2YXWA

The deletion mutant of multicopper oxidase cueo
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
440
structure length
440
Chain Sequence
RPTLPIPDLLTTDARNRIQLTIGAGQSTFGGKTATTWGYNGNLLGPAVKLQRGKAVTVDIYNQLTEETTLHWHGLEVPGEVDGGPQGIIPPGGKRSVTLNVDQPAATCWFHPHQHGKTGRQVAMGLAGLVVIEDDEILKLMLPKQWGIDDVPVIVQDKKFSADGQIDYQLDVMTAAVGWFGDTLLTNGAIYPQHAAPRGWLRLRLLNGCNARSLNFATSDNRPLYVIASDGGLLPEPVKVSELPVLMGERFEVLVEVNDNKPFDLVTLPVSQMGMAIAPFDKPHPVMRIQPIAISASGALPDTLSSLPALPSLEGLTVRKLQLSMDGGANKINGQAFDMNKPMFAAAKGQYERWVISGVGDMMLHPFHIHGTQFRILSENGKPPAAHRAGWKDTVKVEGNVSEVLVKFNHDAPKEHAYMAHCHLLEHEDTGMMLGFTVGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Blue copper oxidase cueO
publication title Structure and function of the engineered multicopper oxidase CueO from Escherichia coli--deletion of the methionine-rich helical region covering the substrate-binding site
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 125
structure length 440
sequence length 440
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2yxwA02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2yxwA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2yxwA03
3AG1B 1SJMA 2DYSB 4HAKA 1AAJA 3GXUB 3T71A 4A2GA 2QT6A 3FQYA 4YSDA 4YSOA 4E9WA 3FU8A 1JXFA 4PAZA 2YAOA 1ASQA 2PPDA 5I26A 3CG8A 4AKQA 1KYAA 2VW7A 1L9SA 4YSPA 3DIVA 4EF3A 2DWSA 1XB3A 4GYBA 1BXUA 2GC4C 2QDWA 1GS7A 1WS8A 2IDFA 2R7EB 1JXGA 3FQ1A 1PMYA 3CVBA 2TSBA 2UXFA 4HHWA 2BP0B 4YSUA 2YAPA 4YSAA 2OJ1A 1KGYE 1L9RA 2QPDB 4KO5A 5B7FA 1ASPA 1ET8A 2CAKA 4A2EA 1PLBA 4UAHA 1GW0A 2YAFA 5I6OA 1JZEA 4E9YA 2P80D 1GS6X 3EHBB 2GIMA 2HXAA 3NP4A 2DY2A 4YSTA 4JHVA 4HALA 1AANA 3WKPA 2VN3A 3IN0A 3N2JA 3DKHA 1BQKA 2IH8A 4AKOA 3S3CB 3EH5B 1AS8A 2NRDA 3ASNB 5D4IA 3ERXA 2J5WA 2EIJB 3FU7B 1SHWA 1QNIA 3SBRA 4GY4A 4G7QB 2BHFA 2QDVA 1WS7A 2FWLB 3FSZA 3X1BA 4BDVA 8PAZA 1W6WA 5I6NA 2GHZA 5FC9A 1BXAA 4F7KA 1PZAA 3QJTB 4DP8X 4TXVB 4UF7C 4DP1X 3D12B 2VM3A 3RYMA 4YSEA 4A68A 1PNDA 2GC7C 4BK5C 3FSVA 1ET7A 1KBVA 4HCFA 1A4AA 3NJFA 3PCYA 3TASA 3T6WA 4KOCA 2BO0A 1OCRB 1TEGA 4KNTA 4A67A 3PXLA 1IUZA 1OCZB 4Q89A 2YAQA 1E67A 3MX0B 2GSMB 2UXTA 1ET5A 2XV0A 5B7MA 2OV0A 2E86A 1WAEA 5I5IA 1RZQA 2LLNA 1SNRA 1N70A 2H47C 1I53A 3WIAA 1SFHA 2Q9OA 1RCYA 1KDIA 3PAUA 1F56A 4BWUA 3OD3A 5I6PA 2IDSA 1NIFA 1SDDB 5I5JA 2EINB 1BAWA 1X9UA 3CDZB 2VSMB 5LDUA 2AZUA 2EILB 5B3SB 9PCYA 2X87A 1SFDA 3NJGA 2FQEA 1NWOA 3HB3B 5B1AB 4P5RA 2IH9A 4L0PB 1NDTA 4KOBA 3OQRA 2DV6A 3DTUB 1ILUA 2BP0A 2CALA 1KCBA 1OCCB 2IDQA 3S8GB 3H56A 4HCIA 1GSKA 2GI0A 4N4YB 1KCWA 5I6LA 2HX8A 1AS7A 1HAUA 4DP6X 5I6MA 3X1FA 2PPFA 4KNSA 5PAZA 3TBCA 1NTDA 1PY0A 3QQXA 3T6ZA 2H3XC 1ZDQA 3T6XA 1EHKB 3CVCA 1RKRA 3NJKA 1IC0A 2CJ3A 4HIPA 4DPBX 2CCWA 4YSCA 7PAZA 1ZV2A 2RACA 2CBPA 3ABKB 1T5KA 1CURA 2FTAA 5I6KA 1JZGA 2HRGA 4HZ1A 1OV8A 2P80A 2XLLA 1BYPA 1EZLA 3T9WA 2VSKB 1N68A 1V10A 3AW5A 1BQ5A 1E65A 2MRYA 1PLCA 3WNIA 1E5YA 5TK4A 2FQDA 1WA0X 3NSFA 4BWWA 3QJUB 2EIKB 1ILSA 3NT0A 1OE1A 4WTQA 3TBBA 1AG6A 1IBZA 3NYKA 2DYRB 4G7RB 3NJNA 5E9NA 4FA7B 1AZNA 1KV7A 2PPCA 2VM4A 4GXFA 1NIEA 3S3BB 1NICA 1AIZA 1L9PA 3X1NA 2PP7A 2FJSA 3HEIB 2XUWA 2FNWA 3GDCA 4DPCX 1JZJA 1JERA 1M56B 4E9SA 5TK2A 3PLYA 1OCOB 4KO7A 1AQ8A 2GB2A 3NJMA 3FYEB 4A2HA 5B1KA 1GR7A 3U25A 4E9VA 1J5CA 1BQRA 5B1BB 2JXMA 2AZAA 2PPAA 1J9TA 5AZUA 1AZUA 2I7SA 4F2FA 4E9RA 1ZPUA 1AG0A 3QJVB 3FT0A 1B3IA 2XVBA 3NSDA 3CDZA 2B3IA 4MFHA 2IWEA 3UABA 2Y1AA 4YSQA 1FA4A 2BWDA 1OE3A 3ZX1A 2H5UA 2VW6A 3UADA 2HLEB 4CSZA 3ZDWA 2YAMA 4G70B 3T6VA 2W88A 4ENZA 2FT6A 2JFCA 3IN2A 2YQBA 2XXFA 4BXVA 1ID2A 2CUAA 2HX9A 5A7EA 1OE2A 4QKTA 5AKRA 3OMAB 4A2FA 2PP8A 1XMEB 2IWKA 4A66A 4F2EA 3FSAA 3QPKA 2YXWA 2GBAA 4HHGA 5D4JA 1GY1A 3EH4B 5F7AA 4K9JA 2HZHA 2I7OA 1X9RA 2JKWA 3ABMB 3AY2A 1AZCA 3H4HA 2XX1A 1W6LA 4E9TA 3JT2A 1GS8A 3KW7A 1MG3C 1ZIAA 3WKQA 3PAVA 3L45A 2AANA 2XX0A 2OCCB 4NERA 2R7EA 2FQGA 2B08A 2PPEA 2TSAA 3UAEA 5F7BA 4KNUA 2IDTA 3AG4B 3AZUA 4DP0X 1XB8A 2ZONA 3KW8A 3NP3A 1A4BA 1M9WA 2XWZA 1MDAA 2VW4A 1SF3A 3X1EA 1CYWA 2WSDA 1DZ0A 1OF0A 1TEFA 1TKWA 3NSYA 5B1JC 1KBWA 2XV3A 2ZXWB 1NINA 7PCYA 3S8FB 1YLBB 4YVUA 1BEXA 1A65A 1PAZA 4X4KA 2UXGA 2YXVA 3N55A 1MZZA 2BW5A 4NB7A 2BP8B 3CZUB 1R1CA 5B7EA 3ABGA 1AACA 4AKPA 1MZYA 1PZBA 1V54B 2J57A 2YARA 3FU7A 1FFTB 1JZIA 2UX6A 3EF4A 3NSCA 1HFUA 3OMIB 4JKNA 4DP2X 2PLTA 3CVDA 5IY5B 2YAHA 2IDUA 3AG2B 5AFAA 1HAWA 3OMNB 1CYXA 2Y69B 3TU6A 3UACA 2VMJA 1OOWA 1JZHA 1NWPA 2XV2A 3FPYA 4P5SA 4JHUA 4WKXA 1IBYA 5D4HA 1L9TA 2QPEB 4G7SB 4G72B 1GYCA 1A3ZA 2HX7A 3WNJA 2XU9A 1PF3A 4KO9A 3IBOA 2IAAC 1JOIA 5EHFA 3TA4D 1PNCA 1BXVA 4AX3A 2N0MA 4DP9X 2AFNA 3SBPA 3UAAA 4M4RB 4ZK8A 5PCYA 3FS9A 3NJHA 2PCFA 1PCSA 3ASOB 2BW4A 2W8CA 4GP8B 1NZRA 3C75A 2BZ7A 1PLAA 1XB6A 3WG7B 1SDDA 3SQRA 1W8EA 5I28A 3FPXA 3EH3B 3ZIYA 4YVNA 3QJQB 4HCGA 4N8UA 2ZOOA 2MTAA 1CUOA 3IEAA 3G5WA 4A2DA 4BXSV 2UX7A 3IE9A 1A4CA 3JTBA 4NAJA 2BZCA 2J55A 3X1GA 4E9QA 1E5ZA 2AVFA 1ADWA 4E9XA 2DWTA 2FT7A 5ANHA 2WO2B 1DYZA 3MBWB 3ZBMA 4DP5X 4BWTA 4GP4B 3QJSB 1NPJA 5B1JA 1AOZA 1J9QA 1GY2A 2XYBA 3H4FA 4QLWA 1ZDSA 1JZFA 4YSRA 3SBQA 4CSPA 3GYRA 3PAZA 4DP7X 1PZCA 1AS6A 1TU2A 3BVDB 3NJJA 6PAZA 1A8ZA 1J5DA 1NIBA 4G71B 1JXDA 3QJRB 1ETJA 3FQ2A 4GP5B 3NJLA 3V9CA 1MG2C 1SF5A 1WA1X 1JVOA 2XXGA 3X2QB 4FAAB 1QHQA 2X88A 4Q8BA 1J9SA 4W9ZA 1NPNA 3AG3B 3FYIB 1AZRA 2EIMB 3FU9A 6PCYA 2PCYA 4BDVB 2HRHA 3UGEA 1KDJA 1NIDA 2BP8A 4UANA 2FT8A 2J56A 3S3DB 4YSSA 1ASOA 2ZWNA 2YAEA 4AI7A 1ZIBA 2IWFA 4M3HA 4PCYA 1J9RA 4RH4A 3ABLB 3BQVA 1FWXA 3OM3B 4W1TA 3NJIA 4KO6A 3WI9A 2WO3B 1SHXA 1E30A 1QLEB 1L9OA 1BYOA 1VLXA 5I5MA 1RZPA 3V9EA 1AR1B 1URIA 1JVLA 4YL4A 1V55B 2FQFA 2BWIA 1L9QA 2I85A 3FSWA 2A3TA 2Q5BA 4AZUA 2UXVA 1NIAA 1UATA 1WA2X 1AZBA 3PPSA 4DP4X 1IKOP 4DPAX 2PP9A 1M57B 1CC3A
chains in the Genus database with same CATH superfamily
4M4RA 1EHXA 3GXUB 1XQ4A 2OMUA 4FE9A 5F9WB 2F5AL 2FWUA 2P47B 5DS8A 1MY7A 3L2LA 5KS9E 4P2QD 1ASQA 5I26A 3U46B 4QPEA 2XVLA 5D71L 1PEWA 5ICXB 4P2RD 3VD7A 1EJFA 3L5HA 3VGHA 1BXUA 3H7BB 1U8OB 3GI9H 1B0RB 3SDAC 1LVEA 3OAUL 1KGYE 1L9RA 5KVDL 1MJUL 4M56A 4PRAA 1Y6KR 3DVIA 1G7JB 3LEXA 1MJ8L 1QSFA 5FM8A 5I6OA 3D69B 1U8PA 5KBPA 4WHYG 3OAZH 3RL2B 4F8TA 3CMGA 1BDYA 2YBRA 4YHYB 5M95B 2BSTB 4F8NA 3P77A 1DE4A 4I7ZC 2F9BT 1TDQA 4JFUA 1AGFA 5EN3A 1OAXL 2JJUA 5IK3B 4TVPH 4WWOA 5AKVA 2WAQA 3OAYH 4M8VA 1QLEL 5KS9A 5K9OB 5BMFL 3RWDB 5DUBB 2R2BA 1W15A 1OSPH 5C0IA 4U6VL 3BP5B 1LL1A 5HHME 3UPRB 5EDSA 2HWZL 1E7UA 5CJ5A 4L2LA 2VDPH 3ZKMD 1NCWH 1RJCA 3GRWH 3M17B 1GCYA 1R19A 2FWOA 5DDHA 5HHPA 5I19L 3SO5A 5IHHA 1BD2B 4TUJB 5FC9A 4JKLA 4Y4FA 4OF5A 3OGOE 3QUYA 4I3GA 4KHXL 1MVFA 4DT2A 4F7KA 5DD3L 3OKDB 4TXVB 2BSSB 3BFOA 3LKOB 4YSEA 2N3JA 2F8VA 2NX5D 4UCFA 5BS0B 1KJ3H 2O5NA 3UAFA 1CGSL 4U4IA 4FZEL 1QA9A 2JJTC 1NC2B 1OCRB 3DOSB 4KNTA 1H5BB 3S5YA 4LSUH 4WWPA 4YPGA 1E67A 5HHVH 4M29A 2UXTA 4Z7AA 2C9RA 2AITA 3GSOA 3E1ZA 5C3LD 3U79A 5B7MA 4G9FD 3ULUD 2EH8L 1IGYB 1FZKB 1SNRA 4KUZL 2Q9OA 2Q87A 1S78D 2FX9H 1E8WA 1N5YL 5EULV 2FD6H 3WDJA 4P5MB 4BWUA 1RMFH 1JZ3A 3OD3A 1BIHA 1XBRA 4MJID 4MTMA 4O51A 1F4WH 3NQIA 4YBHA 5D6CA 4ONFH 1IGCL 2XTSA 5LQBH 1X9UA 3NH7L 4RGMB 1CFNA 4DEPC 2NR6D 1I8AA 5GGTL 3BHBA 5DRNB 2Y07L 4XP6L 1ERNA 4EOWH 9PCYA 1CIDA 3NJGA 5FWQA 3INOA 1BX2B 3QQ3B 2VGLM 4N9GA 4C83A 4OCYL 3VH8B 1JWUA 1S5HA 1IGTB 1MFBH 1ILUA 3B43A 4LHJB 2BH0A 4NT6B 2WQWA 4FNLL 4OKVB 1U8QA 2X1WL 1X5LA 4F15C 4RRPA 3H56A 4Z7QB 4KJWD 4N4YB 2B5IB 3IBEA 2XDHA 3I3BA 2Y6TE 3BKJH 6CGTA 4YHPA 1F41A 3QUZA 3BP6A 4ETYA 2C7UB 5A3ID 5ALCH 1WG3A 3EYUL 4A7GF 2VQTA 4QHPA 5F7HA 2AW2A 1I1YB 5PAZA 3TBCA 1A14L 3ARVA 5DSCB 4XBPB 4XAKE 3AROA 3LTVA 5DCCA 1V27A 5FYJL 3VYNA 1XFPA 2WZPD 3ZZLA 2H1PH 4LPWA 5E8DL 5EZOL 1JPSL 1KTDB 1MFDH 4R96B 2FR4B 3QS2A 2FSDA 1FPTH 4M5YH 5K9KB 2X5PA 5IHBA 4HKZA 5D7LB 1MW2A 1ZHKA 4PLOB 1ZV9A 2V33A 5F0LB 4MA1B 1J1OL 4LAJH 3MLRL 4GT7A 3IJ9A 2PYFB 5CZKA 5DQ9A 1XGQB 3HTLX 4XCEA 3R8BB 2Y23A 4U3HA 3B9DA 4FL4C 1O9VA 2B1HH 1FZOB 1TUPA 3LPOA 2K8MA 2Y3NA 4XTRD 4FLQA 2PCPA 4QXTB 4QHLB 4R6UA 4NJ9L 2CRMA 1J11A 2EYRB 3EUDA 3UAJA 4POZC 1EGJA 1T0NA 4OY9A 4O2FB 4GG6E 3WHXA 1I8MB 2GK2A 1KV7A 2FAUA 3BUIA 5FEBA 4KFZC 1OAQL 3L3OA 2NW3B 3H9SD 3JV0A 3OR6A 2WLMA 1DQDH 2Y06H 4XB8A 5HYQA 1C5BH 3ZPDA 2EDNA 3QDGD 4E41B 2F15A 1O5DT 2A74C 3LXBA 4RMUA 5DUPL 4KJYB 5ECGA 4DPCX 1PZ3A 4U1GB 1FSKC 3SPCA 1H9VA 3I6KB 1CD9B 1CICC 4K3EL 2YQ3A 1TZ8A 1UOVA 3B9KA 1UWFA 4G8GA 3FYEB 4AK2A 4XHQA 2AXGB 3NZHH 5ANMB 4LOFA 2P45B 1BMWA 4GH7B 1QSEE 1A2YA 3UGUA 4J4PC 4UNIA 5A2AA 3NSDA 1B3IA 2XVBA 1MWAH 3HRZC 3TNNA 2X9YA 5I66B 1HH9B 5F3HB 5I2IA 4ODHH 2H8PB 2BHYA 4FDWA 4FQPA 2HRPH 1DDHB 5H94B 2PKDA 4ENEC 4G1EB 1MF2L 5ISZE 3JBG7 1XO8A 1R33A 2HLEB 3F58H 4PI0A 3QPQD 1MY5A 1PVHA 4OZGE 1ULVA 2C7FA 4Q74A 3SKNA 1MHHA 4MBRA 1B2WL 2DM2A 5JTWA 2HX9A 1I7UA 3VA6A 4LCVA 1GKOA 1I1AD 3STZA 2NY1C 4F37K 2ZD0A 2AEIT 4IOSD 4A2FA 2CUMA 4P59H 4AGMA 1LP9A 1RIHL 3BRGC 1QPKA 4S1RL 4WLCA 2HLFD 4XN1A 4Y16A 5LNEA 3DVGB 4R97C 3H4HA 4QHNB 3DHUA 3ULUF 1AZCA 4AV4A 1JBJA 1QSEA 5D2NC 2KL6A 1EFXD 4RAVA 3OAWA 4XNYH 5DJYA 2CH8A 1PG7H 4NRXA 2WQ8A 1UD2A 1FNAA 1MLBA 3IU4L 3KPOA 5INCB 4JDZA 2X4NB 2E7MA 4GMSH 1TF4A 2EADA 3VTAA 3CWGA 3FCSB 2M26A 3JXAA 5ISZA 3RUGB 1SZNA 1G4RA 2MPAH 1N3NA 4DZBB 2A83B 2XQYK 4U1MA 5JMRA 5I1EH 4OZGA 4Y19D 5EZIL 1J1OH 1F6AB 3ILPA 3BKML 1V7ML 1K6QL 4MNQB 2CBTA 3KNBA 3TPUB 2M8XA 2NY2D 2OMYA 1HL8A 4PRDA 5DT1H 5DRXA 2PF6A 3ZW3A 4APQD 4XE0A 5JORA 5AB2A 4DO5A 3I9GL 2WSDA 1V8HA 3TIDA 3QQNA 2ZXWB 3U6RA 2VXUH 3W3BA 3HBQA 4YLCA 4LB8A 3L1OL 3NRPA 2VZSA 3ARYA 4IRZA 3RZWA 3TBYA 1NLBL 4N2HA 3B2UD 3QJHA 5I1LB 1XF2B 4LCWE 1MHCB 3IMUA 4H20L 5DJZA 5LNGA 4JJOA 1YYMH 4FHJA 4H8WH 3EBAA 3ZE0B 5IVZB 1WTLA 4YX2H 5G4MA 4N2IA 1YNKH 3FO1A 4ZPTA 3L17A 4XH2A 3US0A 3PHQB 3AG2B 5FF6A 2ADFL 1CE6A 2UUDH 1JGEB 1JCKA 2H6PB 4P4KD 3FPYA 1JPGB 1JWMB 3GRGA 4NNXA 2C1PA 3DJTA 3C6SA 2NSMA 2VMDA 2VXVL 3PGDB 2BWQA 2BNRB 3U9PH 4AY0A 1A3ZA 3N6YA 4K73A 3CZEA 1MREL 2YD0A 3WGUB 5L4FA 3S3JA 3KXFA 4XVJH 5HI5C 1ZVHA 1YCSA 3BJLA 4CUCA 4X7TB 5K9JH 4PLNC 3VDCA 3NACH 2A9MH 3TCXA 1B2WH 3CFBA 4DP9X 1CFVH 4JHAL 5L4JA 4XRCA 2Z92A 3RZCB 1U93B 4LU5L 4RFNC 1THAA 1G6RL 2FX7L 3PPEA 1NQBA 5FCSH 2Y3AA 2UY6A 5F1KC 3LZRA 4ZK8A 3WN5C 3BMVA 1RIHH 2J1ZA 5B4MD 2ISDA 4JKWA 4S1RH 4V1DB 1GL4B 3OKOA 1VGEL 5AW4B 1SDDA 3EYQC 2OK0L 3N41B 4PY8I 5JHLH 2ZG3A 2IG2L 3AT0A 2ZOKB 3EH3B 3WTXA 1RZIB 2MTAA 1ITBB 2BY1A 2CO3A 5KJ4A 3O4LE 4XNZB 1KYDA 3H0TA 4ACTA 1AXIB 5EBLA 5HJDA 4PJ7B 4LKXB 1ES0A 3TX4A 4Z76A 5A40E 2DWTA 4P07A 3WE1A 4YDKL 3TIEA 1UB5A 4PRNA 4GP4B 4WW2A 3BWUC 3TA3B 5B1JA 5IW1B 2XYBA 3MCLL 4QGTA 3B2DC 2VAAA 2R4SL 1PSKL 3IXAA 5A7BA 3GYRA 1RZ8B 2XA8L 1RPUA 5I1KL 3NJJA 1BVLA 2ALAA 1WF5A 5HI4D 4ANVA 4PWHA 1UJ3B 3BT0A 3KL3A 5JQIB 4Z1PA 4OUOA 2F0CA 4NXKA 3VQMA 4K2UH 4NNPL 2ID5A 4JFZL 3ESVF 2BHZA 4MAZA 3DA0A 3O4LA 3KPQA 1MCKA 3BPLB 3CFUA 4IBZA 4LCCB 4NZRL 4F93B 4Y8DC 2PCYA 2VTFA 4LPVA 1CFTA 1K5NB 1KDJA 1NIDA 2F7PA 2IADB 1CFSA 2XBDA 5HP5A 2W38A 4HWEL 3WSQH 1ZS8B 1KIQA 4JFDB 3DI3B 2VR4A 2ZWNA 3K7UA 2GW5A 4P23C 5FGBC 1ZVYA 5D7KE 3MYJB 1BYNA 1RULL 1XZ0A 4KRNA 1NGQH 3DJZA 1SBSL 3GNML 4H5SB 5GGSB 1UCBH 4LOEA 5DD1H 4PS8A 1N64H 5CFHA 1ZHBA 4EUPH 4QXGL 3EJYD 4KJQD 5F72S 4D9RE 3WY1A 4FTVB 1EZVY 1IC1A 1VDGA 5JZ7C 1QI3A 3IPEA 4JZJC 3I74A 2X0UA 4IMLB 4KMTL 2P28B 1F86A 4TQHA 2X1PA 3CNKA 4X4ME 4M62L 2XNAB 2OL3A 1BA9A 4HJJL 4HIEA 4IIQB 3N91A 5JO5B 3HFMH 2XQBL 4BZ2A 1IFHL 5DJCA 1NIAA 2EDFA 2E76C 2XZCL 4NUQA 4LAQL 4RWHA 5EC2B 3ZE0F 1BQUA 5EWIH 4AQAA 2ZOLB 3QYMA 4P5TC 5BNXD 2PP9A 3I6GB 5EC1A 4BH8B 2X2JA 4HAKA 2JJSA 5HYFA 4JKPL 2KQMA 3F65A 3U4BL 4WUUB 2YAOA 3C5JB 2E7HA 2ZP8A 1QBAA 1L9SA 1L7IH 2OK0H 2WVTA 5I82A 5BZWB 1FVDA 2Y2YA 3TTYA 1JFQH 1SHSA 4JFHD 3BP7B 4ODUA 4PV1C 2BNQE 1K4DB 4WI3A 2QQNL 4UB0L 4WU5A 1A9BA 4HS8L 5E2WL 4L4VD 3BJ91 2VDLH 2H6OA 3BD5A 3D7PA 3IDJB 4X8GA 3UDWC 4LIQL 3NUKA 1U8HB 5B7FA 5DHVH 4UAHA 1O9WA 1E4XH 3P73A 3CFIC 1TLKA 4NKMA 3J7HA 1NBZB 3VWJB 1JZEA 1SQMA 5ICZA 2V5YA 3CUPA 4RAUA 5C2BL 1T7ZA 2YQGA 3QS3A 4TV3A 5ITFB 4YSTA 1D5XA 1PSKH 4W70A 3L1EA 4L4VB 4Q0XH 2EYSB 2N4IA 3PIQA 1UFGA 1OP5H 3UBGA 2Z0BA 5LGJA 1BQKA 2XWDA 2OP4L 3MNVA 2AQNA 8CGTA 5JW4Q 2B15A 3FTGA 3ASNB 4JFZH 1FHNA 4XVOA 4DUWA 4MB4A 3MUGA 5CP7B 4O58L 2EJ1A 4GIAA 5KYXB 4YK4B 1WE5A 4B7LA 2BHFA 2QDVA 4G8FB 3K80A 4L8BB 4NC0B 5CLZA 4ZSOB 3RVTC 4DWHA 3V79C 1NCJA 5E6ZA 2AK4D 3GC3A 1B3JA 2D7PA 1TQBB 5E5UB 4ORGA 1FORL 4ONHA 4NM8H 2D7NA 1G7LA 2JMRA 1UZ8A 4KKLC 3MRJB 3G6JB 3II3A 3GNMH 4U1NB 4AMKL 1I3VA 1A6UH 3PNWA 1AGBB 1SOXA 1H9DA 4KDWA 2IOOA 3BT2L 4DK6A 3RBSA 1R75A 3TT1L 3UEZA 1BVKA 3VSTA 4PJBA 1VFOA 4MQ7A 5FHAL 3HCVB 4KZEL 2GABA 2W07A 2GSMB 3NEEA 4LHUG 5K1JA 4ABUA 1MCBA 2YC1A 5MEOB 1ET5A 1I8IA 2XV0A 1ZTXL 3MRLB 1OP3K 4KQ0A 2LLNA 4NAMA 4HBCL 5I23A 4PJXA 1I53A 4N0FA 4NKDB 1HWWA 4Q97A 3SSGA 1OGTA 5D7SL 3BAWA 1LK3L 4I9WD 1IKNA 3UBXB 5GZOD 1E3ZA 4LFHD 4I88A 3WS3B 2OULB 2IDSA 4MMZA 4JGUA 4CVWA 2VN7A 5IM7B 1DSFL 4JPKL 5F6IB 1WBXA 2OI9B 4I4WA 1BZ7B 4F58L 2OQJA 1AYRA 2GI7A 1SFDA 4JCMA 4Y4FC 5JIDA 4M8QA 1C7TA 3QUYC 5HVHC 3HB3B 3IAGC 7CGTA 4MD4A 2IGLA 5CU5A 4YHZL 4WW1B 4BEIA 1XGZA 2IANB 5I1IH 4KOBA 2QQNH 1MAMH 3QWRA 4ZYKB 1ZK9A 5GJTL 5JR1L 2Z64C 4OM1L 4OM0H 4KTGA 3OKEA 1Z9NA 3IJ8A 4J27A 1D2PA 2HX8A 1AS7A 3CZFA 4EIGB 4MXWH 5EBGA 4DP6X 1D5BB 5AUMB 5TF0A 3TURA 5IW3A 5J89A 4TULL 2GAZA 4WI8A 4AM0B 3K6SB 1EGJL 1YAZA 4UNUA 1XCWA 1ACXA 4JQIH 4R3SA 2ZKMX 1OM3H 2HT3D 5IREA 1M7DA 2QGEA 4AW7A 1BHGA 4N20A 5AW6B 3VFPB 5L8JB 4TPRL 5BVPH 3BVNB 1YEFL 4L8DB 3QRGL 4XNMA 3MCKA 1TJGH 3P30L 2Y7SA 2ZUTA 1L7TH 4LKCA 2WLLB 4U7MA 2VSKB 2D9CA 3SDDD 4NO5B 3QFDA 1RUMH 4Y2DD 3HG1D 2GJ6A 2NY4C 1MPAL 5FCUH 4ZMYA 3EFDL 1F11A 1O6SA 3GJFA 3T04D 4WU7B 1NUNB 3CHSA 4MYWB 4Y5VB 4YXKH 1UG9A 4C4BA 2W65A 4XBGA 2BOBB 5F93C 1YMHB 2P3YA 3PWLA 5E4IA 3D39D 4FADA 4OIBA 2UZPA 3TO4D 4FYSA 3W82A 2CK0H 1YQVH 2QZQA 4Y2DB 4D9LH 4JKMA 4FFYA 3NJNA 3WLBB 4FA7B 1P1VA 2Y5TB 4ODXA 1YEJL 5EFIB 1UC6A 2ZJSH 3QUZC 4B9JA 4Y9BA 4P46B 2Y4SA 5EOCJ 5ESAA 3D3VD 3X1NA 4AUUA 3O3DA 1A7PL 5LN4A 3T6QC 1VKXA 4CBZA 2I9TB 1RURL 1M56B 1OCOB 3DJ9A 1A1NB 4BCYA 3WTYA 1N59A 3BAEL 1E50A 2BX5A 3F05A 1JG9A 2FB4H 5FKPB 5LAXB 1XTLA 1CXLA 3TO2A 1R46A 3G6JF 2VLJB 1JZ8A 1JPTH 1JF1A 4DGIL 2WWMC 2DQDL 3CSYB 1ODUA 2LW3A 5E99H 4J12A 1AG0A 1DJZA 3CDZA 2VABA 1T0PB 4NN5B 4JN2B 4ZMOA 2AVGA 3MNMA 5KSAC 1UWGH 2H5UA 3P0YL 5BZDA 3GXTA 5SWZD 4G70B 1DLHA 4YHZH 1MIEH 4JGMA 1W8OA 2W88A 4ENZA 1QTPA 1MHEA 3UAJC 2XFXB 2XIIA 3MGOA 1UWYA 2KHAA 3O6LH 4QOKD 5JR1H 3KLHC 5KUMA 2LABA 3RDTD 4YGVA 2CUAA 1ZXQA 1XDTT 3D4ZA 2BC4B 2DWEB 4L3ED 5KVEH 5GGVL 3L3OC 4I3SL 3OMAB 1IAII 4MBOA 4NLHA 3IJEB 4LSSH 4HZLB 4UAOC 2YPLE 3IKCB 3RIAK 5JXEA 4K23H 3U0PA 3ASWA 4X98B 3EO1A 4WQOA 2C9AA 2J4WH 4PSPA 4D94A 3QIUB 3U2JA 4J2QA 1OAZH 1SDYA 1U3HD 4PJEF 4Z0XB 1RFDH 3HC3L 5IQ9A 5DO8A 1OGPA 3ATDA 3T3PE 4OLUL 3B9KC 4IRZL 4NHCL 5ICUA 5ITBH 1IBDA 3BZ4A 4OGZA 1F4AA 2WN2A 1PS3A 1IBHA 3CLWA 3WFBL 4NM4L 5BV7L 1HH6A 1RQ5A 3QZWG 2NLJB 2HPTA 1T0MA 3H9HB 5KZCB 1R3LB 2WWKT 1E6JL 3VI4B 2NY0C 4CBPA 2J71A 3V10A 3BW9B 4DP0X 5HD8C 1PLGH 1I1RA 1N7ML 3LSOA 3CPLB 1EZUA 3JTSA 2YPLA 3NP3A 4ELMB 5F71A 2FLRT 1J0ZA 3WKML 1A02N 3U4EA 5E94B 5E8PB 3PGCA 3L5XH 4LPXA 4ZO6A 4O00A 3QQ9C 1MQKL 5EU5A 2CDGB 5TH2A 5C0CA 2XV3A 3DGGB 1WZLA 1WWAX 2H3KA 3D85A 5EF2A 3O0LA 4ZTPL 4RMTA 5A16A 1GIGL 3HR6A 1BEXA 1A65A 4HS6A 2B59B 3G9AB 3QA3B 4JB9H 3IDMA 4Y16C 2OYMA 1DQJA 3SB3A 2ADGA 1RSYA 5E8NB 1CPUA 1MZYA 2VC2L 1QWNA 2N1KA 3TL5A 1TJIH 4M8UA 3LKNB 3SDAB 3TH2T 1SEBA 1UKQA 1AJ7H 4QLRA 5LO7A 1HINH 2I5YH 1UD6A 4F24A 4TRPL 4DGIH 4MX7B 3BWZA 3GBML 2FDBP 2D9QB 3P3RA 1L3NA 3QR1A 3CBKB 4YUEH 1HU8A 3VXTB 3DUHA 5KSUB 1X6LA 3H3PH 2NYKA 4HG4J 1GKEA 3TN0D 4PUBL 1IEAB 2CBMA 5TPWL 3CFEA 3BAXA 2BIHA 3JWNG 3RWFA 4WGVB 4Z7WF 5E00A 2V17H 3DECA 5D6DC 3L48A 1DEEB 3EUUA 4MXQD 4QI3A 1U4EA 1MI5D 1BXVA 2YN5A 3WENA 4AX3A 3Q13A 4LSQL 4ZW3A 1PCSA 4GW5B 4LLUA 4XMLL 1YO4A 2YEVB 4GP8B 4NJAH 5DRWB 4GW4A 1A6AA 3ARGA 4I77L 2HTKC 3ECBB 3KPSD 5BV7C 2EDXA 2ZUQC 3DYMA 3WG7B 2AHIA 4MWFB 3EBGA 3PWPD 1N18A 2OJZL 1H0DA 1T80A 3FAXA 4GT0A 5LNDA 4OGAC 1XGUB 5A43C 4JGNA 1N0XL 1M71B 4BXSV 4UIKL 3NIGE 2BZCA 2W92A 2WQUA 4NQCD 3B7YA 1ADWA 1JWSB 3AT8A 1YYLL 1HZLA 5TQ0H 3A24A 4JY6A 4L4JA 1SXCA 3WAKA 1NAKL 4A55A 3QNZB 2QKIA 3LKRA 1X7QA 4LRNH 3PWPB 1E6JH 4HV8B 1ZLWK 4H4NA 4HQQL 3MZTA 3EJSA 2HFFA 4M7ZC 5IKCB 5D9SB 1T1YA 2NCMA 4LCIL 4XPTL 2NY7H 4LOUD 2IH3B 4F7TA 1P69B 1XF5B 3QJRB 4N2OA 1SXBA 3CZKA 1WA1X 3QIWA 4MJ5B 4MD5A 3V0WL 4FCHA 3TLRA 2IH1A 1VPOL 3IETB 1J9SA 4P04A 5T1LD 2OL3L 3APMA 1QR1B 2V0AA 2Z7UA 3AMKA 3M07A 4ZTPH 1QHOA 3WUWB 5FYJU 4DEPB 2P24A 4BZ2L 4PRID 1YA5A 5EF1A 1MCPH 4FA6A 3G5VB 1RK7A 4O4YL 1LO4L 3N9GL 5SWSB 1T3FA 2ZSWB 4IM8A 4NKOA 5D5MF 3K5SA 1HZKA 4OLVH 4OLXL 4IKNA 3OM3B 2W60A 2AAVA 4HJ0D 4F15B 3FOLA 2YKKA 5H2BB 3L54A 3N1GC 5F7WC 2D7QA 2NY5H 2R29H 1QLEB 1ZMYA 5DI8B 5C0JB 1LD9B 1N8OE 1PX4A 3P54A 5AVUB 5EMYA 3QAQA 4TL5A 1ZANH 4NQED 1TCRA 2B0SH 1KB3A 1V55B 4YIQB 5IVOA 5IHZB 4G3YH 4MS8D 5CEYB 1LHZA 5F6HI 1ZLDA 4P2AA 3HNVL 1SLXA 4UTAH 3OKMB 3QQ4A 1WVZA 1L0YA 1I3UA 4G6FD 5DYFA 2Y1VA 4PCTA 4OAWA 5F9OH 1CD0A 1NMAH 4OCLC 4XMLH 5F7KC 2UZXA 4EIBA 1INDL 3CV5A 1U8IA 4FL4B 4PJIE 4YSPA 5IQNA 4MAUL 1AGCA 4G2AA 5EN2B 1KC5H 4QHMA 1G9NH 3QJFA 2CJSA 3WIFA 3G08A 1WWBX 2XN0A 1LO2H 4UQCA 5HI3D 3D07A 2ZYRA 1ET8A 5HPMB 3KWWB 2XZQH 4A2EA 2CBQA 1UH2A 3EH1A 1TG8A 2X7LA 3GMMA 2NY3C 2A74B 2HKFH 2XRAH 2DY2A 2GUOB 1FSKB 4JFFB 3RJOA 2KZBA 2F54D 4ZMTA 1CICB 2EVJA 4OZIB 3OGCB 4LSVL 3CC5A 4AQ1C 3O3AA 3HLAB 3KYNB 3U7WL 4QCIA 4ENED 2MNWA 4MJ6B 2X10A 1FC1A 3CVHH 4ISVA 4NPJA 4ZW6A 5D4IA 3CE1A 3FFCA 4J2XA 1R3JB 1BGXH 1KLUB 2CUIA 3MKGA 1MFCL 2V8LA 3HRZB 1U21A 4GY4A 4BDVA 2FWLB 3RPIA 4ZMAT 2XJLA 5I6NA 3VFNA 3ROLB 4QXWA 2WVSA 2CLVA 1KELH 4H25B 4PS7A 3QW9A 2WNXA 3HAEB 3IMWA 4Z5RA 3RGVB 3V9FA 2R59A 5EZPA 2XACC 1TSRA 1KBVA 4HCFA 3DPBB 1A7QH 5IQOA 3HNTH 2NY1B 5CSZA 1ZD6A 1IUZA 1RV6X 1BFOB 2IIJA 3FRPA 3KYMB 4ZNEE 3MX0B 1KXQE 1JRHI 2G9HA 1T1XA 2G2RB 1ZHLA 2JCCB 4S1DC 1GZQB 1P2CB 4R97B 3THML 5AD0A 5D2NB 4XP1H 2F53A 3F6LA 3HNSH 4MNGE 4QRRE 3H7LA 3NPSC 4JPSA 2EDEA 3G5YA 1QRND 3MJ8B 4X7FC 3GEWB 3G5ZB 2Z7ZA 5IMOA 4HEMA 3WIAA 1XGYL 2Q8AH 1JF6A 2CLRB 1RCYA 5ESQA 4FKKA 1M7IA 1N4XL 2H3NB 1KG0B 2VZ1A 1QSZA 2BFGA 2UV3A 1I82A 4AG4L 2XY1A 2A4ZA 1OGAA 1ZLVH 1D7DA 2QV4A 4PS4L 3B83A 4WEUD 3RY4A 1T0OA 2ZX6A 1NEZG 5T3XH 1QBML 1RZFL 5M7QA 2ZXGA 3Q5OA 1OP9A 4GAYB 4HU2A 1CGUA 1FNGB 2HVKB 1NDGA 8FABB 4Y5XB 3D0VB 1P7HL 4B5EA 1S8DB 4NAQA 1YEWA 3DTUB 4CDGC 3VRJA 1JFHA 1FL5A 2G30A 3MNWA 1OEZW 4QRRA 3HC0B 4PIRF 4WRLA 4NHUA 2M2DA 3CZJA 4LHUA 3VG9B 1ORQB 1Z0MA 3TBSA 1DSYA 2XHNA 4G5ZL 4Q9BA 4WENB 3DVNB 3WL9B 5KG9A 3IDGB 2VDKL 2HJKA 1OAUH 4GUPB 4H88H 3MV7E 1HC1A 4MKMA 2F58H 1IQWH 4LRIC 1C5CH 4FFYL 2HPOA 4XP4H 5CO1A 1NL0L 3B5TA 3QUXB 4LLVA 2YA1A 1KENH 5KVFH 4DVRL 1TQCC 3ABKB 1BQHG 1G1KA 3IDNA 4M61A 4WI9A 4QIRA 2PYED 4HKXA 4KQ4H 4KTEL 3JWDL 3SDYL 4MMZC 4HKJA 4F92B 3MV9A 1N8ZB 1AD0A 1J8SA 1V10A 3AITA 2MCMA 3EBIA 2X05A 4JFXA 1E65A 2A73B 1BIIB 2MJWA 5EU6B 1X5HA 2LT9A 4WNSA 3KD4A 2IPUK 1FGNL 4QRQB 2OTUB 3D06A 2QHRH 3MUJA 3DX6B 3NESA 3F64A 2PYEB 3EYQD 3EO9H 2WLYA 2QR0B 5JDSA 1ZT1A 3CFCH 3HBGA 4X7SH 1IBGL 2EDOA 5TE6H 1QVOB 3PUCA 3BLPX 3I75A 3Q2VA 4RFNB 3KGUA 1XCTA 4NNYA 3VFRA 4DUXA 3S3BB 1ZHNB 3WN5B 1HDMA 4TLTA 4NI3A 3MRRB 3QNYB 2WQSA 5BJTA 3ARSA 2EKSB 3CSBA 1HXYA 1OSZB 1DFXA 2FGWL 4F1ZA 2A4CA 5L7XL 5TE7H 2YQ2A 1II4E 2GQHA 2DEWX 4KQ3L 4MCNA 4Y7MA 5C0DA 3OAYK 1GGIL 3U25A 4E9VA 1I9RH 4XN9A 5TQ2L 3A22A 3KVDD 5ADPH 1INQB 2A0LC 2FJFA 5CILL 3V4VB 2J8OA 3GO1L 4JO8A 3LHPL 5IF0B 1AKJD 4NBYB 4NN7C 3ZYOA 4JZOB 5E9DA 3O45B 1QNZH 3WFCH 2NXZC 3ZTJH 5HHOD 4JK0D 4GRWB 2AI0L 5C0AE 2QPFA 2VW6A 3W9DA 2PR9A 5K9QG 3UADA 1IAOA 2OPCA 3ZDWA 1TLMA 5FA4A 2QL1A 2QVKA 1GVIA 2C4FT 4G43B 2YQBA 5I8KH 2H0PA 1T66C 2A99A 1CMOA 1NKGA 4O02B 5ID0B 1YN6A 3KYOA 1PU0A 3K3QA 3LZFL 5FHBH 4DVBB 4XPFL 5C92A 1AIFA 4XNBA 1A7RL 3BAIA 1JGVH 4X8CA 2OMZA 3IFNL 3JWDC 4F7EB 3PL6D 3T3ME 1EBPA 2NNAB 2R51A 4OJCA 4P23B 3X3GH 4JNXA 4ZUUB 1NGXA 4HOZA 2DQFA 2ARJB 1UXMA 3D4GA 3KW7A 4UILL 5CEZL 5CLYA 5H35A 4IOFC 1D5MA 3Q2NA 1DANU 2D0HA 1OLZA 2WKOA 3IF1A 5D1ZI 3GSUB 1LEGB 4NEHB 1BZQK 5GRXG 3QH3A 4NC1E 4WF7A 1FE8L 5F0MB 3K6NA 4JZJB 4MDJA 1SLUA 4FLRA 4MHHG 5JA8B 2ITDB 1GMEA 1S7VB 5L2KE 1T21A 1S9KC 1D6VH 3ULSA 3VNZA 5CP3H 4JZNA 1N12A 4ZD3H 4NSKA 2R56L 3LEVL 4X0KB 4BFIA 5T5FH 1NCUA 4Z3TA 5JOPE 4JRYD 3AY4A 3NJXA 1DZ0A 2HCZX 1KOAA 3VMNA 4K7FA 2ZNWA 4P5TB 1AY1H 4J6RH 4MD0B 4WY7H 2NQCA 2GIYA 3MFGB 4DOHB 4UOW0 4YVUA 5JXEC 1QATA 1G5AA 2YMTA 1F3DJ 1F58L 2XQYG 5LWYL 3ME0A 4PV8A 4KKBD 4D0BB 4IBLT 4BQ6A 5C0ND 5F8RC 5GZNA 4FD0A 4CVXB 2YGNA 1YAIA 1YEKL 1PZBA 2YMXL 3CQPA 2CLZA 4MZ2A 3GBNL 1F45A 1HCFX 4M1DH 1FFQA 4I9XA 1C5DB 3QZWA 4GQQA 5AL8A 1OAYL 3BQUA 1KTLA 4JPVL 4JFSA 4GMTH 5E2TL 4HCRH 4FHBD 1NC4A 3OMNB 5I8CB 5CGTA 1CL7I 4M7JH 1YDPA 2Y2TA 5CILH 3NCXA 3MR9A 3NCEB 5GRUL 4P5SA 2WTRB 2XV2A 3ROOB 3GSXA 2FATH 3MXWL 1E4WH 5DC4B 5E6UB 3KPRE 2OSWA 4XNXH 4Y89A 1A6PA 4FNSA 4JFEA 3WNOA 3RVTD 1IAIL 3QHFL 2JKIS 3C2AL 3C5SB 3B7SA 5DHYA 2VDRB 4PG2A 4S0SD 5ADOL 1U8KB 1B88A 3DXAB 3UYPA 3K2UH 4PJDE 3MLXH 5CBEB 5T3ZL 4M4RB 1RJLB 4OH2A 2ICES 4Y1AE 4EPSA 2OMUB 2JH2A 4QO1A 5DS8B 3GLZA 5EIIG 3UH8A 1QSFD 1WAAA 2YJLA 3JVFC 4G8IB 4E42B 3BWUF 1HT6A 3T0EA 1GGTA 3CX5J 4JJ5A 3Q6FA 2QGBA 3LNGA 3NAAL 4EI5A 1SYSA 3QJQB 2A9NL 3ARED 1G7MA 1A4CA 4WFFE 1E3FA 3QEQD 4EVNA 1F13A 3EJPA 1E5ZA 2NZ1A 2C3VA 1V3KA 2UZIH 4PRAB 5SX5H 4AVHA 1Z2KA 2FT7A 1QSFB 3L2MA 4GSDL 4OCXH 2W9EH 1U8PB 2ZKYA 2CCVA 5DJ2A 2NUPA 5FB8A 2WWNA 4ZUTA 2YBRB 2ZCLH 4WNQA 1XIWA 3ZKND 3RFZA 4R7DB 1BFSA 1A8JH 1DE4B 1T4KA 3V6BR 4UUJB 1AO7E 3MRPA 3B9VA 4YSRA 1A6VL 3VXPA 1AGFB 1SN0A 2QGCA 1AS6A 2ALWA 2R56H 5GSVA 5KS9B 4Y4FD 2E0PA 3LPFA 4J39A 1J1PH 1ETJA 2R2BB 2A9CA 3N40P 4AT6A 3REWA 3ECQA 5D1ZA 5CN3A 1WC7A 1OK8A 4Q8BA 4CSTA 1SDAB 4S1SH 1C16A 2ADYA 3ZE1E 4HWBA 1KN4L 1F58H 2Z35B 1DVSA 2EEAA 5DDHB 4GUCA 4I5BA 5IQ7L 2WJ5A 2VXQH 4ZFGL 2FT8A 3APNA 4WWKA 3QUYB 5HVHB 4YAQA 1RXLA 1WV7T 4WKZB 3C5ZA 3FN3A 2P5EE 4M1GL 3IVKA 4R7LA 1P4IL 2PUQT 4R5XA 1EBAA 3ZDXE 2WXMA 1BEYL 1F4HA 2VSDA 5C70A 3C12A 1T04A 1OAYH 1UQSA 1CS6A 1NM4A 2AJXL 2X44D 4OF6A 3NTCH 3FU5A 5EH1A 4FQCL 4IDJH 3S3PA 1FNSH 1UOLA 3KR3H 3HI5L 4XNUL 5CZVH 2AJSH 3ARBA 3B7TA 3OLIA 1FZMA 1ZXKA 3CDYA 5HHMB 4IW4C 3TT3L 2WTOA 4H8VA 4JM2A 4FERA 5AB1A 2WIIA 3FSWA 3U83A 4N0YL 1HL9A 3BX7C 5DMJB 4HGWB 3S88L 3DHJA 1K8IA 4BFKA 3FCUB 3E6HB 5D7EA 4O51B 4JAMB 2BVEA 3OG6B 1ZEAH 2KERA 4Y5YA 1RIUH 5A1AA 4NP4H 3T71A 1KYFA 1CFNB 1L0PA 4YSDA 1RZJC 3FU8A 2NY4B 4N2CA 1MCSA 2YUVA 4HUVB 3WFHA 1JL8A 4DGYL 3LEYL 4GRMB 3NN8A 3WE6A 4P3CH 2Z4TA 5D8JL 4GLRI 4QTIL 2QDWA 4RCAA 2R7EB 1JWUB 1S5HB 1PMYA 2XT1B 3FMGH 4HHWA 5HTSA 2NT1A 1MRCL 3CFNA 2XPGB 1P7QD 1U8QB 1E2WA 1MCDA 4Y9GA 3D9AH 2OSLB 3A6OA 1GOFA 1JNJA 3F7QA 2OJEA 2I9LA 5GGSY 5SWQA 3QUZB 5C07A 5F70A 2UUDK 2D31A 3K72B 3NCJL 1T5XA 2WWMD 5C09D 2HXAA 4Z7NB 4JHWH 3OL2A 5B22A 1CDGA 4BQ9A 1BV8A 4DEUA 3FB8A 2ZF9A 4HALA 1UKTA 4PRPD 4M6OL 4QWWD 5C0BA 4S2SA 4OV5B 4PMFA 4PBVC 4POYA 4OQTA 2HG0A 3T2LA 1ZHKB 5GPRA 2OYKA 5FPIA 32C2A 5F89A 1NCCL 1JTPA 2EIJB 4PJHA 2JTDA 3EYFA 5J7CC 5KBLA 4H2CA 4B27A 4XCEB 4BH7A 1PGRB 5HDLA 3V6ZA 3VXNB 3B9EA 1QI5A 2P5WD 4KH9A 1XSOA 2V2WB 5KSAB 2A77L 2NXYC 3MUY1 1BXAA 3A6CH 1T7YA 2G5BA 1ACCA 4HK0A 1CR9H 1C12A 1VFMA 3C87A 4E5XB 4Z7UF 1OIOA 5IT2L 1OHQA 4PIBA 4TL4A 4HJGA 1OTUD 2A9DA 4WTXA 1XV8A 5KS9F 1YEHH 2ZKHL 4FI6A 4NZDA 4OI7A 2WTPA 3MLWL 4G8GD 2COQA 1WCQA 2DJSA 4PJ9A 3SN6N 2EQDA 5EOQL 4UAOB 1E4HA 2MOVA 2AMUA 2KQNA 3TEZA 3BLKA 4XOCA 2OV0A 2OSYA 2F8XC 5I9QC 2WLNA 5I5IA 5E24E 3B9KB 1AGDA 3HN3A 3QORA 4LO9A 1ZJAA 5D7JA 3EIFA 4B3EA 1DQQA 4MAYA 1ESOA 2J88H 5FW7A 3VFGH 4AMXA 4RGND 1WBYB 2CHWA 1ZLUK 4O2EA 4X4YB 3PY9A 5I2IB 1IGFH 2NY0B 2B14A 4BK8A 2FQEA 4KX7A 3QDMA 5JNYA 1EEYB 3JV6B 5D8JH 5LBVA 4FLHA 4QTIH 4L0PB 4LARH 3UTTD 3VWKA 3VXMD 3LS4L 4U6YB 4G7VH 3DSFL 1DBBL 1NEPA 1I7UB 4ZUWA 4OUUA 4XXWC 5CMAA 3MOBH 2QFPA 3VXRD 2KMWA 1LP9B 4FYQA 5A2IH 1FF5A 4JW3A 2OMNA 2VLRE 3II1A 2BMKA 4FJZA 5L88H 4Y16B 5ESVB 5K9QI 3NCJH 5AKSA 5I1AA 5IBUB 1MCOL 3F2LA 3S35X 3V8CA 1QSEB 2P1YA 1NTDA 1OF2B 4XNQB 3QQXA 5EOCH 1I3GL 5DJYB 3GHEH 2NY6B 3NJKA 1MLBB 4FI8A 4PRHA 4JDZB 3ZYZA 4XMZA 1YPZE 5AW3B 2EVIA 4M48L 5IBTH 3QHTC 5DZAA 2XOTA 5IMKA 5ISZB 2WLKA 3SQOH 5F3BA 2XLLA 2Y36H 1N3NB 1EZLA 5HDOA 4U1MB 3BSHA 4OZGB 4LXFA 1QG3A 1NEZA 3M1BB 1KULA 4KPHH 3MI6A 4PGEA 3MRNB 5MEND 4NZUL 3BKYL 2ARWA 5F7YC 5KVGE 1PLCA 2YZ1A 2OMYB 2WJ7A 2FQDA 4PRDB 1E42A 2J2ZA 4PBXA 4Z7NF 4PG9A 5INDA 3BZEA 1RUQL 2HTKD 2VLRA 1EA9C 5JORB 3RILA 4ZFZA 3U4KA 4UTBH 1OE1A 1JRHL 2YKLL 1BP3B 4WTQA 3U6RB 2CE6A 1IBZA 3KYKH 4OD3L 1ND0A 1KWGA 4Z18A 1T2XA 5J5EA 4MHHI 5DURB 3M8OH 4GXFA 1NIEA 3GQFA 2JI3A 4S1QL 3TBYB 1R9FA 4F33A 5AKTA 3QJHB 4AGLA 1LLAA 2CWRA 3ARDA 3PWUA 1UWEH 2MCAA 3V52H 1AC0A 1RUKL 2EO1A 2BCKA 5BV7B 5DHDA 4ODSH 3MQIA 2XBZA 1MXDA 1MDTA 1BQHA 1FFNA 1I7TA 2ZG1A 3VFVA 3K8KA 5J1AA 1GR7A 3X13B 4XH2B 3O2WL 2MCPL 2R0KL 1B6DA 4UMSA 5DD5H 2AZAA 4APXB 5ICYB 1GC1L 3KXFD 1CBVH 4KKRA 2P7TB 3ALPA 4Y1SA 2QQKL 5ABAA 5I1CL 4K55A 1G0XA 4YSQA 1W72A 2IAMA 4NNXB 2BWDA 3FT1A 4HBQA 1M3JA 4HLZG 4M7ZB 3V4VH 5HDRA 3WTSA 1S7WB 3NABL 1OY3B 3P4MA 1JPFA 3N85L 1JHTA 3O3BB 1F3JB 2E4TA 4GRWH 1JHLL 4KK8D 4U33A 4AL8L 1E6OL 1ID2A 1WGOA 2DH3A 2VC2B 3CFBB 3QRBA 4TUKL 3BP4A 5A7EA 3VXQA 4M03A 3S34H 3HG0A 1J9CT 2VN4A 2UY6B 4Y4HD 3LNFA 4X6DA 4JEGB 3V4UH 4OIAA 3KG5A 3TWCL 3HA0A 2CKBH 4PB9L 1MFEL 5F7AA 3VXUE 1NOAA 2Q10A 3WTVA 12E8L 2H32H 4K9EH 1SXZA 3L4CA 4LASL 3FQTA 3SY0A 1EV2E 4XNAA 1LQSR 3E9TA 5GISL 4HLJA 4L1DA 2V2XA 2GUYA 3E6FA 5AYUH 4L8SA 3GZKA 3VMOA 1EMTL 1I9JL 3MMEA 5EBLB 1ES0B 3MPCA 4Z76B 3L3KB 3MNZA 1UA6H 3SDXA 3V4PA 3TIEB 2WB7A 1QMUA 2CGYA 3WY3A 2DMHA 1WSST 2AK1H 2X6MA 3QZMA 5AZ2H 3WNPA 1IE4A 2OTWA 1PPIA 2JJWA 4NQXA 4UT6A 1LP9F 2VAAB 2IDTA 3AG4B 2MQCA 3BI9X 3HN5A 4X4XA 2EACA 3IXAB 3R7QA 3N1PC 4FP8H 1OAKL 3RHWK 4UT9H 4UZGA 4I13B 4DKTA 1JS4A 4U1HA 1YMMD 2EH7L 3I85A 4C56E 4YHMH 2PO6A 2XN2A 1SF3A 5CJOL 3VXUA 3ZHLA 5IB1B 1M6OA 4B0MB 2QEJA 1G9MC 2D2OA 2RH0A 3KPMA 2OZ4H 1FDLH 4P3WA 2FUTA 3OHXA 1JDCA 1FFOA 2X89D 3OTTA 4TSAH 3O4LB 1J10A 1OD7A 2DEXX 3OSVA 4JN1H 1T6BX 4LSPL 4KTDL 4NB7A 4YGAB 3SOTA 2AEWA 1KJ2A 1GC1C 3SE8H 2HKHH 1KGCD 2NY3D 1DBKH 1XZ0B 5GS0H 1DJWA 3V0HA 4ODVL 1T7XA 4HETA 2WXNA 4HT1L 1NSNL 3ZTDC 3FUJA 4R0LA 1ZHBB 1OQXA 4L1BA 4YQXH 4LDLB 3C6LA 2Y69B 1FRGH 4P06A 3UACA 1UT9A 5IUSA 2NY3B 1VSCA 5AG8A 5KBKA 1QOKA 1HXKA 5F7FA 4PJCA 2IMMA 1T03L 4G72B 1SVZA 1OKEA 2CJTA 4HIEB 6FABL 5L8LB 3GM8A 3N04A 1Q0XL 1EWHA 4AQ1B 1PF3A 5DJCB 5EG6C 3EADA 3AY4C 4TF4A 2JTYA 3V7AE 1X5ZA 5EHFA 1DQMH 4FMVA 4YBQC 3PYCA 3QO0B 1NGZA 4TUKH 5EC1B 3F6JA 2XQYA 2E56A 2H0FA 1AXTL 3DDFA 3MLYH 2VDRH 3LS5H 3DROB 1P6FA 1YUHA 3B6SB 4KY2A 4IBVA 1V7NH 2VR9A 5CZRA 2VDOH 1K85A 4ANWA 1EIBA 2DD8H 2QZ5A 3CN1A 5JW4R 4D3CL 1G0YR 4HCGA 4A2DA 3B9AA 1DJGA 3FTWA 1A9BB 3MRKB 4HWBL 4WU5B 5CJQH 5G2NA 3UTTB 1HSAA 1DQLH 3BQUC 2G4EA 5GXBB 5L6YL 3BUTA 5T3XD 3P73B 3MRGA 4NKMB 4L5FH 4FF9A 5AW8B 5IBLC 5ICZB 3CUPB 5T5NF 5BRZA 4JQXA 1I4FA 2H2SD 1D5XB 2NQDA 3AXLA 4I3RH 1CU4L 2XN9A 4Y9CA 3NPSB 1MH5B 5C71A 1PZCA 4OGXL 1KCUH 3PIQB 2YEQA 4HK3N 2I60L 5CR8A 1OW0C 4PG2C 3CHPA 3FQ2A 4TLKA 1ZSDA 1UT1A 3A4AA 1JVOA 2XXGA 4Q7DA 1R5IA 4FAAB 1M3IA 3FTGB 2O4EA 4BRVA 2NW2A 2BNQB 5EIIA 3RVVD 3EJZC 2MHAA 2ZWKA 3AG3B 2YUXA 1UOKA 4P2QE 3QYCA 4WW2F 3BN9C 3T0EC 1ZY9A 2VLLA 4QY8A 4NWUL 4P2RE 2Z9TA 4EI5C 1CL7L 1G7LB 2YMOA 1UZ8B 3CN3A 4H1LB 1DCLA 4MCYA 3HG2A 1EHLH 3O9WD 3QI9A 3PNWB 2CIIA 2EEXA 4C4UA 4PW9A 3MBXH 3VACA 1DVFA 4ZBJA 1QO3A 1BVKB 3GM0A 4C47A 3QCUH 3L4UA 1L9OA 3ZKQD 2W07B 2WGNB 3ZZQA 3RFZC 1XIWC 3VCLA 2YC1B 3NQKA 5BUPA 5H4ZA 3JWNC 4CILA 4DW2L 4PREB 1KCSH 4NCC1 3BCFA 2R1XA 4R90H 1Y07A 5AWNH 1ZS2A 4P3DA 1IL1A 1IT9H 2X6BA 3R06B 3QYNA 4N0FB 4L23A 1R5VA 1RPQA 3GXIA 1OGTB 1L5GA 3QXDA 4P2QA 3D0LA 5TD4A 4J3OG 1TQCB 4XC1L 3NMEA 4KWUA 5C3TA 3Q1SL 4P2RA 4F57L 5I1HH 3QWRD 4MMZB 2OMBA 1CC3A 1KEGL 4DEWA 1TJXA 2ZAGA 2MWCA 5EBWA 4AYSA 1WBXB 4IKJA 4MMYA 2OQJB 3FQNB 5E8OB 1KYAA 4M8QB 4WWKC 4OQTL 2VDML 2AQ3A 3FQ4A 4F7MA 4GYBA 4W6WB 5CCGE 3C5ZC 4PY7A 1KJMA 3KWVA 1BG1A 4FG6C 4FFTA 4AENA 2WNKA 2TSBA 5DEFB 3TONA 3E8UH 1V3JA 2VZ3A 3VGFA 3OKEB 3MTXA 4KKQA 1NKOA 5FLUA 1PLBA 3CZFB 3QEUA 4OD1H 3FUDA 3SCMC 3WGVB 3BVWA 5L9DL 4OF8A 1G7QA 3MNDA 2GJZA 2GAZB 4NKIL 2GIMA 4IKKA 5DA0B 4G9FE 2WAHA 3ULUE 4LFHG 3RKPA 3U9UA 3NA9H 2ORBL 1H3UA 3AQYA 4MQXC 5DK0A 4LCUB 1CLYL 4KKZA 2ICEC 4Z7OF 3DI2B 3L95A 1XSJA 3K0YA 3HZYA 4XNMB 2WOBA 4MJIE 4LKCB 1QHPA 4Y5YC 4JO2L 1CFMA 3GJEB 3QFDB 2Q3XA 2NX5A 4MQTB 4NN7B 2GJ6B 1U2HA 4RGOH 4NQDD 4AQZA 3BPCA 3QC6X 4KROC 2NXZB 1F11B 1O6SB 3GJFB 5E08L 4W9KC 5K39A 2W65B 5KW9L 2G3MA 2C9VA 1UVQB 5K59F 1U8LB 3PWLB 5IFAL 2VDKB 1ET7A 2XWEA 4XB3A 1MFAH 1KPUA 3RVUD 1BZ8A 3FO0L 1YEEL 4OW6A 5F88A 1TEGA 1X4ZA 5GSRB 4B7IA 5J6HB 5ESAB 2KZWA 3ZE2F 5E8EA 1LO0L 4H8HA 4MJIA 3U48A 4WDIA 1K4CB 4EI6B 3SGDI 3L8QA 5FGCB 2V2TB 1L0XA 2CGZA 4HH8A 5IB4A 2K9UA 3F8UB 2NR6A 4KTYA 4OLYL 5HYJA 5CINL 5AAWA 5TE4H 2I32A 2V5RA 3IAQA 2A1WH 4J3VA 3TO2B 1PFOA 3O2DH 2CGRH 2B1AH 1JF1B 4XO3A 4XXCC 5GRYA 1H3PH 1HX0A 3W9EB 2A38A 4AQ8A 3UOAB 2R0LL 3LYRA 3CDZB 3DX8A 3BUPA 1TVBA 4PJBF 3TJHC 4ZTOH 1SOSA 1QTSA 2X4RA 5AOLA 1CK0L 5JXED 2D0GA 1JD9A 1NWOA 2PR4H 3EOTL 4BKTC 2QKSA 2HRLA 3L5WB 2IH9A 4KVNH 5BOZG 1MHEB 4PHXA 3V0FA 4PJXF 5DD0L 5T1KA 1E0OB 4B41A 2ENSA 4HJSA 3N1FC 4NUJA 4DKFL 2X4OA 3UO8B 4I18A 4PJ9C 1HEJC 2WZPA 3H9SE 4U1KA 3VD3A 4V11A 1Z9OA 1B4JL 4S10A 4GAGH 5ANME 5CF3A 3QDGE 1RUAL 2F19L 1NFKA 3QFJD 1X5JA 4JE4B 5IQ9B 5FLVA 2J8UF 2XG4A 3PGFL 4HSQA 3T6XA 2O6EA 3ESNA 3T2QA 3QORC 1CI3M 4FKHA 3ES6A 4UINH 2CJ3A 2L4OA 2MTPA 1WIUA 5CSGA 1LDPH 3BZ4B 4NWTL 4UDTB 5I1GH 4Q6IA 1NFIB 4MAYC 5J12C 1HH6B 4CGUB 4U2ZA 2DQHH 5EUOA 1A1MA 1T0MB 1SY6L 3C8KA 3SDCA 4G42A 5C0CD 3KS0J 1AD9B 3AS3A 4TVSa 2H4EA 1UM5L 3D85D 4FQLL 4GQ9L 4JY5H 15C8L 2HFGH 3LSOB 3G6AB 2WXGA 3H9SA 3WEXB 2YPLB 1J05A 4ELDA 1XF1A 2D03L 3VW3L 4OGYH 2CO7A 5F9JA 3VWKC 1JUFA 1ILSA 3GMNB 3T8XA 3U4EB 4BE6A 1GYUA 3PGCB 1DBML 1OB1A 1RJYA 1YSOA 2XICA 5EU5B 1LO3L 5TFSL 2K4AA 3OQ3B 4BA8A 2YA2A 3OZKA 5A16B 2ZCHL 2WM0A 3WD5H 2ZUSA 3KWUA 2NDGA 4FXGC 3TV3H 1DQJB 1CWVA 2WK2A 1VCBC 4HEPG 2XUWA 4NZTH 4B9ZA 2R8SL 3CFQA 4ALAH 1OQOA 1TQTA 2VLKD 2ZOUA 4Z6AT 2IPUG 1MFMA 4OU3A 2QSCL 2XV6B 3F3HA 1D3CA 4LLAA 3NJVA 4A2HA 5DWUL 3CN2A 2KZKA 4FJYA 1MCFA 5F9DC 4RFOH 3FC8A 3HS0C 1CDUA 3SD2A 4A04A 5IJBC 1QKZH 4NRZA 4GLRH 4Y19E 3ZL2A 2DIBA 3HG3A 2B3IA 2IWEA 5I18L 3VRIA 4EDWH 5FUCE 1I1AA 1Q72H 3O6ML 4M9PA 1CK0H 3GSNA 3DV4A 1YNTF 3ARGD 4UQIM 5JW4M 3HFFA 3LZQA 3RWFB 3V4PL 3T6VA 5E00B 3Q8FA 5DS1A 1YEIH 3ZYIA 4N0CD 1U3JA 3D48R 4UT6L 3GIZL 3ZE0E 3ZMEA 1EFXA 4I48A 1OE2A 4Y4KA 1FYTD 2IEPA 2J12B 5DJ8A 1XMEB 4F2EA 3GKZA 1O9ZA 3ARDC 1OK0A 3MJ9A 1ZGLM 4RWYH 1A6AB 4RISH 2WXQA 4ZOAA 3KCPA 2HZHA 3QDJD 1G6VK 4JFOA 2F19H 2AQRA 2ZCKL 4D9QD 2YD7A 1RD6A 1T1ZA 1F3DH 1H0DB 4Y19A 2EEBA 2CUHA 3X3FH 3E7JA 3DIFB 1CG9A 2DWDA 5T3ZD 3V4LA 4DERA 1UA3A 3DO7A 3RQ3A 2EO7A 4N68A 4O5LL 1M1SA 1SM3L 5FO8B 1JI2A 1KJ2L 3NK3A 3R4DA 4KXZH 1E9OA 3QIWD 4JY6B 5FDYA 4APQA 1IGJA 5KSVA 1FUNA 1SY6H 2KLSA 2C4FU 2W95A 3BE1L 4MJ2A 4PJFE 1X7QB 2X2HA 1IM3B 4E2OA 2IAMC 1GHFH 4YDJA 1ZLVK 2R69H 5DXWA 2HFFB 4P9ML 1ZOXA 5ALBH 1P84J 1T1YB 1CLOH 1LE9B 4HPOH 5I0VA 4F7TB 2VH5L 4UNVA 1FIGH 4ZUSB 3B5GA 2XWZA 1U42A 2CPCA 3QPXL 1TEFA 4XMPL 4MD5B 3VAEA 2IH1B 1CXHA 4EI0A 2ESVD 1F6FB 4WO0A 3SPIA 5B39G 2XKSA 1MW3A 4POUB 1YLBB 2HB0A 2ZCHH 4X4KA 3NIGB 2UZYA 4DIXA 3L3GA 1XH0A 1WPCA 3KEHA 4DJMA 1DLFL 4UYQA 5DMYA 3RI5F 1BFVL 4JUTA 4PJFA 3FU7A 1USQA 3LZOA 2DQUH 3NEOA 1Q9OA 1LYQA 4V2BA 5T1MB 3MRMB 3VSUA 4L8SC 3Q8BA 3C9NB 5DC0A 2W60B 1OSEA 4KKAC 3ESUF 3FOLB 1VADA 3O4OC 3WTTA 3MU3A 1IGIH 2ERJC 2JNZA 2IXQB 3O0RH 3ETTA 3GD1C 3RWEA 1AMXA 3BIBX 3FTUA 3U1QA 2D0FA 1FO0B 3I50H 3TBWA 3MXVL 3AWGA 5AG9A 4WKXA 2J1WA 3P69A 2GVYA 1E5CA 3LKQB 1TCRB 4KRPD 1BMZA 1GZPA 2GSGA 2O5YH 2H0EA 2FHCA 1J87A 3CLFL 3V4PH 4RMSA 2V7NA 4ZXBA 4JFDE 1X44A 2IPTH 2NXYD 2PO6C 4OJFH 2HMID 3F7LA 4JM0A 4XO5A 1RVFL 2Y5EA 5LCVA 3ZTEA 3L3IA 4XN8A 4XC3L 2JKLA 2RIKA 3LIZH 4FQXA 2JELH 4OAWB 2F5BH 1LK2A 4IBYA 2UZXB 3EFOA 3C75A 3X11A 2GCYA 4FTVE 1EEQA 1U8IB 5GQBA 1YN7A 1ZLEA 1OZTG 3GHBH 4GQRA 5CUSL 1O7SA 4QHMB 2LFGA 4HX1B 3K6DA 4WVRA 2WMPA 4ZDHA 2CCLA 2AQPA 3G08B 5J9PA 3ABZA 5CIPA 2AABH 2ZUVA 3V6OE 3VGAC 4H26A 2TAAA 3GMRB 2VLMD 4UZSA 3C6LC 1NM9A 3UP1A 2DM3A 2X7LB 1NPJA 3GMMB 5AEAA 2X0WA 3ECWA 2W9DL 3H4FA 1UM6H 1R5WA 2F8OA 4JMNA 5DLMH 1GXEA 2NOYA 4P9MH 3GB7A 5I9QB 1TU2A 1Z5LB 2Z91A 3CC5B 1IVLA 3FB7A 3O3AB 3QG7H 3QSKB 4M93C 1JYWA 3W2DL 2Z4QB 1Y1UA 3CN0A 3DJRA 4PJIB 4R4BB 4BQ8A 5I8OH 1YRKA 3X12A 4DF9A 4ISVB 3FFCB 2ZZUT 4FFZA 2WY3B 4QKXB 1LO5A 3FSOA 4N5ED 4TNEA 4N2EA 1B9KA 3CFDA 2WLZA 2AEQL 2K9FB 4BDVB 1KTBA 3RPIB 2WD0A 2XSKA 3VFNB 1OT4A 2CLVB 1IC7L 1GGCH 4WV1C 4ZUVA 4JFHE 1MIMH 1XSIA 4G5AA 4Z5RB 2F53D 4UV7H 3LQMA 4QHKI 3TYGH 1TVHA 2L7QA 1FWXA 4L4VE 4ZMPA 1KB9J 5KN5B 5EZJA 1F90H 5CSZB 2HJFA 4H1LH 4TQEH 5FV1L 4YHKL 1FNFA 1WK0A 1BYOA 2Y24A 4ZODA 3WXVL 4X9HA 5IVXA 2ADJB 1T1XB 1ZHLB 2OR8A 5AD0B 2BY0A 3CFJA 4JQXC 1URIA 2BINA 4X6BA 1KXTB 2F53B 3RKDD 4WEMB 2AQSA 4YBLC 3G5YB 5BZZA 2RALA 1BBJB 3VJ6A 5IMOB 2I85A 5D1QA 4P5KA 1NJ9A 3RA7H 2ITCA 1J5OL 5ESQB 1M7IB 4JO4H 4NYLA 1SQ2N 3G6JE 1GJWA 5FXCH 4M8RA 3H53A 1OGAB 3VFMA 4WCYH 5K33A 4JQVA 3QHZH 3SPJA 1KCVH 2OMVA 5LBSH 5CD5D 1NCOA 2BVOA 1P5UC 1L4IA 3X17A 1QBLH 2AK4E 1AOHA 3LZLA 1J18A 4CAGA 1GS7A 4LNRA 5L8KB 1UD5A 3QI9C 3SEPA 4Z78A 3VRJB 1O7VA 1FL5B 2YAPA 1DVFC 3B1UA 4QRRB 4KO5A 4CU8A 1F8TH 4LHUB 4NHUB 3TBSB 5F3FA 4FX5A 2DKUA 3NCMA 3L5IA 4LEOA 5I1DB 2P8PB 4FQJL 3MV9D 4XN5A 1QFWM 1QWHA 3QWOA 4Q9RL 3GIVB 1EPFA 4F3FA 4PJEE 2DI7A 5IFHH 1S7RA 5IGXH 3DX7B 1P7KA 1WWWX 1AANA 3SD5A 5FUZL 2Z93B 4LLVB 4YDIL 3QC5X 5A2BA 4M61B 4FLSA 2YK1H 1OO2A 4HKXB 5DJAA 2FBRA 4D7PA 3WIHH 5BCAA 5BUAA 4GQZA 1NCHA 4LEEA 1M1XB 1EJ6A 1J48A 5ILTL 1AD0B 3UZEC 1H3GA 4AK1A 3O8XB 4I1RA 3ZGIA 2YR3A 4FQQB 2NZIA 3O6KL 1W6WA 3BZDA 3ORJA 3FT3A 3DRQA 1OALA 3EZ8A 3OC5A 2Y0SA 3WFDH 4F2ME 3RVWC 1B0GA 2B9AA 3CLEL 3AXIA 5BOPA 5E6IA 5JDSB 1ZT1B 1BF2A 3MV7B 2DYPB 4PJEA 3PCYA 5I74C 3I75B 4GFTB 2NYZA 5AOJA 5FM5M 3R8QA 4NNYB 3VFRB 5T33H 1OCZB 1HDMB 1MCRA 3GSVB 4YOKA 5DZ9A 2CRYA 2SEBA 3OX8A 3WFEL 5BJTB 1IC5H 2RFXB 1HXYB 2VWEC 1JHKL 3P0GB 2ATKA 4JY4A 2E86A 2Y1YA 4OZHA 4HOXA 4EAEA 1E7VA 5JW5A 2X4PA 4IRJA 4BRJA 2Q1EA 3ZKMC 4EE2A 4JRWA 3ZQ9A 5E4EC 1J5OH 2Y72A 4H13C 4QR7A 3ARFD 3ARUA 2FJFB 3RBGA 3MLSL 4MJHA 4CADB 3U0WL 3HG1E 4NPKA 4BGDA 5IB3A 5E9DB 5GS0D 2V9UA 3D34A 3CHOA 3CBRA 2EC9T 3W9DB 3P0VH 1IAOB 2XA3A 4K5NA 4OFIA 1Q94B 5FA4B 1IARB 4OVVA 3S96A 3NZ8A 1G94A 2DDQH 2YPVA 4GBXA 4Z7WE 1UM4L 3D39E 5EO1A 5EU4B 2D7TH 1RK0A 2ZX5A 4KY1H 3ULUC 2IDQA 1YN6B 4JFWA 3KYOB 3S8GB 2VISA 5FYLL 2Z3FA 3B8YA 3KBEA 3N43B 1JV5A 1IBBA 2VLJE 1S78C 2WXKA 3WNMA 3BAYA 3D3VE 3WO3B 2GTWA 3KJ6H 1UACH 2OMZB 4ORZC 3UJTL 2P8LA 3WLWD 1RUPH 3TH3T 1R3KA 5KJRH 1PY0A 5D72L 3VUAA 1B2YA 4K7PH 4U7SA 1NGXB 1CD8A 5D1XD 2VRAA 3FN0L 2NR6C 2DQFB 2DQMA 5AAWC 2H6UA 3FUHA 5H35B 4Q4IA 1A4JB 5C0AB 4YSCA 2AS5M 4FZ8L 1KMGA 2JSFA 2GSIB 3P3YA 3T4YA 5TDNA 3S98A 4AQ8C 1QUPA 4LGRB 4WI6A 3QH3B 4FNPA 2VJXA 3MACL 4YR6A 3QUKA 1NBYA 4PS3A 4WO4A 3GXMA 2F6AA 4I87A 1QFUH 1KXHA 1BQ5A 1ZA3B 2LVEA 2W59A 3A6BL 1MJ7H 5JLZA 1T21B 3EYOB 2OXGA 1HEZB 4LBEB 4Z95L 3ULSB 5JIQA 2P48B 3QUML 4JZNB 2G4GA 4A6YA 3MBWA 3VFOB 43C9A 2X4QA 4NSKB 2PWEA 5SWZE 5A3IC 5GZND 3D3VA 2EIDA 5GHWL 3LRSA 2VDQL 4HUKB 4N8CL 5H37H 3T3MB 4HJTA 1URZA 3TBBA 2DYRB 3OPZH 2VIRA 3GSNL 3RPKA 1AZNA 2R9HC 4I18C 3AWEA 1NICA 1V05A 2NQ3A 5I8EB 2Q7YB 1WZKA 4PV8B 3V5KA 4JRXA 2FO8A 1IM9D 5IESH 1PL3A 3RWHB 2I26N 5TK2A 3PLYA 3Q3GA 4OLZL 1MWOA 2IGTA 5L2KB 1KN2L 3EYSH 3OC8A 3QZWB 2VSCA 5D2LA 5D5ME 3MJ9L 2EUXA 4Q6IC 4W9FC 4PSRA 3BQUB 5ELIA 4XTRC 5I17B 4GUQA 1NC4B 3PFQA 1PZUB 1F5WA 1J9TA 4K94L 3RWJA 1YDPB 3RWCA 2ZAIA 4ZZKA 2RCSL 3APCA 4EN3D 5GS1A 2OXHB 4QOKA 2Y1AA 3GSXB 5FYKL 4NN6C 5LUMA 1BREA 2W1NA 9CGTA 4L3EA 4DK5A 3BZFB 4MCMA 2W0KA 4O2CA 2UWEA 4JFEB 4CSZA 2E7CA 2R0WH 2P8MA 3T0ED 1JK8A 3SIKA 2BIOA 2DBLL 2JFCA 4AIEA 3B5HA 3DHPA 2BVPB 1U3HA 3UYPB 2PTUA 3MLZH 4PLJD 5GGVY 5ES4B 2BS8A 5GJSH 1OZUA 3FQWA 4GO9A 5EOTB 4L4TA 4HEPA 3FK3A 3RG1C 4XN7A 3MRFA 2YXWA 1TSHA 2JQAA 2C26A 2H26B 3GLAA 1WICA 4LE8A 1MLCA 4WWNA 1E8XA 4Z0BL 3T0EB 2VXTL 4NXSA 2HN7A 2ZXQA 3Q6FB 4EI5B 1EK3A 2VN6A 5CGBA 5F9AC 1MG3C 1G7MB 4EO5A 4PW3A 3KPRB 5CLWA 4EVNB 2DEYX 4FZ8H 1J12A 2C3VB 2FSEA 2F8IA 1JNLL 3EFFA 3GFUA 5F7DA 1F00I 5SV4A 2NUPB 2DS4A 5D1ZD 5FB8B 3O2VH 1E27B 1YEDA 1IC4H 4ZUTB 4LPCA 1XIWB 5AYTA 4A7SA 4CN1A 3RFZB 3PP4L 1I1AC 1T4KB 3N43F 3OJDB 2QVIA 1G5GA 3EOBB 3QUMH 3CDGA 1EEZB 4L9DA 3KW8A 3BDYL 2R1YA 3CHQA 3MREA 1PX8A 5GSVB 4YXHH 3C09C 4FXKB 5LGKA 4WWKD 2ZE0A 4AT6B 4PP1D 2VRQA 4AEIH 2BSBA 1W0VA 3REWB 1JNHA 1MI5E 2KYIA 4A7TA 3IT8D 4BJLA 4BYHA 2WINB 3D33A 4NO3A 2WKOF 4Y4KC 5JHDA 4MMXA 3BVTA 4AYBA 2LQRA 2DICA 4ZOCA 3RVXD 3VQLA 3MJGX 4I5BB 3GRWA 3KPSE 4YZWA 5LCVL 4WWKB 3A4EA 3GKWL 3PWPE 4H0IA 3QWNA 1RZJH 2J57A 2X4TA 2UVFA 3ARBD 1XR9A 3C5ZB 4HC1H 1TCMA 2YGPA 4JDVB 4YDMA 3P3SA 5D7HA 3IVKB 2YRPA 1AO7B 4L3AA 1AFVH 2Q0ZX 4RESB 4F8OA 4XP9H 4JM2D 1B9ZA 1PZ5A 4NQCE 1JF5A 4KJPC 1T04B 1UQSB 1HKLH 5DVNA 4APQC 3SKJH 3NFSH 1ETZA 5B1CA 3SCMB 3CD4A 2GKIA 5DQJA 3VM7A 1FZMB 1NCDL 4PJAA 3DHMA 4DUVA 5KANG 3B2UC 5KVDE 1FO0H 2WIIB 4GQPH 1CDBA 2Z65C 1P5VB 3AU1B 3EDFA 3UCRA 2ICEB 4DCQB 3KPSA 1K8IB 1KNOB 4WHCA 5B39A 1T4WA 1PD1A 2CMRL 4XAKD 1D9KA 4GRLA 1BMGA 2P5EB 4DKEL 2OX5A 1BF5A 3N50A 3BEVA 2LOEA 3ZDXB 1G7IA 1KPRB 4Y7OC 4NQCA 3A67H 2E9JA 4KROB 4PRIE 4B3VA 4GIPD 3L3DB 5C07D 4U6HA 4AW4A 25C8L 4YE0A 3SQRA 3WE6B 1FGVL 3L4XA 4JG1H 3NGBC 4G7YH 2ARJQ 3GS4A 4P4KC 5F96H 4FFZL 5HDQL 1G43A 3IS0X 4FNUA 4BSWA 2DQEL 3BN3B 1WGVA 4K0OA 2KC0A 2R1WA 4BZ1H 4F7PA 1MRDH 4MA7H 3MOAL 1V3MA 1XHHA 2G0KA 2I9LB 2OJEB 4NQUA 3HI1A 4I1PA 4P8QA 1RHHA 4JKKA 1MKFA 1T5XB 3LKSA 3DTXB 1T2QL 2RGSA 2WXIA 3QDAA 5T1LA 3NIDB 3AS0A 1WAAF 4HMEA 2J6EH 3SJVA 5B4MC 1S9VA 3SPGA 4PJ8B 3BH9B 3B4NA 4P49A 3H8NA 4YO0A 5C0BB 2FWSA 4PRIA 1REIA 4S2SB 3S35L 2R0ZH 1JVKA 1MCNA 2AEOA 3FN9A 4R2GD 3JWOH 2L7EA 4M3JA 3U7YL 3AAZB 4IDLA 2BSRA 4FQXC 4O9HH 5JUEL 32C2B 5F89B 3GXPA 4M6ML 2E46A 5ID1A 4AUJA 1KCLA 2K6WA 3IFLL 3II2A 1SMOA 5T1DH 4U31A 4BH7B 3STLB 4WJ5A 3ZR5A 3GLDA 3P40A 4KDTC 1I9IH 4AH2A 4HK0B 1HIMH 4WHTA 3VE0A 1FH5L 2DMGA 3JV4A 4DN3H 1D5IL 1C12B 4N87A 4N2MA 3LQAL 4GSQA 4L1LA 4IBQA 1KIRA 4NQEA 5E1HB 1GGBH 5DMGC 1UENA 4TNWF 4K71C 4LLMA 3UIZA 5DFAA 1QTYT 5HI4C 5D7JD 4YHLH 1SHXA 4PJ9B 3DX3A 1OWRM 2UVEA 4P4RA 1TPXC 3QG6B 1EEUA 3EYVA 4QRFA 1DFBL 1EJOL 5I30L 1ADQH 1SN2A 5IJDC 3LRMA 2GK0A 5BQ7A 3BKCH 2BERA 4UWQB 2F54E 4TTGA 2R2EA 4XHJD 3NRFA 1AGDB 3QORB 4XMUA 3WTUA 3QIBA 5LXGL 3QDMD 4RLDA 4HG4K 3SOBH 1FL3A 4TOYL 1HL5A 1DQQB 4MAYB 3VWKD 5J12B 5AB0A 3ZHDA 3PUUA 3AQDA 5K5YA 3ZIMA 4KK9D 4QDGA 3VXSD 4AEFA 1W0WA 2KI6A 1ZWIA 4O2EB 3VTMA 4YSOA 1MWAA 3T1FA 5FYJE 3EJYC 3HPLB 4LEXH 4F91B 1EDYA 4PYHA 2VW7A 5JNYB 2GYSA 4U1LA 4MRCA 4XX1G 3WDIA 5DHXB 5HY9A 4U1IA 1A7OL 2GJJA 5HDBF 1KEMH 3BIKA 3QK0A 4AJYV 4FFZH 1T6WA 5D2NE 4GPVA 4JM2F 3JZ7A 1CGXA 4Q4EA 3AQZA 2DQEH 4PVNA 1KYOJ 2EIZB 4PRHD 4OUUB 5IMLA 3O41A 1EXUA 2EIEA 1CFQA 3EW3B 2BMKB 1JZ2A 3BISA 4FXGB 3MRHA 4QRSA 5I1AB 1VACB 5FR3A 4XPBL 1MRFL 1Q0YL 2V7HA 4WI0A 5FKAB 1ACZA 4PWFA 5MEPA 1QRNE 1TIUA 4NUPA 2BOCA 3DX9B 4UIMA 2XWTA 1TTGA 3WKPA 4LCWD 5HYEA 1H15A 1UXWB 1LMIA 5GGUA 1AI1L 5CD3B 1BZ9B 3CK0H 3E3QE 1NBCA 5IMKB 1QZNA 1KCRH 3HS0B 3UYRL 3EOAB 5F3BB 4JBSA 3MA9H 4FHKA 5IQMA 3IMBA 4J1UA 4HA1A 3DC0A 3LQAC 1FJ1A 2XETA 4JQVC 4LZKA 3VD9A 3KWTA 4PGEB 1QNIA 5IFJB 4CA4A 1LWJA 1HHJA 3ZO9A 3PREA 3TFKD 3GUTA 4N2FA 2GPZA 1NCAH 4UQAA 1BJ8A 3OJ2C 4PG9B 3BZEB 1IJNA 2EEFA 2FEJA 2VLRB 1KZQA 3FFDA 1VFAA 3KBFA 4AYGA 3T8MA 3CXDH 3NIDF 4ZFZB 2V37A 1IGMH 4D0DA 2VDNB 3FSVA 4RDQG 3CH8A 1ACYL 1QFWH 2WN3A 4ERSH 4JPWH 1QRNA 3GTTA 5EPMB 2ZIDA 1NDMA 4BCXA 2CBOA 3AJ7A 1E5BA 3VB9A 3ARDB 2QGDA 3NCBB 2YPVL 3PWUB 3SPVA 4PJHF 2BCKB 4XZUA 2P26A 4GI8A 5IW6A 3FUEA 3Q2CA 2W91A 3CDCA 3G3LA 2IAMD 3GT6A 2QVFB 1Q1PA 2OM5A 4J3OC 2B4CL 1BQHB 1FFNB 3REVA 2FRGP 4M7LT 5EU6E 1I7TB 1E8YA 3B7RL 1RERA 1XL4A 4M1CD 3VFVB 3ZUCA 2ZPKL 3IJYA 1CE1H 4UT7L 2ZXDA 4DTGH 4TOYH 5E0QA 2PYEE 1AR1D 4FQHA 3L9YA 4UQ2B 4C4KT 2C9XA 1BAWA 1JNNH 1WFOA 4M5ZL 1W72B 3OWRA 1ONQA 2IAMB 1OCWH 5KYWB 5LDUA 1IRAY 1A47A 3D2UB 4W9EC 1X5GA 3N1MC 4XP5L 3GI8H 3KS0H 5JQHC 4JRFA 3P4MB 5C2UB 1JPFB 5FV2A 3WJJA 5BO0D 2D8KA 5E6IC 3MUZ1 4X6EA 4KUCD 2DQCL 4X6CE 1CFBA 2BP0A 2DQ6A 1FBIH 3BP4B 5EEVA 4C57C 1ZKAA 2ZCZA 2Y6SD 4XOEA 4A6YL 3DSNB 3ULVH 1XD1A 4CVUA 3WXWH 2I24N 4X6DB 2QELA 1E9QA 3WCYA 4EXPX 3R1GL 1E4XI 2E47A 4X80L 1Z9SA 3PJSA 2DLHA 4TTDD 2PPFA 2VERN 5DHEA 4QJ4B 2CM6A 1MW0A 2Q8BH 5JXAL 1MW1A 2DIAA 3FQTB 3SY0B 1N10A 3T6ZA 2H3XC 1H6TA 5JHLA 2GEQA 3MRIA 3ILDA 5JW3H 3KGSA 5IHUH 1SMDA 2QMKA 3MA7A 2E4FA 3HMXH 4L8SB 1FN4A 1A6WL 3MMEB 1BZOA 3OSKA 1FVEB 3O4OB 3OJVC 4NPYA 1JZGA 4HWNA 4Y2OB 5EA0H 1CURA 2ERJB 2PO6D 2YD4A 2HP4A 4DGVL 3RWGA 3MLUH 3AW5A 1SJHB 4X6CA 3SYOA 1I1FB 2PTTA 2TRHA 4NQXB 5HHOE 1KBGL 2MRYA 3RURA 3CTTA 4XZ4A 1QUNA 4JVUA 4CC0A 5AVWB 5TK4A 3HJEA 4N85A 4AITA 3NSFA 3S3SA 4U1HB 3PWNA 4OT1H 1J0IA 3VXUB 3K91A 3BO8B 3ETBF 1RI8A 3KPMB 3ZRSA 2HT3C 3F85A 3NYKA 1J8HA 4QYOA 5ACMA 1CT8A 2YSSA 3IPFA 5HVFB 5C08A 2N01B 5CN1A 5AOMA 2O5XL 1SXNA 1ZT4A 4K3DL 4PJGA 4ZO8A 3V5DB 1FZJB 2HT4D 2AJZA 1EANA 1NMBH 4JJHA 2YPKA 4OR1A 2B4CH 1AQ8A 4UV4L 3T2OA 4N24A 4OSUH 4GO8A