A 2PKFA 3NL5A 3RTGA 3QA2A 5CGEA 5BYFA 1LIIA 3UMOA 4C5NA 3UQ9A 3RQ5A 2R3BA 5TRWA 2I6AA 3RTDA 3RO4A 3RRFA 4EBUA 3HICA 2DDWA 2I6BA 1LIKA 1RFTA 1TD2A 3HPDA 3NL2A 4K8PA 5CGAA 1EKQA 2QCVA 2F02A 2AWDA 5C3YA 1LIJA 2JGVA 3PL2A 2DDMA 4KBEA 2AJRA 1VM7A 3EWMA 2YXTA 4WJMA 3B1OA 3GBUA 1V1SA 3RY7A 2AJPA 4LBXA 4KANA 4S1MA 2V78A 3PZSA 3RT7A 2JG1A 2I5BA 4XF7A 3RRBA 1RK2A 3Q1YA 1UA4A 1JXHA 2A9ZA 3IQ0A 3MBHA 2C4EA 3MBJA 4YL5A 1ESJA 3N1CA 4S1IB 4UBEA 5F0ZA 3ZS7A 4B8SA 5C41A 2JG5A 2AA0A 3B1RA 4E3AA 1L2LA 3FHXA 3NC2A 3VASA 1RKSA 5F11A 2NWHA 2HQQA 3B3LA 5EYNA 2HLZA 4JJPA 4JKUA 4JKSA 4DC3A 3RQ2A 3IBQA 1UB0A 4K93A 4E8ZA 4GM6A 3BF5A 3BGKA 3RQXA 3RSQA 5BYDA 4K8KA 3RM5A 3KEUA 1ESQA 2PKNA 5EY7A 3UBOA 5TQIA 3W4SA 4B8RA 4KALA 3RQHA 3RSSA 2YXUA 1V19A 4K9CA 3UQEA 3Q92A 3JULA 3RREA 3HYOA 1C3QA 1RFVA 4K9IA 3RTCA 4K8CA 3IN1A 5C3ZA 2AX3A 3KD6A 3KZHA 1TYYA 2Q5RA 3NBWA 4XDAA 4YWRA 4PVVA 3NC9A 3LOOA 2DCNA 3RS9A 4E8YA 2HW1A 3GO6A 3NM1A 1LHRA 2ABSA 1TZ3A 3NCAA 4N09A 3VAQA 4S1HA 4O1GA 2PKMA 1DGMA 3RPZA 3DZVA 3QAIA 4KADA 3RQ6A 2A9YA 3K5WA 3NBVA 3RS8A 4EN4A 3FHYA 3UQ6A 4LCAA 4U7XA 4XF6A 3RRJA 2FV7A 3RT9A 4EUMA 1U2XA 1RKAA
chains in the Genus database with same CATH superfamily
1GG4A 2Y68A 3CQDA 3IE7A 4E69A 2VTEA 2Y1OA 3IH0A 2QHPA 5B6AA 3RTBA 1VI9A 4KAHA 5CM5A 1RKDA 3K9EA 1O5ZA 4XCKA 2XPCA 3ZM5A 4X8FA 4C5LA 2X5OA 1GQQA 3H49A 1BX4A 3NL3A 1V1BA 1WYEA 2RBCA 3RSFA 3B1PA 2GC6A 3H74A 3ZL8A 5COJA 3LKIA 4C5JA 3UQDA 1GC5A 3I3YA 1P3DA 3DRWA 3NL6A 4CVMA 2C49A 3PYZA 3HN7A 4E8WA 4LC4A 1TZ6A 3RU3A 5A5EA 1RFUA 3B1NA 3RTEA 3RU2A 1V1AA 5BYEA 1JXIA 3IKHA 4BUBA 4DU5A 1YHJA 4O1LA 1GQTA 2Y67A 3NRSA 1YGKA 1W7KA 2XTBA 3GO7A 3RQ8A 1KYHA 1VK4A 3EAGA 5BYCA 5C40A 2F7KA 2R3EA 3KTNA 3LHXA 3UAGA 3UMPA 3HJ6A 4B8RA 4CVLA 2JFGA 2AB8A 2AFBA 3LJSA 4N08A 1JBVA 2UUOA 3N2AA 4S1IA 4UAGA 1LHPA 4K8TA 4C5MA 2DDOA 3B1QA 4EOHA 1EKKA 1YGJA 2ABQA 2PKKA 3NM3A 4LBGA 1LIOA 2VARA 3RPHA 3RSGA 3OTXA 2AM2A 4E84A 2PKFA 3NL5A 3RTGA 3QA2A 5CGEA 5BYFA 1FGSA 1LIIA 3UMOA 4C5NA 3UQ9A 3RQ5A 2F00A 2R3BA 5TRWA 2I6AA 3RTDA 3RO4A 3RRFA 4EBUA 3HICA 1P31A 2DDWA 2I6BA 2GCAA 1J6UA 1LIKA 1RFTA 1TD2A 3HPDA 3NL2A 4K8PA 5CGAA 4HV4A 1EKQA 2QCVA 1E0DA 2F02A 2AWDA 5C3YA 1LIJA 2JFFA 2JGVA 3PL2A 2DDMA 2VTDA 2AJRA 1VM7A 3QCZA 3EWMA 4KBEA 2YXTA 3RTAA 4WJMA 3B1OA 3GBUA 1V1SA 3RY7A 2AJPA 4LBXA 4KANA 4S1MA 2V78A 3PZSA 4QF5A 3RT7A 2JG1A 2I5BA 2GCBA 4XF7A 3RRBA 1RK2A 3Q1YA 2Y66A 1UA4A 1JXHA 2A9ZA 3IQ0A 3MBHA 2C4EA 3MBJA 4YL5A 1ESJA 3N1CA 4S1IB 4UBEA 5F0ZA 2GC5A 5A5FA 3ZS7A 4B8SA 5C41A 3RQQA 2JG5A 2AA0A 3B1RA 4C13A 2WJPA 4E3AA 1L2LA 4C12A 3FHXA 2WTZA 3NC2A 3VASA 1RKSA 5F11A 2NWHA 2HQQA 3B3LA 5EYNA 2HLZA 3LK7A 4JJPA 4JKUA 4BUCA 4JKSA 4DC3A 4ZIYA 3RQ2A 3IBQA 1UB0A 4K93A 4E8ZA 4GM6A 3BF5A 3BGKA 4QDIA 3RQXA 1GQYA 3RSQA 5BYDA 4K8KA 3RM5A 3KEUA 2AM1A 1ESQA 2PKNA 2UUPA 5EY7A 5TQIA 1E8CA 4KALA 3RQHA 3RSSA 2YXUA 3W4SA 4CVKA 1V19A 4K9CA 3UQEA 4C5KA 2XJAA 3Q92A 3JULA 3RREA 3HYOA 1C3QA 1RFVA 4K9IA 3UBOA 2UAGA 3RTCA 4K8CA 3IN1A 5C3ZA 2AX3A 3KD6A 3KZHA 1TYYA 2Q5RA 3NBWA 4XDAA 4YWRA 4PVVA 3NC9A 2VOSA 2DCNA 3LOOA 3RS9A 4E8YA 1W78A 2VORA 1JBWA 2HW1A 3GO6A 3NM1A 1LHRA 2ABSA 1TZ3A 3NCAA 4N09A 3VAQA 1EEHA 4S1HA 4O1GA 2PKMA 1DGMA 3RPZA 3DZVA 3QAIA 4KADA 3RQ6A 2A9YA 3K5WA 3NBVA 3RS8A 3ZM6A 4EN4A 3FHYA 3UQ6A 4LCAA 4U7XA 4XF6A 3RRJA 2FV7A 3RT9A 2JFHA 4EUMA 1UAGA 1U2XA 1RKAA
chains in the Genus database with same CATH topology
3CQDA 3IE7A 4E69A 3IH0A 2QHPA 5B6AA 3RTBA 1VI9A 4KAHA 5CM5A 1RKDA 3K9EA 4XCKA 4X8FA 4C5LA 3H49A 1BX4A 3NL3A 1V1BA 1WYEA 2RBCA 3RSFA 3B1PA 3H74A 5COJA 3LKIA 4C5JA 1GC5A 3I3YA 3NL6A 3DRWA 2C49A 4E8WA 4LC4A 1TZ6A 3RU3A 1RFUA 3B1NA 3RTEA 3RU2A 1V1AA 5BYEA 1JXIA 3IKHA 4DU5A 1YHJA 4O1LA 1GQTA 1YGKA 2XTBA 3GO7A 3RQ8A 1KYHA 1VK4A 5BYCA 5C40A 2F7KA 2R3EA 3KTNA 3LHXA 3UMPA 3HJ6A 4S1IA 2AB8A 2AFBA 3LJSA 4N08A 3RQQA 3RTAA 4EOHA 3UQDA 1LHPA 4K8TA 4C5MA 2DDOA 3B1QA 1EKKA 1YGJA 2ABQA 2PKKA 3NM3A 4LBGA 1LIOA 2VARA 3RPHA 3RSGA 3OTXA 4C5KA 4E84A 2PKFA 3NL5A 3RTGA 3QA2A 5CGEA 5BYFA 1LIIA 3UMOA 4C5NA 3UQ9A 3RQ5A 2R3BA 5TRWA 2I6AA 3RTDA 3RO4A 3RRFA 4EBUA 3HICA 2DDWA 2I6BA 1LIKA 1RFTA 1TD2A 3HPDA 3NL2A 4K8PA 5CGAA 1EKQA 2QCVA 2F02A 2AWDA 5C3YA 1LIJA 2JGVA 3PL2A 2DDMA 4KBEA 2AJRA 1VM7A 3EWMA 2YXTA 4WJMA 3B1OA 3GBUA 1V1SA 3RY7A 2AJPA 4LBXA 4KANA 4S1MA 2V78A 3PZSA 3RT7A 2JG1A 2I5BA 4XF7A 3RRBA 1RK2A 3Q1YA 1UA4A 1JXHA 2A9ZA 3IQ0A 3MBHA 2C4EA 3MBJA 4YL5A 1ESJA 3N1CA 4S1IB 4UBEA 5F0ZA 3ZS7A 4B8SA 5C41A 2JG5A 2AA0A 3B1RA 4E3AA 1L2LA 3FHXA 3NC2A 3VASA 1RKSA 5F11A 2NWHA 2HQQA 3B3LA 5EYNA 2HLZA 4JJPA 4JKUA 4JKSA 4DC3A 3RQ2A 3IBQA 1UB0A 4K93A 4E8ZA 4GM6A 3BF5A 3BGKA 3RQXA 3RSQA 5BYDA 4K8KA 3RM5A 3KEUA 1ESQA 2PKNA 5EY7A 3UBOA 5TQIA 3W4SA 4B8RA 4KALA 3RQHA 3RSSA 2YXUA 1V19A 4K9CA 3UQEA 3Q92A 3JULA 3RREA 3HYOA 1C3QA 1RFVA 4K9IA 3RTCA 4K8CA 3IN1A 5C3ZA 2AX3A 3KD6A 3KZHA 1TYYA 2Q5RA 3NBWA 4XDAA 4YWRA 4PVVA 3NC9A 3LOOA 2DCNA 3RS9A 4E8YA 2HW1A 3GO6A 3NM1A 1LHRA 2ABSA 1TZ3A 3NCAA 4N09A 3VAQA 4S1HA 4O1GA 2PKMA 1DGMA 3RPZA 3DZVA 3QAIA 4KADA 3RQ6A 2A9YA 3K5WA 3NBVA 3RS8A 4EN4A 3FHYA 3UQ6A 4LCAA 4U7XA 4XF6A 3RRJA 2FV7A 3RT9A 4EUMA 1U2XA 1RKAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CQD A;  3IE7 A;  4E69 A;  3IH0 A;  2QHP A;  5B6A A;  3RTB A;  1VI9 A;  4KAH A;  5CM5 A;  1RKD A;  3K9E A;  4XCK A;  4X8F A;  4C5L A;  3H49 A;  1BX4 A;  3NL3 A;  1V1B A;  1WYE A;  2RBC A;  3RSF A;  3B1P A;  3H74 A;  5COJ A;  3LKI A;  4C5J A;  1GC5 A;  3I3Y A;  3NL6 A;  3DRW A;  2C49 A;  4E8W A;  4LC4 A;  1TZ6 A;  3RU3 A;  1RFU A;  3B1N A;  3RTE A;  3RU2 A;  1V1A A;  5BYE A;  1JXI A;  3IKH A;  4DU5 A;  1YHJ A;  4O1L A;  1GQT A;  1YGK A;  2XTB A;  3GO7 A;  3RQ8 A;  1KYH A;  1VK4 A;  5BYC A;  5C40 A;  2F7K A;  2R3E A;  3KTN A;  3LHX A;  3UMP A;  4S1I A;  2AB8 A;  2AFB A;  3LJS A;  4N08 A;  3RQQ A;  3RTA A;  4EOH A;  3UQD A;  1LHP A;  4K8T A;  4C5M A;  2DDO A;  3B1Q A;  1EKK A;  1YGJ A;  2ABQ A;  2PKK A;  3NM3 A;  4LBG A;  1LIO A;  2VAR A;  3RPH A;  3RSG A;  3OTX A;  4C5K A;  4E84 A;  2PKF A;  3NL5 A;  3RTG A;  3QA2 A;  5CGE A;  5BYF A;  1LII A;  3UMO A;  4C5N A;  3UQ9 A;  3RQ5 A;  2R3B A;  5TRW A;  2I6A A;  3RTD A;  3RO4 A;  3RRF A;  4EBU A;  3HIC A;  2DDW A;  2I6B A;  1LIK A;  1RFT A;  1TD2 A;  3HPD A;  3NL2 A;  4K8P A;  5CGA A;  1EKQ A;  2QCV A;  2F02 A;  2AWD A;  5C3Y A;  1LIJ A;  2JGV A;  3PL2 A;  2DDM A;  4KBE A;  2AJR A;  1VM7 A;  3EWM A;  2YXT A;  4WJM A;  3B1O A;  3GBU A;  1V1S A;  3RY7 A;  2AJP A;  4LBX A;  4KAN A;  4S1M A;  2V78 A;  3PZS A;  3RT7 A;  2JG1 A;  2I5B A;  4XF7 A;  3RRB A;  1RK2 A;  3Q1Y A;  1UA4 A;  1JXH A;  2A9Z A;  3IQ0 A;  3MBH A;  2C4E A;  3MBJ A;  4YL5 A;  1ESJ A;  3N1C A;  4S1I B;  4UBE A;  5F0Z A;  3ZS7 A;  4B8S A;  5C41 A;  2JG5 A;  2AA0 A;  3B1R A;  4E3A A;  1L2L A;  3FHX A;  3NC2 A;  3VAS A;  1RKS A;  5F11 A;  2NWH A;  2HQQ A;  3B3L A;  5EYN A;  2HLZ A;  4JJP A;  4JKU A;  4JKS A;  4DC3 A;  3RQ2 A;  3IBQ A;  1UB0 A;  4K93 A;  4E8Z A;  4GM6 A;  3BF5 A;  3BGK A;  3RQX A;  3RSQ A;  5BYD A;  4K8K A;  3RM5 A;  3KEU A;  1ESQ A;  2PKN A;  5EY7 A;  3UBO A;  5TQI A;  3W4S A;  4B8R A;  4KAL A;  3RQH A;  3RSS A;  2YXU A;  1V19 A;  4K9C A;  3UQE A;  3Q92 A;  3JUL A;  3RRE A;  3HYO A;  1C3Q A;  1RFV A;  4K9I A;  3RTC A;  4K8C A;  3IN1 A;  5C3Z A;  2AX3 A;  3KD6 A;  3KZH A;  1TYY A;  2Q5R A;  3NBW A;  4XDA A;  4YWR A;  4PVV A;  3NC9 A;  3LOO A;  2DCN A;  3RS9 A;  4E8Y A;  2HW1 A;  3GO6 A;  3NM1 A;  1LHR A;  2ABS A;  1TZ3 A;  3NCA A;  4N09 A;  3VAQ A;  4S1H A;  4O1G A;  2PKM A;  1DGM A;  3RPZ A;  3DZV A;  3QAI A;  4KAD A;  3RQ6 A;  2A9Y A;  3K5W A;  3NBV A;  3RS8 A;  4EN4 A;  3FHY A;  3UQ6 A;  4LCA A;  4U7X A;  4XF6 A;  3RRJ A;  2FV7 A;  3RT9 A;  4EUM A;  1U2X A;  1RKA A; 
#chains in the Genus database with same CATH topology
 1GG4 A;  2Y68 A;  3CQD A;  3IE7 A;  4E69 A;  2VTE A;  2Y1O A;  3IH0 A;  2QHP A;  5B6A A;  3RTB A;  1VI9 A;  4KAH A;  5CM5 A;  1RKD A;  3K9E A;  1O5Z A;  4XCK A;  2XPC A;  3ZM5 A;  4X8F A;  4C5L A;  2X5O A;  1GQQ A;  3H49 A;  1BX4 A;  3NL3 A;  1V1B A;  1WYE A;  2RBC A;  3RSF A;  3B1P A;  2GC6 A;  3H74 A;  3ZL8 A;  5COJ A;  3LKI A;  4C5J A;  3UQD A;  1GC5 A;  3I3Y A;  1P3D A;  3DRW A;  3NL6 A;  4CVM A;  2C49 A;  3PYZ A;  3HN7 A;  4E8W A;  4LC4 A;  1TZ6 A;  3RU3 A;  5A5E A;  1RFU A;  3B1N A;  3RTE A;  3RU2 A;  1V1A A;  5BYE A;  1JXI A;  3IKH A;  4BUB A;  4DU5 A;  1YHJ A;  4O1L A;  1GQT A;  2Y67 A;  3NRS A;  1YGK A;  1W7K A;  2XTB A;  3GO7 A;  3RQ8 A;  1KYH A;  1VK4 A;  3EAG A;  5BYC A;  5C40 A;  2F7K A;  2R3E A;  3KTN A;  3LHX A;  3UAG A;  3UMP A;  3HJ6 A;  4B8R A;  4CVL A;  2JFG A;  2AB8 A;  2AFB A;  3LJS A;  4N08 A;  1JBV A;  2UUO A;  3N2A A;  4S1I A;  4UAG A;  1LHP A;  4K8T A;  4C5M A;  2DDO A;  3B1Q A;  4EOH A;  1EKK A;  1YGJ A;  2ABQ A;  2PKK A;  3NM3 A;  4LBG A;  1LIO A;  2VAR A;  3RPH A;  3RSG A;  3OTX A;  2AM2 A;  4E84 A;  2PKF A;  3NL5 A;  3RTG A;  3QA2 A;  5CGE A;  5BYF A;  1FGS A;  1LII A;  3UMO A;  4C5N A;  3UQ9 A;  3RQ5 A;  2F00 A;  2R3B A;  5TRW A;  2I6A A;  3RTD A;  3RO4 A;  3RRF A;  4EBU A;  3HIC A;  1P31 A;  2DDW A;  2I6B A;  2GCA A;  1J6U A;  1LIK A;  1RFT A;  1TD2 A;  3HPD A;  3NL2 A;  4K8P A;  5CGA A;  4HV4 A;  1EKQ A;  2QCV A;  1E0D A;  2F02 A;  2AWD A;  5C3Y A;  1LIJ A;  2JFF A;  2JGV A;  3PL2 A;  2DDM A;  2VTD A;  2AJR A;  1VM7 A;  3QCZ A;  3EWM A;  4KBE A;  2YXT A;  3RTA A;  4WJM A;  3B1O A;  3GBU A;  1V1S A;  3RY7 A;  2AJP A;  4LBX A;  4KAN A;  4S1M A;  2V78 A;  3PZS A;  4QF5 A;  3RT7 A;  2JG1 A;  2I5B A;  2GCB A;  4XF7 A;  3RRB A;  1RK2 A;  3Q1Y A;  2Y66 A;  1UA4 A;  1JXH A;  2A9Z A;  3IQ0 A;  3MBH A;  2C4E A;  3MBJ A;  4YL5 A;  1ESJ A;  3N1C A;  4S1I B;  4UBE A;  5F0Z A;  2GC5 A;  5A5F A;  3ZS7 A;  4B8S A;  5C41 A;  3RQQ A;  2JG5 A;  2AA0 A;  3B1R A;  4C13 A;  2WJP A;  4E3A A;  1L2L A;  4C12 A;  3FHX A;  2WTZ A;  3NC2 A;  3VAS A;  1RKS A;  5F11 A;  2NWH A;  2HQQ A;  3B3L A;  5EYN A;  2HLZ A;  3LK7 A;  4JJP A;  4JKU A;  4BUC A;  4JKS A;  4DC3 A;  4ZIY A;  3RQ2 A;  3IBQ A;  1UB0 A;  4K93 A;  4E8Z A;  4GM6 A;  3BF5 A;  3BGK A;  4QDI A;  3RQX A;  1GQY A;  3RSQ A;  5BYD A;  4K8K A;  3RM5 A;  3KEU A;  2AM1 A;  1ESQ A;  2PKN A;  2UUP A;  5EY7 A;  5TQI A;  1E8C A;  4KAL A;  3RQH A;  3RSS A;  2YXU A;  3W4S A;  4CVK A;  1V19 A;  4K9C A;  3UQE A;  4C5K A;  2XJA A;  3Q92 A;  3JUL A;  3RRE A;  3HYO A;  1C3Q A;  1RFV A;  4K9I A;  3UBO A;  2UAG A;  3RTC A;  4K8C A;  3IN1 A;  5C3Z A;  2AX3 A;  3KD6 A;  3KZH A;  1TYY A;  2Q5R A;  3NBW A;  4XDA A;  4YWR A;  4PVV A;  3NC9 A;  2VOS A;  2DCN A;  3LOO A;  3RS9 A;  4E8Y A;  1W78 A;  2VOR A;  1JBW A;  2HW1 A;  3GO6 A;  3NM1 A;  1LHR A;  2ABS A;  1TZ3 A;  3NCA A;  4N09 A;  3VAQ A;  1EEH A;  4S1H A;  4O1G A;  2PKM A;  1DGM A;  3RPZ A;  3DZV A;  3QAI A;  4KAD A;  3RQ6 A;  2A9Y A;  3K5W A;  3NBV A;  3RS8 A;  3ZM6 A;  4EN4 A;  3FHY A;  3UQ6 A;  4LCA A;  4U7X A;  4XF6 A;  3RRJ A;  2FV7 A;  3RT9 A;  2JFH A;  4EUM A;  1UAG A;  1U2X A;  1RKA A; 
#chains in the Genus database with same CATH homology
 3CQD A;  3IE7 A;  4E69 A;  3IH0 A;  2QHP A;  5B6A A;  3RTB A;  1VI9 A;  4KAH A;  5CM5 A;  1RKD A;  3K9E A;  4XCK A;  4X8F A;  4C5L A;  3H49 A;  1BX4 A;  3NL3 A;  1V1B A;  1WYE A;  2RBC A;  3RSF A;  3B1P A;  3H74 A;  5COJ A;  3LKI A;  4C5J A;  1GC5 A;  3I3Y A;  3NL6 A;  3DRW A;  2C49 A;  4E8W A;  4LC4 A;  1TZ6 A;  3RU3 A;  1RFU A;  3B1N A;  3RTE A;  3RU2 A;  1V1A A;  5BYE A;  1JXI A;  3IKH A;  4DU5 A;  1YHJ A;  4O1L A;  1GQT A;  1YGK A;  2XTB A;  3GO7 A;  3RQ8 A;  1KYH A;  1VK4 A;  5BYC A;  5C40 A;  2F7K A;  2R3E A;  3KTN A;  3LHX A;  3UMP A;  3HJ6 A;  4S1I A;  2AB8 A;  2AFB A;  3LJS A;  4N08 A;  3RQQ A;  3RTA A;  4EOH A;  3UQD A;  1LHP A;  4K8T A;  4C5M A;  2DDO A;  3B1Q A;  1EKK A;  1YGJ A;  2ABQ A;  2PKK A;  3NM3 A;  4LBG A;  1LIO A;  2VAR A;  3RPH A;  3RSG A;  3OTX A;  4C5K A;  4E84 A;  2PKF A;  3NL5 A;  3RTG A;  3QA2 A;  5CGE A;  5BYF A;  1LII A;  3UMO A;  4C5N A;  3UQ9 A;  3RQ5 A;  2R3B A;  5TRW A;  2I6A A;  3RTD A;  3RO4 A;  3RRF A;  4EBU A;  3HIC A;  2DDW A;  2I6B A;  1LIK A;  1RFT A;  1TD2 A;  3HPD A;  3NL2 A;  4K8P A;  5CGA A;  1EKQ A;  2QCV A;  2F02 A;  2AWD A;  5C3Y A;  1LIJ A;  2JGV A;  3PL2 A;  2DDM A;  4KBE A;  2AJR A;  1VM7 A;  3EWM A;  2YXT A;  4WJM A;  3B1O A;  3GBU A;  1V1S A;  3RY7 A;  2AJP A;  4LBX A;  4KAN A;  4S1M A;  2V78 A;  3PZS A;  3RT7 A;  2JG1 A;  2I5B A;  4XF7 A;  3RRB A;  1RK2 A;  3Q1Y A;  1UA4 A;  1JXH A;  2A9Z A;  3IQ0 A;  3MBH A;  2C4E A;  3MBJ A;  4YL5 A;  1ESJ A;  3N1C A;  4S1I B;  4UBE A;  5F0Z A;  3ZS7 A;  4B8S A;  5C41 A;  2JG5 A;  2AA0 A;  3B1R A;  4E3A A;  1L2L A;  3FHX A;  3NC2 A;  3VAS A;  1RKS A;  5F11 A;  2NWH A;  2HQQ A;  3B3L A;  5EYN A;  2HLZ A;  4JJP A;  4JKU A;  4JKS A;  4DC3 A;  3RQ2 A;  3IBQ A;  1UB0 A;  4K93 A;  4E8Z A;  4GM6 A;  3BF5 A;  3BGK A;  3RQX A;  3RSQ A;  5BYD A;  4K8K A;  3RM5 A;  3KEU A;  1ESQ A;  2PKN A;  5EY7 A;  3UBO A;  5TQI A;  3W4S A;  4B8R A;  4KAL A;  3RQH A;  3RSS A;  2YXU A;  1V19 A;  4K9C A;  3UQE A;  3Q92 A;  3JUL A;  3RRE A;  3HYO A;  1C3Q A;  1RFV A;  4K9I A;  3RTC A;  4K8C A;  3IN1 A;  5C3Z A;  2AX3 A;  3KD6 A;  3KZH A;  1TYY A;  2Q5R A;  3NBW A;  4XDA A;  4YWR A;  4PVV A;  3NC9 A;  3LOO A;  2DCN A;  3RS9 A;  4E8Y A;  2HW1 A;  3GO6 A;  3NM1 A;  1LHR A;  2ABS A;  1TZ3 A;  3NCA A;  4N09 A;  3VAQ A;  4S1H A;  4O1G A;  2PKM A;  1DGM A;  3RPZ A;  3DZV A;  3QAI A;  4KAD A;  3RQ6 A;  2A9Y A;  3K5W A;  3NBV A;  3RS8 A;  4EN4 A;  3FHY A;  3UQ6 A;  4LCA A;  4U7X A;  4XF6 A;  3RRJ A;  2FV7 A;  3RT9 A;  4EUM A;  1U2X A;  1RKA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...