2YXWA

The deletion mutant of multicopper oxidase cueo
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
440
structure length
440
Chain Sequence
b'RPTLPIPDLLTTDARNRIQLTIGAGQSTFGGKTATTWGYNGNLLGPAVKLQRGKAVTVDIYNQLTEETTLHWHGLEVPGEVDGGPQGIIPPGGKRSVTLNVDQPAATCWFHPHQHGKTGRQVAMGLAGLVVIEDDEILKLMLPKQWGIDDVPVIVQDKKFSADGQIDYQLDVMTAAVGWFGDTLLTNGAIYPQHAAPRGWLRLRLLNGCNARSLNFATSDNRPLYVIASDGGLLPEPVKVSELPVLMGERFEVLVEVNDNKPFDLVTLPVSQMGMAIAPFDKPHPVMRIQPIAISASGALPDTLSSLPALPSLEGLTVRKLQLSMDGGANKINGQAFDMNKPMFAAAKGQYERWVISGVGDMMLHPFHIHGTQFRILSENGKPPAAHRAGWKDTVKVEGNVSEVLVKFNHDAPKEHAYMAHCHLLEHEDTGMMLGFTVGH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Blue copper oxidase cueO
publication title Structure and function of the engineered multicopper oxidase CueO from Escherichia coli--deletion of the methionine-rich helical region covering the substrate-binding site
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 125
structure length 440
sequence length 440
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2yxwA02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2yxwA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2yxwA03
1ET8A 1CYWA 4DP4X 4A2GA 2PPEA 3T6WA 5I6KA 2IWFA 1PF3A 1SNRA 3D12B 1KYAA 3BVDB 1AS6A 1J9QA 5I6NA 2PPFA 2GHZA 4UF7C 2FWLB 4GY4A 3V9EA 3QJSB 1URIA 2ZXWB 3QPKA 2N0MA 2Q9OA 1AZNA 4KO9A 1KDJA 4G7SB 1KBVA 4KNSA 3ZIYA 4BWUA 2XLLA 3ABLB 3TU6A 1DZ0A 3NP3A 2DWTA 3UAEA 1R1CA 2EIKB 2IH8A 3L45A 3FQ1A 3JT2A 3FPXA 1M57B 5B7EA 3T6XA 1MG2C 4JHUA 1AAJA 2PPDA 1JZFA 2VW4A 2DYSB 5FC9A 3PPSA 4AKQA 1JERA 3EH4B 3GDCA 3FU7A 1BXAA 4DP7X 3NJGA 1ZV2A 2OCCB 3S3BB 4RH4A 1OE2A 2H5UA 4HZ1A 5AKRA 2B08A 4G7QB 5B1JA 1GS6X 1RKRA 1ZDQA 1PZBA 3FSVA 5E9NA 3EH3B 1CC3A 2DY2A 3ASOB 1W6LA 2JXMA 2XVBA 4A66A 2A3TA 3N55A 3NSCA 4P5RA 4FAAB 4GYBA 3X1GA 4BXSV 4YSUA 3OMAB 3NT0A 2BWIA 1JVLA 5I6MA 2J56A 3T71A 4GP8B 1CYXA 4Q89A 2JKWA 4WTQA 1JZJA 2QPEB 3QJRB 2UXTA 4KNTA 3NP4A 3NJHA 1OCOB 4KOCA 3CZUB 1I53A 2J55A 4GP4B 1IBYA 1RZQA 2AANA 1ASOA 1NPNA 1QNIA 3EF4A 4M4RB 1ZIBA 3IE9A 2IDQA 1BEXA 4E9RA 1OF0A 1NIDA 3FU7B 5B1BB 1AIZA 2BZ7A 1J5DA 2J57A 1BYPA 3PAVA 2XXGA 3UACA 1JZEA 5B7MA 4KOBA 4GXFA 4PCYA 1SF5A 4G70B 1KGYE 2IWKA 1ASPA 2WSDA 3NYKA 1AR1B 1A3ZA 3MX0B 2HXAA 1ZIAA 3DTUB 2E86A 1NPJA 2Y1AA 3AG2B 3WG7B 4YSTA 4G7RB 2NRDA 2WO2B 1PLCA 1AACA 1JXFA 4YL4A 1SFHA 3X1NA 4E9SA 2PP8A 8PAZA 1GYCA 4YSRA 4AZUA 7PCYA 1XMEB 1M56B 2EINB 1AQ8A 4AKOA 4F7KA 1HAWA 1JZHA 1M9WA 4FA7B 3NJFA 1NICA 1BXVA 5B1AB 1PAZA 4DP6X 2GIMA 2UXGA 1FA4A 4AX3A 2EIMB 5D4JA 1A4AA 2H47C 3T9WA 3WI9A 4AKPA 4ENZA 5EHFA 5I6PA 1AZBA 1AZRA 2PPAA 3OMNB 3ERXA 3FYIB 1AOZA 2GSMB 2I7OA 2UXVA 2XU9A 5D4IA 2DV6A 2XV2A 4K9JA 3NSYA 3OMIB 2BW4A 3NJLA 3AG4B 4YSOA 1OCZB 1IUZA 1PZCA 3EH5B 2DWSA 2PP9A 2VMJA 2ZOOA 4CSPA 1JVOA 2XX0A 4G72B 5ANHA 1TEFA 2FJSA 1KCBA 3AW5A 2P80A 4ZK8A 3CVBA 1XB6A 3HEIB 1BQKA 1N68A 2VM4A 3X1BA 2XWZA 3EHBB 1YLBB 2OJ1A 3ABGA 3X1EA 3T6ZA 3PLYA 3C75A 1A65A 4F2FA 1UATA 3FT0A 4M3HA 3QJTB 5I26A 1ILUA 4A68A 4NB7A 1SHWA 1CURA 9PCYA 4YSAA 4QLWA 2YAMA 1WS7A 3N2JA 2YQBA 2XX1A 3FYEB 1SFDA 4F2EA 2QT6A 2BP0B 1NTDA 3SBRA 2Q5BA 2GBAA 4KNUA 1PLAA 1SF3A 2ZONA 1GW0A 4E9VA 4YSSA 1B3IA 2PLTA 4A2FA 3ZX1A 3TA4D 5B7FA 2AZUA 1IBZA 1KDIA 3G5WA 1OCCB 2FQFA 1JZGA 2CBPA 4W1TA 1ZPUA 2HRHA 1A4BA 1A4CA 3FQYA 2BHFA 4A2EA 1ASQA 2OV0A 1TU2A 2GI0A 4UANA 3PAUA 2FT6A 1WA2X 3BQVA 1AS8A 4DPBX 3FSZA 1ETJA 2IAAC 4HCIA 3OM3B 5I5JA 2QPDB 3ABKB 2ZWNA 1BXUA 2HX9A 4BK5C 1HFUA 5B1KA 1X9UA 5D4HA 1KBWA 2QDVA 3CG8A 3NJIA 3QJUB 1AG0A 2QDWA 2X87A 4WKXA 1OCRB 2YXVA 4Q8BA 2YXWA 1W6WA 1E5ZA 2B3IA 3PXLA 2HZHA 5LDUA 2BWDA 2IWEA 1PNDA 2XYBA 2FT8A 3MBWB 4PAZA 2W88A 1AZUA 5B1JC 4A2HA 1ET5A 4HAKA 3FS9A 2PPCA 3SBPA 1E5YA 3IN0A 2IDFA 1J5CA 4KO7A 1A8ZA 5PCYA 1NZRA 2YAFA 1PNCA 1AANA 1MZYA 3FSWA 3X1FA 3FPYA 2BZCA 2FNWA 4G71B 2VN3A 2EILB 5I28A 2H3XC 2VW6A 3UABA 2PCFA 5I5IA 2DYRB 4BXVA 1J9TA 3SBQA 1PY0A 1WA0X 1GY1A 1PMYA 2P80D 3NJMA 1IC0A 3SQRA 2EIJB 1L9TA 2HX8A 4BWWA 3FU8A 2IH9A 1BQRA 4KO6A 1J9SA 5F7BA 2YARA 1PLBA 2BP0A 4DP0X 3QQXA 2HRGA 2VM3A 4MFHA 3UAAA 2FQEA 5TK2A 3RYMA 1WS8A 2HLEB 3JTBA 4JKNA 4E9TA 4X4KA 1NIFA 1FWXA 3FU9A 4L0PB 2UX7A 4P5SA 1AS7A 3CVDA 3OD3A 4N8UA 2CUAA 1BYOA 1V54B 2XXFA 4NAJA 3ZDWA 1GS8A 2CALA 5I6OA 4NERA 4YVNA 3S8FB 2GB2A 1MG3C 2I85A 4EF3A 3S8GB 1KCWA 1IKOP 3AZUA 1GSKA 3WNJA 4A2DA 3S3DB 3GYRA 1ID2A 2FT7A 4N4YB 2XUWA 1NDTA 2FQDA 4HHGA 1SHXA 2IDUA 3CDZB 1ADWA 3NJJA 5AZUA 3U25A 4KO5A 1WA1X 4BWTA 1FFTB 2VSKB 3TBCA 3FSAA 4YSCA 1BAWA 3UGEA 4UAHA 3NSDA 2YAHA 2Y69B 1NIEA 4A67A 1SJMA 3H4FA 4E9XA 1WAEA 3CVCA 2YAQA 2JFCA 1MDAA 5IY5B 1T5KA 2BW5A 1E65A 2MTAA 1NINA 4YSQA 1RCYA 3NJKA 2PCYA 4HCGA 2UX6A 1QHQA 2XV0A 1EHKB 4QKTA 1JXDA 2BO0A 1ET7A 3KW8A 7PAZA 1RZPA 4BDVB 1L9RA 2IDTA 1KV7A 1F56A 1JZIA 4DPCX 2BP8B 1W8EA 4TXVB 4JHVA 5PAZA 2X88A 2R7EA 1BQ5A 2W8CA 3AG3B 2VW7A 5F7AA 1GY2A 1L9SA 4YVUA 2MRYA 3AY2A 1E30A 1OE3A 2FQGA 1V55B 4HALA 3WNIA 4E9YA 3IBOA 2GC7C 4YSEA 4DP1X 5B3SB 4YSDA 2WO3B 4E9WA 5TK4A 3V9CA 1L9OA 1L9QA 1SDDA 3NSFA 1GR7A 1NIBA 1HAUA 5I5MA 3OQRA 3TBBA 1PCSA 2XV3A 4DP9X 4GP5B 4AI7A 1DYZA 5I6LA 2YAOA 2IDSA 2TSBA 2HX7A 1NIAA 2CJ3A 3IEAA 4HHWA 3ABMB 3FQ2A 2GC4C 3HB3B 5A7EA 1V10A 3X2QB 4DPAX 3PCYA 1JXGA 5AFAA 3T6VA 2AZAA 3PAZA 3CDZA 2YAEA 4DP2X 3DIVA 3H56A 2R7EB 3GXUB 2RACA 1OE1A 3NJNA 3ASNB 1N70A 2AVFA 4E9QA 3WKPA 3QJVB 1VLXA 3ZBMA 1CUOA 6PCYA 3QJQB 2FTAA 3TASA 1NWPA 4W9ZA 1E67A 1J9RA 1X9RA 1QLEB 4HCFA 3H4HA 3WKQA 2AFNA 3AG1B 2J5WA 1GS7A 1TKWA 1XB8A 4CSZA 6PAZA 3DKHA 1ZDSA 1MZZA 4HIPA 2CCWA 1JOIA 2LLNA 4DP5X 3KW7A 1EZLA 1TEGA 2CAKA 1SDDB 2VSMB 3IN2A 2PP7A 1ILSA 1NWOA 4BDVA 2YAPA 1AG6A 1OOWA 1OV8A 1AZCA 2BP8A 1PZAA 4YSPA 3UADA 2I7SA 2TSAA 1L9PA 3WIAA 1XB3A 4DP8X 3S3CB 2UXFA
chains in the Genus database with same CATH superfamily
2X9WA 2YLKA 2Z4QB 2DQTH 2H26B 1FGNL 2OS7A 5I6KA 1LO3L 1AXTL 4LP8A 3V4PL 2IWFA 3KL3A 4DO4A 3NMEA 2VLJE 2P8PA 4JO4H 2VC2H 5IW3A 3QXTA 1A6ZB 1J9QA 5FA3A 1CL7H 4LU5L 1OGPA 4NUGH 3HG1E 2VDKL 2EH8L 2OJEA 5F7UA 3IPEA 3QRGL 1C12A 4F2MA 3TEWA 3MO1B 4K3EH 2ATKB 2EDDA 3PP3H 3KWTA 2DJSA 4GO8A 2ZOTA 3S96A 4F37F 4TNGA 3X14B 4Z7NE 3JWDC 3MLSH 2IV8A 3BSZH 4N2HA 4XPHL 1AKJD 3KEDA 4CJ1A 2ZXEB 4XXDB 3EYFB 4BWUA 2Q76B 2K6WA 1KULA 2XWTB 1VFBA 4CC4C 3BAJA 1S5HA 5JORB 3DPBB 3RIFF 3MV7A 3IGUA 4HIXL 3W0WE 1OGTA 1T1WB 2YPKB 4KX7A 5K5YA 1QA9A 3QQ9D 1MAJA 1KPUB 3PGCB 3QA3A 4H8WL 4NQEA 2Z6FA 4EBQL 4OZIA 3WIHL 3BRFA 1KTKE 5CMAB 4TNVF 1FVDA 2WLMA 3IETA 3F5WB 1E8ZA 3OJMB 4EDWH 4UQCA 3U9UB 2X6BA 2YD9A 4GKLA 3N1FC 2A38A 4WI4A 3LNDA 1G9NL 5AOLA 4D0DB 1KTCA 1RI8A 2ADJA 2EIDA 4APXB 5TGBA 3ZHKA 1CU4H 5FO7B 4G6KH 2EDLA 2YSTA 5CKGA 4BZ2L 1YECL 3FT2B 3PWUA 2XICA 1P7BA 1PZBA 5BS0D 4APQD 4JO2L 3TZVB 4GQQA 1IBDA 3CX2A 5SWSD 1I1AB 2LU7A 3ZTDC 1SXSA 3SPJA 4P23B 1J86A 1VACA 2WLJA 1OAUL 4DGYH 1FFPA 3GI9H 2Q8AL 1AP2B 2AJVL 3FUIA 1PEWA 3IAQA 4TULH 4F33B 3MZTA 1COBA 2OQJA 4L5FE 4DO5A 3G6JA 1P7QB 4IW4C 3CZUB 4FFWC 4O2CB 4U1KB 3UG3A 4IU2B 2BSSB 4X7TB 1B9KA 3KLAA 1AJ7H 4Y4HC 3VI4B 4P07A 4CW1A 2D7PA 3SDCB 5HVHB 4HOWA 3D3VD 2X09A 2E9JA 2BY0A 1O7SA 4I13B 1XEDA 1UT2A 1QPPA 1DJHA 1OGAE 2OTUA 3PAVA 4HIIA 1X5IA 1AGEB 2W59A 2W9EH 1UG9A 5J3HD 2X4UA 1KB5B 3FUDA 3ZYJA 1MUJA 4MBRA 3IB4A 3NFPB 4Y1AD 2DH2A 5C7XL 1RUAH 4PJIE 1CE6A 1KNOB 3JUZA 2V6HA 3MLRL 2WSPA 4Y4KD 1ZMYA 2R1YB 3UGUA 5EOQH 1UT1A 3G5YA 4MGXA 4N20A 1JXFA 2AXHA 5A6LA 1OARL 3X1NA 2JI1A 1F6AA 3EOTH 3BAYA 2A4EA 4X8XA 4XXCC 5FOBA 1QBLH 4YSRA 4AZUA 8PAZA 4DN3L 4O02B 3TS8A 5KVEE 1KJMB 2E6PA 1AQ8A 1O7DC 1HILB 5HJDA 4NENB 1B0GA 3K71A 4YNYB 2AEOA 2DKUA 2YQ2A 1YN7B 3D48R 4LAQL 3UTZB 3KL5A 1KG0B 4JGNA 3ARTA 4IOFC 3TPKA 1Q0XL 2D4FA 1QABA 4K9EC 4U33A 5BRPA 4JEGB 1LE5A 3OR6B 4JK0D 4L1LA 4CVXA 4WW1A 1SQMA 3FYIB 3VXRE 4GBXB 1G9NC 1PDKB 4JG9A 5C92A 1NMCB 2AQ1A 1TF4A 1SJVA 4KPHL 1FO0H 3AG4B 3BEWA 5C07D 3K0YA 3PWVA 5CGBA 1SEBB 3THML 1PZCA 3EH5B 4NX0A 4JY5L 3KLQA 2PP9A 1N59B 3MLYL 2J8UF 3H9SD 2XX0A 5I8EA 3FXIC 1NLDH 1MFEH 1H6FA 2B9AA 1XR8A 1DUZB 5LWYL 1FZMA 3UFIA 2K6YA 4GQPH 4NQDB 4LCCB 3E9UA 1AXIB 4LDOB 2WV3A 4PJ7F 3FRUA 1NQBA 1HEHC 1A7OL 1FE8L 1XF4A 3W38A 1BFSA 3DMMD 3CFEB 4XWGH 3O2VH 5FLUA 3IMBA 1BM7A 3GDBA 5DEFA 1IGTB 4XXWC 1WS7A 2AV1B 2VZSA 3ARDA 3DGDA 2HAZA 4XP6H 4DT2A 2EDKA 1P4BL 2QT6A 4BQBA 2VKXA 1IL1B 4BGLA 4AK1A 1R5WB 2XJLA 4E5XB 2Y5TB 3SPVB 1BOGA 1G87A 1QEWB 4Z5RB 3GMLB 3LSOA 4DZ8B 4X5PA 5ACLA 4HMEA 5LNEA 4Z77A 3EJYC 4ODTH 2GPZA 4JDZB 5TFSH 5GHWL 3UC0H 3BE1L 4JN1L 2AK4A 4E42B 3F00A 1A4BA 4RAVB 4JFEA 1I1FB 4TSAH 4A2EA 4QHLA 1U2HA 1AGFB 2WAQA 4HS6B 5C0GA 5CEZH 3MV11 2GI0A 4MB1A 2B2XH 4LVOB 2EQDA 2W0PA 2EDMA 5D2LE 1XCQB 4IEFA 4PJ5B 1JZ8A 3BUYA 4NBZB 3H3PH 1NOAA 4WAFA 3KLKA 3MLWL 1U30A 2FUQA 4FG4A 4DNLA 3UDWA 3KYKH 4E41E 2IADA 4Z7VE 2IIJA 1VKXA 1WYJA 5J6GB 2XWBB 3MROB 5F3BB 4QMEA 1F11B 4HIJA 3M8OL 4MJHA 2ZNXA 1H6TA 1PX8A 1GGTA 4YGAB 1T2XA 2W92A 4LDCA 1SOKA 4H0LC 5SWZE 1Z2KA 1CE1L 1JK9B 4OLZH 2QSQA 4ZFOB 2HVBA 5EZOH 4QHKI 2JJVA 5B1JC 1R0AH 3MYJB 1ET5A 5ALBL 3U0WH 3ZQ9A 1MFNA 2PPCA 3BLKA 4OF0A 1LK3H 1RIVH 3EFOA 3JWNH 4NQXA 4P2OA 1NGYA 3GO1H 4GAYA 2AMGA 4IRSC 3U9WA 1JTOA 5LHDA 5IG7A 5KYNA 2YD1A 1DEEB 4HPOL 2R2CA 3A4DA 3Q2CA 3Q05A 3TZVD 2QQQA 2VN3A 1ZCRA 3Q6FB 3PXJA 1I1AD 4QR7A 3UO1H 3MRPA 1I85C 1EA9C 3BPOC 4P23D 1OIOA 3HRZC 1I8IB 4B50A 4ZDHB 1S7QA 5MP6H 5IVNA 4HLEA 2DKMA 2ZNWA 4ZUTB 2BINA 4NZJA 1I82A 4G9FB 1VAHA 15C8L 3W82A 3CN1A 4OFDA 1P7QD 2DICA 1ED3B 1AO7A 1F4HA 2BCKB 3I50H 4JVUA 2F8VA 2PTVA 3LPWA 2F8IA 3FU9A 4RESB 3IDJA 4L0PB 5GS0C 4QF1B 2ODHA 5I30H 3SDCD 3IDUA 2YD3A 4N8UA 4LZKA 3LKSB 2A9ML 4LESA 3FO1A 4KZDH 1UXSB 2H1LM 4U6XA 4XOAA 4HDIA 3I9GL 5ADOL 1K6QL 4AGNA 4FQQA 4KK5D 3CLFH 5DJAB 2WLHA 1RZJL 2BC4A 1FF5A 3P30L 4Y5YC 1XCTB 3I6GB 1WWWX 2QHRH 2ZQKA 3OAYH 4YPGB 5KSUA 5T5FL 4KI5E 5C0ND 1JPGB 2FH8A 3AITA 1IGIH 4IOSA 3WFBL 4HEPG 4ELMF 2AERT 4UU9A 1UM6H 3CAFA 5DK3A 3LPFA 3RBSA 3VRLE 3VXNB 2WB7A 1QSFA 3HZMB 2JCCB 1D6EB 4WHCA 1HKLL 2F58H 3GSQB 2IH1A 2E76C 4NKDB 1QFPA 1WUZA 1XO8A 3AS2A 2V2WB 3NZHL 1TJMA 4PV1C 3PWJA 4DKFH 4BKLA 1TMCB 5E4EC 1KBGH 1MW3A 1MFAH 3IDIA 4Q0XH 3T6QC 2Y7SA 4MZRA 1MI5A 4PJEF 4OCWL 2JKIS 5C0BA 4BSVB 1FV1A 4GBXD 3KPLA 5EFIB 3SQOL 2F74A 1X4XA 1HQ4B 3VWKB 3DUUA 5CD5C 4NKIH 4TSBL 5CGTA 2M8XA 2NZIA 1I1CA 1G1YA 4UV7L 4W9CC 3D25B 3QE5A 5DC9B 2PYFB 3FB5A 4DTGH 5PAZA 2D31A 1S7WB 2VABA 3WN5B 5KSAC 3QDHA 4AENB 2VJ0A 3M46A 2MRYA 3QCTH 1FLTX 1KTLA 1E40A 2DQUL 5EIIA 3ARPA 2EDHA 4NQDD 3QUMH 1XFPA 3TCLB 2FX7L 2ZUXA 4XN1A 3TEUA 3ORJA 3QZLA 3WAJA 2DMGA 3NDZE 4Y5VA 2AJZB 4R0LB 5J56B 4JAMA 3VA2C 2AJSL 2DMCA 3QZOA 1LJMA 1QFOA 5F7MC 3ULSA 3RILA 1NFDE 3GJFH 1ZGLB 1A9BB 2X4QB 3OPZH 4N2MA 1G7JB 4LSTH 4CC0A 4S1QL 4U1HA 5DURB 2FL5B 4JHAH 1BZ9A 2FX9L 3NDYE 5I6LA 1KN4H 4N2KA 4PJXB 4YPJA 1R47A 2L3BA 4N5EC 2X70A 4WU5B 4M7KH 4K4KA 2GC4C 5F8RC 2W5PA 3KPQB 2VOTA 4WWID 5BS0A 3X2QB 2AXWA 1RZJC 3RUGB 2WY3B 1O6SB 3TEXA 2WQVA 2WUCH 5F0PB 5D2NA 3S35H 2Y72A 1QUNB 3KHQA 3P02A 1G7MA 3I74A 2KQMA 3LHPH 1UEYA 2AJYH 1GZPB 1S7SA 5B38A 3TASA 3V6FA 3WJLC 5HHVL 4Z7OF 3NA9L 2CO6B 4PJ5D 5IBUB 2FATH 5KUMA 4M8QA 4DJMA 4JNXA 1SOXA 1YYMH 1MDTA 2E7MA 4UM9B 1JMXA 2BVPA 1L7TL 3P54A 2HT2D 6PAZA 1B2WL 1ZA6A 1ERNA 3FU6A 1DQTA 2PKDA 2PYEB 1SMOA 1INEH 1BMGA 2PWGA 2YXMA 4HUNB 4J3OH 4XZUB 3RNKA 2XPYA 1SXBA 3CZNA 3LRSA 4NWTH 5E2WH 2EKSA 5T3XD 3WENA 5AYQA 3D3VA 5DD5L 43CAB 4MAYB 4LSVL 1UKSA 1LD9A 2IGLA 3BI9X 4MQXD 4WKZB 1YN6B 5GGQH 2MCPH 3LYRA 2DMHA 3BIKB 4G8EB 4FFVC 5FUCC 3VUAA 2RMNA 5HI5D 4BM7A 3FTWA 1XAUA 2NXZC 1ADQL 1B2YA 2QTVA 1XZWA 1HL9A 2WQ8A 2PXYC 4Y1AA 1ES0A 1LP9F 3HC4H 4DKEL 4HJ0C 4G43A 1PU0A 1MFCL 3JZYA 1JUFA 4UQ9A 4I18C 4IU3B 4LSQH 5C08A 3NFSL 1NLBL 4JL1A 4L37B 3WS6A 5BOPA 2OCFD 3BSHA 4F15B 4XP4L 2XG5B 4LPTA 5DYOB 1FDLL 1AIFA 4FQ2H 4R4FH 4EDXA 4MA8H 2QR0A 3CFUA 1FZOB 3B8SA 5GRUH 3RY6C 3BP4A 1BZ7A 1ND0B 1RZKC 4YIQA 5DD3H 4ZMVA 2Z92A 3HC0A 1ZSDA 4P9MH 3E7JA 2XHNA 5J1AB 3T4YB 4LNRA 3ZZ1A 3HPJA 1NGXA 4G9FD 2L7EA 4G11A 3DO4A 4G7VH 1XHHA 4PP2B 5DRWB 3OR7B 1D9KB 4UUJB 1D6VL 5E8DL 1OAKL 4GW4A 2H8PB 3MR9A 3RVTD 3JBG7 5D1ZI 3P0YH 5FC9A 3WIIH 2VWEE 2CU9A 4XNQA 5C07A 2VJ8A 5J57B 1XZ0B 3CPUA 5DJ6B 3ZE2E 3H9SA 4NC1C 4PGEB 5G5DA 1IQWH 1JRHL 3UAJC 3VFMB 3BZFB 3OQ3B 5BVJA 3CVHL 4P4KC 5GGTL 2J1ZA 3HZKA 4MCYA 5JQ6H 3EDDA 4P2QB 3SPGA 1XXDC 4MJ6B 1HOCA 4PVNA 4U31A 2J25A 3LY6A 4PGJA 1MQKL 2WYTA 4Y9GA 1A7BA 5L4JA 5F89A 3L9BA 3PGFH 5DSCA 1ZV9A 3KPOA 4ZNEA 5ESQB 4ZOBA 1W91A 2L8AA 4L1SA 5HGDA 1CC3A 1RUPL 3F7VB 5E5MA 2C9SA 4FYQA 4X5WA 4JPKL 4LVHB 5CLTA 3REVB 3OKEA 4PB0L 1GHFH 4WI0A 2LHAA 5GIRA 1CR9H 4AE1A 1VHPA 3CVIH 2IBGA 3B4NA 2D3LA 4MJIE 2EVHA 3ZSSA 3PP4L 4B95C 5KS9F 2PF6A 3AWGA 4X98A 3B2UD 3MBEB 3NJHA 4NM8H 1OCOB 4D9LH 4O2FA 1JYVA 3RWFA 4ERSL 2BSDA 4GP4B 3VB8A 2H26A 4C4BA 5C9JB 1QNIA 4L8SC 1CXLA 3GNML 1H6EA 3QQDB 1NCUA 4PM1A 4XB8A 1OALA 1TTUA 3GMPB 1KCKA 1UZ8A 1A6ZA 3D4CA 4OJFH 4QDGA 5E5LA 5IK3B 4WFGE 5CF3A 5HYJE 3HUJB 4JFZH 5I1EH 3WTUA 3DUSB 2VB5A 3FUKA 4X9HA 1HL8A 5FS5A 3MO1A 4ORZC 4PJAE 2ATKA 5BO1H 1U0QA 1LXMA 2IWKA 1ASPA 3BWUF 4CAGA 4QTFA 3MX0B 3W37A 4YLBA 3X14A 1IE4A 4NT6B 1RHHA 3TJPA 1F2XK 2Y1AA 3EYFA 3ZZSA 3LQAC 3ZIMA 2Q76A 3IBEA 1XGTB 5GSVA 1T7WA 4LHUG 4UIMA 3MMEB 4QOKB 4KRPC 4NO3B 5JORA 3QQ4B 3UYRH 1T1WA 2YPKA 4C56E 5EO1B 1E5AA 3I3EA 3PGCA 2V3FA 3BAKA 5E95B 43C9B 3LKPB 4FFYA 1MREL 3IJ7A 3HRPA 2R0WL 3ATAA 3IK2A 5CMAA 2VN4A 3F5WA 1U92A 4AGLA 3U9UA 5DURD 2D8KA 4M93C 1RZIB 3EKCA 2GT9B 4WFEE 1XMWA 3CFKB 4LLMB 1F3JB 5T8IA 1T3FB 4HEMA 1D5XB 4D0DA 4APXA 2AJUL 3ERXA 1AOZA 1YEGH 4FQPA 3V0IA 1IKFH 2BERA 2VR4A 2CUMA 4M7ZC 4B9IA 4G5AA 4YEFA 3OMIB 3H85A 1LILA 3TZVA 3BSGA 4TVPD 1IAIL 4Y4FB 4U1SB 1CFTB 4BQ9A 3GBML 1QNZH 4P23A 3DA0A 3AW5A 2FO8A 3K81A 1S8DB 1XF1A 1SOQA 3OKOB 1BQKA 3L2MA 3DHUA 1B4JL 4RAHA 4U7MA 4L5FL 2XN0A 1D5MB 4F33A 1VZIA 1XIWC 2Y7QB 3C75A 4UM9D 1BJ1H 1P7QA 3TH3T 1W0WB 5I1DB 5LGHL 4O2CA 4U1KA 4EUPG 2YXFA 1UJ3C 2BSSA 4IU2A 1X4ZA 2PYED 4X7TA 3UIYA 3VI4A 4H20L 1S9WB 5CLYA 3SDCA 1A4JB 3DX2A 1KENH 3FC8A 4QRTB 4QLWA 4GO6B 1XH3B 4H0IA 4MAYD 2Z3FA 4G7YH 2GI7A 8CGTA 3DJTA 4FXGC 1AGEA 5JHMA 1KB5A 1Q0YL 1NJ9B 1ECZA 3IKKA 4Q9CA 5JIDA 4R9HA 3NFPA 1FVEB 2CDEB 3AUVA 3UEQA 1OAYL 5AW9B 1KB9K 3ESVF 5T3ZD 2X1QA 5E4AA 1KNOA 2EECA 2WLIB 4PJDF 5B7FA 3GSOA 4M7LH 4G1MB 2EEAA 1U8MB 2R1YA 2FQFA 1TOXA 1NCHA 2G0KA 2JKSA 1MHHB 4MRCA 1WZMA 2ZCLL 3GKWH 2F1BA 1DVFB 5C6WH 4IRJC 4O02A 2HFEB 2AI0L 1MRDH 4ZUVB 1KJMA 3UG4A 1HILA 2VDPH 3HMXH 4NENA 3NAAL 5IVZB 4XODA 4YNYA 1EAPB 1KGIA 1YN7A 4XVJH 1KG0A 5DD1L 5F72S 2CDGA 3KPNB 4HCIA 4WFHE 2GEEA 5I5JA 2Y1VA 4QI3A 3ABKB 3F05A 4LPYA 1FC2D 3QDGA 1D9KD 1PDKA 2DQTL 3MRJB 2ARJB 3ZDZB 3V0VA 1ZTXE 3E8UH 1VZHA 1R5IB 2VC2L 1CDCA 4G42B 4X8JA 1CL7L 4ADJA 1N59A 2O61B 1TZGL 3JXAA 2RJMA 4LO9A 4MNGB 4JM2C 2NY0C 2ITCB 1C5BL 4GMSH 1KB9J 4K3EL 1U6AH 3BVUA 1WT5A 3FJTA 1KFGA 4P2QD 2Q6WB 3GWJA 3G6DL 1UQSB 2R56H 4PVBA 5HYEA 4NQDA 4LCCA 2AV7B 1EO8H 3FT3A 5EIQA 2FBRA 2XBZA 4XAKE 5E8NB 1T03H 1P5UC 1RY7B 1F3DH 1YPZB 4OFQA 2IXQB 2WLKA 2JSFA 3B9AA 3D08A 3EYSH 3MXWL 4Q14A 3CFEA 5C0IB 4TSCH 2OMXB 4O9HH 2V5MA 5E9AA 1JD9A 1L6ZA 5HI4D 3SQRA 1IGTA 4JFXB 1IZKA 1PTZA 5DRNB 4FI6A 4X8GA 5DC2A 2AS5M 2GIYA 3HE7B 4EDWL 4EZMA 1H8SA 2AV1A 3Q8CA 2ZWYA 3CSTA 3B1UA 3LNHA 4PJCF 2Z1KA 4WDIB 3L7EA 4DO6A 1IL1A 1RV6X 4XVTL 3P0VH 1KSRA 2Y5TA 3VG9B 3MBED 3SPVA 5FGBA 3WNPA 2CLVB 5IB3B 4PD4K 1QEWA 4Z5RA 4HMDA 4YDVB 2O5ZH 3GMLA 4DZ8A 3EBGA 1E9PB 3AQYA 5IJKA 1P2CB 4YLCA 5D93B 5E2UH 1R6VA 4K7PH 3BDXA 1BYOA 1EJFA 1QSEB 1CZ8H 1TXKA 3O6MH 3V0WH 1N19A 4JDZA 2OYMA 3P3SA 5I73C 2OXGB 3FQ4A 4X83A 2ZKHH 3L3DB 1V3MA 2J8OA 2LFGA 2Z7YA 4EF3A 4RAVA 1I1FA 5J06A 4N3UA 5I71B 1AGFA 3CMOH 3I84A 3HR5B 4DGYL 5D5MB 4CN6A 1T1YB 3EJTA 2C4FU 4TULL 1XCQA 4PJ5A 2FNBA 5DEJA 2XUWA 3DV6B 1HKFA 5IT2H 5DC4B 1Q9WA 3SCMB 5KN5A 3NJJA 4QOKD 5F9WC 1VGEH 2ID5A 3MROA 4K55A 1AJ7L 2H9GB 4FKHA 4OGYH 1F11A 3OPUA 2WYHA 4F7TB 4KDVA 3NSDA 4HUUB 4MD0B 3SJVE 1SJMA 1JK9A 3IDYB 3IFPA 3GIZH 3MLXL 5CIPH 4ZFOA 3MJ9H 2QFPA 2W9EL 4JDTH 3WNLA 3MYJA 4PD4J 2EIZB 1EEQA 4TNWF 1MHEB 3V0HA 4H8QA 2AAVA 2NDGA 2J3SA 5BXFB 4DUXA 3B43A 5KJRL 2YMXH 2ZCZA 5IMMB 3MNZB 2TAAA 5E70A 1KF9B 3MNDA 4WV1C 5FCSH 1GVIA 4N86A 1DEEA 4LCWB 1E3XA 1GC1H 3VXSB 2VSDA 3EOTL 3Q6FA 4Y4FD 2OPCA 1QBLL 5EEWA 4L3AA 1SY6H 3VTMA 5LQBH 1YQVL 5I1IH 3TFKC 3WBDA 1TPXC 1JPFA 4U1GC 4R97B 5EA0H 1E30A 1QR4A 1TEYA 4LT7A 4ZUTA 5J6HA 2NNRA 1UXMA 2ROXA 3TBYB 5HPOA 2ENSA 1ZHKB 1ED3A 1F4YL 2OK0H 5FYJE 4ZD3H 2BCKA 3RZCC 2B5IB 2IOOA 1GOGA 4FQXB 4DK3A 1NANI 5LXGH 1FO0L 3IMUA 2CRMA 3LKSA 3F6LA 1ZVHA 4JCLA 1PCSA 4X2UA 1BAGA 5AYUH 1LP9E 2A6DA 4GP5B 1T0MA 1UADC 4LOUC 1UXSA 2X1WL 4ATTA 3LH8A 3V7MA 3NJVA 2H1XA 1KGXA 4V33A 5JW4R 5DJAA 5C0CE 1AC6A 3K2UH 1OB1B 4G5ZL 1XCTA 1KGCD 3I6GA 2E8ZA 2YUWA 3CU1A 4OKDA 1JPGA 3S4SB 3MLPA 3QFJE 3CV5A 3VXNA 3HZMA 1DVFD 2JCCA 2YD8A 3NRQA 4NI3A 4XN2A 2B77A 4XWGL 3GXUB 2RACA 3MV9E 1D6EA 4M5SA 2R9HC 4PJXF 1JFQH 4TUKL 5KBDA 1EHNA 3MI6A 3FTZA 2AVFA 5LO7A 4NKDA 4XVOA 5EEVA 5CCGE 2V2WA 2BVOB 4IOIB 4LQFH 3L3HB 4XP6L 4GI9A 3RUGF 2JQAA 1I8MB 1Y0LB 1WC7B 1RZGB 3C09C 1T2QH 3D8MA 3ZVVA 5LGJB 3CMGA 2A4ZA 4HAFA 2GEQA 3OLGA 4DQAA 2CCWA 3L6FB 4BSVA 1KCRL 4M61B 5EFIA 2XQYK 4HIHB 4KTDH 4GKNB 2H3NB 4IRZA 5GGRY 4W93A 2G2RB 4ODTL 1A5FH 1N0XH 3S88L 5TFSL 5BUGA 3D25A 1MVFA 3O8XC 4TSAL 1S7WA 3TV3H 3D07A 3WN5A 4A6YB 3ES6A 5CEZL 1TSRA 5H2BB 5HDRA 4AENA 4X99B 5ICZB 4O5LH 4Y2DC 2UYLB 4W6WB 3PJLA 2NZ9C 4BFRA 3VFTA 2QKIB 4JREC 2C3WA 3TCLA 4WTZA 1NAMH 3ARBB 3MRKB 4BFGA 4R0LA 2E9WA 1M2OA 3KYKL 4PJ8C 4XVSH 2F7QA 2QPFA 3BAXA 1LGVA 1MWAB 3KPRB 3GRWH 2L7QA 4A37A 5IB4B 4GRWB 1ZGLA 2OI9B 1A9BA 2J7LA 2X4QA 1G7JA 4HWBL 3BVVA 1QFWM 3QRBA 3FT9A 1BWMA 1JK8B 2BK8A 5GSRA 2GKIA 1MNUH 3HE7D 4HUXB 2FL5A 5EZOL 3U7WH 2P24B 4YGVB 1R0AL 1ZLEA 4EJ1C 4PJXA 2R1XA 2EO7A 3FU0A 5EG6C 1LK3L 1RIVL 3NCYS 2XYCA 4WU5A 3UZVB 3PRZA 5B7EA 1UWXH 2MMXA 2PPDA 2VW4A 3KPQA 3VSQA 2VE6B 3LZOA 1HHGB 3BAEH 3LQZB 5EBLA 2H7WA 1UD3A 3GDCA 1QSED 1NSNH 4AVHA 4KI5C 3NJGA 1O6SA 3GKZA 1UH4A 4H26B 3TO2B 5J13C 5B8CC 3UO1L 2A9BA 5F9DC 4GEJA 2JTYA 2QSCL 4BBWA 1GZPA 1KT2B 3F62A 4I77L 4WEEA 3UAFA 3HG5A 4BHUA 2OMUB 5JUEH 4I4WB 3BMVA 2CO6A 3OV6A 3T08A 5MP6L 3VMNA 4WWPA 4UM9A 3OGCA 3EH3B 5FFGA 3MC0A 5B4MC 2XVBA 2A3TA 3SCMD 1YEKH 2PYEA 3KBHE 3AREA 1F1AA 3PWNB 4XZUA 3JV5A 4PHXA 2PO6C 1TTFA 2JMRA 3LQAH 3FTUA 2BMKB 2X3CA 5I30L 5FYJU 3MA9H 1JVLA 1WV7T 1N8ZB 1RZ7H 3VQLA 2CA3A 2LV4A 1U95B 3T71A 43CAA 5HGHB 4MAYA 3HR6A 1ZHBB 4ODUB 5L8KB 4KZDL 4BFFA 1YN6A 1DBKL 3BIKA 4P2AA 4CBPA 2BOBB 3BPCB 2L7UA 3JTTB 4KOCA 1RZQA 2G0LA 5DCCA 1PQZA 1D5IH 1G9EA 3TIDB 4RGMC 2A7BA 4IU3A 2QHRL 2X6AA 4J3UA 4Z0XB 4KKLC 3FU7B 1IGIL 4L37A 3RGVC 4LCWD 1UM6L 1UXWB 3ILQC 1MSPA 3VXSD 1UB5B 3FFCB 1BFTA 3NK4A 2XG5A 2EYTB 5DYOA 4X7EC 1KJ2L 1UWEH 3NZ8A 2F58L 4KKBC 4X4ME 1UD4A 1ND0A 1UB6B 4YE0A 2DMBA 4G7RB 2XTSA 1IFHL 5J1AA 4TPRH 1KBGL 4RLDA 1MFAL 4Q0XL 3DARA 4MSWB 2V17L 2WLZA 1SBSH 2WWMC 4PP2A 3OR7A 1D9KA 4PWKA 4UUJA 4RZCB 2H8PA 5KWYC 2VDLL 4FQXD 1M9WA 1CXIA 1IFGA 5E00B 1BXVA 4UTCA 1ZJAA 3HJ0A 5ABDE 1XZ0A 5DJ6A 3FB6B 3ULUD 3FF7A 4PGEA 2ZKXA 3FTXA 4TNEA 5AB1A 3BZFA 1OCWL 4PJDE 3VFMA 4DTGL 3OMNB 4P2QA 4MJ6A 2VXUH 2DV6A 3M45A 4TUJB 2JJWA 5FGSA 4JFHE 5A7BA 1MWOA 3QUML 5ESQA 4BYHA 3ECBB 3H53A 1RP9A 1DJWA 2VMCA 3F7VA 5H4ZA 2DWSA 1AY1H 3P40A 1JGLH 4CSPA 1JVOA 2BRRH 4LHUB 1G4RA 1SPDA 4ZS6C 2FJSA 3RIKA 2XQYG 5E5RB 3HPLB 3BUBA 3REVA 1EK3A 4Z7UB 2AEWA 4OCXH 3ALWA 3OPZL 1WIOA 4ORGB 1BG9A 2GJZB 3C9NB 4PY7A 3VYNA 4I3SH 3WEBA 4B7LA 1N3NB 5EPMB 3HMWH 4FEIA 4Y9BA 3KM1A 4JHAL 4X5LA 3PLYA 3SDXF 5FPIA 1WGOA 1KN4L 4PGDA 1J9CT 3ARFA 5BW7C 4CNIB 3O0RH 5HHMB 4F2FA 5BZXA 4U3SA 1I3RB 4S11A 5IZ7A 5DD6B 5I26A 3FAWA 5GZNC 2ZX9A 3UCQA 1G5AA 2K7PA 5C9JA 5K9JH 1G1KA 3OLIA 4LCYB 2VMFA 3QQDA 4JFFE 5CZVL 3ARQA 3GMPA 4X50A 5IK3A 4WI2A 3HUJA 4F2EA 4WF7A 5JHDE 1HZHL 1DQVA 2Y6TE 3DUSA 2ZKWA 5E4OA 3WJJA 4XO5A 2AJYL 3LIUA 3MX0A 1NUDA 2QMJA 2R0KL 3AY4C 4NT6A 4ENEC 4F9LA 3NIDF 4WUUB 2OL3H 1KMGA 1K4CB 3G5WA 5GZOD 1YYML 1XGTA 4MMXC 3L5HA 2Z7WA 2CRZA 4W1TA 4NFCA 1UXLA 4QOKA 4Z0BL 3ARBD 4NO3A 1NEZA 2HRLA 2MJWA 1INEL 1RP8A 43C9A 3KPRD 3WD5H 3CK0H 3K6NA 4NWTL 5E2WL 3LKPA 4PJCE 1GYWA 4GOSA 5L2KE 2O5XH 1M71A 1ZANL 1J1OH 1WA2X 1RZIA 4WNQA 4DPBX 3CFKA 4LLMA 1F3JA 2MCPL 1T3FA 3OM3B 4HIQA 1CXFA 5DZLA 1T7VA 5LBVA 1D5XA 4P46C 3MRFB 1LTXA 1B6DA 2OSXA 4MJJA 3VFSA 2EZ0C 4GS7B 1RK0B 3QZPA 4RDQF 3VGHA 4FNLL 2C7FA 3FHQA 1AG0A 4E0RA 1CLVA 5C2UB 1RULH 1FAKT 3U6RB 1YJDC 4WNSA 1UD5A 5DI8B 3DX3A 1H5BA 4UILH 2HZHA 5DTFB 1GZQB 1BJ8A 3VAEA 1UH3A 4Y4FA 4U1SA 3MBWB 1CFTA 2X0VA 4K5NA 4ZOEA 3WELA 2YOCA 4M48H 2E7LC 1WFTA 4AZ8B 1S8DA 1TDQA 2CNZA 3F58H 3OKOA 4JRXA 2VDQB 2R69H 4R7XA 5GRUL 5PCYA 4XMWA 2DW5A 2ODIA 2A73B 4N0FB 3ZDZF 5IB1B 3FSWA 1Z5YD 4J39A 2BZCA 2Y7QA 4IM8A 3MA7B 4TUOA 2BLFA 6FABH 2W9DH 4PLNC 4AM0A 5I1DA 4G7VL 1BIIB 2VW6A 3ECWA 5EU3B 5I5IA 1OKEA 2XN2A 4NRXB 1S9WA 3L9RB 2EDNA 3P0YL 1A4JA 4QRTA 1I7RB 1UA6L 1IC7L 2YGPA 1AOHA 1BQRA 1CLZL 1XH3A 4JX0A 4RFOH 3U4EB 4HC1A 3WTXA 2AVGA 5F93C 2DLFH 3UAAA 2WNGA 1IQWL 1YPZF 3RVUD 2VKWA 4FA6A 4IBYA 1NJ9A 1KLGB 5JQ6L 4DEPB 32C2B 1FVEA 1QRNB 2CDEA 1ZLWK 4B9JA 4BFEA 5I15L 2CUIA 1FL5B 2WLIA 1IBFA 3TC9A 4P5SA 3OD3A 3APMA 4TTDD 1J8HE 2IQAA 4G1MA 2CUAA 2P5WB 3NFNB 5TE4H 1U8MA 1UC6A 1YDPB 1FJ1B 3P9LB 3VWJB 1AQHA 1MHHA 3PWPB 3H9HB 4WK4B 3CPLB 3FUNA 4QNPF 3FFCD 3V4VL 1GGUA 4LPVA 3BRGC 1PD6A 2HFEA 4A2MA 2WWNA 2JJTC 4ZUVA 3V6OA 4A55A 4O51A 3IF1B 3O3EB 1R3HA 5IVZA 1GHFL 1EAPA 3DIDA 5LLIC 3T1FB 2EACA 4AT6B 1DLFL 25C8H 2WOYA 4OLUH 1NCNA 3KPNA 4I7ZC 1L3NA 3B9DA 1DBAH 4BRJA 4H2CA 4BFKA 2F0CA 4NM8L 4D9LL 5I75B 4JVWA 3DYOA 4MASA 3MRJA 1HDMB 4RMWA 1ZTXL 4MA1C 2ARJA 2ADYA 4R6UA 5D5MF 4DUWA 1NCTA 5B39G 2IJ0C 4MMZC 7FABH 5DHVB 3GHBH 4LASH 1KB3A 4OF7A 4A67A 4FE9A 4JQIA 4FNRA 3ZKNC 2O61A 2QTEA 4HKJB 2XWDA 5I1EL 4W4NA 5AVTB 2YAQA 4MNGA 1V05A 3MJ7B 2ITCA 2YEVB 5BO1L 2P5EE 1E9OB 2Q6WA 1A14H 1JYNA 4JZOA 5C0JB 1MCBA 2B1AL 4QKTA 1UQSA 2VMEA 4F3FB 3ULVE 1FFQA 5K59F 2AV7A 2C3HA 5E8NA 2J21A 1RMFH 5G4OA 4FL4C 1YPZA 3DSNA 4KY1L 4FNQA 2UUDK 3ZO9A 1YMME 1HWHB 4LHUD 5C0IA 4OV5A 2ZX7A 3MOQA 4B3EA 2R7EA 5D1ZB 4ZUSA 5BPPA 5I1LB 1FNAA 2FHFA 1UKQA 1IBGL 1A47A 1OVZA 1SXCA 2Y6SD 4JFXA 2VQ1B 5DRNA 2ZXGA 5C6PB 3O4OC 4N0YH 4ZX3A 3HE7A 4L8CA 4QTHB 4XNBA 1RL1A 4FFZA 2J73A 4KK8C 1T66D 5HPMB 4S0SD 1PPIA 5HHMD 3W11C 3VTAA 5IB3A 1HZKA 1CB4A 2WO3B 1YEGL 4E9WA 4FEMA 1IKFL 4YDVA 4YDLC 2MQ0A 2VN6A 1E9PA 3A5VA 3NSFA 3GXIA 1P2CA 1QSEA 1PFCA 3NCFB 3WNKA 4PJHE 1JNNH 4EMZA 2OXGA 4XPTH 2NW3B 1WZKA 4DP9X 4OZGB 1JP5A 3L3DA 4EI5C 4IBWA 1QNZL 3NA4A 2ICWJ 3HR5A 5M7QA 1J8SA 5D5MA 5G4NA 1YEIH 3HS9A 4OSUH 4P5KB 4BV1A 4NOBA 1ZY9A 4V1DA 5D7LA 2CXGA 4H7VA 2CPCA 5E6IB 4WUUD 2KLSA 4TLSA 3ZYOA 4X9FA 3DV6A 4OJEH 5E03A 4G82A 2EDEA 2AJXH 3ULUF 2BJML 3SCMA 2J43A 3HI5H 1PAMA 2ENQA 3SKUD 4ONGH 3SGKA 4HP5A 2H9GA 2DWDB 3AC0A 3JVGA 4XHJC 4F8OA 4MVBC 3EW3B 4WWOA 1J5OL 4P04A 4PJGE 1RVFH 4JQVA 1FBIL 2IO5A 4B5ZA 4G7YL 1N67A 4UV4H 2NR6A 2J5LC 1A7PH 1JJUA 4N8CH 2EIZA 5BXFA 3DKHA 1MHEA 4QXWA 3HOGA 3B3IA 4WY7H 4HLZG 3F83A 5C8JB 3MNZA 4JFSA 2B7DT 3VD7A 3K6IA 1A6VH 1Q72H 2CBOA 1QO3A 3V10A 4LCWA 1OOWA 3GTTA 1PL3A 3VXSA 3WUWG 4XPBH 3GKWL 4YDJA 4G80B 1XGRB 1NBVH 3U46B 1JRHI 1ULVA 4Y9FA 1PZAA 2C5DC 1PYWB 2DQEH 4RCAA 1J5IA 4DN4L 1L9PA 1EJ6A 2VDPL 3HMXL 4APQC 1TTBA 3VFOB 1TT6A 4AYGA 2AK1H 1K5WA 3RVXD 3KWXA 2E3VA 4ZMWA 3S8WA 3TBYA 5FYJL 1ZHKA 1Y1UA 3U9PH 4EPSA 3SKNB 2FWLB 1QWNA 2ZCHH 4FQXA 4EAEA 1B4RA 3NGBB 1QHPA 3E8UL 4CJ0A 4LLDB 3WLBB 4NAQA 3ZIYA 4NAMA 3TV8A 3MRQB 3RY5A 1FIGH 2JCWA 3SDDA 3LCYA 4GMSL 4KZEH 1G0XA 2A5UA 1FH5H 4PI0A 1U6AL 1R1CA 4JO5A 4BSWB 3K8MA 3JT2A 2E5EA 4ODVH 1QRND 3DXAE 1OB1A 1Z9LA 1AQMA 2CO7B 2R56L 1PD1A 4GRWF 4XMZA 4QXUH 5EU6E 3WEAA 3VD9A 4WK2B 1EO8L 2F8OA 1T03L 4HF5L 2P5WD 3C5ZB 1I8AA 3S4SA 2CNYA 4RWYH 3VWJD 3L3IB 3PWPD 1RZFH 4Y2LA 1UGKA 1E4XL 3EYSL 4AL8C 2FEJA 2QVIA 4HGMA 4Y4KC 5KSBF 1SLXA 3B9EA 4C47A 5AKRA 3FFDB 3KLHD 1OP3H 4LXFA 5ISZE 1GS6X 3K2MC 3PJNA 4LVNC 3QXUA 1D3CA 2BVOA 2XTLA 4IOIA 2K8MA 5ELIA 2VDOB 2KZ1B 1NA8A 1I8MA 1Y0LA 2H2PD 1WC7A 1FRGH 5E7FA 5LGJA 3P0VL 4XOEA 2Y3AA 3ZQWA 4FAAB 3GSNB 3L6FA 4LFHG 4XI5D 3DNKA 4S1DC 4K71B 3QW9A 4M61A 4HIHA 5JW4Q 4Z3FA 2H3NA 1WE5A 5E2UL 2G2RA 4K7PL 3V0WL 1CYXA 1CZ8L 5IHUH 3B7UX 4RRPG 3LZFH 3SYPA 4A7QA 3MUJA 2NUTB 2NY5H 4KV5E 3EJPA 4KI1A 4KGLA 4UINL 4A6YA 3L4UA 3QZBA 4QGTA 5TQ0L 5H2BA 4X99A 1T6WA 4WVRA 3SSGA 5ICZA 5IV2B 2I25N 2UYLA 1S5IH 1S78D 3IE9A 1F42A 2QKIA 4WTWA 2X4RB 4MQ7A 4PV9B 5IT2L 1PKQB 1IAII 4N8VG 2HH0H 1JZEA 4FQJH 1MWAA 3KPRA 3K2KA 1CXHA 1KGYE 3HS0C 1HH9B 2A0LD 2WSDA 4NKQB 4NUQA 5D1ZD 5IB4A 2SEBB 3SDXE 2BVQB 1FFNB 2WMPB 5CXPA 5CJXC 3UP6A 4HUXA 3DMMC 3GIZL 4M5TA 3MJ9L 1JGEB 2P24A 1IT9H 4I0KA 5DC0A 4NN7B 4QRRE 4Z7QF 4Q4IA 3SYQA 3QDJA 3CH1B 2P1YA 2YMXL 3ZJAA 1Y7VA 2ZAGA 3UZVA 2Q20A 3MDJA 2WC7A 5CJQH 3FCSB 2VE6A 1HHGA 1ANUA 1OSEA 5E0FA 3LQZA 1A6AA 3DGGB 3FB7B 2UXGA 5BV7H 4HX1A 5SX5H 4EZKA 1BMZA 4V11A 2H47C 1HEZB 4H26A 4XHQA 3TO2A 4AKPA 1G7PB 3NIDE 4IKNA 1T83C 2CMRH 4QYOB 5LQBL 1TFPA 4P9HL 1KT2A 5TDPB 1OPGL 5KVDH 2X89D 2ZE0A 3MRRB 5EA0L 2LFEA 1D5BB 4ADIA 5E6ID 1BV8A 1OQXA 2D0FA 1IUZA 2XACC 5L6YL 4K2UH 5KBPA 3BFQG 4YXKL 3AQZA 2MNUA 2GG1A 2OK0L 4AVIA 4ZD3L 3GEFA 4UIKH 4FXTA 1HU8A 1YQ2A 3OJVC 2Y1ZA 3AMLA 3QRFM 2XXCB 3EDJA 5LXGL 1U95A 2APXA 4HU2A 1ZHBA 4ODUA 3T4AC 1BW8A 4LDLB 3ELQA 4L1HA 1ZHNB 3IPBA 1N12A 2BOBA 2QZ5A 3BPCA 3JTTA 4M3HA 2QZQA 2G75A 5F21B 4DEWA 5DF0A 4Z9KB 3TIDA 1CURA 1TJGH 4LPUA 4W6YB 1LM8V 3MV7E 5JOPE 4JGMA 3FB8B 1HX0A 3L48A 1KEML 1UXWA 4OZIE 4WWKB 3FFCA 2BP0B 3VVVA 2EYTA 1YJDH 1TJHH 3BT2H 4YJZL 4OZHE 5F7KC 1KYOK 5TDOB 1TR7A 3C5SB 2C1PA 1LVEA 1F3RB 3L1OL 3VJ6B 3WEMA 1UB6A 4AITA 2WXMA 4GMTH 1E28B 4LQFL 1I1AC 5DJXB 5JPMB 3N1GC 4P4RB 4ZO8A 1X7QB 3V5DB 3ZN6A 1Z3GH 3PREA 1CDIA 3ZTCC 4JDVB 2Z0UA 3R8QA 4KTDL 2EKJA 3P2DA 5E00A 4AGOA 1AD9A 5MEPB 4BQ6A 4WHYG 1N0XL 4ZSOB 1K9TA 3FB6A 1AS8A 2YUXA 1R3IH 3BWUC 3CC1A 2ZP0T 3HNSL 4K8RC 1PZ2A 5DUPH 3ZTEA 2D3NA 1JHLH 4YO0B 2VIRB 5FKPA 4BH8B 4ODHL 4KTEH 3QO1B 4X42A 3TV3L 3GM8A 5KANI 1CD1B 2DM7A 4W9IC 4AYDC 4OLVL 1VDGA 4O5LL 4TUJA 4Y2OB 2VDRH 4QNPE 5EF2A 4H1LB 1PX3A 4MLIA 1R5VB 3PGDB 3ECBA 3ZHDA 1NAML 3C5ZD 1G6RB 4XVSL 5IVOA 3M07A 4F8PA 1G6VK 4JE0A 5GS2D 5H37A 2ZXAA 3HPLA 2C26A 3FS9A 1QZNA 4Z7UA 2BWQA 1NDGA 2R2HA 4FX5A 1EHXA 2H6PB 4ORGA 1H8NA 3C9NA 1JL8A 1NCGA 1N3NA 1MNUL 3DO3A 5EPMA 1GA2A 4Y4HB 5ID0B 2IAMB 4HMCA 3IJHA 1K85A 4CNIA 5I28A 1HK6A 3SBQA 1PY0A 1BX2A 4L4VB 2OR9L 3V4PB 4F7MB 5IUCA 4LCYA 4A04A 4K7PY 3BZEB 3BAEL 2MWCA 3QT2A 5IQMA 5HDWA 4PMFA 4UYQA 1NSNL 1YC8A 1YO4A 2P47B 1QI3A 2VDKB 2X4PB 2WQUA 4CMMB 2VM3A 2WKOF 4GBXC 2A6JB 2GY7B 4FJYA 4FNSA 5K59E 1NMCC 2IFGA 1WS8A 3VXTB 2Z34A 4E9TA 3ILDA 3KPSB 4S1SH 1FWXA 3S97C 2CH8A 3FO2A 2WXRA 4YHLL 2WOBA 1D7CA 4WUUA 4LPCA 1K4CA 2WKGA 4WHTA 1DJSA 4KNQA 2J6EA 4KJWC 2C9UA 4HYTB 5T5NG 4MB5A 3PU7A 1WLHA 4WSKA 1UCBH 1WUNT 4XNXL 2CUHA 1Y07A 1MVYA 3MA9L 2RCSH 1ID2A 1U21A 4U3HA 3EYVA 2VZ3A 2I69A 3FONB 4KZ0A 3LZNA 1DANU 3OWRA 3MRFA 3RRQA 2YKLH 1RK0A 1WAPA 2WO4A 1H19A 5J9PB 4MWFB 2VSKB 5TQ2H 1DQJB 3VXQB 5BVPH 1D5IL 3B6SB 5B3JF 3RPBA 1FC1A 5DI8A 2DJ4A 1C7SA 3CHRA 1GZQA 2EEBA 3DHJA 5DTFA 2WXLA 5DVOA 3MBWA 5FXCH 3WFHB 3TM6A 4PJBE 4OZFG 5L4IA 2G5UA 2DF3A 2CBQA 2X4NB 3GI8H 4WGWB 1RCYA 1UWEL 4AZ8A 4UDUA 2DI8A 4Y5XC 1JPSH 4OF3A 3HC3H 5DQ9B 3BGMA 1TJIH 4FLRA 2A73A 4N0FA 1QR1B 5IB1A 7PAZA 2JJSA 2HA1A 2ZWLT 4M1DL 4TPRL 3UG5A 3MA7A 3S6CA 1JZIA 5CD3B 1SBSL 1BIIA 5AOZA 4ZMTA 4TXVB 3SY0B 5EU3A 3EGSB 4NRXA 4ODXB 1G7QB 3L9RA 2OSYA 5DJYB 4HUMB 2WXKA 1I7RA 2XNAB 2Y4SA 2EDWA 2EUZA 3O3DB 5DLLA 2HT2C 4Z76B 5T1DH 3U4EA 1U36A 4L0YA 4P57B 1N9PA 5HGAB 1PJWA 1J12A 2ZSVB 4ZNCD 4BUHA 1JGVH 4QGYA 3IBOA 3TBTB 1KLGA 2ZXCA 32C2A 1QRNA 4JPWL 5EZJB 2ZTBA 1PZSA 5CJOH 1HAUA 2PW1B 2P5WA 3NFNA 1YDPA 3OJDB 1FJ1A 3P9LA 4X80H 3VWJA 1P7KB 3PWPA 3VXPB 2EYRA 1AY1L 3H9HA 4RFNB 3CPLA 5FO2A 1GPOH 2CKBL 1DYZA 1T4KB 4WWKD 1ZLVH 2C4FT 12E8L 3I3BA 4WZ9A 4AYBA 5I1AA 1NCIA 3CC5B 5IHBA 4K5MA 2JLLA 4WCYH 4I2XA 1M2VB 3FSOA 3IF1A 2VR3A 3O3EA 4OCXL 2XWRA 4OJDH 5IWLA 1F41A 4KUZH 4HH9B 5AVXB 2IOMA 3T1FA 4I3SL 3TPUB 3HMWL 5EU7E 2AZAA 2NSQA 4W9JC 1U8HA 4OZGF 3O0RL 3ME0B 4WI7A 3LMJL 3N42F 4PR5A 3W1ZA 1MVUB 1OE1A 2CDFB 4L3FA 2O6PA 1U8IB 1HDMA 1N70A 3E1F1 1HHJB 2WVVB 3L3GB 5DHVA 3WXWL 4XNMB 3LEYH 4PYHA 4P2YA 5CKAA 3HI6H 2K9FB 3OZKA 2J5WA 3BO8B 3RVTC 4ZQKB 1W0VB 3MJ7A 4IHBA 1DFBH 4IRSB 1ZDSA 4ZMNA 3ULVL 4K23H 4UDTB 1RFDL 2OMVB 1E9OA 3QUYC 3KW7A 3CXDH 4PRPB 5ICXB 5C0JA 4QTIH 5F6HI 1XD1A 3QR0A 2OL3L 4HXAL 5AZ2H 1AO7E 2HT4D 1NWOA 4WUKH 4HJ1A 4M6NH 5DWUH 5KSBE 1B88A 4WGVB 2W80C 3V0EA 3SGDH 3BUPA 4X9GA 2X1OA 3HRZB 4HKBA 5E08H 3WXVH 2OXHA 4K94L 3LN5B 5D1ZA 3CK0L 5I1LA 1NBCA 1KLFB 4U1MB 1NUFA 2VQ1A 5C2BH 3FO0L 3T6WA 1J1OL 2P7TB 3D12B 1KYAA 3BVDB 1NKGA 1YEEH 3DJRA 3H7LA 5FKAB 3QWQB 4Y4HD 2IAMD 3ZYZA 5HPMA 4UF7C 3EJJX 3D0LB 3ZZLA 3M1BB 5E5UB 1X5ZA 3DJZA 4TOYL 3QPKA 4L4VD 1VCAA 4DGIL 1QSFE 3T0EE 2X2HA 4UILL 3RTQC 3G6AA 4ANVA 4BJLA 1KELH 2NW3A 4OZGA 5I9QB 3VRIA 3WUWB 1P1ZB 1UOVA 2WLNA 4M48L 2EIKB 1J1XH 2JF1A 3VWKC 3BW9B 3KPSD 2DI9A 2V33A 4TLTA 2B15A 2QLVB 1G7LB 2X89A 3T6XA 3W2DL 3KS0H 4K3DH 1DUYB 4M43H 4AQ8C 4RMVA 2VO8A 5JIHA 5I1CL 2DTSA 5C0BE 4ZMOA 1OLZA 3IDXL 3L4YA 2OCCB 3FMGH 2R27A 3AS3A 5TE7L 4KGJA 3U83A 2WB1A 2XN9E 2XQBH 2DWDA 3BYTA 3PY9A 1UD6A 2B08A 4HJUA 4YQXH 3SB3A 1LE9A 2QJDA 2IMNA 5AW3B 3HZ3A 3G3LA 2F5AL 4RFOL 1C9SA 5IMLB 3VU2A 3PE9A 4PV8B 1MPAH 5DVNA 4AIOA 2NTSP 2DLFL 3LIZL 4GI6A 5KANG 3RB5A 5HYQA 4MNHA 3MJ6A 4YR6A 1N7ML 2M26A 5C8JA 4PLJC 4I87A 1B9ZA 2HCZX 4I5BB 4JG1H 3OMAB 4MAUL 3DVIA 4HA1A 3ULVC 4AWJC 4DF9A 5TE4L 2IPUG 2XTJB 3U6XA 5CN1A 5IMKB 1SUHA 5E99H 3VFGH 3OTTA 1ACZA 3Q1EA 4G80A 1XGRA 2EH7H 4J7RA 3U46A 1R3LB 3QJRB 1GCFA 1PBYA 2Z31C 1ZS8B 4HIEB 1PYWA 4A7VA 4BQ8A 5KYXB 4AYFB 4K94C 3VFOA 5DD0H 3TVMC 3IU3A 2X1PA 4FOMA 1WISA 2NY4C 4HVBA 1RURH 25C8L 4XC1L 1L5GB 1OT1A 4AIXA 5B1BB 2FWOB 2J57A 5E6RB 1DBAL 2YD5A 4DZBB 2YPVA 3QWOB 1OXYA 5B7MA 3SKNA 1HXKA 3WFDH 5AKVA 1R34A 3BCFA 3KYAA 3RIFK 3D9AH 2ICWB 3EO9L 4EKJA 5IGXH 1IC4H 3MGAA 2FYYA 5F44A 3GHBL 4LLDA 3WLBA 3ZE1F 1FNSH 1FFOB 3MRQA 3FBKA 4TNVK 3KXFE 2WVSA 3NN8A 1WZ1H 5I82A 1SFHA 3LOWA 4DUVA 2DOCA 4BSWA 4PGBB 1A14L 4ZO9A 3COOA 3EJYD 2CO7A 2GSGB 3MJGX 3HBGA 1FUNA 1S7UB 3LKRB 4PP1C 2YD2A 1PAZA 1RMFL 3C5ZA 4FFYH 4FN0A 5GRJL 5F3HB 2DH3A 3L3IA 3SDYH 4UTAL 1A4AA 3T9WA 1R46A 4MCNA 2DBJA 2VZUA 2HT3D 1K3IA 4IQHA 2L4OA 4D8OA 2JH2A 4K5LA 1T1ZB 1UASA 4N0YL 4OF6A 1B4LA 2YWYA 4GUCA 5KSAB 3BQUC 3TN0B 1U91A 4H44C 4Z18A 4PGZA 1AHKA 4GEIA 4GINA 4N3TA 2VMJA 2QGBA 5C08E 3GSNA 4I9XA 1XTLA 2F8XC 1QLFB 1MJUH 3CVBA 4DKAA 1XB6A 3FOMB 2QPUA 5MEQB 1I7TB 4BSJA 3GUFA 2VISA 4W81A 2FRGP 1JNNL 3Q1SH 4S1RL 2PXYB 2NUTA 4XPTL 1PY4A 1W72A 2BSBA 2O72A 4Q6IC 3X1EA 5HDQH 5A2IH 1A65A 1KZQA 5JLZB 2VR5A 4I18B 5JMRA 4IRSD 3SDAC 1M7XA 3O0LA 5EBWA 1YEIL 3KD4A 4OSUL 5IV2A 2KS0A 4PRPD 2OMYB 2RA1A 3T3MF 3IWVA 3B8YA 5HVGB 5BRZE 4ELKB 2X4RA 2XX1A 3FYEB 3VI3B 1Z7JA 3MCG1 3M17B 1PKQA 2AJXL 1A6UH 1KCVH 3NRPA 3OHMB 4HGWB 3SBRA 2H0EA 1NMAH 4OD3H 2Q5BA 5HTSA 1HHHA 3CSFA 4ZRGA 5HD8C 1OTSC 2L7JA 2OJZL 4NFDA 1HH9A 4G3YH 4E9VA 1RJLB 3H9SE 1KB5H 3KM2A 4HHAA 2SEBA 4NJAH 4UNIA 3FDWA 2BVQA 1FFNA 2WMPA 4JQXC 3BZDA 5CZKA 1QAWA 5I17B 5GGSY 1JGEA 4UV4L 2IVFC 1A7PL 3HKFA 3T3PB 4LVHC 3GZOA 4RFEB 5GS0D 5JA9A 3AS1A 5J5EA 4U1IB 3CH1A 4WY7L 3II1A 3HLKA 4ZNEE 4EO5A 2X4OA 3GJFK 2GTZA 3LJ3A 1BZDA 1A6VL 4UMGA 3L7FA 4O02H 4N90D 3V79C 3FCSA 3HAEB 4GSUA 2K3TA 2VERA 3DGGA 3FB7A 5LCVA 4P4KB 3MBEC 3O6LL 4XPBL 3HHMA 5ENWB 1HEZA 3F04A 3O6FC 1G7PA 3E6FB 3BKJH 4QYAA 4BK5C 2BVYA 1X9UA 3O41B 4QYOA 2XN1A 5TDPA 1CQYA 4WKXA 1OANA 3MRRA 4LMQE 1D5BA 1S9XB 3GB7B 1Z9SB 1BG1A 2MFNA 2P45B 4AQ1B 1YCSA 4X7CC 1PNDA 4NBXB 3D33A 3U9PL 2ED7A 4FKKA 2NT0A 2ZCHL 1JD7A 4LBEB 4AMWA 5BOZG 3AABA 5C6TH 1CK0H 1PG7W 4JUTA 1FIGL 2ZX5A 1ZHNA 3JWNG 5B3JE 4L8SB 3RE0A 1IGMH 1IAOB 5DJ0B 1DVUA 1R17A 3HG3A 5DYFA 5CD5D 2SODB 1BVKA 5EORH 1XAKA 3AGWA 2N4IA 4JANB 4ODVL 1AE6H 2YGQA 1IC0A 2MEJB 3DROB 4J28A 1A3QA 5AW8B 2HX8A 2JKRM 2XTJD 4KO6A 2LU5A 1RZFL 2BP0A 2MSPA 5FW8A 2E46A 4M8UA 5HDBF 4PB9H 3Q2NA 5EN2A 3UEZA 1OZTG 3BISA 3EOBA 5GJTH 5TDOA 1OHQA 2XQYA 3C5SA 1NUNB 4CC4A 1SYSA 1DO6A 4YDIH 4HEME 5D7KD 5DA4A 2BNQA 2BIPA 3OX8B 4KRPB 3VJ6A 4AYMC 5KAQG 2W07B 4EN3C 4LGPB 3II3A 5DJXA 4P4RA 3REWB 5JPNC 3U1PA 5CLZA 4L48A 4D3CH 1X7QA 3V5DA 1OTTD 1U3NA 3HE6C 2I85A 4JDVA 1J10A 4M93B 3GMMB 3I75A 3D06A 2JB5H 3PNRB 2XKSA 2NCEA 3LXAA 4JZJC 5MEPA 3LZFL 5ANME 4ZSOA 1Q8MA 2BSTB 4ETYA 4NIYE 2NY5L 1SXZA 3UPCA 4FLOA 5D7IB 4YO0A 4BH8A 2VIRA 1K8IB 4M7ZB 4JDEB 4R7VA 3QO1A 5G4MA 2D2CC 1CD1A 2V5TA 4MKTA 2HFFB 3B34A 3TA3B 3TBSB 1JSYA 2OSLA 4Y2OA 3LNGA 1JPTH 1BAWA 3LVTA 4G6MH 2A77H 4H1LA 5KW9H 3J2PA 1R5VA 4NNPL 1M6OB 3PGDA 2RAMA 2DDQH 1G6RA 2HH0L 1EFXB 4JN2B 1XQ4A 4UOJA 3CVCA 4FQJL 4KFZC 1E65A 4YEEA 1PEZA 5BUPA 4CADA 2IPTH 1Y18B 3C6LC 2WNKA 4HCGA 4XBPB 1FCCA 1XIWB 2H6PA 1CCZA 4XN9A 4ACTA 3K4DA 5HY9A 1J8KA 5HGBB 1DCLA 1DVFC 1UJ3B 3SN6N 1L9RA 3QDMB 5KSAD 3TN0D 4Y4HA 5ID0A 2A99A 2CQVA 2ZP9A 4OLWH 4U2YA 4DPCX 2V5RA 4DKTA 3RKPA 1MCPH 4L18A 5AAPA 3P2BA 4L4VA 2VLJB 3AUWB 2E75C 3QUGA 4OIIL 4F7MA 4FZ8H 1FYTB 3Q8FA 4JKWA 3TESA 4G9DA 2YKKA 3VDCA 3ZL4L 4FFVD 3BZEA 3NCBB 5BV7L 4JKPH 3AM8C 4FERA 3CSPA 3GXTA 4ISVA 4UT9A 2X4PA 4Y9EA 1MFDH 3O4LE 2PXYD 4J23A 1V55B 4KH9A 2E7BA 1U8OA 4HJ0D 2A6JA 1ZXQA 4PJ9C 5AYTA 4AYSA 1BZQK 2I9LB 4Z7NB 3VXTA 4OZFB 3KPSA 3ZGHA 1MRFL 5EO9A 1Z9MA 2A6KB 3P3YA 5DLMH 5EZLB 5KVDL 4LL1A 1X5LA 1LL1A 3N50A 4XXCA 3QDGE 4IRJB 1CI3M 3RDTC 1GMIA 4K2UL 2R0ZH 3W0WB 4P2RA 5ALCH 5DMGC 4DW2H 4J2QA 3U4KA 2VXVH 3FCUB 5IHHA 1AQDB 1B90A 3E9TA 2GBVA 1QSZA 4JR9H 4JRYE 1TZOA 5FWRA 1INQB 2HFGH 5I6XC 1BA9A 2OM5A 3FONA 1U3JA 3PCYA 3ATBA 4X6BB 3DURA 1KXVC 5I8CB 3Q8AA 5AZEH 4PRIE 2DQMA 1KY7A 1Y1DA 3CZGA 5KTEH 1WITA 1R4XA 2GSIA 5J9PA 1ESOA 4ANKA 4BZ2A 1DQJA 1DVTA 4HWZB 3VXQA 4PJFE 1H15B 4J3TA 1MF2H 5KYYB 4N0UE 4E9QA 5DMIH 1TJGL 5CS7A 5BCAA 2YOAA 4JM2B 2NY0B 3UAJD 1MJJB 2K7QA 4P4KD 3JV0A 3NZSA 1WAAF 4PUBL 1GTFA 1QLEB 2ILLA 3WFHA 1MNNA 5BQ7B 1EAJA 2Z91B 1GS7A 1TJHL 4CSZA 2X4NA 1A2YB 1K4DB 3KYNB 3T0WA 1C16B 1TZIA 5IBTH 4S2SB 1P5UB 2BH0A 2A74C 3FUHA 5DQ9A 2VSMB 3FK3A 1QR1A 5JW3H 1OAZH 5F9JB 4L9LC 2DQFB 4JFOA 2ZOWA 4J3OG 3DX9B 3VO0A 2BVEA 4IRZH 1AGBA 4LEOB 4ESKA 4WJ5B 2VN7A 1E4XI 4XXWA 1BZOA 2WHVA 3L2NA 3EGSA 3SY0A 4ODXA 2BXZA 4PW3A 1EPFA 1ORSB 1G7QA 5DJYA 3IM1A 2X4SA 1MHPH 2XNAA 1OGAB 4DP4X 3EBAA 3O3DA 4D94A 2E7DA 2FB4H 4P57A 4GSDH 4QHMB 5HGAA 1T04B 1R3IL 2ZSVA 1NCAL 5DUPL 4PTUA 1JHLL 5CINL 4KTEL 3R1GL 5FW6A 2APBA 4GY4A 4UZSA 1CGSH 1PG7X 3IAPA 4HSAC 5EZJA 1F4WL 4OIBA 5L8JB 2ZXWB 5GPRA 5I73B 2VDRL 4LGRB 3B2VH 1WBXB 1AZNA 2FO1A 2PW1A 1KDJA 4FMKA 3B7RL 4GW1B 3OJDA 1UOKA 1ZRUA 1P7KA 4KZCA 5IQ7L 1T4KA 3WV0A 2WLLB 1RPKA 1JZ4A 4LAJH 3CC5A 2H1PH 4LQ1A 1IM9B 4PW9A 2X42A 1M2VA 4RMTA 2N0KA 4HH9A 4YLQT 1NKRA 5F9WB 4KRPD 1TLMA 4MS8C 4UOQA 3VXRB 1CFVH 3NEEA 5DWPA 5ACZB 1GMEA 4TVPH 1GGYA 1MVUA 1ACXA 3ZE1E 2VLRE 3RA7L 4Y7MA 2OTPA 3KZ8A 1UFUA 4K3JH 5BJTB 4G7QB 3HA0A 1BFOB 5GGRB 2WD0A 5B1JA 3GS4A 2P26A 3L3GA 3OKMA 3RX9A 2YFNA 4XNMA 1VIWA 1CTMA 4H5SB 4XBGA 3P73A 1EO7A 3BO8A 5INCB 4W9KC 1W0VA 3VVWA 2DY2A 2F54E 5LN4A 1QHOA 4IRSA 3CZKA 1CI5A 4ES8A 4UDTA 4M1CD 2OMVA 3VXUE 2HSIA 2F5BH 5ICXA 1SVZA 4HXBH 4PLKC 1IEHA 2D9CA 4M02A 3TA3D 4Z6AT 3SOBH 1BVOA 4GP8B 4K0OA 1UEMA 3NBNA 1I85A 2BY3A 4NRYB 4JBSA 4X4YB 1QW8A 3QUXB 3A23A 2WM0A 1CFBA 3HRZA 1EFXD 2VXSL 4NQSB 1JYXA 1TPXB 2YRZA 4U1GB 1UCBL 3LN5A 5HVFB 4NLHA 4A7UA 5AVVB 5FYLH 1I53A 2AP2A 4PWIA 4ZW7A 3PPEA 1KLFA 3NIGF 4D0CB 1XIWD 4ZMPA 3LXCA 1ZIBA 2OR8A 2P7TA 3EFFB 3IFNL 4F57H 1CDJA 2IDQA 1KPVB 2LLGA 3CN4A 3QDMD 1IX2A 4HQQH 5FKAA 1UM5L 1V7NL 3VFNB 4WGKA 1E5BA 1T5WB 2X05A 4ZO7A 2YKLL 4RETB 4KDTC 4XCNB 3D0LA 2ORBL 1I4FA 2FBOJ 2DYPB 3M1BA 5TQ2L 1LK2B 1XTMA 4MDRA 5BVPL 1F18A 2VLJD 3ZQXA 2JCCE 2R15A 1FYTD 2Y0SA 4MQSB 4LGSB 4YSTA 3J8F7 4HUWB 1EFQA 3WUWA 3T3ME 4UNVA 4Y5YA 1P1ZA 4E9SA 3U30C 3GI8L 3LRGA 3BW9A 1OAXH 2Y2TA 1I9JH 2EINB 1G7LA 1JPSL 3RVWD 3KBEA 3HC3L 1JCKA 5HVWA 1TJIL 1DUYA 3TYGH 5IM7B 4CU6A 4IRJD 3LPOA 2WANA 3CXHK 3KMDA 3S5ZA 5EU7C 3W0WD 2F15A 3EDKA 4R2GC 2Q87A 2FWUA 3QDAA 1X6LA 3Q8EA 3ZRSA 1N6UA 5SWZB 4AXWB 5GZOC 5K1NA 3C09B 4LLVB 1JN6A 3ARBC 4GT7A 5T1DL 5IMLA 4AIZB 4NYLB 1W8NA 3G08B 1BHGA 1FLRL 1MXDA 2LABA 5TJWK 4YXHH 4OR1A 3ARVA 2YA0A 3HFMH 4XCFH 2LVCA 5IROD 4NO0B 3F7YA 1ZK9A 5CJOL 4N2EA 5AWNH 3WHXB 1S9VB 1NFAA 4XN8A 4X80L 4JM2D 2NY0D 2HG0A 4EE2A 3QRLA 4Q9QL 3QC5X 4Y2DB 4WCYL 5KYXA 3FT0A 4AYFA 4JREB 5E24E 3QJTB 3Q5TA 1XBRA 3K6OA 4KUZL 4W70A 3V0AC 4XAWL 1FPTH 2R0LL 5FO9B 1L5GA 5E8EB 2YAMA 4ZPTB 2YQBA 1KBKA 3DOSA 4PEEA 2P5PA 4DZBA 5JIMA 3QWOA 3Q44A 4W9FC 2YQGA 1BAFH 5DS8A 3MRIB 3ZU8A 4BH7B 4NP4L 3MU3A 4TVPE 5ID1B 1SXNA 2ZP8A 2ICWA 1SHMA 3QZWG 5J4MA 5DQDH 1OGAD 1NCWH 3BDYH 4N6QA 5EBMB 3T0EC 2CIKB 4X6CA 1FFOA 3AAZB 3HI6L 1RSFA 4NUMA 3NEOA 5F7WC 1DFBL 4LKCA 1OK8A 1ZPUA 4K23L 4PGBA 2JKJA 3CXDL 4NQCA 3ISYA 3ZDXF 1E5CA 4JFDE 3BLPX 5HDBE 1S7UA 5AZ2L 3OAZK 5J13B 4WUKL 5B8CB 3SD2A 4M6NL 1EEZB 5L9DL 1BGXH 2HKHL 4GG8B 3WXVL 1PGRB 3VD4A 3GMRB 3WJLA 5CZRA 3HB3C 2I07A 3MGTA 5D4HA 1IM9D 1KBWA 2R2EB 4FYTA 1YYCA 4WW2B 2QDWA 4HPYL 1JNLH 3L5JA 1WZAA 4FP8H 5FYLE 5JIIA 3RGBA 3ABZA 5KSAA 3TN0A 2B3IA 4YHMH 5GQBA 4EIGB 3KR3H 5IKCB 2HB0A 2PO6B 3VD3A 2X4TA 2P44B 3FHEA 3VXRD 2PR9A 2FYVA 3ZKMD 1DSFH 2V37A 4Z78B 2YK1H 4JRFA 2AABL 1MEXL 1QLFA 4LHJB 5MHSD 1FN4B 4XCCH 2I5YL 3FOMA 3MNMA 5MEQA 1I7TA 1E6OH 4OD1H 1PNCA 3FZUC 2PXYA 4NNXB 1KELL 3GBLA 4PRBB 3RPIB 4G71B 2ZPKH 2GJJA 1RJYA 2Q86A 4I18A 4RGMB 3C8DA 5JLZA 4QWWC 3TX4A 1M6UA 1J9TA 2VXQL 3RGVB 1WA0X 4GIAA 3A4FA 2OMYA 1DHKA 4K3DL 1XDTT 2FX8H 4M43L 2E56A 1XGUA 3HHSA 4ELKA 1JF1B 3SE8L 3VI3A 1GIGL 3EBIA 3M17A 2WGXA 2YARA 5GGVH 4B9PA 3KAAA 3QUXD 4HGWA 1XGYH 4MB3A 3RY6A 3KYMB 1NFDB 1Y6NR 2N1KA 3RYMA 3TFKD 4HC1H 3LKQA 2HLEB 2RFXA 3DOHA 3JWOH 1RJLA 4AV4A 3GMOB 4LIQE 3ECQA 4YX2H 1E90A 3MHZA 4KVCH 4OQTA 5CHNB 5LBSA 5I17A 1T2JA 4N2IA 1NGPH 1T89C 4HS3B 3KPMB 1V54B 3LD8B 1AZZC 4KROB 4L29B 1ECYA 4LRNH 4RFEA 4AOFA 4U1IA 2Y6SC 1HEJC 4M8VA 5C0AA 5I5RA 4HK0B 3OZ9H 2NDFA 2DYPD 1N18A 3MVSA 1UVQB 4GXUN 5LUMA 5CCKL 4QCIB 5LAXB 5T1KA 5C0EB 2FJGB 1P9MC 3SE4C 2ZYIA 3A6BH 3HAEA 1L6XA 1MCNA 4LOUD 3UAJA 3MLVH 4P4KA 4L2YA 4AH2B 5ENWA 4KXBA 1NDTA 4B97A 3GXDA 1EUUA 2Z0BA 3E6FA 4JHWL 5I1JL 3O41A 4O2EB 3QNYB 5C3LD 3CFDA 4WJKB 2YD6A 5DD0L 4FABL 5ADPH 2ZOLB 1MCOH 4PCKA 4QO1A 5HHXL 3BH8B 1S9XA 3GB7A 1Z9SA 1MJ8H 2WVTA 2BVUA 4CKQA 4U4BA 5I19H 1U33A 2X41A 3B5HA 3FUJA 2XFXA 2R9HD 4MB4A 1UJTA 3MACH 5DQJB 4NSKB 2CHZA 5D7IF 3WFDL 2JFCA 5LKNA 2UWEA 4ONFH 4JQIH 3LZRA 5CJBA 1ZTMA 1U3ZA 3NJKA 5D8JH 1QHQA 1IC4L 1PSKL 1ET7A 1FNSL 1KACB 2WTOA 4R4NC 4IBQA 1TITA 2IDTA 1WZ1L 4ZO6A 1OHZA 4KKPA 4L8SA 1ADQA 1F56A 1IAOA 2RHEA 5D71H 5DJ0A 3NRFA 4D9RE 4KITB 1HHIB 5T5NF 5AD0B 4JANA 1NC2B 2PR4L 3BUQA 4NO0D 4QOKE 5F7AA 3X3FH 4FCAA 1TETH 3DROA 3DX0A 5K9OA 1IC5L 2EXSA 3N41B 4F93B 5IREA 1HH6B 3PIQB 1KJ2B 4Y2DD 2Y3NA 4FFZH 4KUCD 4YSDA 4MMXB 1AYOA 3QEGL 1RQ5A 1AGDA 1VENA 2W07A 3P4NB 4Z3EA 2VLME 1R3KB 3REWA 3TBBA 3KJ6H 3PDOB 1HXMB 1OSZB 2YD0A 1EDYA 3H8NA 3WGUB 4JFVA 1G7HA 3ZMEA 3KL0A 2DKSA 3US1A 4Z7NF 2VDLB 3NSXA 5C1MB 2Q2LA 1MJUL 1EXUB 3GMMA 5I1HH 5DHYB 5DFAA 3HHRB 2VCOA 3ZE2B 4B9CA 1DANT 4RNRB 1Q9OB 5E7BA 2PMZA 1ACYH 2BSTA 3TLRA 4JRXE 3WHE1 2ZOUA 5D7IA 1K8IA 3SE6A 4JDEA 4ONHB 2QGCA 1QPXA 3FF8A 2HFFA 4TNWK 4PRNB 3VGEA 3TBSA 3QUKB 2W94A 4KI5D 3IFOB 1CUOA 3AXIA 3NSJA 5ERWB 5C97A 4XC3H 1M6OA 4AJWA 2XA8H 4XPAH 1J9RA 1I3UA 4JN2A 1HE8A 1B0IA 2BFVH 3QCVH 5EU5B 1F4XL 4N85A 3QJOA 2AJ3B 1QD0A 2HJFA 3GJFB 3QORB 2VXTH 3BVTA 3FCBA 4XBPA 5AW1B 1XIWA 4MJIB 3KWWA 5B4MD 5HGBA 4NZDA 4X9BA 1I7ZA 1UJ3A 3QDMA 4XMPH 1GGBL 5ECJE 3GXFA 2PO6D 1FGVH 3H42H 2CGZA 3L3OB 4IBZA 4YSPA 1A4KB 2Y7LA 2W0LA 3UADA 4B60A 4PWGA 2YQ3A 2VLJA 2B1HH 3QI9C 5HYJB 4FXGA 3F3HA 2KPWA 3BJ91 1AHWC 1FYTA 2H2PC 2JE8A 1UYWH 4ILDA 3NK3A 4PTTB 1AZVA 3QXWA 4LLWB 1SNRA 4NZUH 2D4DA 1NGQH 3MOAL 3QFDA 3FRPA 4KQ4L 1QASA 1A21A 1OTUC 4L3CB 4UB0H 3TP4A 4Z3HA 2PPFA 2I9LA 1NL0H 1IRAY 4OFVA 2GHZA 4EN2A 4POUB 2WPGA 3NCCB 3GJEB 2A6KA 5F7YC 1URIA 4KKLD 1DFXA 3ARSA 1WFNA 1I8UA 3P9WB 5EZLA 3RGVD 3ILQD 4KO9A 4MJ5A 4IRJA 4OFYD 2E7CA 2ZWZA 4OT1L 2J4WH 3W0WA 1HWGB 3MV8E 4C56B 4AEHH 1AQKH 3NIGE 4KKBD 1UWGH 5IJBC 3CU7A 3ULUH 3NP3A 2K1MA 5EO0B 4PJIF 3QCUL 2FLRT 2ZCKL 4M1GH 2Y06H 5C6TL 1CK0L 4XO3A 4BK8A 1AAJA 2XA3A 3OKKB 1INQA 3UYPB 3N44B 3P3TA 2JVUA 3KGSA 1KLUB 2WWMD 4X6BA 5I8CA 2BPBA 4MA1B 1IGML 4KROD 3S35X 1BSIA 4YWGH 2ZX6A 2VJXA 4MMZB 3L54A 5AB0A 4HWZA 1AE6L 2RALA 1H15A 3RP1A 3VW3H 1EXHA 2N3JA 5E8PB 3S37H 4M7JH 5CEXB 4JM2A 1G9MH 1OGSA 2AITA 3PQYE 1MJJA 1ITBB 3QAZB 4GAJH 4AW4A 1UA3A 3CD4A 4H4NA 2HKAA 3QHZH 4QAMB 4ZT1A 5F71A 2Z91A 4BE6A 4XP1H 1F58L 1DSWA 2G4GA 1W6LA 1A2YA 1YNKH 3KYNA 3TFBA 4GUQA 1C16A 5GJTL 4S2SA 1P5UA 2G2NA 3C5XA 4FL4B 1HCFX 1MLBA 1S46A 3AQDA 3C6SB 4J3WA 4Q4EA 2J56A 1WCBB 2QVKA 2ZWKA 2DQFA 4B0MM 4I3RH 4RDBA 3LTVA 5JOFB 3DX9A 1J7VR 2IFFH 3NG5A 1JZJA 2CKNA 4LEOA 1MW0A 5HBBA 4U6HB 2AC0A 2F7PA 5FCUH 4ACPA 3O4OB 1H9VA 2F53E 1ORSA 2XWCA 4MKMA 4AGPA 1O75A 2J55A 3PG2A 3P9MB 4OM0H 5E6IC 5K39B 5L0QC 1JFHA 1OGAA 3N0PB 3TNMB 2JB5L 4BZ1A 4A6YH 4Z8FH 4NN6C 4OKVB 4M4RB 4EOWH 1E3ZA 1T04A 1OPOA 4TL5A 1NIDA 3ZL2A 1Z9NA 5GZND 1RUMH 4YDLB 2VLLB 1G7IA 1AMXA 4DKDC 4V1DE 2CIIB 5D7LE 1DZBA 2FECL 4FQIL 1R9FA 2R4RH 2F7IA 1NC2D 3NYKA 1JPTL 3CX5K 1JDCA 1UUNA 1WBXA 4IK7A 1MWAH 4EI5B 2A77L 3D69B 4FA8A 4GW1A 4NOFA 1F6FB 2PABA 4D9QE 4GRWH 2DDQL 3AG2B