2YXWA

The deletion mutant of multicopper oxidase cueo
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
440
structure length
440
Chain Sequence
b'RPTLPIPDLLTTDARNRIQLTIGAGQSTFGGKTATTWGYNGNLLGPAVKLQRGKAVTVDIYNQLTEETTLHWHGLEVPGEVDGGPQGIIPPGGKRSVTLNVDQPAATCWFHPHQHGKTGRQVAMGLAGLVVIEDDEILKLMLPKQWGIDDVPVIVQDKKFSADGQIDYQLDVMTAAVGWFGDTLLTNGAIYPQHAAPRGWLRLRLLNGCNARSLNFATSDNRPLYVIASDGGLLPEPVKVSELPVLMGERFEVLVEVNDNKPFDLVTLPVSQMGMAIAPFDKPHPVMRIQPIAISASGALPDTLSSLPALPSLEGLTVRKLQLSMDGGANKINGQAFDMNKPMFAAAKGQYERWVISGVGDMMLHPFHIHGTQFRILSENGKPPAAHRAGWKDTVKVEGNVSEVLVKFNHDAPKEHAYMAHCHLLEHEDTGMMLGFTVGH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Blue copper oxidase cueO
molecule tags Oxidoreductase
source organism Escherichia coli
publication title Structure and function of the engineered multicopper oxidase CueO from Escherichia coli--deletion of the methionine-rich helical region covering the substrate-binding site
pubmed doi rcsb
total genus 125
structure length 440
sequence length 440
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2yxwA02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2yxwA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2yxwA03
1VLXA 2XV0A 1URIA 3FQ2A 4QKTA 1AZBA 4F7KA 2IH8A 2GB2A 1QLEB 4BWWA 2J56A 6PAZA 2TSAA 2J55A 1W6LA 1BEXA 1IUZA 2Y69B 2IWFA 3ERXA 2E86A 2MTAA 2WO3B 2IWEA 4L0PB 4QLWA 2H47C 1XB6A 5PAZA 1GY2A 2VSKB 3FT0A 1N68A 1BQRA 3NJFA 1GSKA 3X1GA 2QPDB 1X9UA 5AZUA 1XB8A 2XVBA 2R7EB 1KBWA 3QJVB 2YAMA 1N70A 1ZIBA 4E9RA 1OV8A 3KW7A 4KO7A 4X4KA 2J57A 5B7EA 5I5IA 3S8GB 1GS8A 5B3SB 3FQ1A 4YSTA 4A2EA 2HZHA 3TA4D 1A8ZA 3V9EA 2IDSA 1KDJA 4YSAA 3OD3A 3UACA 1CUOA 5I5JA 3FYEB 2BWIA 2H3XC 4Q89A 1M56B 3ABKB 4G72B 6PCYA 1X9RA 3WG7B 3AG2B 1T5KA 2IDFA 4GP8B 1OE1A 3IBOA 1PLCA 4AI7A 4AZUA 4YSPA 4DP8X 3AG4B 1NIBA 1ADWA 3FSWA 2P80A 2PLTA 3FSVA 2ZWNA 3WKPA 4A2HA 1JZIA 4P5RA 1IKOP 2FQFA 3EH4B 5FC9A 2XV3A 3H4HA 4DP9X 2AANA 3NP3A 2GHZA 2XV2A 1FWXA 4HALA 1NIDA 4W1TA 4DP4X 3X1EA 3FU7A 2W8CA 4G7SB 1HFUA 3NJGA 4YSUA 2WO2B 2CJ3A 1NIEA 4E9VA 5B7MA 2AZAA 3AW5A 2BW4A 3S3CB 2PPCA 3HEIB 1CURA 2FQEA 2PP9A 5TK4A 1JXDA 3ZBMA 1PAZA 2XYBA 1MZYA 3BQVA 3NSCA 2W88A 1BAWA 3AZUA 5AKRA 1SFDA 3IN0A 3NYKA 4WTQA 1AS6A 1AOZA 4KNSA 1OCZB 2BW5A 2UXTA 2B3IA 1ZDQA 4G7RB 2PP8A 3WIAA 1AS8A 2PP7A 4E9SA 1JZGA 2Y1AA 4RH4A 4A2DA 1CC3A 1OCCB 3U25A 5I6PA 1JXGA 1SF3A 2XUWA 2BZCA 4YVUA 4HIPA 2XXGA 1JZHA 2UX6A 4DP7X 2BP8A 4HCFA 1J9SA 1MG3C 4DP1X 1WAEA 2CALA 3S3DB 1WA1X 4GP4B 1PY0A 4NERA 3NJJA 1NWOA 1BXVA 2FT6A 4N4YB 1TU2A 1KBVA 2AZUA 3PCYA 3UAEA 4KNTA 1AANA 4Q8BA 1J9RA 1IC0A 2BP0A 5I6KA 3PXLA 3OMAB 7PAZA 4YSQA 2QDVA 4PCYA 2IH9A 3TASA 3UABA 2JKWA 1L9QA 1DYZA 2GC7C 2ZOOA 2A3TA 2DV6A 1ETJA 4PAZA 1QNIA 1NWPA 1ASPA 1FFTB 3PAZA 2B08A 3H56A 3FU8A 5A7EA 2R7EA 4NAJA 5EHFA 2DWTA 2DWSA 2N0MA 1OCOB 1ET5A 2YAQA 3AY2A 5D4IA 1A65A 1NTDA 2CCWA 2VM3A 3ASOB 3NSFA 3OQRA 5I6NA 3D12B 4E9YA 3S3BB 9PCYA 5I6OA 1OOWA 3CVCA 7PCYA 3FSZA 1E30A 2CUAA 1JXFA 1OE3A 3PLYA 1ZDSA 1RKRA 4UF7C 4BK5C 4DPBX 1SNRA 2IDUA 3DKHA 3DTUB 3C75A 1J9QA 1ZPUA 1NICA 2GIMA 2XX1A 2YAOA 3ABLB 3SQRA 2FT7A 4HAKA 4YVNA 1J5CA 1L9OA 1AZUA 4YSDA 3SBPA 4ENZA 3G5WA 2OCCB 2YAFA 3PAVA 4HHGA 1A4BA 1NINA 2BWDA 2HXAA 1KV7A 3QPKA 2GSMB 1EZLA 1AG6A 2FTAA 3NJIA 1AIZA 2QPEB 1W6WA 1SDDA 1DZ0A 2PPDA 4GXFA 3EH5B 3TU6A 1ET7A 1F56A 1L9TA 2FWLB 2YAEA 2HX7A 1KYAA 2RACA 3QQXA 2X88A 3EF4A 3UADA 5IY5B 1KDIA 1NPNA 1JERA 2PPEA 4JKNA 3ASNB 4KOBA 1E5YA 1L9RA 2GC4C 4JHUA 4BXVA 1ILSA 2VMJA 1KCBA 3T6VA 5B1BB 4KOCA 1MG2C 3QJUB 1XB3A 2ZONA 1PMYA 3WKQA 1I53A 3GDCA 4KNUA 2NRDA 3FU9A 4BWUA 1HAWA 4UANA 1A3ZA 3CZUB 2I7OA 4YSOA 4EF3A 1JZJA 1R1CA 3ABGA 2VW7A 2YAHA 5B7FA 2HRGA 4BXSV 1ASOA 3NJLA 2XWZA 3WI9A 1RCYA 2BZ7A 1WA0X 3UGEA 5B1JA 1BYPA 2FQGA 3KW8A 1JVLA 3OM3B 5B1JC 2OV0A 1PLAA 4HCGA 4KO5A 1OF0A 2IWKA 3NT0A 3TBBA 3T6ZA 3OMIB 2DYRB 3RYMA 1J9TA 3WNIA 1IBZA 3S8FB 1TKWA 4TXVB 2TSBA 1SFHA 1SHXA 1JZFA 4YSRA 1PZCA 3TBCA 2VN3A 4GYBA 4DP5X 3X2QB 1KGYE 3T6WA 2QDWA 2CAKA 4BDVA 4E9XA 2HLEB 4UAHA 2YQBA 1XMEB 2BHFA 3X1NA 3QJSB 4N8UA 1PZAA 5F7BA 1B3IA 1SDDB 2EIMB 2YAPA 5F7AA 4GY4A 2LLNA 4A67A 3QJTB 4FAAB 3CVDA 3MBWB 3L45A 3PAUA 1NIFA 2HRHA 2UXGA 3X1FA 1AR1B 2YXVA 8PAZA 4K9JA 2IDTA 4F2EA 4YSCA 4A2GA 1ASQA 3NSYA 4G7QB 1CYWA 4E9WA 1OE2A 1AQ8A 4M4RB 3WNJA 2X87A 4KO6A 1E5ZA 3N2JA 5I28A 2AVFA 2HX8A 3EH3B 3T71A 4NB7A 1PNDA 2J5WA 1FA4A 1EHKB 3FPYA 4E9QA 3IE9A 2IAAC 2Q9OA 1V54B 2YARA 2PPFA 2VM4A 3FS9A 4E9TA 3UAAA 1E65A 3EHBB 3HB3B 4BDVB 2UX7A 2FJSA 1SF5A 1M9WA 3NSDA 2GI0A 5PCYA 1A4CA 3GYRA 2VSMB 1QHQA 4YSEA 3QJQB 1GY1A 3AG1B 4DP2X 1WS7A 2XU9A 5LDUA 3SBRA 3SBQA 2GBAA 2P80D 4A2FA 1AZRA 1ZIAA 4A66A 3CDZA 1GS7A 1GS6X 3CVBA 1NDTA 1OCRB 1PNCA 4YSSA 4KO9A 5AFAA 3V9CA 1AS7A 1RZPA 2I85A 3CDZB 3DIVA 5B1KA 4BWTA 4CSPA 3N55A 3ZDWA 4G70B 4DP6X 1SHWA 4F2FA 3OMNB 1BQKA 1JVOA 2XXFA 4YL4A 3QJRB 1L9SA 2IDQA 4GP5B 4DPAX 2VW6A 2UXVA 2I7SA 1AACA 2DYSB 1J5DA 1NZRA 1NIAA 1YLBB 3JTBA 3T9WA 3BVDB 2XX0A 1M57B 1TEGA 2FT8A 3ZX1A 4P5SA 1V55B 3NJMA 5I26A 5I6MA 1GR7A 1JOIA 2EILB 4HHWA 5ANHA 1PCSA 1NPJA 1GYCA 4FA7B 1HAUA 1TEFA 1AG0A 4ZK8A 4HZ1A 1WA2X 2PCFA 4CSZA 1PLBA 1AAJA 3FU7B 2BP8B 2YXWA 3JT2A 2PPAA 3FYIB 5B1AB 3ZIYA 2AFNA 2EINB 2DY2A 2OJ1A 4DPCX 5D4JA 1WS8A 1V10A 2MRYA 5I6LA 1MDAA 1MZZA 2QT6A 5D4HA 2Q5BA 1W8EA 2JXMA 1IBYA 1BYOA 4MFHA 3FSAA 3CG8A 1UATA 2BP0B 2FQDA 1ZV2A 2EIKB 4JHVA 4M3HA 1L9PA 3NJHA 3ABMB 1ET8A 2HX9A 2BO0A 5I5MA 2VW4A 4AKQA 1A4AA 4DP0X 1PZBA 2CBPA 3FQYA 1BQ5A 3PPSA 4AX3A 2PCYA 4WKXA 3IEAA 2EIJB 5TK2A 3NJNA 2ZXWB 1SJMA 3H4FA 1BXAA 3MX0B 3X1BA 3IN2A 4HCIA 2XLLA 1AZCA 2UXFA 1CYXA 1E67A 3AG3B 4AKOA 4AKPA 2FNWA 3NJKA 1ILUA 1AZNA 2WSDA 3T6XA 4W9ZA 2H5UA 1KCWA 1JZEA 1ID2A 1BXUA 1GW0A 2JFCA 5E9NA 3GXUB 3NP4A 1PF3A 3FPXA 4A68A 1RZQA 4G71B
chains in the Genus database with same CATH superfamily
4WHYG 1S7VB 2QZQA 4WEMB 1Y1DA 3QZNA 2GG1A 1YNTF 4DJMA 2LAAA 5IROD 2BY1A 3L3OC 4JBSA 3DUUB 3GJFA 3WFHB 5DUML 4LCUA 2IWEA 4PVBA 1GY2A 1AXSA 1S9YB 3VG9C 4YQXH 1AR2A 5ICUA 1A7NL 4XZUA 3I9PA 4LB8A 3RWJA 3X11B 2FX9L 3LB6D 3AGVA 2W1NA 2C3GA 2JJSA 2DQTH 2O6EA 4OCMC 2WYZA 1N70A 4KK6C 4QNPF 5FK9B 2Q8BH 3M7FB 4GAYB 2GUYA 4DQAA 4X4KA 1PJWA 5BVPH 4NFCA 3UCQA 3EYOB 4Y8AA 1U8IB 2VDML 4NO0D 3Q06A 1MRFH 1ZLEA 2V7NB 1MREL 1R3LB 1A1MB 1AHWC 4D8PA 1QD0A 2J5LC 1UTDA 4S1QH 5I0DA 4YHYC 1DBKL 4JDZB 2VDKH 4S2SB 3DI2B 4NQVB 4N20A 5I30L 5I75C 3QEHB 3NA4A 4QTIL 1B0WA 5KS9F 1EGJH 1MCOL 4UTBL 4AIXA 2Z3FA 4Y19E 3H6AA 4L37B 1XGQA 2RA1A 3AG4B 5J12C 4PD4K 3UJIL 2ENQA 1GGCL 3HG0A 2FVNA 5AVQB 3CU7A 3QJOA 3RBGA 1IGIH 4PJ9C 4W6WB 3K1DA 2Z92A 2AXGB 2A77L 2K6WA 1EANA 4YJZL 3OR7B 2PWDA 2AJSH 1EUUA 4F7EB 1K8IA 1GRWA 2IAND 4AYGA 3DPDA 5C0CD 3Q5OA 4LGPB 5E2TL 5LGJA 3D09A 2CRMA 2ZUQB 5FUCE 4PS4H 3PE9A 3RA7L 2ZG1A 4XODA 3ZE0F 2D9CA 4R84A 5L2KB 2JSFA 4XVUC 3D33A 3KWVA 2GYSA 3HN3A 3GSNB 4KKBD 3DHPA 3SDDB 1W72L 1FIEA 1TQUA 3QZWB 2XYBA 1N59B 4LCCA 4ODVH 5E1HB 3SB3A 5MERA 2HFFA 5JW5A 1N6QL 2E9BA 3JV4A 4Q0XL 4KFMA 4UWQB 3GI8L 4ADJA 2Z8WC 3ECQA 2XN9A 3U9PH 1AS8A 1PAMA 1JHLH 4QOKD 2WLJA 4NKOA 2FO8A 3F7VA 2KZBA 2A5UA 2XTLA 1JP5A 1T1YB 2BVPB 3KYAA 4ELMB 3PL6C 4NX0A 5T8IA 4HUCA 1WAAF 5LAXB 1ZGLM 3JWOC 4HCFA 1DBML 3O6LH 3RFZC 1GAFH 2EDQA 3VFVB 1Y0LB 4M7LH 4MZ3A 1HEZA 1W9XA 4TUKH 4A7VA 3WNLA 1IRAY 2PXYA 4P3WA 3PREA 3OG6B 4M62L 3UTPD 4RMUA 2NY5C 4PLOB 1U8HA 2HJFB 4N4YB 4YUEL 3B2XA 1B88A 3MREB 4XC1L 2PTTA 4ZW7A 5E00B 1OB1A 5IZ7A 2CIIA 3TURA 1TU2B 3MRDB 2MIZA 2FD6H 3PXLA 3DX7B 4HJSA 5SV4A 3TBSA 7PAZA 2WXHA 2YKLH 4LDEB 4WW2F 1ZA3B 4UZSA 5CD3A 5JXAH 1UURA 3WTTA 1H9VA 2PO6A 4JRWA 1L9QA 3I6KA 5D6CB 5I0ZA 2IIJA 1JTOA 3DC0A 3U30C 4JFWA 5AVSB 5JW4N 5DGQA 1IM3A 1U3HB 4GQZA 3QORB 4LCWE 5I1IH 2BFGA 3QUXB 4LKXB 1YMME 1A7OH 1VERA 3HLAA 1I1AC 3C09B 3KH3A 4NPYA 4E9YA 2KQMA 5IJCC 1BYNA 4PWKA 2DS4A 5HHPB 3LZOA 2P5PA 2AAAA 2X9ZA 3NABH 5J1TC 3O4LA 1IQWL 4KZCA 1EFQA 3ZKXC 1MWAB 1U8HB 2HJFA 4AIOA 3ARBA 2EDWA 3JTTB 1DDHB 4P23B 4RX4A 3CLEL 4G8GE 4L3EE 1FRGH 2QSTA 2Y1YA 4KKCD 3GI9L 4ODSL 2WAHA 5D6DA 3KNBA 4JDEA 5IBLD 1L9OA 3DIDA 4AVHA 5KN5A 2EDDA 4M1GH 5DHYA 1VDGA 2BHZA 2PO6B 4O4YH 2DLTA 5KUKA 1RJLA 4JO4H 4FADA 3PWVB 2SEBA 3GSQB 3Q2VA 5D7JB 3P11L 3AREA 1ZEAL 5JHDD 4F33A 4F9PA 3WS3B 2ATKB 3VFSA 4U0QB 4QGYA 2L3BA 35C8L 1Z9OA 3C08L 3BQUC 3QVAA 4L0ZA 1KCVH 2BINA 3U48A 2ICCA 3ULSB 3IFOB 1VPOH 3GS7A 5ICZA 3JYBA 4O2EB 1E8XA 4M6ML 1QLFA 3LQZB 1LTXA 2VIRA 1TFHA 2NNCA 4OCRL 2NW3A 3C60A 1E6JL 4P59L 3SJVA 3EF4A 3UIZA 5IY5B 4ZMVA 3VI3A 4A7TA 4BUGA 4FN0A 2AJ3B 3EO0B 4MDIB 3CD4A 2QMJA 3L5XL 2K8QA 5FOBA 4FLSA 1MJ7H 2X9WA 5DMGD 3QO1A 3MLZH 5AL8A 1WDAA 3TO4D 4NNYB 4KOCA 1HOCB 4OZFA 1V3LA 4BHUA 3GDCA 1V3JA 1WD9A 3ZDYF 3W0WD 5I1GH 2GABA 2VC2L 3N04A 1EEQA 4U31A 4DKTA 2DJSA 3H0TA 4NI3A 1D6VL 4PJXF 4RGOH 5ADOL 1YEHH 4P99A 2F5BH 5CM1A 3JBG7 3LEYL 4L29A 3ATAA 5KVFE 1HHIA 4UOZA 4MWFB 4NQTA 2K1MA 5E4IA 5SWZD 4IW4C 5EU7C 2PWGA 1W0VA 3VXME 4UIKH 4N0YH 4X0KB 4O2EA 4ZFFB 4GBXD 3MLRL 1KTDA 4RWYH 2YZ8A 3CN4A 2VE6A 5E8NA 2VAJA 5FO7A 4JJOA 2BS71 2A74B 3BDYL 2D7PA 3VW3H 1BJ1J 3RL2B 2OXHA 2WIIB 3OKOA 3VD2A 1U2HA 2XOTA 5MEPB 3AXLB 1KPRA 2B7DT 4PJAE 2ESVD 3P4LA 4DZBB 1J5IA 3KPQB 3VXUA 1U8QB 4ELKB 2AERT 5HYFA 1P4UA 3GUTA 1J1XH 1CDCA 1S7QA 1WWBX 3CK0H 4FQHA 4CDHA 3SGKA 2LLNA 4OLUH 5F6IC 3AXHA 5HY9A 3AM8C 4Z7UE 3CVDA 3ARGC 2J72A 4JFTA 3MRJA 1HILA 1OAXL 8PAZA 2CKBA 3VCLA 4A2GA 1ORSA 3QRLA 4HIIA 4G5ZH 4TLKA 4PJIE 4OJFH 1MCOH 4UTBH 4KO6A 3TLRA 1S5IH 5JORB 3VFMB 3UZQB 1SDAB 2EIEA 4KJPC 5L7XL 2P8PB 3RDTA 4M7KL 2WKGA 4Y4HB 4JFEE 4KBPA 4OBSA 3ZDXB 2XNAA 4NZTL 3SE6A 2VAAB 2OXGB 4ZDHA 4QOKE 4K9EL 4E9TA 4UQAA 5TF1H 1KT2A 4Z95H 3ZU8A 3PG2A 1M05A 4Z3EA 1G7LA 3JTSA 5HDWA 3HB3B 4P9MH 2RHEA 1P5UC 3CFJA 3P0YH 1M9WA 4G8AC 4HV8B 1S3KH 3S5ZA 2ICEC 4YC2B 1E8YA 1JGVL 2D7TL 4HJ0D 1R0AH 2AQ1A 3EOTL 2IGTA 5G55A 5KJ7E 5KVEH 4UINL 3AG1B 1N67A 3TYGL 2WXQA 4RRPG 3QH3A 2DKSA 4JGUA 4XVOA 2EUZA 4GKNA 4PRIB 4UUJB 1HK6A 4MD5B 2XKNA 4DGWC 2DICA 4A66A 4H8VA 2CKBB 4WWKC 3RWGB 1N6UA 3HR5B 4XC3L 3WAJA 4YXKH 3CFEB 1UYWL 2IOIA 3R0MA 4QRFA 1CIUA 3HZMB 3VI3E 4ZS7L 1WEJL 1NCCL 5L8JB 1D9KA 1MW1A 3ULVD 3MV8D 1IQDA 5HHOB 1H9DA 1S78C 3O4OB 2B0SH 5DJ0B 3KS0H 4A7GA 3HZ3A 2JIXB 2P44B 2WLHA 3CVHA 4OLYH 2BNQB 3U0TA 4EBQL 1MW3A 3T0ED 3CC1A 4M5TA 5C0FB 2YBGA 2EICA 4IRZH 1I7UA 1AKJA 1QUNB 3MMEB 5I1AB 4U1JB 1BF8A 2XQYA 4PB0L 1TQSA 1JFHA 1GYCA 1NSNL 3ARDC 5ESAB 4YFLI 3CFKB 3L4XA 1JGIA 3WFCL 5HI3C 2VDRB 2LQRA 3PPEA 5TD4A 5TQ0L 3O9WD 5ETUA 4UT6A 4WSJA 3K6NA 6CGTA 2J1YA 2F53A 2WQVA 3ZIYA 2A6DB 3FQWB 3SD5A 2EINB 4ZMWA 1TMQA 2VLRB 1X5MA 3RL2A 2DQCH 1HH9A 2CO7B 3L4UA 4XGZA 5FHAH 2RALA 4RMSA 4JHWL 1D9KB 2Q5BA 4KKQA 4U1MA 1T1ZA 5LWYL 4JJ5A 3D39E 4Y9EA 1J0HA 5SWSB 1PDKA 4K4KA 4H0HB 4XPFL 1E27A 3CN0A 2VSCA 3TJPA 5MHSD 4PJAA 4FFTA 4J4PA 2Z91A 3ECBA 2CA4A 3BKYH 2V0AA 1QBLL 3R1GL 3O6FC 4HH9A 2A6IB 5B39G 1Q8MA 2JI3A 3L5IA 3BLPX 2F2HA 2VDQH 3ZE0B 4K8RH 1PZBA 3FQYA 1AKJB 5DLML 4ZNCD 3J27A 4GAJH 3DX8A 4FJYA 3E2HC 3QJXA 4HWZA 2Y07L 1SJHB 1IILE 4M8QB 5INDA 3OXRA 3IN2A 2Y5TA 3MOAH 4JRYD 2WNWA 4RLDA 2FWSA 2KS0A 1AGDA 3QA3B 4UOJA 4S1SL 1QYGL 2NUPB 1Z32X 2FNWA 2Z93B 3QZMA 1UA3A 4XOEA 1MVUA 2DQEH 1JYXA 3BVUA 5D7LA 1A1NA 1ID2A 5F1IA 1I8KA 3ZPDA 3DBXA 2ICEA 1T0MB 4L23A 1PZSA 2VR3A 3FPXA 4P46A 2V7NA 3MV9D 2VXQH 1TOXA 1I1FB 2DQFA 3CLFH 1TZIA 5E99H 1ICTA 4JJ5B 2AQ3A 2C9AA 1F4XL 2DLFH 3OTTA 5IVZB 1B9KA 4KI5E 4AYBA 3OHXB 5KVFL 2JJVA 2IWFA 1HT6A 2IG2H 3P1VA 4PMFA 2Q6WB 3D69B 2WO3B 5LXGH 1T20A 3VGDA 4LPYA 5CKGA 5JIKA 2VSKB 3UC0L 2GJ6E 4HJIA 2DLEA 1YECL 3QSKB 3TVMB 4BCYA 5J11B 2ZOUA 1KGIA 5IIEA 2ZX5A 3NRFA 1J8HD 4NQCB 4F7PB 1RUKH 2KDGA 2YPLE 5DC4B 4O2CA 3VWKB 4RA3A 2XICA 4XI5C 1BDYA 2NDGA 3EBIA 2Y1VA 4OZGF 1XIWC 5DEJA 1TQBC 1UKTA 1PD1A 4HPOH 3QHFH 1GS8A 3C6LC 3QDHA 2L8AA 2X6MA 3CSFA 4GQRA 4HMEA 4APQA 5HVHB 5JYMA 2IQAA 3P30H 4ZTOL 3GRWH 2IAMD 1RAMA 1C12A 1NLBH 1KJ2L 3T2LA 5HHOA 2I24N 4KUZH 4G72B 1ZK5A 4OD1L 1FG2B 4JQIA 5I8OL 3RHWF 1X9RA 4FCAA 2FX7L 2J44A 1GH7A 3WG7B 3W0WE 4F20A 1OQXA 4I89A 2Z8SA 4P23C 2VT0A 3DETD 3U1QA 3UZVB 5B38G 4H88H 3BVNB 1C5DA 4F91B 1NDMB 3QDGA 1I9RH 1IGCL 3FSWA 1A3RL 4NJAL 3I02B 3X3GL 1HKLL 4PJ5D 1PQZA 5KSAC 2Z92B 4NQXA 2XV3A 4ZZFA 15C8H 2JQMA 1B0RA 2GHZA 1AGCB 2J71A 2UZPA 4X7TA 1T1WA 1OP5K 2VQ4A 5DJZA 4PRAA 4J6IA 1U8CA 1ZRUA 1HFUA 1HIML 3UTTA 4X6CA 5L6YH 3BSZL 4FI6A 4DKFH 1NIEA 3ARFD 3L3IB 1MKFA 4QAWA 5E0QA 4DN3H 2WO4A 4NN7B 4KZDL 1NJ9B 2PPCA 5TK4A 1QPKA 4ZMQA 5L88L 4AUYA 4LNRA 3MKKA 3PDOB 4BKLB 5HDBB 4K55A 5KANI 3DUHA 2W88A 1S7SA 2XDHA 2R8SH 2CDEB 4R7DB 3WN6A 3RP1A 5DZPA 2ARWA 3NCXA 1RZ8B 5TDOB 1AGFB 3BVVA 4TNGA 5DHDA 3WJLC 5EOCH 3WIAA 2VMCA 2AGJL 4XNQA 2Y1AA 1VZGA 2F8VA 4PBVC 3ULUH 3LN9A 1JGEA 1LXMA 2AITA 1P4IL 1NKOA 1VPOL 1TFPA 1XGTA 1D5XB 1RP9A 2DTSA 3QYCA 2PYEB 2VR6A 3UGXA 3W9EA 1TTCA 1D7CA 1Q72H 2CPUA 1Z5LB 1NLBL 3V4VL 1WAEA 1CGSH 4NQVA 1G6RL 3AACA 3IFNL 4GKLA 1ZHNA 5KS9A 3NJXA 3P77A 2B5IC 3E6FB 1XGPA 4R4BB 5I1JL 3RVWC 4I3RH 1FO0H 5F88B 3KL0A 2ICWI 3IJEA 3QXAA 1RMFL 2CWRA 2YRLA 5EBLA 2WWOA 1OPGH 3T3MF 2HJKB 4JPWL 1PZDA 4PCYA 4DK3A 1HHJB 4LEEA 3H7LA 3BQUD 2YR3A 4PWGA 4NPJA 3MA7A 1NKGA 5DD6A 1E8ZA 5C7XL 1PU0A 1U3YA 3EO9H 1ODUA 4B9ZA 4DAGH 1IM3D 1NBZB 4JQVA 5EU3A 2E76C 5AZ2L 1JZ8A 4OZIB 4EVNB 3PAZA 4OLZH 4BRJA 5A7EA 5K1VA 3KXFD 5IESH 1BIIB 1C5BL 1NAKL 1SY6L 3MU3A 1A65A 4W9JC 4XP9H 5INCB 4R96B 3FSOA 3GBML 3NN8B 1MFEL 5I1KH 1BJ1H 4I8DA 4J3OD 1OSPH 3FSZA 1E30A 1RZKL 1QTPA 1EERB 4Y1AB 1OP9A 4R0LA 2B9BA 2DD8H 2PCFB 5JHLA 1OGTB 1U3NA 5ISZB 4PGEA 1T4KB 4F37K 2EAEA 5CUSL 4UB0H 3BZ4B 1QEXA 4N90D 1WBXB 1G6RA 2O1AA 3N42B 2F61A 3WXVL 1ML0A 1VZHA 2MH4A 3K3QA 1I1CA 1VFBA 3RTLA 3UJJH 3CUPB 4WFFE 2OA9A 3RVVD 4Z7WA 2WBJB 2XN0A 2CDFB 2J8UB 1KENL 1WPCA 4LSVH 2WOYA 2ZXCA 2PXYD 2X4TB 2E46A 4R7NA 2VXUH 2X4QA 4AGQA 1N7MH 1J9CT 1JDDA 4FHBD 2QKIB 4N68A 4X5XB 1CG9B 2BP5M 1F97A 4QTHB 1ACCA 1RJZA 5KSBB 5LG1A 3QZWG 4TL4A 4QD2E 1DZ0A 3GLZA 4QRQA 1IGFH 2EXYD 2OM5A 1LJMA 1EXUA 5E8EA 1BOYA 2YAEA 1B9ZA 1H8OA 3QQXA 3FHAA 3Q3GB 1A9VA 2BY0A 2M1KA 1J1PL 1X9QA 3EO0A 3BKYL 2HPTA 4OAWB 4JKNA 3ASNB 1AJ7H 3TBWA 1LK2B 3T65B 3MLYH 3NCJL 4OFKA 1TJIL 2NY7H 5ABDE 3GPSA 2N4IA 3GHPA 2OULB 4EXKA 3T6VA 2CXKA 1G1KA 1RY7B 3QEUA 2GJ6D 1ND0A 4UT7H 5GGVH 2EC9T 3WKQA 4Y4FC 4YN3A 5JTWA 3E7JA 2DWEB 3FU9A 5BVJA 1NFIB 3RU8H 3F85A 1VFUA 4FZ8L 3RIAK 3DBSA 5F7KC 2YN3A 4QO1B 1S2EA 5EN3A 5B8CA 2VUYA 4Z7VE 1NBVL 3D7PA 2XWZA 1RCYA 4BHUI 4FD0A 3PV7A 3PIQB 5CJXC 1FUNA 1SVZA 1X4XA 4FTVE 1WJ3A 2Z8VC 4LE8A 3HS0A 1T22A 1TVBA 3CX2A 1ZTXL 3OM3B 4HSCX 4XWGL 5T1LD 1CLVA 2AABL 1G7HA 2DW5A 4XBEL 3ROLA 3VRJB 3CNKA 4KO5A 3ZE2F 1CDYA 4WEBH 1MDTA 4XB8A 2P8MA 3GSNA 4Y89A 1FZKA 3FF8A 1RP8A 3GSNH 2F8XC 3G6JA 3WSQH 1B90A 2CRZA 3O3EB 3FDWA 5BS0A 1YNLL 4HD9A 3DRTB 1F4YL 3ZL1A 1DBJL 2CJUH 4X6EA 1MFVA 2Q86B 3TC9A 2AK4A 3N41B 3EH1A 3US1A 5F9OL 2F7RA 2AV1A 3GUTB 4U33A 5BW7A 2Z4QA 4P46D 2QVIA 1DVFA 3OKLA 3V8CA 4H25B 1PZAA 4HIHA 1B3IA 2AJUH 4P48A 2NLJA 1MIEH 3G9AB 5CCHE 1FCGA 4B7LA 5TH2A 1KEMH 2YAPA 4LMQI 5IHUH 5LCVH 4UU9B 4FFWD 4A67A 5BXFB 4D0BA 2EO9A 1YUKB 4ZUSA 3L45A 4KAQH 5FDYA 1A5FH 2HRHA 2VITB 4JPIB 3VCLB 4N0CD 1XGUB 5LB1A 5ECJE 1ZT7B 2DI7A 4WJ5B 1U4FA 1ASQA 3QUYA 2GT9A 4OM1L 3GEWB 1CVSC 1YYLL 1Q9KA 5F7MC 1Y7VA 3GBDA 5BUGA 4G8FB 3T71A 2I32A 4Z9KB 1RSYA 1OPOA 4I13B 1FA4A 2DTML 1NLDL 2OL3H 3RX7A 1EHKB 3D9AL 2IMNA 4JCWA 5GGVL 5ITFA 4K5OA 1A1MA 4MXVF 2QQNH 4FQXC 5GGRY 1RVFH 3MACL 1T2XA 5E7BA 2F5BL 2WBJA 2WLNA 4XPAH 3LZFL 2WBJD 3C6SA 2DWXA 1E6OL 5GJTL 3DK2A 1SF5A 1HVXA 2GI0A 4JB9H 4BK8A 4PLNC 5F97E 5EOCJ 3O81A 3WGVB 3W57A 4ZFFA 2HTLC 1TNNA 5GGUB 4KRPB 2X4PA 3P40A 3L54A 3K72B 4L4TE 1UA6H 3TONA 3WHXB 2KLRA 1YEIH 3MRQB 3MV9B 3J8F7 4EI5C 3RGVB 3V4UH 3HE7D 3QIUC 4NRZA 3US9A 3HNTL 5LXVA 1T03H 1NDGA 5A6LA 3TZVD 5DSCA 1JG9A 1BVOA 1CYGA 4YNYB 1BF5A 1KV3A 1CT8B 2VR4A 1BVKA 4NQSB 3H42H 4Y2DB 4IIQA 2EDXA 1L9SA 1MJJA 4GP5B 1RERA 4JRYB 5FYJE 4WDIB 4BGLA 2KDYA 5FKPA 2UXVA 1EZVY 2FL5B 2G4EA 1AACA 1RV6X 2Q0ZX 3D08A 3TBVB 3WIFA 3N44F 2AMGA 3L2LA 4JX0A 3W2DL 3C6SB 4LSRL 2IALB 3JV4B 4PJ7E 2OX5A 2ZUVA 1AO7A 3COOA 5I76A 4JFQB 3RUGA 1FFQA 1JN6B 1UB5A 4Z7VA 4L4VB 3LYRA 2JB5L 2C3XA 2VISB 3PIQA 2VZOA 2CIKA 4Y1TA 5JORA 2RFXB 4HZ1A 3JYCA 5GXBB 4G7VL 4QMEA 1AAJA 2DQUL 2ZE0A 2BIMA 5F7LB 3O11B 4F2MB 2ZCLH 4UIMA 1NFDF 1SJHA 2QQNL 1FZKB 1YEEL 5DHVB 1UXWA 3HE6D 2DY2A 3U36A 5MEOA 3WEXB 3BRGC 1U36A 3D0VA 1BBJB 1MCWM 2ZWLT 3G6JE 1JNLH 3ZE2B 1YEKL 2WJ5A 1ZS2A 4B41A 4PJCE 5BS0E 5SWQB 4JFXB 1CJYA 4QRSB 2WVTA 1NOFA 3STZB 2FO1A 5L0QC 2YIHA 1U33A 1M7IB 2P48B 3ZRCC 1JUFA 1NOAA 5GRZA 3EKCA 5F3HA 2XG5A 1CFSA 2ZP9A 1X3DA 4MD4B 4ZUUA 5G4OA 2QPFA 4JM4H 1P6WA 1QABA 1XIWD 3NK3A 3G5XA 1FDLH 1R24B 5C9JB 4IMLA 1ZHBA 3O6MH 1EHLH 3X14B 3M17B 2C9SA 2ZXWB 1D5BA 4WKZA 3FUDA 3X1BA 2F8IA 5T3XL 1BGXL 3QUXA 1MJ8H 4JFFA 4C59B 3DTXB 1G9HA 4GT7A 3AAZB 4P04A 4XP5L 5IMOB 1E67A 3P02A 3ASWA 2OMZB 1NMBL 3TIEA 5FCUL 4AKPA 1WYJA 2ZOKA 3W11C 4TUKL 2H5UA 5JHAA 5GRXG 2Y2WA 2QTEA 1WD8A 4PG9B 1M7UA 2C9RA 1UD4A 2HT4D 1L0PA 4XCFH 1RZQA 4S1RL 1LQBC 4TQEH 5C0FA 4J23A 1N8ZA 3LN4B 1F6AA 1I7TA 4L9LC 1QUNA 3B2DC 2IH8A 2X42A 5C3TA 2HP4A 1QLEB 2ADGB 1TCRA 4HLZH 3UBXB 1FG2A 2GCYA 3D06A 5C0AE 1JNJA 1G84A 1IUZA 1JJUA 3ERXA 3VG0H 4HEPG 2E86A 3O6FA 2D31B 1QSZA 1EK3A 4MRCA 1V7ML 1R24A 2ZWKA 3WD5L 5IMMB 3H2PA 1ECZA 1D5IL 5GS0L 3NABL 4YLBA 1NGQL 2DB8A 2Q7YB 5JR1H 2R2EA 1DCLA 3A6CL 3GRBA 3FUEA 2KERA 2NZIA 3MLTA 1NBQA 5ICZB 4G11A 1V3KA 1C5CH 4RX4D 5C0NC 4XO8A 5HHNB 4AM0Q 1A8ZA 1RUQL 3QW9A 2ZYSA 2VAAA 2ZF9A 3IAQA 2I26N 3LV3B 4KXZI 1DQJA 3TA3D 2CO4A 3HG5A 3V6ZB 3L3GA 5AG9A 3BP6B 1MAKA 1WAAE 3K8LA 4I4WA 1FRGL 5I1HH 3O3DA 3GXIA 4MB1A 5GGTA 3WNOA 1ZTXH 1SLWA 3UROR 1DBBL 1BLNB 1XBDA 2PO6D 3TP4A 4WFHD 4FEIA 1E9OA 3KM2A 4OCSL 3FB5A 3PABB 4RMVA 1OT2A 2QADC 4K2UL 5ID0A 3RUGE 1IKOP 3LRLA 3JWDL 3B9KD 4PJDE 3WIHL 2AANA 3P4NB 2Z93A 1RJCA 1GGUA 1X4YA 2OBGA 3MBEB 4PREA 1CU4L 4CJ1A 2LW3A 5EF1A 2X4UB 4Q6IB 4X6CB 3FO0H 4Y4HC 2DBJA 3QI9B 2FCBA 1A14H 1L7IL 3KHQA 1CFVH 2W0FB 4ZX4A 1E2ZA 2FZ3A 4KPHH 4E5XG 2CJ3A 1KNOA 1XIWA 2VQUA 3UZEA 1YNTA 1F4XH 4MJ4A 2KKQA 2O5ZH 5KZCB 3KLHD 1HHHB 4LF3B 2A74A 5FF6B 2OR9H 1G7QB 4N5EC 2HVKA 4MLSA 5I8CB 3VDCA 1JFQL 1A7RH 3FQRA 3MAWA 4P2QD 2K78A 1YEHL 2UXTA 3L13A 3TEYA 1TJGH 1HZHH 3W37A 1UEYA 4JDVA 2HJKA 4IOSA 1TLMA 4ELKA 1QLEL 1AP2B 1CE1H 4QF1A 1MVFA 3MBXH 4U6HA 3P3YA 1NLDH 2ZSWA 1BQLH 4NUJA 4Y2DD 3LEXA 3QI9D 4CVWA 1ZT4B 1L0XA 3R06A 1MJUL 3RWJB 3X11A 4GIAA 2XWEA 3RZCA 5DD0L 1JF1A 5GSRB 1P5VB 1MG3C 2BZDA 2NY1D 1SVCP 4ZMTA 3IPBA 4O58L 1TQCB 4LLVA 3T2NH 5C08A 4BFEA 3GTVA 4OZ4A 4C54A 4UILL 5KG9B 4XP1H 1XR8A 4P3CL 4WGWB 3U9PL 2YFNA 3BJLA 1E3ZA 3CFDB 4L4JA 5DZ9A 4XN8A 4M8RA 4X7FC 3UG5A 4C4KT 3PV6B 4G7YL 2M26A 2DKMA 4OZHB 1BPLB 1VADB 5DMIL 3I02A 4ANUA 3QISA 4Q2ZA 1MY5A 2C34A 2NNAB 1I9IL 3SKJL 4MA8H 2XTJB 1X7SA 5DUBB 4X8JB 3CZFB 5I75B 4BKTC 3O8XC 3GIZH 2MCAA 2QMKA 1UT2A 2V3EA 1DP0A 1NOLA 3IU4H 3K1KC 4NN5B 1OXYA 3QYNA 1NGYB 4QHMB 4G5ZL 2AEQH 4ETQB 1NCOA 4EUPH 2VM3A 2R2EB 2W91A 4CUCA 2XFGB 5DJYA 4QTHA 4RQQB 1F3RB 3R0NA 4LKXA 5CZRA 2IBBA 3ZE1E 5BS0D 4U1NA 2Q76B 3D50A 4MA3A 2WGXA 5D72H 3UMNA 2R2BA 5IVXB 3WTWA 4Z95L 5HDOA 5FV2A 2YO3A 1B2WH 5I30H 3D2UA 3EFFB 4O9HH 4P0DA 5M95B 3ABLB 2VO5A 1ODAA 1VFMA 2WBWB 3HB3D 5HPMB 3T8XB 3EGSA 5CBAA 1QASA 5AVYB 1J8SA 3ZT5A 4Y9FA 3SDCA 1ND0B 1O6SB 5KSBA 3MFGB 4AW7A 1PY9A 2A4ZA 2F7OA 4HWBA 5HI4D 4EZLA 3U6RA 4F8QA 3A6OA 3I3BA 4LOVA 3RG1C 5T1JA 1UWXH 3ECVA 2EO1A 3P9LA 1X5AA 3FXIC 4TQIA 1UWEH 1A4KB 3IS1X 4CNIB 2P46B 1DLFL 4JHBA 4ETQA 3GFUA 1VF5C 3IDGB 1JV2B 2VC2H 4MJ2A 3IFOA 1G1YA 2GAZA 3V0IA 4PJIB 4KZEL 1P6FA 4CVUA 1OANA 1ZXQA 3FFCE 3VI4F 3SY6A 1M2VA 2XKUA 4WTWA 4X6CF 1RUAH 3AMLA 1L9RA 4J2XA 5CJ5A 3IPEA 3TEZA 3B9AA 5GGSY 1OTTC 3NCMA 4OKVB 5EOQL 4NENB 4NBYB 1R5WA 4JKWA 3TX4A 4KKAD 1XB3A 5FCSH 4BSWA 5GIRB 3GIZL 3ME0A 2IF7A 5T33H 4NQQA 5CEYB 5HGHA 4HFWA 3DOSA 1JHKH 3IXAA 2LTQC 3TO4C 5L88H 1YN7A 1HI6B 4YSOA 4EF3A 2CNZA 2Z4QB 2NY5L 4XAWH 3WCYA 2VW7A 5D1QA 5B7FA 4XMKL 5DURD 1B0GA 4KKRA 3F7KA 2D03H 1IEBA 2H6UA 2J2ZA 2QVKA 1XH1A 4CBPA 4Z23A 2MQ3A 2W9EL 4XCYB 3DK0A 2G30A 4GBXB 1AQHA 4BZ1H 3GO1H 3BGAA 3WN5B 3IDGA 4AM0B 3L7FA 3QAQA 5EV7A 4LMQE 1E9QB 3VXMB 3A4DA 2D0GA 2W65B 5BRZE 5C08E 3VXRB 3T77A 3O0RL 4QXUH 3WKNA 4KVNH 1OEZW 3FT4B 4KMLB 3I74A 4QT5A 1SXNA 1ZS8B 2W07A 4IGBA 5JHBA 2QDWA 1G0XA 1T83A 2JTYA 4YHLH 1UCBL 4NJ9H 3SGKC 5J9PA 4JZJA 5C0EA 5F7WC 3CXFA 1RJLB 2W80C 1C5CL 1JGEB 3L9YA 2D4DA 4WK0B 5L0QB 1M1XB 3KPLB 3DJSA 3MOAL 3MBWB 3SKNA 3PAUA 5SX5H 1AR1B 1LMKA 1BJ8A 3CZGA 4NN7C 3F7RA 4NUGL 3UTZB 1A21A 4P5TB 4WCYH 1KSRA 3RQ3A 1JPEA 1KIQB 2UUDH 5I1IL 1LP9B 1AQ8A 1RUPL 5EU4B 1RZGA 3S37L 4H8PA 4NM4H 2VLKB 4UT7L 4P57B 2B9AA 5JW4Q 4Y16C 4I88A 3GMPB 1JPST 3IJEB 4ZMZA 2J1ZA 1PFOA 4JHAH 3RTQB 2IC2A 1JDAA 5HJDA 5F89A 2Z31C 1X5XA 1A02N 1DJZA 32C2A 4YPGB 2VXQL 3IMWA 4RAUA 3RKPA 3V6OA 3MJ7B 1RHHB 1MIMH 1UZ6F 3NSDA 2NNFA 3BH8A 4CMMA 2Q7AA 4ODSH 4JZJB 4JM4L 4CVXB 4K0OA 4L9LB 2Q8BL 4ACTA 4HWUA 3MC0A 4U1HA 4M9OA 3S5YA 4YSEA 1J5OH 4XXDA 2BVYA 1FGNL 3CSYB 4PJFE 5D1XD 3MJ8B 2K8MA 3IKCB 3QQ3B 1Q0XH 4Z77A 4Z7VB 2Q10A 2VXUL 3MRIB 1W0VB 4U1LA 1NDTA 3P9WB 2BXYA 1OGTA 4M56A 3O0RH 4QXUL 3IGFA 1FSKC 5FK9A 3EUUA 5AW2B 3P0YL 4I1PA 5CZXD 1OB0A 3ZT6A 5IBLC 3VFNB 3WAKA 5I2IA 5I15L 1DN0B 2B77A 3G5YA 1R75A 2HKAA 2ZKMX 5JXED 5DRXA 5EEWA 4EZMA 2W0PA 1A7BA 2Y7NA 3OKOB 1EGJA 3E38A 2FB4H 4U1GC 4WTXA 2DI9A 3QNZA 5TQ0H 1J5DA 4HMDA 4UT9A 2F8OA 1YLBB 3II3A 3T9WA 5IMKA 3Q44A 2NY0D 5F93C 2R0WH 2N1TE 5BPPA 4XMVA 1KY6A 3EBAA 2KBGA 1FZOB 4N2AA 4OF3A 1RZ8A 4RISL 3BIKA 2OP4H 3WY4A 5AW6B 3T0EC 3S36X 4ZG1A 2PNDA 2AQ2A 3ZKSD 1FE8L 1T04B 1SEQL 5F0MB 2X4OA 4FYTA 2X3BA 4UIMB 1UKSA 3LRHA 3QZPA 4FNLH 1XTMA 4PIBA 3CFBA 1S46A 4XCEB 1I8UA 2H9GA 3WEXA 4ISVA 1CO1A 4FG6D 2EQDA 4JFSA 1Z5LA 2AFNA 3M1BB 4OTXL 1PSKL 1OHZA 1WS8A 2OJEB 2FX9H 5CJ8A 4WY7L 4PFEA 4IBTA 2BRQA 2J43A 1SGKA 4G42B 1P84K 4UZUA 5C0IB 1KFAL 1HYRC 3BWZA 4U3XA 3EBGA 3TS8A 1KJMA 1ACYH 2DMHA 4J8RB 5EN2A 1O6TA 3T0VA 4DKEL 1ZVYA 5SWSD 3FCTA 3RWEB 3SDXA 3STBA 4TSAL 2IXQB 1J48A 1L9PA 2FWOB 3PWLB 2BERA 5E2UL 3SY0B 2ZKHL 1ET8A 3AMKA 3E8UL 1GMEA 5KBNC 5D8JH 3V8OA 3ZHNA 5ECGA 2NR6A 4WO4C 3APNA 3LS4H 3FOMA 2FJHA 3LZRA 4WKXA 4OVUA 3T4AA 4KROD 5HDLA 4JFYA 4K9EC 2N01B 1TYRA 5G4MA 3O2DL 2ZOTA 4AEHL 2X4OB 5BOZG 5BV7B 3KAAA 1ES0B 1PKQE 1COBA 3C12A 3QDMD 4PJ7F 3DGGA 4YHIA 5J6HA 3GT6A 3IFNH 1SMDA 2JFCA 3ZQWA 3BPLB 2X70B 2YRBA 2OI9C 3VD0A 5SX4I 2QQKH 1IQDB 2ROYA 3QUMB 1BZEA 1UOWA 3TYFA 2ADFH 3NQKA 4LOUC 1DLFH 3FQ2A 4P46B 5E2JA 3SGJA 3T08A 4AZ8A 3MUUA 5I18H 4Y19B 1U8PA 3VXTA 5JIQA 3GB7A 2ZNWA 3G5VB 1NFDE 2G0KA 2XTSA 3N9GH 5BXFA 3P30L 4UM9D 1WK0A 3EDDA 1RVFL 5IMMA 5FA3B 3QIBB 4S10A 1E42A 3H9HA 5FYKL 1L5GB 3D69A 4ZFOB 2H41A 3BWAB 4KJPD 4F9PC 2WYTA 1X9UA 5D5MF 3ZK0A 3AS1A 5IT2L 3LNIA 3FHEA 5FGRA 1N64L 4GUCA 3KPOB 5TJWK 5I24A 4R5XA 3D2UD 1FP5A 2QL1A 5ETUB 3QUXC 4KH9A 3HG2A 5FA4B 1BWMA 5DRNB 3TA4D 4KGLA 2APTA 2HFEB 5LXGL 4Y4KD 3NZSA 1CGWA 4K5MA 1QSFD 2CO7A 4AUUA 1QEWB 3ABKB 3QIUA 4GMSL 3NZ8A 3QNZB 3PU7A 1CFTA 2F68X 3WGUB 2IAMC 3QRGH 4CN4A 1MAML 5CP7A 3ESMA 4APXA 5HDQL 4NWTH 4MA8L 2VZ3A 4BZ2L 1EAPB 2QVFB 4EN3A 2B0SL 1FZOA 3S88H 1OALA 4FL4B 3UTSA 5IB3A 2NTFA 3ELQA 1I4FB 4X7CC 5BO0D 4PREB 4ZYKA 3FFOA 2VZVA 4PBWD 4TVPD 2G3MA 2VLLB 4ZTOH 1D9KD 1CL7H 4H0GA 5DK3A 5IQOA 3TNNB 5DA0B 3EJZD 3L1OL 1J10A 4HALA 5C3IA 3IMVA 3EDKA 3QJHA 3NGBB 3P4MA 3DWTA 3EJJX 4G6JH 3CFBB 5DSCB 1CTOA 3QXDB 3KPOA 2OZ4L 2BIPA 4FLQA 1QTYT 2VDPH 2VERN 1VACA 1CURA 1RIVH 4PJ9A 4Z7WF 1UD8A 2ADGA 3H54A 1A6ZA 4W4OC 3RDTC 1XBRA 1RSFA 2CM6A 1IARB 1ERNA 3CQFA 4IDJL 5BS0B 3SE4C 2COVD 4K3JL 5D6CA 2XVKA 5E24E 4F7MB 3UIYA 4MNGA 1JPFB 3IGUA 5FXCH 4MNQE 5BMFH 5CGYD 2CHZA 1DQML 1D5RA 4X4XB 1LD9B 3NTCH 4N3UA 1MAJA 2UWEA 1GA2A 4MD0A 4E9SA 1UH4A 4ZX5A 4MHHI 1U3JA 1RD6A 1TYEB 3RVTC 1SF3A 2AABH 1X5JA 4XBEH 1AMXA 3GZKA 5KSUA 1KTLA 3OC8A 4DP7X 5DJXB 1UM4L 4ZAKB 5HYEA 3KLDA 1T66C 3WOVA 2R1YA 4RGMC 4RGND 2EDJA 2WMPB 3BW9B 3OAZK 2J12B 3NH7L 1XGZA 2VRKA 2DBLH 4OQTL 3GMMB 2XWJB 1KJ3L 4JPKH 2EE9A 4BCZA 3GSNL 4DOHB 1MHCA 1CR9H 1REIA 4OCSH 4P2OD 3HJEA 2IBGA 5F88A 1IKFH 2VLME 3NFSL 5GGVY 1WITA 2GSGB 3UABA 2ALAA 2XPGA 1W0WA 1NUNB 3DPBB 1FPTL 1SOQA 4NN6C 1BQHA 1BLIA 2DV6A 3BOVA 5K5YA 1XF5A 2X4UA 4Q6IA 2A6JB 3UC0H 3HVNA 1RHFA 1XAKA 4LLWB 1BX2B 5TDNB 3BGFC 2E7LC 5MEND 5EHFA 2DWTA 4NXSA 1CD1B 4XWOC 2F5AH 1NTDA 5EEYA 1FNEA 3CCHB 4QRPB 3V4LA 2O5ZL 1KLGA 5K93A 5DDHB 5E56A 5L4JA 2EZ0C 1IO4C 1IJ9A 4MAZA 1A4KA 4XP4H 4AG4H 5DJCB 3VXQA 2WMPA 3EO9L 4DAGL 2WCGA 4P5TC 1IAIH 1KGWA 5J06A 3D39B 5HYQA 4QHLB 3HMXL 3CTTA 3RA7H 4NBXB 2IDUA 3DTUB 2CE6A 2QLVB 1ZPUA 4BKLA 1HJBC 2XX1A 3FRPA 1V8HA 3M46A 4K07A 4U1SA 2VLRE 4N85A 1UXMA 3EGSB 3V5HB 2MCPL 1W16A 3F6IA 5D1XA 1MFEH 4A7UA 2CLRB 1O0VA 3DX6A 3TO2A 3CFMA 3DMMB 2PMZA 3RZCB 2GSMB 2J21A 1KYOK 3DOSB 1CVRA 3IXAB 3OKYA 4K3DH 5I1HL 3QDME 1BX2A 4BE5A 1E2WA 1HXMA 1BZQK 2VXSH 1BZDA 1YEDA 2R9HD 4MJIB 4MQ7A 2P42B 5CINH 2GK0A 4FFZH 5DJ6B 5E2WH 3EJYC 3WBDA 3LEVL 2X88A 3KPMB 2EE2A 1SXSA 1ZHNB 5KS9B 4LARL 1NAMB 5ERWB 3QWOA 3BP7A 3D0LB 3FULA 4K8RD 1UXWB 3OKEB 4KI5F 3KHOA 3KPPB 2WZPA 3TJHD 3LMJL 4JG0H 5EBLB 2AMUA 1S9XB 3VU2A 3QJUB 2DJUA 5L7XH 2LFGA 1L6PA 3JWDC 1U42A 4XNXH 3BUIA 3BAEL 2N59A 3ZE1F 2AP2A 1QA9B 4WFGE 3S96B 3W0WB 1NPUA 1ZHKB 3TCTA 2ADIB 1EAJA 3HPJB 1KJVB 3O3BA 3TWCH 3WI9A 5K9JH 4GNKB 4PV1C 1BYPA 5EOCL 4N0UA 5EWIL 4JRXD 5IB4A 4AGMA 3KPSA 4MX7B 1FVCB 3GRWA 1IIIA 2H1PH 4U1IB 4DTGH 3PP4L 2UY6A 3G5ZA 3CMGA 2ADFL 1A47A 3QGVA 3FOLB 3CZNA 4JQIL 5CHNB 4P2YA 1TMCB 1IFGA 4WNQA 1KJ2A 1MCIA 3KPMA 5K9KA 4NKDA 2G9KA 5GJSH 5MENA 3G6DH 2WP3T 4PJ8A 1P9MA 4YSRA 4UMGA 5FYLL 1WE5A 4YXKL 2OYKA 1ZGLA 1W0YT 1U8NA 2O93L 2YSSB 4KK9C 2ITDA 3CFJB 5EORH 1SN5A 5JOFA 3HBPA 5KANG 4EE2A 3P3UA 1UASA 1T5WB 3ULUC 3VI4E 2TAAA 1SDDB 4HH9B 3MXWH 4XO9A 3MV7E 4L4TD 2DTMH 5HGAA 2YK1H 3A21A 3T2QA 4FAAB 3GKWH 4P5TA 1TQTA 3LNGA 4TL5A 3HC2A 3QUML 3TPUA 2WC7A 5EZLA 3MCKB 5F7FA 3OXRB 2JCCA 4WO4B 3TIDB 5JPMC 2E7BA 3FN0L 3ZKMC 5BUAA 1RZ7L 4PW4A 5KAQF 2EVGA 2DL9A 3EYUL 4IS6B 2GT9B 1FFRA 3ISWA 4GT0A 1PNDA 4Q97A 3NG5A 3VWJA 2VRAA 4NRXA 4M8UA 2ZX7A 4E9QA 2ICEB 3UJJL 4R5VA 4HGMA 4FLRA 3T8MA 4GO6B 4IK7A 5A40E 5IHZB 1NM9A 4JQXC 4DT2A 1TYJA 4L8SB 2P5WE 3EHBB 5FYLD 1U8NB 4LVEA 1WBYB 5FECB 5DC9B 5K9JL 3GSXB 3DX0A 1UB6B 4ODWA 3GYRA 3WUWA 1Y6MR 1JYVA 4RGNE 4WWPA 5LN8A 2WN2A 1NCGA 3WN5A 4YZFE 3RRQA 3II1A 3HNSL 1KELL 5EC2A 3ULSA 2Z65C 3VFVA 5LDUA 4HJJL 3SBRA 3JVGC 2VABA 1DJIA 1KGXA 2MJWA 3ZT7A 3PWUA 3CVBA 3SDAD 2I9TA 1CFBA 1I1RA 4N25A 4GKZA 1S7WA 1LO5A 5DD5H 3ULAB 4DESA 2FX7H 1D5MB 1NAMA 3N55A 5FYJL 1HWGB 3Q2NA 5T3XE 1HEZB 3MPCA 2WUBL 3N44B 3PDDA 5IB1B 3HOGA 5KJ4A 3RIKA 1A7OL 4H2AA 1FN4B 5MI0C 2P9RA 3LXAA 3EFDH 3O2WL 2VN4A 3LVEA 4GRLC 4A2MA 5I1CL 2XXMB 2YK1L 4H0IA 5D2LB 3ARQA 4XNUH 4N6QA 2EEBA 2NY6B 2E7LA 3LCYA 3F7YB 1CU4H 1J11A 3VFOB 3DV4B 43C9B 3QWNA 3HLAB 4X5WB 4JFDD 4D0BB 1KIQA 2V3DA 3B5HA 4IEFB 1QACA 2L0DA 5CEZL 4DN4H 1TEFA 4M8QA 3Q9PA 4KPHL 4V1DB 4L05A 1NFAA 4ZK8A 3OJMB 3BN9D 1IEAA 4WEBL 4D9QD 4ZSOA 1KJ2B 4AQEA 3W2DH 4NKDB 1NFKA 4G8FA 5C0BB 4LLUB 2VN6A 4PRIE 5EF0A 5L2JB 4PJEF 2Y7QA 4LAQL 5I0VA 5I73C 2GI7A 2RQEA 4JHZA 4K71C 4L3EB 5D7KE 1KIPA 5DRZB 3N1FC 3FTWA 4PRDB 4O5LL 2GTWB 3ZQXA 1RH8A 4HH8A 6FABL 2FX8L 2FWOA 3KVDD 2YZ1A 4U1HB 4LLAA 3OHXA 2AJUL 2YD6A 3E2HB 1GGYA 2VDNB 3FU3A 2RJMA 3QUZB 4JN2A 3FAWA 4FXGB 4K7PL 4YR6B 4LLDB 2HG5B 5LGKA 2Z34A 4GRMB 4PTTA 5BUPA 2GTZB 2EXWD 4Y7OC 3MV7A 3VGFA 5DD0H 1BQ5A 1X7TA 2HRPL 4F57L 4B9YA 1IC1A 1YAIA 2VIRB 5TE6L 1KEML 3PHQB 4D0CB 2AXJA 2PYED 4AM0A 2WXNA 3DV6A 4G9FE 1MCLA 3FFDB 4DF9A 4YDZA 5BQDA 4OZHF 4OUUA 3VMPA 1FZMA 4LP4A 3UGUA 3OV6A 4GIPD 4AQ8A 1JZEA 3RGVC 5A1AA 2ZD0A 1HH6A 3MUHL 1CT8A 2GPZA 3QIWC 4JO3H 4M6AA 5CLXA 1MNUL 3T2OA 5GS1A 3I75A 5LO7A 1CLZL 3W11D 1AYRA 1DFBH 4Z7VF 3PNWB 2OSLA 4M3KB 3BD4A 4XX1E 1VLXA 4XMXA 4KITB 1AZBA 2NNRA 2B4CL 4LPXA 3MRGB 4XP5H 3BUYA 4X5PA 1MFDH 1NCTA 5C0RL 1ZJBA 2E7HA 3CVHL 5D9SB 3MRCA 1MH5A 3QEQD 4LPCA 2W9DL 2AKRB 3ZL4H 4BZ2A 4JE4B 1TQBB 3CQQA 4XCEA 5I17B 5LBGA 4MD5A 4ETYA 1SN0A 4GQ9L 1JF6A 4R3SA 5HVHC 4KKBC 3RDTD 4R96A 5D1ZD 1HDMB 1AHKA 1JTPA 5ENWB 1BCIA 2WZ0A 5DVKA 1CTMA 2XBZA 3LHPL 4U05A 1V27A 4X9IA 5DHVA 3SDXF 1I31A 1BM3H 3DHMA 3HLKA 3J7HA 4M48L 4HIXL 3BZ4A 4OJDH 2PWHA 4GUOA 1BD2B 5EO1A 1A6UH 3D51A 4R2GC 2H1PL 4DTGL 1E28A 3QPXL 1K4DB 1NGQH 2YFOA 1U3HC 1SJXA 3H42L 4G6FB 4L1HA 4MSWB 1AZVA 3QORC 1WZLA 4EZJA 1LO3L 4HOXA 5F3BB 5FLVA 4YHZH 4XNYH 4ZPVA 5GS2D 4X99A 1TVHA 4PJ6A 3B2UC 4KUCD 1EWHA 1YYMH 3X14A 2YJQA 4MMZA 4KRLB 4N3TA 3MUJA 2DQDL 3MRLA 4HQQL 1KLUA 2FLMA 4F1SA 1E4JA 4G7SB 1N5YL 4F1ZA 5BRZB 1JK9A 1T2QL 4YSUA 1QFWI 4LLUA 1A7PL 4GRWE 3EOTH 1TZAA 4B60A 1GTNA 2EVIA 4JFPA 4URTB 3LKRB 4UNTA 3S35L 3FW6A 1KB5A 1PAZA 4N2HA 4HHAA 5A2AA 2ED7A 3KGRA 5D5ME 3D0AA 5I6XB 1A0QH 1NEZA 4OI7A 4ZUWB 2F0CA 4NQUA 3N1QC 4QY8A 2FEDC 1ONQA 4N2MA 2VDRH 3QDAA 1K4DA 3MRMA 4P49A 3PF2A 4PWHA 3QR1A 1VGEH 3F6JA 4DGVL 4XB7A 4WY7H 5EU3B 1BFOA 3QE5A 3L3OA 1FDLL 2VZTA 3S5LB 4JFZH 1MCFA 5JLZA 1J0JA 3PJLA 1GC1L 3ZUCA 1MY7A 4CC4A 2ZKHH 1NMAH 2IQ9L 5T3ZL 1A6AB 1Y1UA 1FNSL 3ZLQC 3U7AA 1FC1A 3KLAB 4N9GA 1BGXH 1FL5B 3QHFL 2GUOA 5GS1B 4OGAC 5CSGA 1Z2KA 2G2RA 2M8XA 3N91A 4JG9A 3WE6A 25C8L 1MRDH 2XZCH 4EOWL 2Q86A 3MRGA 1YEJL 4YDKL 2QPSA 2QZ5A 3RWCA 4NP4H 2J7LA 4U1JA 4UTCA 3QPQD 3IS0X 1MEXL 1RJZB 2B08A 2YPVL 1N5YH 2HLAA 3DMMD 1HE8A 1MLBA 3IRCA 4BQCA 5JLZB 3ASOB 1GGBL 3LRSB 1KBBA 4O2CB 3VWKA 5F96L 3NCYS 3IU3B 4Z77B 4ZW3A 1SUJA 1OGAB 3H2QA 4PBXA 3T3PF 1BF2A 3PLYA 1A6WH 5T3XD 5FDWA 3QZOA 2VDQL 5DGRA 1SHMA 2CLVB 2ITCB 3EUDA 3NIGF 4RWYL 3TYFB 3WS6C 4FQJL 3TESA 1MCWW 4Z7UF 4W4NA 2YAOA 4PGDA 4DGVH 2X5PA 2WWNA 3EW3B 3TEUA 3TBYA 2Z6FA 5IVOA 4ZXBC 2BIIA 1QFWH 2CXGA 2L04A 4FHJA 4IKNA 3SBPA 1A9BA 1MW2A 4MS8C 4ZPTA 4JM2D 4DQOL 1MF2H 2YAFA 4KXDA 1H6FA 2XXCB 3KPRB 4XPBL 4GI6A 5D7EA 4L4VE 4WHCA 5DO8A 5C8JA 4NCC2 3VQ2C 3V4UL 3VO0A 1EZLA 1NGZB 2YGPA 2FJUB 1BFVH 4IJ3C 4BSVA 1DBMH 3IDJA 3O6LL 4KRNA 1M53A 4MMZB 3OPUA 5DVLA 3GGWA 1DEEB 3ZUNC 2BSCA 3D07A 4ZXBA 1INDH 2QFPA 3JWNH 1R9FA 2H6OA 1CWVA 1UXSB 5D2NE 3CHSA 1KN2H 1PZUB 1QPXA 3DYOA 3TT3L 3PWPD 4JFPB 4QDGA 3SE9H 2MKWA 4IU3B 3UAJC 3KPPA 5FWRA 3IFLL 3RPIB 3I6KB 5FW7A 4U2ZA 4N8VA 3FQNB 3KD4A 3VXRD 4KROB 3RY6C 1N3NB 3RZWA 2NQDA 1MHEA 2ZONA 4RGNB 4LPWA 1RZJH 4G6ML 3M7OA 3MRMB 4CU8A 2YPVA 4GEJA 1OTTD 4ZFOL 3RJQB 5F7UA 1HAWA 3ZDZB 4Y4HD 3WFEL 4UYPA 3RWEA 2XN9E 3SDXB 4WSGA 1O6VA 4CN6A 4UU9A 1JNNL 4AV4A 1TF4A 1YDPA 4QRBA 3UGEA 2C9PA 3VTTA 5IOPA 5IWLA 2MNUA 4AT6A 5I8OH 1H5BC 4JUTA 1N4XH 3K6SB 1CE1L 3IDUA 4NNXA 3ALXA 4RQQA 1G7IB 1P4LA 5H4YA 2ZAIA 2DH3A 1OF0A 5M7QA 3NT0A 3OF6D 3WELA 2LU7A 2E56A 5D1ZI 1R47A 4ZZKA 3V5HA 4FDWA 4MDRA 3MROA 4YE0A 1TKWA 5AKVA 4P2OA 4NQDA 2A83A 4XC3H 4I18A 4AENB 4LSPH 1ZVSA 2CGRH 4PGCA 4DERA 1WT5A 5KYYA 1H3VA 1VSCA 3H2WA 5AENA 3OLDA 4QXTB 1R3KA 1P1VA 3GTTA 5EIVA 4QRSA 1DBAL 4X4ME 3MFFB 3W38A 3AROA 1T6WA 4GAGH 3VXNA 3HS9A 4N0FA 5AB2A 1XZ0B 5JMOC 4CVZB 1U8LB 2R0ZL 3FONB 4IM8A 4S0SD 1AD9A 4ZUUB 2WUCH 3G08A 5HGDA 4B9IA 1WT5C 2A9DA 1NCBH 1EO5A 1TZGL 2R59A 4H40A 4MAYD 1TO5A 3TBTA 3QUKA 2J4WH 4FFVC 3VGBA 5I71B 3IU3A 5ERWA 5A6IA 1WC7A 2B39A 2P8PA 4X6DA 5DEFA 3RDTB 5CCJA 5FOBB 4XVSH 2J20A 3OBAA 1RLBA 2OMZA 4OZFG 4IOFD 2CO1A 5I28A 4LQFH 3P9MA 4M5YH 2J5WA 4FYSA 1Q9LA 4FG2A 1F2XK 2OS7A 5F7DB 3IJHA 1XF1A 2X12A 3KM1A 1LWJA 4TQ8A 1WFIA 1P1ZA 4X5RA 5EUOF 2GKIA 2UV3A 1U93A 4X50A 1L9NA 1H3GA 4LBAA 4QYOB 2AAVA 1MI5A 2X9YA 1VHPA 5E8PA 5ADOH 4G8GB 2AJSL 2F15A 3WMPA 4AE1A 3KPSB 3MJ7A 2WWKO 3C5JA 4CKVX 1CG9A 4XCCH 3K2UL 2GJ6A 4L4VA 4NQCE 4L5FL 3GM8A 4UTAA 4L18A 1N19A 1U8LA 3VD9A 2F53D 1TT6A 1S8DB 2IH3A 3SBQA 2GBAA 2TRYA 3NA9L 3VQMA 3QUYD 1C08A 3WL9A 4ZUVB 4G9FB 1XCTA 1UM5L 3CFQA 4PVLA 5CR1A 4NDMA 2IWGA 3Q3GA 3QUKB 4HUWA 2XI9A 4HU8A 3VW3L 3V9CA 1RZPA 5C7XH 4FQLL 3GJFH 4R8WL 4NO2B 3A67H 1YSOA 4PW9A 5D2NA 3GWJA 4MJHA 5EORL 4E5XB 2E6PA 3CC5A 3I85A 3FQNA 3AUVA 4HLZG 4N8PA 1JVOA 4PJHB 2C3VB 5HHOE 4BCXA 1XO8A 1NEZG 3L4CA 5B8CC 3IYLW 3SDDD 3QEUB 1KCRL 2EXWC 5I19H 1BAGA 4GPVA 4K5NA 5SV3A 1JXJA 4I4WB 3BGFB 5GZNA 2NY1B 3S3JA 2NY3D 3HPLB 3SN6N 4R90H 1Z5YD 4HC1L 4R2GB 5KBLA 3BH9A 4P5SA 5T1MA 4YQXL 1BQUA 4V1DA 3Q43A 3RLSA 3MLVL 4KKZA 5I82A 5IK3B 1HAUA 3P54A 3MX0A 5LGHH 5ID1B 4S0TD 2JJTA 2WW8A 2PCFA 4L1BA 1FFNB 2GSIB 3DXAE 3MYJB 4B9KC 3FU7B 2YXWA 1A8JH 3VXMD 2CBMA 3CMOL 2MOGA 3K4AA 1JWMB 1YPZF 4IDLA 3TL5A 2FATL 3JWNG 4PUBH 1ZVSB 2VLKE 2A73B 2NUTA 3MNWB 1UZ8B 3OKMA 5F1OB 5MP6H 1EEZB 2NYYD 1JDCA 1T21B 2HKFH 5D4HA 5AW8B 4Y16B 1I8KB 4KX9A 3CHQA 4UV7H 2J6WA 3HRZC 5ESVB 3FBQA 3HZVB 5GJTH 1FLRH 1XZ0A 3PQYD 1B6UA 3ABZA 4L9LA 5LBSH 4OIIL 4Y2OA 5L9DL 3FQXA 1A4AA 4PQXA 4DP0X 5FO8A 5K39A 3IMRA 3P4OB 1Q1PA 1PX3A 4I3SH 4AYEC 5C1MB 1GXEA 2VL5B 2FGZA 1QBML 5E7FA 4R0LC 3I50L 5AG8A 2MPVA 4IU2A 5G2NA 3H8NA 5JA9A 4YOKA 4WEEA 4AKOA 2ORBL 4TSAH 4R3SB 4CDGC 3NJKA 4G1MA 3S3SA 3DETC 4WWKB 2WQRA 3D18A 3E8UH 3LPWA 5A16B 1GGIH 3LIZH 2ZKXA 3GEFA 2BK8A 3OQ3B 5SWZE 3V4VB 4JFEA 2D7OA 1INQB 4LKCB 4A68A 4EUPB 5JHLH 5KW9L 4JQVC 2EYSA 3MNWA 4WU5A 5E6ZA 5T1DH 3BN3B 4BZYA 1V7NL 4MCZB 3BUYB 5TPWH 4IKLA 4OW6A 4EI0A 2V17H 3ZYIA 5EEVA 1UGKA 4I0KA 1MI5E 4NC0B 1S7VA 1LO2H 2EABA 2BSRA 1TEYA 4QIRA 3I2CL 4XNAA 3DURA 3OAUL 1YN6B 5EBMB 1FFOB 5EO9A 1BFSA 2K3HA 1BVZA 2HLFD 1BBDH 4L0PB 5PAZA 3IE4A 2ED9A 1SMAA 2I9LB 2VGLM 3BIKB 3D2TA 4KFZC 1BQRA 4ATTA 4NQCA 1NDMA 1RZIA 3U4AA 4XHJD 2VMEA 3D3VB 4AGOA 1JHTB 4PJEA 1IEHA 1GAFL 3QJVB 2CO6B 5K59F 3N40F 4XPGH 1FGNH 4V2CB 3H3PL 4XGZB 3S8GB 3IDNA 1YNTB 1W8NA 3AUWB 5FOJA 4XXCA 1CZ8H 5E4OA 2IFFL 2GEEA 2IDSA 4QOKB 3MRKA 3GHBH 5E0FA 1NAMH 4UZGA 4W9KC 4YDIH 4A37A 2H3XC 4KVCL 1M4KA 1F4WL 1OP3H 5CLTA 3IMTA 2N56A 1DDTA 2NPLX 1BMGA 1QBLH 4JFEB 2NOYA 4L2YA 4PLJD 2YQGA 3IWVA 5BZZA 2YUZA 3IXTA 5AAPA 1T5KA 2AJZB 4XNBA 4Z0XA 3IBOA 4RDQF 4RAVA 1IBFA 3SIKA 5J5EA 1PLCA 1YNKL 4AI7A 3KJ6H 4BYHA 1KIUA 5TQ2H 4H20H 3STLA 4D0CA 2YA2A 3B34A 4B3EA 4HUVB 2CHWA 3DX9A 3EDFA 5MHSE 1JV5B 4GS7C 1BP3B 3EO1B 5JPMB 4CA4A 4JO8A 3U6RB 3U6XA 3FQTA 4EQ2A 3Q9QA 4Z7UB 1LE9A 2ZUQC 4G8IB 2VZUA 1DJXA 2DQHL 2XN2A 3RIAF 4PV9A 5BRPA 1QSEE 3AB0C 2Y2TA 3NJGA 1XGYH 5T5NG 2OMTA 1DQMH 2WO2B 3WEAA 4FEMA 3O4LB 4F7EA 5C0BE 1J8HA 3HEIB 3RDJA 3TNMB 3BH4A 2PTVA 3MXVH 5DLLA 3ZE1B 3QNXB 5HGBB 1CPUA 2H26B 4YHKH 2OQJB 4ZUTA 3GZOA 1WIPA 1IGJA 4U6TA 4KNSA 2BW5A 3O6KH 3OWRA 1L9MA 3SO5A 3TF4A 2NXYD 3VX0A 1DUZA 1U91B 3GSRB 3O0LA 4O5LH 4QRRE 5DVOA 3TTYA 5FO8B 4Z7NF 2APFA 2R4RH 4JO2L 3X12B 1OK0A 3HBGA 5GRYA 3P2TA 2VDMH 3MCLH 5FPIA 3F7VB 3QRBA 4OY9A 1IAKB 2J2ZB 3UTTD 1XH3A 4HKBA 5DMKB 4MJ6A 1E7VA 1A6VL 3SPCA 2PW1A 2GUOB 4LXFA 5EOTA 4NERA 1F4WH 3SE9L 4LASL 3NJJA 2V37A 4P4KC 1EGJL 4H1LA 4QKXB 4AEHH 3LSOA 3JV0A 5C2UB 1KBVA 4FG4A 4Q9CA 2AZUA 2O5XH 1G7MB 2AEPH 2VLJD 3FB8A 4RIRB 2SODB 4NRYA 3QC6X 3LPOA 1TQVA 4KKNA 2IH9A 5AW4B 3FKUS 5EZJA 2EH7L 4ZTPH 1RJYB 2A9AA 1AXTL 3ZTCC 5J0BA 1RIUH 4LSSH 3FO9A 3HHMA 4JVUA 3L3HB 4ILDA 4PAZA 4UM9B 1TZ8A 3QFJE 2DQHH 3ARVA 3RJOA 5DS8A 3VFUA 4H2CA 3QQNA 4Z7QF 5ACZA 3UTTB 3MDJA 4CNIA 3L3IA 5D4IA 3I3EA 4E36A 1Z1WA 1ROWA 2HTKD 1QKZH 2AXFA 3CQPA 2MQ0A 2KHAA 7PCYA 3BUDA 4CMHB 4EBQH 1N64H 4UF7C 3HMWH 4PCTA 1I1AB 5E6UB 1AMYA 4C56B 2JK5B 4PJGA 4M1DL 2BFVL 5HYJA 1YC8A 2GIMA 3CHRA 4HX1A 4PB0H 3QRGL 5GSVB 1A1OB 5DFAA 1HOEA 3QEGL 4HCRA 4Y5YC 1OAYL 1U8QA 4M02A 2C1PA 4NKIL 4ZFZA 4MKTA 4RSYA 2BC4B 1QLRB 3SCMC 4QRTA 3WJMB 4I0PB 5ALBH 4L1SA 3QDGE 5JPMA 3JZYA 5I17A 1JVKA 2ERJB 5IQMA 1DEEA 2OTPA 2R1XA 1WG3A 2XQBH 4ELMA 4JN1H 3V4VH 3MRJB 43C9A 2OSWA 3BFQG 1DE4A 4GXFA 5E4EC 5AVVB 4ZRGA 3W56A 4KTEH 4OJFL 3ISYA 2FWLB 4KJQC 2R1YB 2X7LB 1RIHL 1N12A 3AS2A 4PG9A 5IBUB 1RLWA 4ADIA 2YEVB 4WUUD 1NPNA 5LQBH 5GRWA 3UCRA 1U95B 2JKIS 2QTVA 3C9NB 1MI5D 3UC2A 2BOLA 4HP5A 2VNCA 5LJYH 4YWGL 3V6FB 3DOIA 5C0BA 1J8HE 1UD3A 2VMJA 2VXTL 1C8QA 4PRHA 5JZ7C 2EXSA 2OQJA 2D7QA 2DYPA 1F2QA 2A83B 7FABH 2AXWA 2E3VA 3CDFA 1J12A 2VMFA 4GSDL 1S3KL 3OZ9H 5HYIA 3DO3A 4PJ7A 1S9XA 5B8CB 5LKNA 1XCWA 1AO7E 2WKLA 2JQZA 2R69H 4XVJL 3ZTDC 2X4NB 2OL3A 4I7ZC 1FQ9C 5CJQL 5EU5A 3ABGA 1Q9WB 3U7YL 1YJDL 3ZOAA 4ODUB 2AK1L 5HYSB 3L5WB 5F70A 4DVRH 4LLQA 3I3DA 4TNVK 3LXUX 4BFIB 4D3CL 4OD2A 4HAFA 4N2IA 3OKDB 2PW1B 1BJMA 1EDYA 2IPKB 4HIEB 3LKOB 4M1DH 4EIBA 1FL6B 4FNPA 2MQCA 1UA6L 1TG8A 4KXAA 4FXKA 4IBQA 4LSUL 43CAB 4C4BA 1FZMB 3SDYH 5KZCD 5KS9E 3DRTA 2EYRA 3KXFA 3U7WL 3C87A 5LHDA 1QRNE 1KCUL 1J1OH 1SFHA 1SHXA 3VFRB 3TBCA 5G4NA 4DP5X 5IGXL 4KMTH 5L2KE 2X53A 5D8JL 2NSXA 4FQIH 1A14L 1KGCE 1L7IH 3RY6A 5BJTB 1NMCB 3IJHB 1NGWB 5I15H 2HLEB 1AGEA 2YQBA 5CEXA 2WXPA 5H37H 1GTFA 4J39A 3QJSB 4N8UA 3UJTH 4Q6IC 5D71L 1JMXA 1KXHA 4NO5B 2PCPA 4RNRB 2EVJA 5ANMA 1NGYA 4QHMA 3TZVC 1OAUL 1NIFA 2FIRT 3FOMB 1CXHA 3MRIA 4PP1D 3TN0D 2QGEA 1FYTE 5ID0B 1YHPA 3SDAA 3VFPA 4U1KA 4JW3A 1TSRA 1CYWA 2Y3NA 2H3NB 1OM9A 5HJGA 3Q8EA 3WNJA 2YPVH 1E5ZA 1FIGH 5DR5L 4CU6A 4POYA 5IVXA 1HHHA 3WL9B 3GSOB 4KZEH 3TIDA 1M1SA 2ZYHA 4QNPE 5I1GL 4TM9A 1XEDA 5J6HB 3GXNA 1FFPA 4YBQD 8FABA 3VQLA 2IQAB 4X7DC 1I7RB 4U6XA 1TZHA 4ZD3L 4MVBD 1MCQA 4OJCA 5H94B 4PGBA 1LK3H 2FSEA 1Z6JT 4K94C 3RY4A 4GI9A 1XXDC 3OLIA 4PS7A 1QW8A 1A4CA 1A9EB 1JHKL 4LDOB 2VDQB 4YBLB 5DLMH 4LLMB 3T3PB 3LRSA 3G04B 4DKEH 1WS7A 3TN0B 2VJ0A 5C9KA 2W9DH 4MQXC 2IPUG 4WI3A 5AB1A 3ZHDA 4FCHA 1JWSA 2WLIB 2FE0A 4UQ2A 3O6ML 4P3DB 4OQTA 1ZEAH 4K5LA 1MFCH 1UD5A 5D7KD 3P73B 4H0LC 1K6QL 4M48H 4QGTA 2X2HA 4JR9L 5LN4A 4LHJB 1FG9C 4F2FA 4IIQB 3OMNB 1BQKA 4QHPA 2WTRB 4GG6F 2GJZA 3AVEA 4PW3A 3VTMA 2WD0A 1B4TA 4DPAX 4G43B 2D7MA 5EC1B 3EOBB 1PG7L 3GS0A 2F74B 3ZE0E 4RFEB 4ZFQA 5JHDE 2YSSA 3KPRA 5A2LH 3QQ9C 4A38A 4F9LA 3BPNB 2JLLA 2IXQA 1UZ8A 3OKMB 4X9GA 1W2KT 3BEVB 4R83A 2NY6D 2WN3A 4PJBF 4NJ9L 2WLYA 3GM0A 2YSTA 3MUY1 1NC4B 1XF4B 2EACA 2JIXA 4HJGA 3TEXA 2KZ1B 1PIGA 2X6VA 1FBIH 1GR7A 1KXTA 2CUMA 4X6DB 5DEFB 5F9AC 1SN2A 3QFDA 4FQQA 5EZOL 1T2QH 2D3LA 2ZZUT 3HUJB 2B2XL 1AG0A 3QFGA 3NIDF 4GBXA 4APQD 1HILB 4ORGB 2HT4C 5IFHL 2A77H 1YYCA 4Z1PA 3QNFA 5EIIB 3LKNA 3KPSD 1FHGA 2E5EA 2WXLA 4H1LG 2IFFH 3AXIA 1J8KA 3HFFA 1FHNA 2N1KA 3K8MA 3MRRB 4IS6A 4K3JH 4ZD3H 1FGVL 3MNVA 2CRYA 2I60L 5DD1L 2LVCA 1OZTG 2R56H 2WTOA 1BVLB 5HHQB 3KLAA 1UJTA 2ZOKB 1JZ7A 3FRUA 4H7VA 5GGSB 4Q6YA 2F19H 3RWFB 1MFBL 1DJYA 1K5NB 3UBXI 5E6IB 3GDBA 3U1SL 1AGEB 1ZV2A 3QS3A 5CEXB 1O9ZA 4HV8A 1UH2A 4IRJC 2CCLA 3RURA 1HZLA 3KR3H 2Z91B 2IV9A 4LCWD 4GIOA 5I23A 1OWRM 5FHBL 4AKQA 4X9FA 4GG8A 3AQXA 5ANME 2UZYB 3DSFH 1UT9A 3CDGB 2VDNL 1DVFC 1J5OL 3O6FB 4QHNA 4NT6A 3HUJA 4JR9H 1T1XA 4CGTA 4QRPD 4PRAB 1R3IH 2R0ZH 5FYKE 2AJVL 2AJXH 4PS8A 4B27A 3KCWA 1UFGA 4PJFB 2K9FB 3FUKA 4YBHA 3CVHH 2G75B 3MNVB 4JL1A 5E1AA 3KH4A 3GXMA 3MZTA 1G7JB 3EYUH 1DHKA 5F6HI 1HXYA 1F86A 4RWHA 3EF7A 3EG9A 1ADQL 3HJ0A 2XA8H 2WQAA 1URIA 1ZWIA 1I85A 3TV3H 3SKOA 1S7RB 1AI1H 2J55A 2CZNA 2CIKB 4JFUA 3LKQA 3PHSA 4JMNA 3DPBA 4LFHG 5AQ0A 3RWIB 5IVZA 3K5RA 2X4TA 2R39A 3MN8A 3RBSA 5LVEA 2VDMB 3HE6A 4LZKA 2A9NL 3RX8A 2OK0H 4GG8B 1XL4A 2G0LA 2Q3AA 5D7SH 3FUNA 1NCJA 3FB5B 3LAFA 3EFOA 3PABA 4QHNB 1DCEA 1U6AL 2DAVA 4WUKH 5DZOA 1B3JA 4AH2A 2WVSA 3MRBA 4NC1E 4DVBA 5MP6L 1QRND 1ZIBA 4GSDH 3ESVF 4R4ND 4TNFA 5I5IA 4WUUE 3CFNA 5E9DB 4Y1AD 3EGXB 2BVQB 4N6RA 3OR6A 2P24B 2ZKYA 3S8WA 4Y9CA 3MJ9A 3V9EA 1KDJA 1P1ZB 2XZQL 4XNYL 2OMTB 2G75A 4Q6KA 2ZKWA 5J8OA 1U8JB 2CR3A 1LK2A 5IJVB 1Q1JL 1XIWB 2FEEL 4FL4C 3O3AB 1XFPA 5K33A 6PCYA 1Z9MA 4EDXB 4LIQE 3T0EA 2WUBH 1ZHBB 2LR4A 4M5ZH 1LD9A 3KPLA 3GBNH 5KSBE 3M17A 1KBGH 1T7WA 2G3XA 4QAMB 3WIHA 1I82A 3TO2B 5D7LD 3RB7A 4TF4A 1C5DB 2WANA 2ORBH 3OHMB 3WDHA 3LZPA 4FQQB 4D0DB 4PJIF 3QUZC 3M86A 1JNHB 5FAAA 2BSTA 3C2SA 4AL8C 3VE0B 4HUWB 1DVXA 1RU9L 1CIDA 1U8IA 2FZ3B 1UACL 2X10A 5IW3A 3LEXB 4EPSA 4F7CA 1S9VA 3O2DH 3SPVA 4KJYB 4TULH 3F7LA 4FLHA 2R23B 5DS1A 2X2YA 4LAJH 4OT1H 1Z7JA 4JFZL 4MCZA 5D4QA 2BW4A 5BZWB 5I0XA 4XZ4A 4PSRA 3KWTA 1I75A 3VD5A 1RZJL 2PTUA 4XN1A 3PGDA 1WV7T 3U9UB 3JVFC 3VGAC 3CDYA 3R4DA 1U91A 4LCCC 1AOZA 3PGCB 2FATH 4P2QA 1UUNA 2OCJA 5ALBL 4G7RB 3S7GA 5FHAL 4AWJC 1F45A 5DYOB 4PJAF 3C8HA 4XVTH 4OZIE 3MRNA 2NNAA 4A2DA 5L8KB 4RMQA 1INEH 2YEZB 5DHXB 2IEPA 2EVFA 2A4CA 2FR4A 3FFCB 4HIPA 1T4WA 5EUOA 5HHNA 4MXQD 3OSVA 1U3ZA 1HNGA 1CN4A 1NANI 3TBTB 5FYLH 1OTSD 3E1F1 4PWFA 3AGWA 3IKCA 1XH2A 3QQ3A 3W9EB 1LL1A 1PY0A 3ULVC 1LNUA 2RCSL 2YHGA 4NGHH 1HWWA 4KRPC 3L6FB 4GAJL 4Y5VB 1JIBA 3KDMB 1T21A 2GJPA 5C86A 2PXYC 4TTGA 4UNIA 1OIOA 3UP6A 3FRPB 5F0PB 4NHUB 1XGPB 4KNTA 2FK9A 5I2IB 4UAOC 3VI3B 1FVDB 4YSQA 2QDVA 4PRBB 5JXEC 4X8XA 4WI6A 3WFDH 4JQXA 1EO8H 1HINL 1MAMH 4MSWA 2WUCL 3IJYB 1GOGA 2RR3A 4E41E 3K91A 2EXYC 1I8MA 3K71B 3CJJA 5D1QC 4CAGA 1NMCC 4OZFB 3DX4A 3FK3A 3RVXD 3H56A 4S1DC 3TA3A 1EHAA 1LE5A 2Y4SA 5GZOA 3CX5J 2MEJB 4HGWB 2IDCA 4AH2B 1BFTA 3B9DA 4U1NB 3MLSL 4ZQTA 3OL2A 4PGJA 4HDIA 3GSUA 3HE7B 3ARRA 1DVZA 4XPHH 4N28A 4J3BA 1QFWM 3ET9F 4WNJA 4HG4K 5CBEB 4AIZA 1SNRA 3DKHA 3W5MA 3ZDXE 3CC5B 4PJHA 3KG5A 3O6FD 5D2LE 5KEZA 2AK4B 3SQRA 3ATFA 1U4EA 1KCKA 1A6PA 2LE9A 3K2UH 3CZEA 4JDTL 5F0JB 3DURB 3G5WA 2J1KA 4FFYL 4NKMA 3T0EE 2OCCB 1PLGL 4OGYH 3G6DL 4XNDA 2I9LA 1BECA 1HSAB 5FM5O 2FJHB 1A4BA 1B2YA 2A1WH 2HRLA 4ZPTB 5C3LD 4HISA 4XNQB 3RVVC 1IC5H 3HPLA 1FGVH 1IV8A 5IR1A 4HKZB 3L1FA 3CFTA 4JFQA 2BSTB 2QPEB 3L95B 4UINH 3SPJA 2OMUB 1QVOB 1ES0A 5CGBA 3CHOA 4DGIH 2DL2A 4Q9RH 3LNDA 4FULA 3IDNB 3RZCC 3BPLC 3BWUF 1ZPLA 5ESQB 3OGOE 5LGJB 1NCCH 3P3RA 5FO7B 3WFEH 3SKMB 4G2AA 1JERA 3O45B 3RTQC 4IK6A 4OF8A 1KZQA 4P46C 2PR4L 4ZTEA 4G9DB 4AQZA 4R7LA 4IGBC 2HH0H 3ZQ9A 4N22A 4PS4L 5IUSA 4ZFGH 3Q1SL 2Q8AH 5AAMA 5B1BB 4HFWB 2J6EA 1UOKA 2P5WB 2WXMA 3BYYA 5DMJB 3AT8A 3CE1A 1I53A 1T6BX 2ZCKH 4MAUH 1WCBA 4P2QB 3S35H