2YXWA

The deletion mutant of multicopper oxidase cueo
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
440
structure length
440
Chain Sequence
RPTLPIPDLLTTDARNRIQLTIGAGQSTFGGKTATTWGYNGNLLGPAVKLQRGKAVTVDIYNQLTEETTLHWHGLEVPGEVDGGPQGIIPPGGKRSVTLNVDQPAATCWFHPHQHGKTGRQVAMGLAGLVVIEDDEILKLMLPKQWGIDDVPVIVQDKKFSADGQIDYQLDVMTAAVGWFGDTLLTNGAIYPQHAAPRGWLRLRLLNGCNARSLNFATSDNRPLYVIASDGGLLPEPVKVSELPVLMGERFEVLVEVNDNKPFDLVTLPVSQMGMAIAPFDKPHPVMRIQPIAISASGALPDTLSSLPALPSLEGLTVRKLQLSMDGGANKINGQAFDMNKPMFAAAKGQYERWVISGVGDMMLHPFHIHGTQFRILSENGKPPAAHRAGWKDTVKVEGNVSEVLVKFNHDAPKEHAYMAHCHLLEHEDTGMMLGFTVGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and function of the engineered multicopper oxidase CueO from Escherichia coli--deletion of the methionine-rich helical region covering the substrate-binding site
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
molecule keywords Blue copper oxidase cueO
total genus 125
structure length 440
sequence length 440
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2yxwA02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2yxwA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2yxwA03
1GY2A 3ERXA 2YAPA 5PCYA 1WA0X 4HCGA 3IN2A 2RACA 3FPYA 3NSDA 4YSRA 2H47C 2AFNA 3CVCA 4HIPA 1JOIA 4JKNA 2CJ3A 1ASPA 3EH5B 1URIA 2DY2A 2IAAC 1CURA 4E9QA 1AS8A 1NIFA 2I7SA 3FPXA 2GI0A 1KGYE 1A3ZA 3QJUB 1J9SA 1V55B 1IUZA 1HFUA 1SFHA 1T5KA 1PF3A 2DYSB 4A66A 1IBZA 2FQEA 4AX3A 5I6KA 1M9WA 1WS7A 1ASQA 1JVOA 4DP0X 4YSOA 5D4IA 7PCYA 4DP2X 4JHUA 1ETJA 1OOWA 2YAQA 1N68A 1L9OA 4DPBX 2W88A 2XLLA 1KDIA 2CUAA 2PLTA 2CCWA 3NSCA 2YXVA 1ZIBA 2FT6A 1PNDA 4YVNA 4L0PB 1A65A 1RCYA 4HALA 3T6VA 3V9CA 1E30A 2FQFA 3IEAA 1AZUA 1BXAA 1XB8A 2FTAA 2VW6A 4P5RA 2BP0A 1ASOA 1KCBA 1ZDQA 2VSMB 2AVFA 2VSKB 3HEIB 4Q8BA 3TU6A 2UXFA 2XX0A 4GYBA 4HCIA 1L9RA 4EF3A 2TSBA 1M56B 1OCOB 2X87A 2ZOOA 2BO0A 4YSDA 1A4AA 1NPNA 3NJNA 1AQ8A 3QJSB 1AANA 2XVBA 2PPEA 3NJFA 3RYMA 4HAKA 5I28A 2J5WA 2VM4A 1ZV2A 3V9EA 2XX1A 2BW5A 4KNUA 3PLYA 1PCSA 1W6LA 2EINB 2GC7C 3NYKA 3X1BA 2XWZA 2J57A 1W6WA 3WKQA 3X2QB 3ABLB 1VLXA 1AAJA 1UATA 4W1TA 2GBAA 3FS9A 2BZCA 1AG0A 1JZJA 2IWKA 1E65A 4YSAA 2CALA 2HX9A 1NWOA 2PCYA 5B1KA 2Q9OA 5AFAA 4YSSA 1AG6A 5EHFA 3QJTB 1PZAA 1XB3A 1GW0A 1BYPA 1TEFA 4DP1X 4E9RA 5B7FA 4E9XA 1V10A 4BDVA 5F7AA 3EH4B 1AZNA 4DP4X 2CBPA 3S8FB 1CUOA 1GYCA 3X1EA 2TSAA 2FWLB 1SJMA 3UACA 1GY1A 2YAEA 1ILSA 2GC4C 1ET5A 2YAFA 2UXTA 4UANA 3FU8A 1MZYA 5TK2A 2I85A 1HAUA 2PCFA 2H5UA 3FYIB 3AZUA 4HZ1A 5E9NA 1FA4A 5IY5B 4QKTA 2DWSA 2OJ1A 1NIDA 4YSTA 3T71A 4A2EA 1L9PA 2PPAA 4X4KA 1PLAA 2I7OA 3OMAB 1EHKB 5B1AB 1OE2A 2N0MA 3QJRB 3NJLA 4A2FA 3SBQA 1JZEA 3DKHA 3AW5A 1TU2A 1NDTA 3T6XA 1MDAA 1EZLA 2ZONA 2IH8A 2HLEB 4K9JA 2YQBA 5AKRA 3IBOA 3PAVA 2FJSA 4KO6A 3PPSA 1QHQA 2HRHA 5I5JA 4KNTA 4ZK8A 1ILUA 4A68A 1KV7A 2VM3A 1PLBA 4QLWA 1KYAA 2YARA 4P5SA 3T6WA 1J5DA 3X1FA 5B7MA 1NIBA 1CYWA 1IC0A 1A4BA 1AR1B 4WKXA 2Q5BA 3AG4B 1KBWA 2HRGA 1J9TA 1JXDA 3EF4A 4KO7A 2PP8A 2WSDA 4YSCA 1AZCA 4KOCA 4NERA 1CC3A 4UF7C 3L45A 4YL4A 3IE9A 4A67A 3QPKA 4E9YA 2B3IA 2EILB 2FT8A 2BP0B 3PAUA 1MG2C 3FU7B 5ANHA 4YSQA 5PAZA 3WG7B 3BVDB 1W8EA 2BWIA 4HHWA 5TK4A 1TEGA 2BW4A 1BAWA 1HAWA 3AG1B 3FYEB 1ZIAA 1MG3C 1JZHA 5B7EA 2MRYA 2BP8A 2GB2A 4HHGA 5I6LA 1ET7A 5I5IA 2EIMB 3NSFA 5AZUA 2IDUA 4BDVB 1WA1X 4AZUA 2IWFA 2OCCB 1QLEB 2FQDA 4CSZA 3CVBA 3MX0B 3MBWB 1ZPUA 5B1JA 3FU9A 4FA7B 4PCYA 4RH4A 3X1GA 4WTQA 2JFCA 4N4YB 2YXWA 1PY0A 4A2DA 4BWTA 4DP6X 1PLCA 4M3HA 1WAEA 4AKQA 1KCWA 1OCRB 1OE1A 3UGEA 3EH3B 1CYXA 1V54B 1PZCA 1AS6A 4N8UA 1N70A 4AI7A 3WIAA 1PNCA 4DPAX 2DWTA 4G7SB 3WNJA 1YLBB 2UXGA 1PMYA 5I6OA 2P80D 3TBBA 1SHWA 2BWDA 3U25A 3QJVB 3DIVA 4DP7X 1NWPA 2B08A 2IDTA 3C75A 4YVUA 3ZX1A 2FQGA 2PPFA 1B3IA 1BYOA 2OV0A 1WS8A 2EIKB 4A2HA 3ABKB 2AZUA 2FT7A 7PAZA 3OM3B 1X9UA 1SF3A 4YSPA 2P80A 3FQ1A 2XV3A 3GXUB 2XUWA 2XYBA 5D4HA 3FQYA 1BXUA 3CZUB 3S8GB 4W9ZA 8PAZA 1IBYA 4G72B 1BQKA 3AY2A 3AG3B 4KNSA 2J56A 4DP8X 4FAAB 4GXFA 3T6ZA 2ZWNA 1BXVA 4A2GA 5LDUA 2J55A 1SNRA 3NJHA 1WA2X 4JHVA 1JZGA 2GHZA 3FSWA 3NSYA 4E9SA 4MFHA 4AKPA 3ASNB 2IH9A 1E67A 3NP4A 4F2EA 3HB3B 4HCFA 1BEXA 3OQRA 1JVLA 2MTAA 2YAOA 1ET8A 3IN0A 4KO9A 5B1JC 3WI9A 3ASOB 9PCYA 1NIAA 3UAAA 3D12B 4E9TA 3ZIYA 3QQXA 3S3DB 2GSMB 4M4RB 3CDZA 3NJIA 3NP3A 1JXGA 3TA4D 2JXMA 2IDSA 6PAZA 4BWWA 2Y1AA 1SFDA 5I26A 1A8ZA 3JT2A 2AZAA 4TXVB 3WNIA 1NIEA 1NPJA 5B1BB 3BQVA 1NICA 1AIZA 5A7EA 4YSEA 3ABGA 3NJKA 1DZ0A 1M57B 2CAKA 5I6MA 1JZFA 1NTDA 3TASA 4G7RB 3FU7A 4DPCX 2VMJA 4F7KA 1XB6A 1E5ZA 2QPEB 4ENZA 3ZDWA 1AZBA 4DP5X 3UADA 1SDDB 2FNWA 4PAZA 4DP9X 3GYRA 2PP7A 1SF5A 1OV8A 3OMIB 1PZBA 2LLNA 2QDVA 5D4JA 3S3BB 1KBVA 1OCZB 3T9WA 4BXSV 3NJMA 1AZRA 2UXVA 3EHBB 1SDDA 2UX6A 3NT0A 1JERA 3OD3A 1ZDSA 4GP8B 5I6NA 1KDJA 3FT0A 2YAHA 4BK5C 3N2JA 2Y69B 2BHFA 1GR7A 1AOZA 3QJQB 2WO2B 3FSAA 1OCCB 2HX8A 2DYRB 1GS8A 5I6PA 1J9RA 4KOBA 1R1CA 3CVDA 3PXLA 1J9QA 1J5CA 2HX7A 5F7BA 4BWUA 2IDFA 3H56A 4CSPA 1FWXA 3KW8A 3KW7A 4F2FA 2EIJB 4KO5A 3NJJA 1A4CA 4G70B 4E9WA 1X9RA 1BQRA 3UABA 2X88A 1RZQA 1FFTB 1SHXA 3CDZB 3JTBA 4G7QB 2HZHA 2R7EB 1DYZA 3NJGA 2XV2A 2PPDA 3ZBMA 2JKWA 1MZZA 3CG8A 3DTUB 3X1NA 2W8CA 3OMNB 2IDQA 4NB7A 1GSKA 2H3XC 2PPCA 2YAMA 1TKWA 4BXVA 1OF0A 2GIMA 1IKOP 1L9SA 4YSUA 3FQ2A 2XU9A 1L9QA 3AG2B 2DV6A 2ZXWB 4GP5B 3S3CB 1I53A 1E5YA 3WKPA 2VN3A 4G71B 1PAZA 1RZPA 3TBCA 4E9VA 1RKRA 3SBPA 2UX7A 4Q89A 2QDWA 3SBRA 2IWEA 3FSVA 4GY4A 1ADWA 3PAZA 1GS6X 1ID2A 2NRDA 2WO3B 3ABMB 2QT6A 4NAJA 2BZ7A 3UAEA 1QNIA 3SQRA 5I5MA 1F56A 2E86A 2PP9A 3PCYA 1L9TA 2XXFA 1OE3A 2VW4A 1XMEB 5B3SB 2VW7A 1BQ5A 1JXFA 3H4HA 2BP8B 1AACA 3G5WA 3H4FA 4GP4B 1NZRA 2A3TA 2QPDB 1GS7A 1JZIA 3GDCA 6PCYA 2HXAA 2XV0A 3FSZA 1NINA 4AKOA 5FC9A 2AANA 4UAHA 1AS7A 2XXGA 3N55A 2R7EA
chains in the Genus database with same CATH superfamily
3HE6C 2EKJA 3ECBB 4U1HB 3RVVD 1WA0X 2D2OA 4HUXA 4MYWB 2VXVH 1I3RB 2V2XA 2AQRA 3QUKA 5GGSB 1SN5A 5K59F 3GD1C 4DZBB 1KLGA 2CJ3A 2FIKB 4TVPL 1J87A 2GTWA 5ERWB 4K3EL 4PJBA 2AJUH 2XC8A 4PJHE 3M6DA 4NUGL 1A3LH 4PV8B 3VXRD 3DTDA 4GS7B 4ZO7A 5IVZA 5DFTA 1XH3A 4GSQA 5CXPA 3P3RA 3WJMA 3DUSB 2FX7H 2BP3A 2CDGB 3IS0X 4KK6C 4RDQF 1TDQA 4Y16D 5FYKD 1U6AH 4R84A 5IBTH 1YY9D 1AR1D 2QVTA 3AGWA 5H2BA 4YAQB 1JTPA 1DVXA 1JHKH 3FFDB 1E6JH 4NQXA 4LU5L 5AOJA 1Y6MR 1H5BA 4HBQA 4OLEA 3E8UH 4LPCA 3VD9A 1QSED 2GBUA 1ZANL 2R2EB 4DPBX 1YUHB 4YHZH 2CUAA 3SQOL 3KPLA 4M48H 3RBSA 4OZGF 4P0DA 3L6FA 1KLFA 3O0LA 3PHSA 4BA0A 4M8QB 1J5HA 3H9HB 4N0FB 1KJ2H 4LOFA 1IAKA 4L1TA 4XZUB 2G2RA 1J1PL 3DX9A 3ULVC 2C1OA 4QLRA 2YO3A 3CFNA 1J0KA 2VDOL 2W65B 1NCGA 4WO4B 5JYMA 4NQEE 3T2OA 4P5RA 5CEZL 5ILTL 1P7BA 2ZWYA 1PAMA 1I31A 3DIFB 3SDCD 3HUJA 3KJ6L 3QUZA 1NGXB 4M00A 2WWMD 3NH7L 2ZJSH 4AG4L 2V2TB 5AOIA 3CSTA 3OZ9H 3OKYA 4XAWH 4HKJA 1UCTA 3GSNB 4GRLB 4L18A 5HI3D 1WAAF 5D6DA 1AANA 3APNA 4OLUL 3SDDB 1A9EB 4H8WH 4P4RB 4FFWD 1CI3M 2P5EB 3QJHB 4PIBA 1BFTA 4XMLL 3RYMA 1B2YA 2C3XA 3FOLB 3G6AA 5JIIA 3GHEH 3ILDA 4F8NA 1EXUB 2IAMA 1GAFL 3VI4F 5DD5H 1T5XA 1VB9A 2MQ0A 1FFNA 2X6CA 1HI6B 3NYKA 3MN8A 4I9WE 2XWZA 4AL8H 1ZAGA 1WFMA 2QPFA 3QH3B 3LHAA 2V2WB 1RLBA 4C56B 2GBAA 1XZ0B 4NJAL 2Z93B 1KTBA 3BXNB 4P59H 1NCCL 4JN2B 4PLJD 2YMXH 5JHDA 1U93B 1EGJA 1IFRA 4AV0A 1HCVA 4YXHL 5IHBA 3I9AA 2NMSA 2D7QA 1TEFA 2AI0H 2J1ZA 4XH2B 3VFGL 3VWKA 3W0WA 4F7EB 2X42A 3JQOB 3SKJL 3ZTCC 4YHYC 1N26A 1Z66A 1ZHNA 3NIDB 4PJ8A 1GJIA 1BJ1J 4FFZH 1TMCB 3N6YA 2F54A 3X12B 4NKIL 1ZTMA 2YK1L 2CWRA 1MJJA 1LJMA 2FHBA 2R0KL 1CDYA 3ALPA 1E27A 1ET5A 3CMOH 5EB9A 2X4RB 4FFZL 3V6FA 3QG6B 4QXGL 2OW7A 2AP2A 2OZ4L 2PCFA 1LO5B 1G1YA 5A3ID 2X12A 4GMTH 4PRPD 1UWEL 4EMZA 1YG9A 3OGCB 2P8MA 1ZLEA 2VE6B 1MW3A 2P45B 1A7QH 2WZ6A 4HWEL 4OGXL 3PABA 5GGRA 2NY1C 1IZKA 4BZ2A 2O6PA 1UENA 2ZUQB 3MYJB 5HYSB 3S98A 2AQPA 5JO5B 3V4VB 4PGDB 2FR4B 1GTNA 4ELKB 2BK8A 2PYEB 5B39A 1EZLA 4ICWA 2XHNA 2ITDB 3PPSA 1VADB 1QA9B 4KNTA 4FXKC 2R1XB 4JANA 5IGXL 5I8KH 1MW1A 2I25N 3OJMB 3VI4B 3UZVB 1WCQA 1F4WL 2EJ1A 3TONA 2J6EL 2DQ6A 4FQQA 4MD4B 4YE4H 3J2PA 2C9QA 3X1FA 5LLIC 3LX9A 3POHA 5HP5A 4R4NC 2WIMA 2WWMC 1YUHA 3M7FB 32C2A 4KU1A 2I07A 4OIAA 2ZKWA 3HMWL 1BDYA 2VXQH 3MLRH 3WEOA 3K6SA 2X70A 3KWWA 1GGBH 4E9YA 1F6FB 1YZZA 2FT8A 3QG7L 4GLRI 4F91B 3DTXA 4HK0B 1T21B 2GTQA 5IQOA 1JZ3A 1JN6B 3GS7A 4LVHB 3GKWL 1ZLVK 2Q8BL 2BW4A 5DEZA 2F1EA 3S88H 2NDFA 2XWDA 3KPSA 1DDTA 4JFFD 4ZDHA 2E7CA 4CAGA 4DGYH 4M5TA 3SHSA 4F37F 4IBVA 1Y1DA 4G9DB 2WN2A 4LP4A 1K8IA 3G3LA 2R2EA 3N44F 2VLRB 3CE1A 5E8OA 4LLVA 2XN9E 1CDUA 3FULA 3G6DH 4G8EA 4AEFA 5KSBA 2L3BA 3HI5L 1RUAH 1ICTA 4YZWA 3TVMC 3E6HA 2FDBP 2D4DA 4W6XB 4JK0D 2DKMA 3CLFH 1E28B 5FO9A 2KH2B 5JIKA 2VLJE 4G7VL 1YEEL 1AY1H 4N24A 1A1NA 4B60A 2JK5B 2Y07L 3MI6A 4F7TA 3BCFA 1PY0A 2RFXB 3O8XB 5C07E 4KRMB 2BOCB 1JK9A 4X6CE 5DFWH 3B1TA 4G1EB 3AU1A 5I74B 1CJYA 3BE1L 5CP7B 1BBDH 4LFHD 5F89A 2ITCB 3QSKB 1AS6A 1CD1B 1A7NL 4BQBA 1BV8A 4X5LA 5IZ7A 1WC7A 4XPAH 4RZKA 3VTMA 1G6RH 1VHPA 2BMKB 2YS4A 2NLJA 1XGPA 3GXPA 4FLRA 4KPHH 3P11H 1EFXB 4PJ5A 1TTBA 2H1PL 2VUYA 4NRYB 2OTWA 3LNIA 1EMTH 3FN9A 4QJ5B 4PP1D 2YFNA 3EFDH 4GQQA 4S1SL 4BZ1L 1DSYA 1LO3H 3IDJB 1SF3A 2CKBH 3ARZA 3QP3A 2P80A 2IGTA 4LHUD 3IF1A 1UJ3C 5CIPA 2IFFL 3L4VA 3K74B 4FTVE 3OAUL 4LCIL 3GNML 3BDYL 4NWUL 4YDNA 4AK2A 4MASA 3VU2A 3F05A 5KVGL 3GLEA 1J0YA 3L3HA 3UAFA 3VXUE 4UZSA 5EZJB 4YHPA 3L5XL 5M94B 2CO7B 4XO9A 2IJ0C 4ZT1A 3G08A 4ZX3A 2QHRL 4P46D 3O2WL 4HWBL 1HL5A 1M1XA 3WUWG 2Q7AA 1SBSL 4NO2A 5FO7B 3PJLA 3QDGB 2UY6A 4GSUA 4LLDB 4IBSA 4OCYL 5K9OA 2NR6D 2J71A 4QJ3B 5E1AA 3MRCB 3QYNA 3LMJL 3H54A 5B38G 3ZXAC 3ZU8A 1EJ8A 3T3PE 5CZVL 1FNSL 3IXAA 3KEDA 4O9HH 5CWSB 1YN7B 5AAMA 3ZL4L 4YHKH 5LCVH 1QUNB 4PR5A 4D0BA 4BKTC 1ADQH 1P6AB 1JPFA 2G5BB 1NIAA 1NDMA 2WBJD 4XMPL 3FCTB 3S3DB 1TYRA 1IJNA 2LAAA 3BWUF 3V0VB 2IDCA 4M8UA 2VOTA 3TNMA 4FTVD 4NZUL 4R90H 2GQHA 1CICC 3RKDC 3T77A 3U30C 3I75B 4IK7A 2BOBB 1FLRH 1INDL 1KLFB 2AJSH 3KWXA 5ACMA 3T0EE 2VKWA 3TEXA 1F3DJ 1O6TA 2AZAA 3EBIA 2QSQA 4G43B 5AW6B 3RG1C 3RFZA 3HLAA 5F9WC 5IREA 4XNQA 1PLGH 3TBWA 3DDFA 2MOGA 4E36A 1U58B 5IFJA 2XWJB 4W9GC 1IBDA 4XCNB 2OPCA 3GUFA 1OHQA 2PW2A 4YQXL 4L8DA 1BD2B 1IL1A 4S1QL 2HA1A 4J4PC 1E9QB 4MXQD 1CL7L 4UDUB 1U58A 3R18A 5EOTB 4GFTB 5AOMA 4PAZA 3ARPA 1JGIA 2F74A 5HYFA 4KNQA 3BT2H 5T1KD 1U8PB 1R5WA 4JFPB 2VQUA 1OCZB 4G1MB 1YPZB 1IT9L 3ZY7A 3U36B 3EJRA 3GSNH 4MS8C 4HS6B 3HMXL 3KDPB 1ZSDB 1KTDB 2BNRD 5DUJA 3ROOB 3FRPA 5TF1L 3GMLB 5GS3A 4ZNEA 1KLUA 4WRLA 1R6VA 4WUUE 4HIXH 3SQBA 2HT4D 3DROA 2X41A 3VGAB 4GW1B 1UM4H 1DJYA 3N9GH 1CL7I 1HDMA 3BGMB 1OTUD 3WEAA 1AOZA 1FO0B 4WW2A 2J1WA 4ZW6A 5CCHE 2XNAB 4FQHA 3B9DA 5AWNL 4OH2A 2O6DA 1H9VA 4K15A 3H56A 5C09B 3PXHA 3GRBA 4BFOA 3QPQD 5E6YA 4E2OA 3QORA 5C6TL 3NFSH 4P2OB 1FL6A 1KC5L 4FI8A 4NLHA 1HYSC 1ZHBB 1BQRA 2JB6A 4FQIH 3HRPA 4Z0BL 4P3WA 5D7JC 1HE7A 4JY6A 1RIUL 4KFMA 5E2JA 1FYTD 5F1NA 2BMKA 2F5AH 3IU4L 2BVYA 2X2JA 3NAAL 5KJRL 4L4TA 3NEOA 3MFFB 3FTGB 1BQUA 5AVXB 1XF3A 1T1XB 3P9LA 1EJOH 1VFAB 3DX4A 5E2TL 1T7WA 4Q9RL 2H2PD 2P47B 4DWHA 2A9MH 2IOMA 2HKFL 3MRIB 3GRWH 2ZXWB 4P4KD 1WLHA 4OZFA 1E5YA 1EEQA 1KJ3H 2VN3A 4LE8A 2E75C 2V5RA 4AMKH 4HFUH 1NCTA 2XI9A 4I1NB 3SBRA 2XA3A 4GY4A 2NY0B 5I6XC 3Q2NA 3DVNB 3ISWA 5DVNA 3FJTA 2VQTA 4QY8A 3BAIA 1FSKB 2H3NA 5JUEL 3BZFA 2ICWA 5LKNA 5EBWB 1MNNA 1GOGA 4NO0D 1B4RA 2YPVH 3HE6A 4O2FB 1CF8L 4FABH 1NUGA 4Z3TA 4Z3FA 4N68A 4NAMA 4HHAB 4KHTL 3IFOA 5CJQL 4I0PD 3IDYC 4YDLB 4XGZA 2WYIA 2YLKA 3RURA 4MCZB 2XXGA 3CFQA 4HGKC 5AOKA 1MIMH 2YAPA 5DHVA 1YEHL 1BFOA 2F15A 1I9JL 2C1OB 2IMNA 2BRRL 1FE8H 3K8MA 4IJTA 4KI5F 3WHE1 3WKNA 4KROD 2HKHL 4KKBC 2CK0L 2R1YA 4XPHH 1XQ4A 3LZOA 4ZG1A 5DJCA 1MCSA 3LS4L 4F7CA 3L3OB 1JD9A 1RPQA 5HHQA 2V3EA 2QVMA 1FH2A 3UJTL 3RL1B 1NAML 3U48A 2ZG2A 1OGAA 2NSMA 3ZE2E 3S37X 3QDJD 3HG4A 3GSQB 5TQ0L 3LB6D 5E1GA 1T5WB 4YHKL 5C0AA 4BBWA 2FVNA 4JVPA 3ZYZA 1TZIB 5F7MC 3CU7A 3RTQA 2F58L 5GZNC 2ZAHA 2R56L 4Y1AA 4UQCA 2W0PA 1TJGH 2X0UA 1HWGB 3QJFA 5T3ZD 3QJXA 1OAQH 2X6AA 3NIFE 3IBEA 5FF6A 2IEPA 1CIUA 4PJEA 4HWBH 3V0FA 5EU6E 3U79A 4TQIA 1PW3A 5E9DD 4OKVA 3NSCA 4HIHA 2EVFA 4N9GB 4KUZH 4TSCL 1ADQA 4LRIC 5K5YA 1CQYA 1FG2B 3U7WH 4J3OG 5IW6A 4P9MH 1X44A 4P3DA 3Q1SL 4URTB 2Y06L 4KTGA 4LKXA 1BZOA 1Z5YD 3IGAA 5H94B 1OEZW 3DTXB 4HK0A 1DJSA 5D7JD 3NJVA 4LASL 3RDJA 2XWJA 5F7YC 4Q0XL 2VSMB 4HJGB 3L2MA 5FKAA 5DRWA 4Q14A 4Z7NB 4N2EA 1JWSA 3V6BR 4WEEA 2UZIH 2UXFA 2XA8H 2EE3A 4EF3A 1KZYA 3QCUL 2NY6B 3QZLA 4JPKH 1W72H 3N42F 3IGFA 4JQXA 4P8QA 4IOIA 4ZYKA 1CFQA 2XT1B 2YMOA 3TZVB 1N4XL 5EFIA 4GEJA 4LPWA 1A6ZA 4QRPE 3RTQD 2E0PA 2VM4A 4EUPH 2YD3A 4O58H 4WKZB 3P30L 5E0QA 4TUOA 1FVEA 1DFBL 4TRPH 1BZDA 3TPKA 4PUBL 3KPRD 4L8CB 5E4EB 4FFTA 4FRWA 5IV2B 4ZW8A 2EC9T 1V05A 3TN0D 1F1AA 2E59A 3U9PH 4NM8H 1RUKH 1WD9A 2Q3XA 1AZVA 5SWZE 2JJTA 3U1SL 3B2DC 1A7PL 3D9AH 3HVNA 3MYJA 5HYSA 4TVPE 1DVUA 4E41A 1IVTA 1TVHA 4LL4A 2Z35A 1QSEE 4I0PC 3ISYA 2Y3NA 3GINA 4L9LB 4ANWA 1CR9L 4N6RB 4OB5H 1PG7L 3WBDA 1UD4A 1NSNL 1AIFA 1RUML 4QCIB 3BISA 1R4XA 1UCBH 5F7AA 1ZT1A 4X6CB 4LB8A 4RZCB 5IF0A 3QQDB 4KROC 1WHPA 2YGQA 4K23H 5FR3A 3DETD 2ESVA 3TJPA 1I3VA 1EHNA 3GK8H 1RMFL 1SJMA 5FYJE 2Y5TB 2PN5A 5HGAB 5BZWB 5E8NB 3QCVL 3T2NL 1CLCA 2DQCH 1YEGH 4G9FD 2PXYD 2R1WB 4HCRA 4AJ0A 2HSIA 2VSDA 5A2AA 4YH6A 3VRLF 2ZCLH 4OM1L 4O02B 3I74A 1FA4A 2GT9A 1XGQB 4RAVA 4CDGC 4OY9A 2VN4A 4JB9L 3BUQA 3AY4C 5HTSA 1HOCB 1XGRA 2TRYA 2QQNL 4QHKI 3T71A 3QZBA 1V3JA 2HT2C 3SPVB 3CIAA 2X28A 4F7PB 4PHZA 3ZLQC 4LVNC 1ETZA 2CQVA 3DURB 4Z1PA 1Z3GL 1A6PA 5KVEE 2ZXGA 1AE6L 1TU2A 3U4BL 1KN4L 5TQ2H 4PWKA 5JDJA 1ZEAH 1U4FA 4MD4A 1IL1B 2H8PB 5JIDA 2ZWLT 3E1F1 3H7LA 2N01B 1MNUL 3QDGE 1PLBA 3BP4A 1E43A 2GUOA 4JB9H 4HIJB 4NFCA 4Y1AB 2XZQL 3G5ZA 2WLKA 2G2NA 2X4OB 2H6UA 4CILA 5E6ID 1DQQA 1S9WA 4XP5L 1R5VA 2D31A 1I8IA 2DQCL 3VFUA 5HI5C 2NY4C 3UJIL 3M7OA 2Z7WA 2DH3A 4QHLB 2Q1EA 3PREA 4CN1A 3BFQG 1NGQH 4U3CA 3F6JA 5J1TC 1N67A 4QXGH 1CC3A 5IWLC 3IE9A 1GGIH 4KAQH 4NYLB 4JO5A 3B7SA 2B3IA 5L6YH 4HJSA 3T4AB 5PAZA 1S8DB 4BFJA 3MLSL 3OTTA 5EH1A 3UTTE 1QI4A 3V4LA 2DWEA 1RFDL 1I8LC 4OZHE 1BAFH 1DP0A 2VKXA 3NFNB 3ZDZF 2DEYX 4PGZA 1AGFA 3MJ9L 4PB0L 1ZIAA 1MG3C 4IIZA 5LAXB 4AQ1A 5FEBA 3UROR 4G8FB 4J3VA 4XNXL 3MRKB 1FH5H 3EJSA 4HFWB 3B2UD 3TFKC 5E6ZA 3HC2A 4WGKA 4NDMA 5AZUA 4M6MH 4C47A 4PGEB 5T1KA 1A7OL 1UACL 4NRZB 4PTUB 3RZCC 5CBAA 1IC7L 2R29H 5IJCC 4H2CA 4ZQKB 1CXFA 2F9BT 4J5VA 2FLBT 4BQCA 3NZ8A 4OV6F 5T1LD 3RB7A 3WFBH 4XTRC 2DPKA 3CVBA 1H8NA 4QAMB 1F11B 3SKNB 1GHFH 1IBBA 1ZTXE 4FXKB 4XPFL 1IGJA 2KPNA 4N2CA 3T1WA 1MCRA 3GBDA 3U1QA 4OZIA 1EANA 1S7QA 2F54B 4FULA 3KJ4C 1XH1A 3PS6A 1BQLH 4CVWA 3BUYA 2HN7A 3OZ9L 4XAWL 4G7SB 1MWOA 1P5UB 1YLBB 2XIBA 3IJ7A 2OXHB 2Y06H 4OCRL 4DP7X 3CSGA 1F4YL 2PPFA 3CX5K 3LNGA 5CIPB 2V5TA 2GBTA 2ZNWA 1WFJA 5DS2A 4ORGB 7PAZA 1WT5C 4XI5C 4JN1H 2GFBA 3LQZA 3T0DA 3IU3B 3D39D 3HLKA 4K7PL 5D1XA 1SVBA 2OP4H 3MRMB 4PH8A 3MRNB 5GS0C 3PG2A 4X0NA 5C7XL 1J10A 4W9ZA 3F7RA 5CAYB 2NDGA 5IB5A 3NCBB 2NY7L 5FUCE 4LPYA 2J56A 3WS6C 1HHIA 4IDJL 1DBKL 1BXVA 3LKPA 1UJTA 1KMGA 1ZWIA 3SGEI 2BSED 4L3ED 2VLJB 3ZDYF 5DRZB 4X9HA 4Z7UB 4X80L 4UCFA 2OMUA 1QX1A 3LKSB 1P4BH 3POCA 1U8HB 2GJZA 5HYIA 4RMTA 3K0WA 1FFNB 5FGBC 2YAOA 4UOJA 2G60H 3IM1A 2L4OA 4OAWA 4QJ4B 2WNGA 3EGSA 3K2UL 4HGMA 4KKCC 3O8XC 4XPTL 1NBCA 5LNEA 5T1DL 3WIIL 2CM6A 4G6AD 5DHYB 4JDVA 5EEVA 2VDQH 3HMXA 4RRPA 3ZKMC 4D9RD 3SZKC 5AW7B 1A66A 5CZRA 4RSVA 1CG9A 4GW4A 2HJLB 4ZO8A 3WNIA 4HUWB 1CF8H 4FABL 3TBVA 5EO9B 1EDHA 1EVUA 5EEYA 4CW1A 1IEBA 2I32A 1D5IH 1AOHA 1EQWA 1MCKA 1UXSB 3LIZH 4ODVL 3ABGA 4P2YA 4YSEA 3IDYB 2YKKA 1UOKA 2KS0A 2Q3AA 1U92A 1DZ0A 1XF2A 2EUXA 1G9MC 5I6MA 1JZFA 5EIIB 3TASA 1TOXA 3WNKA 1P4LB 3B5TA 3QHZH 3PIQB 4IRJD 2IC2A 1NGZB 1E0OB 5A2JH 3P02A 2V3FA 5HJBA 3G5YA 2XFXA 1EEZA 3UADA 1J8RA 5ETUB 1ZHLB 4MA8L 5KSVA 2HFGL 2VZSA 4J12A 1U42A 2WXJA 4JMXA 4NX0A 4HIHB 5E94A 1CYGA 4L4TD 4H4NA 3CC5A 5D7KD 5HGBA 1JNLH 3NJMA 1NMAH 5KOMC 2WM0A 1OSPL 3TJEH 2AJVL 3ARGB 2OBGA 4P5MA 5CFHA 5H35A 2NZ9D 4QO1B 5MEOA 4PREA 2HKAA 3WMPA 3HS0B 4GKZA 4TL5A 4IIQC 4U1KA 1AHWA 5E8EB 3WEXB 4XXDA 4EUPA 3VSQA 4LQFL 3MGTB 4AE0A 2DQUH 2Y0SA 1NL0L 1E27B 2EEAA 5J3HD 3FQUB 1J5CA 1CGSL 4IKJA 1LNUA 3CHPA 3LZPA 4QKXB 5CU9A 5IBLD 4NM8L 4ZQTA 1BVZA 4ZOEA 1EWHA 3HE6B 4O2FA 5D1QB 1GKOA 4NCC1 3UMTA 3MR9A 4Y19A 2G2PA 5CLZA 2DKSA 3GXNA 1MVYA 1I7ZA 4OBRA 1E50A 4UT7L 4QXUL 3HRZC 5GQBA 4B9PA 5AVTB 4PS3A 5DZVA 3F00A 5A16B 4KZEL 3B9AA 3EDJA 1JNHA 2HFEA 2CXKA 3Q8EA 2C3VA 3EADA 3QEGH 1N4XH 2H41A 4AQ1C 2NCEA 1BD2E 1XCTA 5C6WH 3RWFB 3V6OC 4H25A 1NCHA 1JXKA 4YL9A 4ZFFA 3IPBA 1GSKA 3AXLB 4WI3A 1TKWA 1S7UA 2WKGA 3J07A 3K81A 4FQ1L 4WEUD 3FQ2A 5B3JF 5SX4I 2FJUB 2B59B 3AG2B 4GP5B 4ZS7L 5BCAA 1H6EA 1Q9LB 1R3JA 3TO2B 3VCLA 1T04A 3UBGA 4QY8B 1S46A 2DQDH 3HPLB 3L7FB 2C7FA 4FFWC 3QO0B 3L3GB 2EO9A 3CZKA 1N7MH 4QDGA 1FL3A 4UNTA 1C08A 1IU1A 1RUPL 1QFPA 3VMNA 5AB2A 4W93A 2VW7A 1YNLH 3L3IB 4KKRA 3ZKMD 3SY6A 1TCRA 3LRKA 1P1ZA 3FZUC 4EDWH 2FJGB 1WSST 3S2AA 3NPZB 2A6KB 3ZZ1A 1IQWH 4AGMA 4M7LT 3DIFA 3S35X 2GEEA 4TTDD 4OZIF 2IALA 3ULAB 4ZZKA 3IRCA 3N55A 4S10A 3AUVA 3CX2A 4DAGL 1ZT4B 1MI5A 1XIWD 3AUWB 4H40A 2RACA 1DQIA 1C8QA 1ADQL 2ED7A 4IRJC 2CJTA 1ZTXH 5DK0B 1JOIA 4MJJA 3EH5B 4MAUH 4E42A 1ACCA 5BRQA 1CXKA 1E3ZA 43CAA 4J2QA 3DIDA 1CG9B 4GW4B 3K7UA 2FATL 1ACXA 3WFEH 3MV7B 3P69A 3BHBA 1PFOA 1R24B 2NYKA 3MA7B 1IUZA 3ULSA 1G4MA 3NRQA 4NIYE 3UBXB 3T4AA 2JKLA 1BMGA 2D7NA 2NNFA 4JHWL 3RP1A 2BVEA 4PSRA 3BP4B 4R7DA 3EFFA 5KTEH 3RUGE 4HAFA 8CGTA 3CNKA 1GCYA 1KTDA 4O02L 5DD0L 3WAJA 1JDDA 1OOWA 3KMDA 3S37H 1ZLWK 5C0CA 4Z5RB 4CGTA 3L9RB 5DQJB 3A4DA 4XVUC 4Y5VC 5EC2B 5CCGE 1S5HA 1SXAA 2FLMA 3OXRB 5CSGA 2WKOF 4FXLA 2WW8A 3D2TA 3S2CA 3VMPA 3I9IA 4M4PA 5DWUL 1M1XB 2PWEA 3UAJA 4ADGA 2Y7SA 4WFFD 4KX9A 3RHWK 4APQA 2EEDA 3MGOA 3CFBA 4L4VE 4AEIL 1BXAA 3EBGA 1JK8B 3V4VH 3PUUA 2AK1L 4JDEA 1NCAH 3UCQA 2C1PA 4WUUB 5TPWL 1T1ZA 2DDQH 3LZRA 4A37A 1MCCA 4X7FC 5DXWA 4OLWH 2FZ3B 4ONHB 1T66D 5KS9F 5K9QI 1CXLA 4GYBA 3JV6B 3T8VA 1AH1A 2GPZA 3OXSA 3BKCH 3SPHA 4WZ9A 4TSBH 3V6OA 3NABL 1A4AA 2R59A 3P0VH 1AI1L 2QELA 3RJQB 2AJVH 3CXHK 2ZP9A 5DZLA 4ZUTB 4AQAB 2YZ1A 3HE7B 4DGIH 3NJFA 2ZSWB 5EV7A 3WV0A 2VRAA 4XPBL 2XPGB 2B16A 4XMVA 1A5FL 1FZMA 1LO4H 1T7VA 2QVIA 4PJ8C 3HNTH 4RRPG 2FBRA 4IS6A 4YFDB 3VXQA 1M42A 3HKFA 1WDAA 2Q0ZX 4O02A 4DQOL 5FPIA 1W6WA 3H42L 3NFSL 4LEOA 4Z7UE 1DJZA 3V7AG 1DUYA 1TVHB 2BNQD 4ZMOA 1OCWL 1RVFH 3IU3A 2A0LD 4X8XA 1KIQA 3AXLA 4NQCA 1UH4A 4LCYB 3AREC 4W9KC 3KH4A 4CADB 1E65A 2GITA 2VJXA 1TTCA 3QEUB 4OGQC 3A4FA 3P0YL 3LIUA 2ADGA 2QV2A 3EGXB 1WEJH 1OGSA 3FT4B 4EQ3A 2Z31B 5DURB 5EUOE 3PWJB 3MNVB 4ANXA 4DUVA 4EI6B 1M9SA 4MDIB 4OUUB 1LYQA 4XX1E 1V10A 2ZIDA 4G8EB 1QSEB 5EZPA 3BYYA 3OB0K 1RAMA 3EH4B 2FWSA 3FT4A 3KCWA 3HZVB 4RIRB 5EIIG 3Q01A 4P23B 1IB5A 3F04A 3F65A 5DRNB 3NCWA 5BO1H 5HYQA 2YRZA 3ISRA 2G75B 4RNRA 2A73B 1LE9A 4ORGA 1DBAL 4I48B 3X13B 2EDWA 4DK6A 4F92B 5ANME 5I0DA 4F7TB 1W15A 4IJ3C 4NCC2 4ONOA 2YEQA 4NQDA 2ZYSA 1X7SA 4PWIA 4WI8A 4HZ1A 5BQ7A 5GJSL 2CA3A 2DWSA 4X80H 2GJ6A 4OZHF 5E4OA 2FGWH 2EEXA 2X4UB 4PI2A 4AJYV 1MCPL 1YEWA 3X3GL 3WFBL 1MJ7H 4FNPA 1EDYA 1YPZA 5FYJD 4GXUM 4KITB 1U33A 2ZP8A 4N2BA 4EUPG 2R69L 1UG9A 4QXUH 5FYJU 1MY5A 4Y9FA 3O4OC 2IH8A 2X2UA 4PJEB 5BS0E 1I7TA 1AC6A 5I5JA 1LDPL 1YEKH 5E8DL 4PRIE 1HXYA 1RL1A 2J5LC 1L7TL 4A68A 2OI9C 5ECJE 2JIXD 4W9FC 3B56A 3CVHL 1FZOA 1V27A 3BAJA 4D0CA 5D5MA 4R26H 4UOW1 5AVVB 1RP9A 1CDJA 4JRFA 4P46C 3V0GA 4DGIL 5FM5M 1AI1H 4L3CA 3AG4B 2Y6SD 1ED3A 3CC5B 5HGBB 4A55A 1NFDB 1JXDA 4F2ME 4HLZG 3SIKA 1JZDC 5L6YL 2WKOA 1TJXA 5B1CA 1QPPA 3QC6X 5DJYA 4YGVA 2X1QA 1T0MB 4LLQA 2VL5A 4Q9QL 2XN2A 3FU7B 1DBBH 4K8RD 4QHKJ 3CFBB 5LBSL 4WWKB 3KWVA 4A63A 4YXHH 4I8DA 4ZW3A 35C8H 3AM8A 1HL9A 4Z76B 2B3RA 2JJTC 2WTPA 4D8PA 1DE4A 3MRGA 4NRXB 3Q8FA 3RBGA 4MVBD 2R29L 2MRYA 2ZOLA 5T1LA 4M5ZH 3U0TB 1TNMA 1JTTA 2K6WA 3A6CL 5JMOC 1MELA 4NOBA 2JXMB 4AL8L 4ZXBA 3Q2CA 1YMMB 3ZE1E 2FO4B 1AE6H 3VG0L 4X4ME 2AXFA 1EO7A 3P11L 1WA1X 5MEPA 3ZJAA 3MJ9H 1SOXA 1HHGA 4TOYH 5HDRA 4UAOB 3BLKA 4DSYA 2AC0A 2LU7A 4L9LA 3L3KB 4I3SL 2VM9A 1SJEB 1OGTB 3QNZA 4JREB 3BGFC 5E00B 4QF1A 2NXZD 3BE1H 3GO1L 2B59A 2JFCA 3AWGA 4GBXD 2YBRB 2Y25A 1QRNA 1DQDH 4ZW5A 2HUEA 3VFMB 2G60L 1OAZH 4P5KA 5M7QA 2ED8A 5DUMH 1TQCC 2G75A 2VDMH 4N1CA 1BSIA 4GI9A 4MA3B 2QHLA 4F9LC 4KKLC 2IGLA 2MOQA 4LKCB 3UIYA 4DPAX 4PJ9B 4ZPTB 3MO1B 1T20A 3VRLE 4JG1L 5CEZH 1TJHH 5FW8A 3WNJA 5A16A 4AIOA 1L4IA 3E3QC 2NY4B 5AW0B 5DJ2B 2R29A 2YFOA 2HT4C 1X5XA 3SCMA 2FQGA 5AZ2H 1OTUC 3QDJE 4UZGA 3PDDA 2EEFA 3P9MA 3ABKB 3C60A 2DLTA 4TLSA 2J4WL 2VXSH 5F2FA 1PG7H 4ICXA 1X9UA 1X6LA 4C54A 1YN6B 1U95B 2ZCKH 5G5DB 4AH2A 1G7QB 4N86A 5E23A 1A1MB 4QRPB 1S6NA 2GSGB 3RGVC 1RUPH 3DO3A 2VDLL 1YJDC 4A7VA 2BSRA 2EYRB 2AABH 3VFRA 2BS71 4PS4L 3FL7A 1MIEH 1FL3B 3GUTA 2XQYG 5J1AB 2JB6B 4GXFA 2QGDA 2ZWNA 5FCSH 3V55A 1HC1A 2Y4SA 1XGTA 1AYRA 3QXWA 4A2GA 3APDA 3QAQA 4HWNA 1TZOA 1WA2X 2APTA 1JZGA 3OR7A 4YXKL 4HC1L 3MBEA 4KJYA 4OKVB 1UQSB 5D6CA 4HLEA 4LP8A 1F97A 2FRGP 3O8XA 4HZAA 1VFAA 3HB3B 3BP7A 2D0GA 5FM8A 1S2EA 4L4VB 35C8L 2WZPD 5GGVH 4ADIA 4MNGB 1CMOA 4NC2B 1GHFL 2XQYK 1FP5A 1PKQA 3OKDB 5J56B 2R0WL 4ZSOA 3KNBB 1G87A 4ONFH 5I2IA 1C12A 3ESPA 4OLVL 6PAZA 3CWGA 2EECA 3EO1B 4DGVL 43CAB 8FABA 1HQ4A 1N6UA 3H7BB 5GGUA 4X0KB 4LIQE 3N42B 3OF6A 3A6BL 5ICXA 2F08A 2XCMC 3OPUA 1IM9D 4PYGA 1ZVSB 5IHUL 2H32B 2O5YH 4NKMA 3SCMD 3T09A 5KYYA 3PNWA 2M26A 4JHZA 3SE8L 3MODL 4R7DB 1RD6A 3TA3A 1JJUA 1HILB 3D4GA 3A3YB 1KUMA 2YC1B 4B0MB 1CFMA 3ENEA 5HGDA 5MERB 4PJCB 1JNNH 2CE6A 2NY0C 2P52A 4N8VA 5C0JB 1WWCA 3QQ9C 2R0WH 3EBAA 3D2UA 1IBGH 4CMHC 5F6IC 5FHBL 5KYXB 2QDVA 1KBVA 4GBXC 1D2PA 1T2JA 4JG0L 4JO2H 4OCNC 5E1AB 3V6ZA 1QFUL 5KSBE 4HT1H 1BYNA 4EAEA 4XWOD 3KVQA 2EDXA 4XP5H 3X3GH 5JIPA 3KPRE 3LB6C 4HJUA 3CH1B 4PCSA 2OM5A 2FUTA 1GPOH 2CO7A 3UTSE 2G5BA 4ABQA 5IP4A 1W9XA 1F4AA 3DUSA 2VMCA 25C8L 4OZ4A 2JQMA 2WTRA 5FK9B 5IG7B 1T80A 4C4BA 5BZWA 4AYID 4X9BA 2HX7A 1Z9OA 3L9EA 3M45A 3MRCA 2WZPA 4QYOA 2RALA 3C09B 2DD8H 1UD8A 2FSDA 5KSAD 3BVNB 1TCRB 3OVUB 1X5ZA 5D2NC 3NJJA 1RPKA 2WWOA 3HCVB 4MX7B 2DD8L 5EUKA 4UDTA 2L0DA 2FJHB 4JM2D 1IGFH 3QAZC 5I8OL 3O2VL 4ORZC 4WFGE 5I1AA 1SY6A 1GZQB 3MRMA 1RU9H 1WEJL 3HJ0A 4JFDB 3HAEA 5CZXC 5IJKC 2DN7A 4H8WL 4HMCA 2I5YH 4X5PA 3VXPA 1MREL 2YD2A 4XHJD 3BSZH 4FN0A 4K3DL 3US0A 1AHWC 2K4WA 4NC1C 4YSUA 4P4KA 2YMTA 5EU6D 3NH7H 4ODXA 3RWHA 4HFUL 3T65A 1TNNA 1QEWB 3ATDA 3KJ6H 4G71B 4W4NA 1B6UA 3SBPA 3ZHNA 3CPUA 5CEXA 5F6HJ 1I3GH 1QLRB 3SPCA 2K78A 4WJ5B 4OUUA 1CS6A 4K0OA 4NAJA 4JQXC 3RDTD 1T4KB 4P06A 4UQEA 1AXTL 5ENWB 2EDQA 3O9WA 2EDYA 4IOSD 4MJID 2B5IB 5HGHB 3S5ZA 1XGUA 4G1EA 3BVWA 4N2IA 3NACL 5F6HI 4B3EA 2DW5A 1R5WB 4R4ND 2Z7YA 3V0WH 1M7IA 4G6ML 4BGDA 2B15A 5ABDE 2QPDB 3VG0H 3GDCA 4R4FH 4DW2H 3NCCB 4TLKA 2PWGA 3HI1B 1WS8A 1UWFA 3BLPX 3T2LA 1E4XI 3LZLA 1S9XB 5IBTL 5IESH 2VH5H 3SCMC 2DYPD 2J8HA 4F58H 1UXSA 4PRDB 4YK4C 1IGTA 2PWDA 1WWAX 1H3XA 3HJEA 1ASPA 1S78D 4R97B 3KLHD 2ITCA 2Z9TA 5SV4A 3NPSC 5I5RA 1XH0A 2D7OA 3AXIA 3FQWB 4AUJA 1D9KC 4FA6A 4FZEL 5C3LD 3TBTA 3W39A 5EEUA 1JGDB 2XG5A 4O02H 4XWOC 1IMHC 2LU3A 1SFHA 2R2HB 2YPKB 3ZKSD 2IV9A 2DI9A 5KZCB 5D7IA 4WU5B 1UZGA 5DUPH 1UJ3A 1JNJA 3TBTB 2X4NA 3QCTL 1OK0A 5D4IA 3S4SG 3W39B 5IMMA 1QA9A 2XTJC 3GPEA 3Q44A 3FUJA 3NAAH 4U1JA 1KTKE 1MIEL 3GQFA 4XMTA 2BVOA 1PNDA 3GMQB 2WLLA 1KCLA 3ZQXA 3Q1SH 4ETQA 3BZ5A 1AQDA 2D0HA 4ZNEE 3W1ZA 4DJMA 1OAXH 5C0BA 4NT6B 3D34A 4YPGA 3PV6A 3NK3A 1A4JA 3RWEA 2FX8H 3BN9D 1LO0L 3CU1A 4HEPA 2PWFA 1S3KL 1VJSA 3MCLH 4U4BA 4NZUH 5IB1B 3V9FA 1WBYA 5E70A 1MCPH 3V6FB 1DQML 4DKDC 2GFBB 3LQZB 5CWSA 1TJGL 2BM3A 3B3IA 3HLAB 2F61A 3D05A 3G6JE 5DS8B 1SLVA 3U0WL 1OCOB 4UWQB 1A22B 1SJHB 1YNLL 4Z7WE 4YSDA 5ESVA 4MD0A 3CC1A 2IPUK 4JDVB 3DX8B 3V0VA 5CD5C 2ZX6A 1CBVL 3NABH 5IOPA 2ATAA 4B9YA 1ERNA 2AQNA 2HG5A 1D5BB 1FIGL 2Y7NA 1NBVH 4KROB 3S97C 3OJDB 3OLIA 2VLRE 3Q5OA 2WBKA 3FQRA 4WNJA 3TP4A 2DLEA 2HH0L 4CNIB 1VCBC 3X1BA 5CD3B 1SLXA 2K8QA 3ZL1A 1FVDA 2IQAA 4OKDA 4CN4A 4KDTC 5BRZB 5CJQH 1P2CB 3RZWA 1MIML 4LAJH 3EG9B 5HI4C 2OR8A 1P9MC 2WN3A 1ETZB 1I8AA 2IQAB 1J86A 4HQQL 3TBYB 3UGUA 4YNYB 5F3BB 1CFNA 1Z0NA 1QBLL 1ZXKA 2Q9OA 3NVQA 4X6EB 3X14B 4OZGA 4XN1A 4OD2A 3J8F7 3K80A 3RZCD 2YOCA 2E74C 2OXGB 3LZFL 2ZKYA 4OCLC 3M17B 2X6VA 2CO2A 3TBYA 4DP4X 5B8CB 4KJWD 1T7XA 4ZODA 5ISZA 3KLAA 4AGOA 3ARRA 2I24N 3X1EA 3T1FA 3T4AC 3B9KA 3C9NA 4KRPD 4WW2F 4Q9QH 4N5ED 4KJQC 2P7TB 4PJ6A 3QZWG 4JAMB 4N85A 1T22B 4ALAH 1EHLL 4GW1A 5E0FA 3C60D 2E47A 2FATH 2LR4A 3ALWA 4MZ3A 4HOMA 2F5AL 3BGAA 3WJLA 5E2TH 4ZMVA 4MAUL 4J3BA 4ZD3H 2D73A 1EHLH 4AC2A 1EHKB 3IETB 5CEYB 3DRQB 4LBEB 4KV5E 3LN5B 3L3JB 2ZUWA 5E2UL 4YX2H 3UC2A 4B96A 4EKJA 3SE4A 1I8LA 1H19A 1HTYA 4N90D 1MDAA 3FUMA 3LEVL 5DS1A 2AERT 3PAVA 5F21B 2VDMB 1G7PA 3EOYG 4MS8D 1QHQA 5D5MB 2H2SD 3PWPE 4ZK8A 5K9QG 1ILUA 1HILA 2MCPH 2ZT9C 5I9QC 3QIBB 5GS0D 4L3FA 4QGTA 4WKZA 4MXVE 5K33A 1E5BA 4PGEA 3GXTA 2XPYA 1G7PB 2ICWI 2ENSA 5L2JB 1B88A 3LKOB 5ISZD 4JGUA 1W72L 4A2LA 3H9SA 3L16A 3AT9A 1UWGL 2B14A 1BLNB 4P48A 4FFVD 4LLYA 4LSTL 4YSCA 4JFQB 5D93C 4KKAC 3VWJB 1NC4B 4I9WD 3PDGA 2RHEA 4JFWA 5F1SA 1DUZA 1ANUA 1I85C 1LO2L 4Q6KA 3ZQWA 3M46A 7FABH 1LEGA 3FRPG 2FEDC 4QR7A 5KSBF 4AQEB 1MG2C 1MHHA 2ZNXA 2NY5L 1MFDL 2XN1A 4HD5A 1W8EA 5JW4Q 4YBLC 4KH2A 3BLBA 3WLBB 2L8AA 4P5TA 5IFJB 5AVUB 2VL4A 4W6YB 2DMBA 3LTVA 2O1AA 1C5DB 4LL9A 5FV1L 1U4EA 2IPKB 3ZTJG 4BSJA 4KUZL 2PXYB 2DQIH 2AJSL 5LUMA 2QKIB 1E5AA 3C6LC 1TQBB 1JCVA 3BKMH 3D2UD 5I1EL 3RVXC 3BDBA 4U1LB 1N10A 4X8CA 2BP5M 4Q4EA 5JPNB 1GYAA 1BVOA 3MRNA 2KZWA 4D7PA 2DQUL 1RJZB 1VA9A 4P2RA 4BRVA 4N28A 1JWMA 4P9HC 1R24A 4A6YB 3MX0B 5BUPA 5B1JA 4MXVF 1RPUA 4HWZA 4DQOH 4PCYA 4A2DA 4X5WB 3WO4C 5HYJE 2GJPA 1JTOA 1W0VB 2W9EH 2WGNB 1OCRB 4LSUH 5BRZA 5J4MA 1XWVA 3RFRA 3SOBL 5I17B 1CGVA 3E9UA 3LS4H 4N5EC 2J20A 1P6FA 4BEIA 4L1SA 4H8QA 3O4LA 3BO8A 1XCQB 5CIPH 5IFAH 4HKZB 1S3KH 3LMJH 4NQDD 1URLA 1KEML 3TEZA 1KOAA 1MCOH 2AK4E 1ORQB 3V5DB 3VGGA 3HZYB 2EDKA 4M1DL 4KKBD 5JHDB 1SBBA 4WNQA 3OB0H 1RK1B 4HJ0D 4AH2B 3D3VA 1ES0A 3KDMB 5KJ7E 2VUOA 2RFXA 2EYTA 3FBKA 3SJVA 3QFDB 3FQUA 1Z9LA 3V52L 3ZTDC 3MFFA 1T1ZB 4AYBA 1YJDL 4KJPD 4IGBB 5D4HA 3TTSA 1RJYA 4ZAKB 2PR4H 4MCNA 5CBAB 2NLJB 4OFKA 5A2BA 5IIEB 3MRBA 3F3HA 1O75A 4HLJA 2K70A 4XP9H 4XPAL 4ZMTA 3WDIA 4HS6A 1SNRA 1A7QL 2A5UA 4IOIB 3VGEA 2ED6A 2PYFA 4R3SA 3RWIA 3WIHL 3WAKA 5I19H 1TIUA 1T2QL 4JHWH 5E5UB 2C4XA 2P8LB 2Y36H 3P77A 2NT1A 4YUEL 1XL4A 2PYED 4KO9A 2HTKC 2CDFA 1WG3A 4Q58C 5D7IB 4EXKA 1HKLH 2GIYA 1S7VA 1KBPA 3SDAD 1PG7W 3QORD 1I3GL 1NC2B 4KZDL 5DEGA 2NNAA 1KB5H 4AYFA 3CFIC 1BZ7A 1CICB 4X99B 3K6OA 3V5KA 4LSPH 4UILL 3WS3B 3CFUA 3SOTA 4P2OA 2EICA 3SKJH 1A7BA 1XFPA 1KB5A 4ETQB 1KBBA 3ARGC 5D70L 2YLHA 3JV6A 1ESOA 1NIEA 4DZ8A 4XN2A 3KPLB 3VA6A 3V0DA 1HYRC 1NICA 4WW1A 3LN4B 4PV1C 2F53D 4A1RA 4C57C 4CJ1A 3K71B 3BQUC 4ZUVB 2CHWA 1H8SA 4UNIA 5IVNA 1BP3B 5LGHL 3GSNL 1WF5A 2DBJA 3GYRA 3X17A 2JKXA 1WTLA 1Z9SB 2FEJA 4WI5A 1E4WL 5IROD 1K8DB 1EEYB 4ETYA 1A2YA 3DMMC 5KYUB 3LKOA 5FUOH 1JWUB 5CR8A 5IQMA 4BK8A 1JERA 2FLRT 4N2DA 5FFGA 2R0ZH 4DQAA 2ZXDA 1E9QA 4Q6YA 4F5CE 4FQPA 2DM4A 1A6TA 3CDGA 3G5ZB 3SYCA 4XPFH 3VDCA 2XXCB 3V4UH 3Q5YA 5BVPL 5I8KL 2BHFA 5FGRA 3FTYA 1C8PA 1F0LA 3FSAA 5BJTB 5FYLE 3D25B 3GLZA 4PJBE 5DEFB 4UUJA 2WUBL 2WYTA 1G0YR 2RBLA 2JQAA 1PLGL 1PQZA 1XF1A 3JUZA 4IDJH 3VXMD 2FIRT 2WNXA 4NO3A 3D07A 2FYYA 3DGGB 5F7BA 4YR6A 4YWGL 5I1DA 3O6MH 5D2LF 1WWBX 2P5ED 1A25A 5ICYB 4FNLH 3KDMA 4WY7L 3L3IA 4YJZL 2EIJB 2DAVA 2PXYC 1M7DB 3D69A 1YYLL 5DDHB 2Z4QB 1GJUA 5I1AB 1X9RA 2FO1A 3DECA 4H1LG 1OOAA 2OXGA 4H0GA 1RZGB 4YDIH 3HZ3A 3GMNB 3JTBA 2DLFH 4XCCL 1PYWB 4Y5YB 4NUMA 3L9BA 2GJ6B 3HNSL 4LCCC 4PMFA 4UB0L 4YDVA 4F8TA 3A6BH 1KFAH 1M7DA 2EIZB 1LP9A 2O93L 1U91B 1WHOA 3PRZA 2WQSA 3FT3A 2BSSB 4R4BB 4KZDH 5D1XE 5L4MA 3V8CA 1B0GB 4S0HA 2BNUB 1ZV9A 2BS8A 2XU9A 4HDIA 3ARBD 1CK0H 3IMSA 1I53A 2WB1A 5C0IA 2JWYA 5JOFB 1G7LA 4L8CA 1BQLL 3K5SA 2CO3A 5ENWA 1MEXL 2H3KA 4NQEA 2Y23A 1NGQL 3CBKB 3MROB 4R6UA 4XRCA 3NZ8B 1ADWA 2ZUTA 5K39A 1F3JB 5FO9B 3MXWL 4NN7C 4XB8A 3HUJE 1O9VA 1UXMA 4CMHB 5GZOD 3FRPB 2ZSWA 1B3JA 3BO8B 4OM0H 5AKVA 3QUYB 3TZVA 2HUHA 1E2VA 2OMWA 3DBXA 3JV4B 2JTDA 5AD0A 3MJ8B 3OAUH 4OU3A 3C08H 3QT2A 1R75A 4ZMAT 3MRIA 1QVOB 5C8JA 3HNSH 4F15B 1JK9B 2BP8B 5E94B 2YA0A 3G5WA 1I1AA 1NZRA 3MLXL 3VH8B 4Z7OB 3FU6A 2R4RL 3QYCA 1LWRA 3D3VB 5C07A 2CJUH 2JH2A 2XFGB 3OG6B 5FYKH 3TM6A 4J2XA 2VIRA 1NCCH 2DIBA 5DUBA 3KBFA 4P05A 5D2LA 1QW9A 6FABH 3IN2A 3VFOB 4BZYA 1B90A 4O51B 5TDPB 5DWPA 1KCUL 1ECYA 4JRXE 4JRYB 4KX8A 4QOKB 5DZJA 5BRPA 1CFQB 4ZFZB 4Y4HC 4U1MA 1P5VB 3Q3GA 4QTHA 5T1DH 1CURA 3PYCA 3N44B 3GHEL 4APXB 3I9GL 3U7AA 4Z7QE 1GIGL 1MCBA 5IFAL 3ZKXB 2NTFB 4LAQL 2WXQA 5C0JA 1V55B 3B2UC 2Y22A 1OAQL 3KXFB 4WU5A 1XR8B 1DLFH 1UD5A 4FTVA 4M6OH 1BOYA 4JM2F 4Z3EA 1JVOA 3WDHA 3MV9B 4JHUA 4FLQA 1BZ8A 4PS8A 4B9ZA 1SVCP 3NCYP 4AOFA 1MFCL 2CCWA 3HE7C 3WXWL 3WU1A 4YFLI 2OCFD 1J1PH 1CGUA 3RL2A 1S5IH 5F3HA 3V9CA 1OWRM 1MFMA 2ICEB 4UQ3A 4LU5H 4MA1C 4FNLL 4WY7H 2ARJB 3DJRA 4UV4H 2BSTB 5INCA 3QZWA 4YHZL 3H3BC 2GK0B 1GGBL 1HH6B 1N0LB 1TJMA 5TE7H 1QABA 1U8IA 3J27A 3QWOA 5TDNB 3VI4E 1YN6A 4MHHG 2GBVA 1DFBH 4TRPL 3N04A 5MENB 3PNRB 1D7DA 4AJVA 4Y19E 3F5WB 1URZA 2IAMC 4D2NA 1MFBH 3U0PA 1GH7A 3NJNA 1AQ8A 3T0EA 4J3UA 1YUKB 4FNUA 2BSBA 4C4UA 1P1VA 1AKJB 2VISB 3VWKB 3W0WB 3B7UX 3BZ4B 1X7QB 2SEBB 4Y4KD 3V9EA 4GIOA 4NQEB 4C55A 3ZDZB 5BMFH 2OMYA 5DJXB 3LEXA 3ABLB 1VLXA 3T04D 5J8OA 3QWRD 4NNYA 4R7LA 4W1TA 1DCEA 3F2LA 3MBEB 2JSFA 2RTTA 1TPXB 2Z93A 4K94H 4XE5B 4ATTA 1A7OH 3AQDA 3S34H 3BC9A 1AJ7H 1BX2B 2XZAH 2ATPA 5I30L 4P9ML 4HWEH 3AS0A 1OT2A 2JCCB 2NNCA 4R26L 4AZ8B 3RJDA 4RESB 5KBMA 2JJSC 3ULUC 1A6AB 2CCLA 4XP1H 2HRPH 3QJTB 4JDTL 4AQ8C 4JE0A 3LVEA 2VZVA 2Q2LA 4IMLB 5K39B 2RCSL 3CN2A 1VFBB 2ALAA 4ENEC 1KGXA 4NDMB 5L2KB 2VWEC 4HLZH 3BEWA 3HBPA 5CBEA 4X5XB 2P7TA 2ENYA 2ZICA 4LHUB 2BIIA 1WFTA 1ZJAA 1OIOA 2IPTL 2UV3A 4ZMXA 3Q7JA 3F64A 2ZE0A 2YAFA 2ZPKH 4HKXB 1BVNP 2ZKMX 1MI5E 1B9ZA 3JWNE 5EG6C 3OC8A 4NRYA 4U1KB 2L7JA 1YEDA 1JZ7A 3FYIB 1VEPA 2KLRA 2ARJQ 5JXAL 2O6CA 4NENA 1NGWB 5F1NB 1JXJA 4YBQD 3SDDC 3QDGD 1DJGA 4OQ1A 5HHNA 4X4KA 1BQSA 2W38A 4EN3D 4HULB 1RURH 3ZMRA 5F96H 4ZXBB 4IBQA 1I7RA 5H8DA 1OAYH 3QJRB 2OSLB 3H3PL 3FTXA 1LE5B 3LPPA 3GM0A 1NEUA 4MQXC 4RFNC 1O7DC 4N1HB 5E5RB 3VYOA 2B0SL 3QHFL 4NRXA 4YHNB 5EEWA 2CUIA 3CBRA 2WQAA 1EXGA 3TT3L 5K1JA 3TYGH 3FFDA 4NQXB 5HDQH 3U4BH 5C0NC 3OB8A 3FQRB 5F88A 1NCOA 2NZ9C 2EIBA 3NEXA 4NN6C 3UTZA 3UZVA 3KPOB 4FTVB 2BJML 2LOEA 5B7MA 3L13A 1IC0A 3TIEA 3KD4A 1WVZA 3GHPA 2DF3A 3DHPA 1EBPA 5BPPA 1F3DH 2NX5E 3PWLB 3RVUC 1U8PA 1PY4A 3LKQA 1G5GA 5D1ZB 2BS9A 4XC1L 4MYPA 3C6SA 2A83A 4MNQB 2NNRA 1A9VA 5HXMA 4X8JA 4YSQA 3MLWH 2EQDA 4XMZA 2I9TB 3QWQB 3UJTH 2JV6A 5EDXA 4DKEL 4GKOA 4C58B 4IU2B 4DCQA 2E7BA 2VUKA 2CO4A 1ZVHA 1BAWA 3P4LA 5DR5H 5SWSE 3FO9B 3B9KB 3C9NB 3I6KB 4BQ9A 4GSXA 1ZLVH 4EO5A 5HYJD 1LO0H 3MUGB 3PHOB 2FX8L 2HLFC 2ZX8A 3GBNH 1RVFL 4XNZC 3ZL2A 4A7UA 1ZOXA 5I5IA 4PJ8B 3PP3H 3N06B 4G6KL 4X6DA 5J6GB 2CMRH 3ZRCC 4XNZB 4HUVA 3D9AL 5AB0A 2VDRB 2DH2A 3V4VL 1Q0YL 3BD3A 5E2UH 1QQDB 1JPST 4G6FD 1BFSA 4WGWB 3TO4A 3M88A 1CFNB 4Y16A 5CR1A 4LCIH 2ICWJ 4YUEH 2VWEE 3FXIC 4HIXL 3X1GA 3CK0H 3BKCL 4KKNA 4M6AA 5KW9L 4RDQG 2FH8A 4LHUA 4M93C 4XZ4A 5EU7E 3ML8A 4L37B 3MUZ1 4XO3A 3FNKA 3WUZA 2W0KA 1N70A 1IKNC 3F58H 2FWOB 2VABB 4K7PY 3BRDA 1S9XA 5I6OA 1DVYA 1JDAA 4G8IA 1G84A 3BT0A 3ZT5A 5D1ZI 3V52H 2F8XC 4A2HA 1B0IA 3FOMB 2J44A 3FUEA 5DJ0A 3QUZD 2QZQA 1MRCL 4FXKA 4O5LL 4JUSA 1FNLA 3SJVD 5I0WA 1ROCA 2XXMB 1XCTB 2CMRL 2V37A 3DA0A 1M2OA 2GJ6E 3F7YA 3IDNB 1RHHA 4WUUA 3D08A 5C6TH 3FQYA 1NLDH 1AO7D 5JMRA 1UGNA 4WWKD 5IOKA 1PX8A 4G9FB 4QHUA 4TUOB 4NQSA 1P5UA 4AVIA 4FAAB 4KK8C 3TO4D 1RZIA 1PEWA 3ZDXF 5IHHA 1YY8B 1UVQB 3EOBA 2VZTA 4F9PA 1I1YA 5CZXD 2E9JA 2HH0H 4NQCB 4DGYL 3D8MA 4N20A 2W9EL 4LSUL 4OGZA 2W9DL 4AKPA 1U8MB 5GRYA 1MUJA 5BS0A 2Z92B 4Y9GA 4CVZB 1Z9SA 3WFZA 1EJFA 3OQRA 4XXDB 4CA4A 1Y18B 2PKDA 5G4OA 4MAYB 4E41E 2GSIB 3DK2A 4ELMB 1KPUA 5C6PB 3NN8A 3LKRA 3VFPB 4ZFOA 3WO4B 4NBYB 1SGKA 5HHOE 1QR1B 3I3BA 5AYTA 4XNBA 2G2RB 3DYOA 5HHPA 4Q2ZB 4F2MA 2PF6A 3MR9B 4Y19B 4ZS7H 5AALA 4GMSH 4AMXA 3DX2A 1YEJL 4M61A 2FK9A 3FFCD 3Q8BA 3K72A 3T3ME 1EVTC 1D2OA 5H4ZA 3LSOA 2P5WD 3DVIA 1UT1A 4DEUA 5C3TA 3MREB 1M53A 3L4WA 1XXDC 3OKKB 5I15H 3AAZB 4NHCL 4JZNA 2PW2B 4J3XA 2WV3A 3B3BA 3MV7E 3P73A 4L5FE 4P2QA 4DPCX 2WJ5A 5HVFB 2IALB 4ENZA 1KV3A 4I4WA 3BP6B 3HZKB 3MA7A 5D5MF 3EDKA 3R06B 2YEVB 1T5WA 2FE0A 3MCKB 5KVFL 5CJXC 2R4RH 3ATAA 2VLMD 2WLIA 1MW2A 1TQWA 5DJ8B 1R9FA 1X9QA 1ZRUA 5ICUA 5GHWH 1CFSA 3A47A 3B83A 3DPBB 3GSXB 1C1EH 1ZVNA 3EHBB 3R06A 3NT0A 2F8VA 1X5IA 3OSKA 4OM0L 5KW9H 1TF4A 3Q2VA 4GUQA 4D0CB 2YAHA 1NANH 3K3QA 4KZEH 1J8HB 3CK0L 3DXAA 4R5TA 1U8QB 4BSWA 3UZQA 1OT1A 4YEFA 2D7TL 1L9MA 1OGAE 3PXLA 1DSFL 1DVTA 3NCXA 4OIIL 5C08B 1UT9A 3NBNA 4GQ9H 2CLRA 3MODH 3ZOAA 4JDTH 2LTQC 3O11A 4AVHA 4NQVB 4MA8H 5GS1A 1NM4A 2B77A 4NO2B 1BQHB 3EYFB 4DW2L 3L9YA 4W4OC 2ZOKA 3QNXB 5MI0C 1JPGA 2C5DC 2OTWB 2X88A 3C5SA 4BFIA 2VDPH 1PDKA 3KLSA 4WHYG 1YC7A 4FD0A 4K94L 2HRPL 1MRCH 5AWNH 2R7EB 4LPXA 1NEZB 1DYZA 1H0DA 5KG9B 4KK9D 5DYOA 2XV2A 3ZBMA 3AROA 2JKWA 3EYFA 5BXFA 2C26A 2PCFB 5I8CA 1LLAA 2JKIS 3QFJD 4Y1TA 5J12C 4BSVA 4MBOA 3S34L 3JYCA 2C9XA 3ZMEA 2E9WA 3IFOB 4ZUSB 2H1PH 3UTTA 4NZDA 5D7LE 2WBWB 2MQ3A 3JT0A 3TCLB 1IKOP 4KPHL 3OKEB 4PY7B 3IAQA 4IBYA 4WWID 4RGOH 3MXVL 4JFVA 1P4IL 2Y5QA 3F7QA 3RNKB 2WHVA 3EO9L 2W59A 2C3VB 3DMMB 3FSVA 4OF6A 1MCDA 4AYMC 2NRDA 4NNXB 3BIAX 1FDLL 1JDCA 4G9FA 4QHUB 4QHNB 1F56A 3GIVB 4WWNA 4Y4KC 5F7UA 4MS6A 5TE7L 2QTEA 3H9SD 5DMKA 4Q7DA 2Y6SC 3VFMA 3VGAC 1GA2A 5E08L 1IGJB 3OKNA 4ANVA 4U3SB 5IB4B 2CPUA 3JWOC 4IHBA 2AAVA 4YPJA 4Y2DB 4I5BB 5T1JA 4L8SC 1I8MB 4OCSH 2PTVA 3UERA 4JHAL 2DS4A 3G6DL 2QPUA 2CNYA 5DJZB 1TVBA 2UVFA 4M9OA 5IBUG 2ZG1A 4XBEL 2ESVD 1SHMA 2ZXBA 2DZEA 2AKRA 2EO7A 3ATEA 1E6OH 3E2HC 1V7NL 3F62A 4G6JH 5E5MB 2DBLH 2G9HA 1JUFA 1RZ8A 1I7ZB 3FPYA 4V11A 3VACA 3EDDA 4J39A 3ZO0A 2AFNA 5FA4A 3IFLH 3CVCA 1R0AH 3IDMB 4K7PH 2C3GA 5H37H 5SWZA 1XMWA 5HDOA 4L8BB 4TL4A 1R3HA 4EZLA 1HHJB 1CF1A 5C9KA 2KBGA 2V2TA 3FONA 3SO3C 3QIWC 1F8TH 4PWEA 3MLVL 4NM4L 1K6QL 3NA9H 3BIKA 5JPMB 1H3PL 1DQKA 2BFVH 4JM2B 4RMRA 1OAJA 5DK2A 1OK8A 4U7MA 4ZTEA 5HHXL 5DUML 5KN5B 2QGEA 1JHTB 4KI5D 1CGXA 4H8HA 3ZKQD 5DJ6A 5JORA 1XAUA 4U33A 3QI9B 2KT6A 3VB8A 1MQKL 1CGYA 4ACPA 1LMKA 2DIAA 3DC0A 4IRJB 4PJHF 5TTRA 4C56E 4C8XA 3QI9C 3ZW3A 3Q43A 3RL2B 4EI5B 4JN1L 2AI0L 4K71B 4ALAC 2WLIB 1W72A 3W11D 3KPRA 1AGFB 1U2CA 5ALBL 1A65A 4UIKH 1ND0B 1E30A 3QZMA 4FZ8H 1UM5L 4XC3H 4PG9A 1WBZA 5GRUH 4J1UA 4PG2C 2I9TA 1MF2L 4F9LA 4MZRA 4TUJA 1ASOA 4U1SA 5GRXG 4FZ8L 4RQQA 2OMVA 1ZSHA 2CJUL 5F96L 5FYKL 2AF2A 3PWUB 1G7IA 4I2XA 4DIXA 1T0NA 1QYGL 1FCGA 4GUPB 1MXDA 2TSBA 3APCA 1FZJA 3LQAH 4AV5A 3EGDA 3EJPA 2PW1B 4QRTA 5JXAH 1UD3A 1U8CA 2FSEA 2RAMA 4E42B 3KLAB 4L9LC 2CR6A 4FFVC 2X4UA 1G1KA 2XJLA 4Z95L 4K4KA 5I28A 3FQXB 1GGYA 1T03H 1TZHB 2XWBB 3GF8A 4Y4HB 3VFOA 5FHBH 1NGYB 3LY6A 1T7YA 4NKIH 1MEXH 4ZTPL 3PLYA 3QULB 1CDHA 5GZOA 3QIUD 2XN9D 3H85A 2J57A 2NNXA 3AACA 1KPRA 2Y5TA 4TVUA 1Z3RA 4UB0H 3VXRB 2RCSH 2E7HA 1EZSA 2FH6A 2W60B 2VDOH 4UYQA 3UC0H 3ZSTA 4XP1L 5JO5A 2UY6B 1HN1A 2ZWSA 1FO0H 3RWFA 3TNNA 4PQXA 1KSRA 1A64A 5KVEH 5FB8A 4P49A 4XCFH 2E7MA 3C6LD 2HVKA 1WK0A 3U4KA 1MFCH 3KYAA 4L0YA 2XWRA 3U2JA 1IGMH 3D51A 2ZOKB 3QNXA 2HFFA 5L8LB 1BVNT 3EUDA 1ZEAL 1MJ7L 2KQNA 2AV7B 3MV8D 1SM3H 1BM3H 4F1SA 2P5PA 3R0MA 1IC4L 5DD5L 2K7QA 3UDWC 4A2MA 3KM2A 1TJHL 3MTXA 1NMCB 1LVEA 2NX5D 4QRSA 5HDWA 3D87B 1XL6A 3A67H 3HBGA 1CFTA 4EKXA 4P5TB 4FCAA 4QF1B 4AGNA 1QLEH 5DHMC 4K8RH 4Z76A 2VXQL 2VDML 2OR9H 2CJSA 4M93B 4HG4J 2AXGA 1IGFL 4QKTA 1FDLH 3KS0J 3VGHA 2DMGA 4MDIA 1PZ3A 1SEQH 1UUNA 4LGPB 4U1NA 4YSTA 4OM1H 4A2EA 4CRPA 1I8KB 4V1DD 2VDKL 3OMAB 5F9DC 12E8H 2ZYIA 4A39A 3HRZA 4AQ8A 4E0RB 1SMOA 1KYOJ 1KN4H 4OZHB 3F5WA 2OSWA 3BW9A 3DKHA 1TITA 1MCLA 4MJ5A 1D6EB 4PJXA 2P42B 1KTCA 2J88H 3T6XA 2VDLH 4I89A 5CGBA 3DO4A 3UBXI 4L5FL 1F58H 25C8H 4DO6A 5ELIA 4G83A 3GXIA 1TEYA 5CGYC 4YDJA 2MIZA 4GRMB 2Y9RT 2ENJA 2F7IA 5F3BA 5H2BB 1U36A 4KJPC 5A7BA 4M56A 4R9HA 4RLDA 3T6WA 5KN5A 2GTZA 2NW3A 4UQ3B 1AD0B 4OI8A 4RAUB 2VC2L 1C5CL 1WZAA 3ULSB 3QO1B 5C0AB 3CDFA 5EIQA 3LEVH 1E6JL 5FFOA 3SDDA 1QLFA 1OZUA 3QRGL 3MAWA 2Z6FA 2WSDA 2C9AA 1AZCA 4L8BA 1K3IA 5JDSA 4KXBA 4Q97A 4YL4A 5JOPE 5EU5B 4X7TB 2EXWC 3QPKA 2CHZA 3LH2H 3O3AA 5DA0B 2CSPA 3FCGA 1P6WA 2YSSA 3BKYH 1T0OA 2EDEA 1RUMH 2V7NA 1DQDL 3D06A 4PRNB 1U8NB 1KCSL 3PP3K 2AJUL 4Z7OF 4L2YA 2CDFB 1TG8A 4Z95H 1ZVYA 1FN4A 3EH2A 3JVGA 3O6LH 3BUBA 4QT5A 2K3HA 5IW6B 1IEBB 2DB8A 4H8PA 1SN2A 4TOYL 2JJSA 3FYEB 4W68A 4CMMB 1NFDA 5I1KL 4YDIL 5B7EA 1QYGH 3ARGD 2QTVA 1XR9B 1D6VL 2WIIB 4MMYA 4ZAKC 4B41A 2A4ZA 4IBWA 4X6CA 4FYQA 1XGTB 1E90A 4PJHB 4BDVB 4PW4A 4RSYA 5I1GL 3ZE0F 4WI0A 4PBXA 1ZLUK 3TV8A 4YWGH 2PR4L 4YHPB 2JI3A 1WGVA 3ZVVA 1QBLH 2W9LA 3FTUA 3LXUX 5T3XD 1D7BA 1WFUA 2WBJB 2VR6A 4KK5D 5BUAA 3B43A 4B5ZA 4Y5XA 2J2ZB 4PJ7A 3HS0C 4FDWA 2IOOA 5C70A 2D3JA 5LBSH 3UTPE 3IB4A 1I9EA 5JW4N 3UGEA 3EH3B 5IROC 1TKWB 3ILQD 3L1FA 4WQOA 2B9AA 3T8XA 5FO8B 2ICWB 1U3YA 4OZGE 3PFUA 1MQKH 1QO3A 3CVIH 1MCOL 3AU0A 3HS8A 4N2HA 5TDPA 5DD3H 4F7EA 1HHIB 1MWAA 2X44D 5HYEA 3E7JA 1YMHA 1ZT7B 2N7AA 3G08B 3OX8A 4UM8A 5D1ZC 2CA4A 5D2LB 2WWNA 4LLMB 3VXUA 2BFVL 1PZUB 2W0FB 1NWPA 4JJOA 4UQDA 3NFPB 4TSCH 5KS9A 4JBSA 1DVZA 3QARA 3ESOA 5TDOB 1KY7A 2AJYH 2XQYA 1KPRB 2V9UA 3BZDA 3KHQA 4Q56A 5FW6A 3HAEB 1HH6A 2XUWA 3IFLL 4X9IA 4U31A 5FDWB 4OT1L 5D1QC 2HJFB 1AO7A 8PAZA 5LJYH 1BQKA 3AY2A 1NCJA 4X6BA 2EZ0C 2LW3A 3JZYA 4H5SA 4KVPA 2OLDA 4Y5VA 4F93B 4G11A 2DQFB 1NAKL 1SRDA 1QFHA 2J55A 2EH8H 1R3JB 3EG9A 4HBCL 4KHTH 1KIQB 1U6AL 3WLWC 3V4UL 5BV7C 5GRVL 4WHTB 2IH9A 3EZJB 3NP4A 1UKQA 3TVMD 5AOLA 4XHQA 5FM5O 2BVPA 2FD6H 4NIKB 4P46A 1LO2H 5C09D 3IGUA 4XPHL 1PU0A 1JN6A 3DVGB 4NQCE 5IQ9A 4LRNH 1CCZA 5A2LH 1CQKA 4CNIA 2AV1A 4X9YA 2NUPB 1VF5C 1MFDH 1B6DA 1NGZA 5E7FA 4NUGH 1BD2A 1KLUB 1YEFH 1ZA6A 3RY6C 4F57H 5BO0D 5ID0A 1TZIA 3H55A 3O3AB 7FABL 3CN0A 3F58L 4HUNB 4F7MB 1P4IH 1G6RA 4K3JL 3H2PA 1M71B 3H9HA 5EMYA 2X0WA 1NQBA 4GEIA 4NP9A 4BWWA 5I26A 2FEEI 4NLAA 4NS0A 3CFDB 2BCKA 5DSCB 4ODUA 3DPDA 3SDCA 2FHFA 4Z5RA 5DJDB 1M6OA 2AEQH 4Y5YC 4I0KA 1EFXD 4L8SB 3QIWB 2WXRA 1OB0A 3C8DA 5IVXF 3AQXA 1R46A 3MGOB 4YX2L 4NQDE 3HG1D 2KZ1B 3BZEA 2BY2A 3UYRL 3PWNB 2VZOA 4KK5C 3JZ7A 2J12B 3GSXA 1DDHB 1AYOA 3OMIB 2A7BA 1XGZA 2YPLA 2ID5A 5CHNB 1R3IH 2XICA 3SZ6A 4FQXA 1U3HC 3OR7B 1QLFB 2D7TH 5AD0B 4GAGL 1MRFH 1L6PA 4GH7B 1JNLL 2BC4A 5BW7A 2Y72A 4LCUB 5GSVA 3MCG1 4UYPA 2Y69B 3O9WD 3QFGA 2XG5B 3W2DH 1IGIL 1MJ8H 2EVHA 4PB9L 3BH8A 4RMWA 3N1QC 3GSVA 4L4TE 2X89A 2JCWA 3LDBC 4FFYL 4JUTA 5FGSA 5I1LA 3HE7D 3EO1A 4RZCA 1QVOA 4JRYA 4QOKA 4F2FA 3VD0A 2MCMA 4H20H 3TLRA 1CXIA 2JKRM 4HQQH 4XWGH 3RWDB 3VXMA 3CLWA 2X6BA 4Q52A 5GRZA 1CICD 5KBPA 5I0YA 3CX5J 2ETWA 4JZOA 2AKRB 4GAFB 4F15C 5T3XL 3D3VE 3S37L 4PRAB 3L8QA 5C0CE 4JLRB 2ZX5A 3HMXH 5DD0H 4NGHL 3CZNA 1YN7A 1NBQA 3CGTA 4WV1B 3Q8CA 2W60A 2XVGA 4KBPA 2A73A 4P2CG 1LE9B 3U82B 5AL0A 2CUMA 4UM9D 1Q9WA 4ZPVB 3BSZA 4BFBD 2GJJA 2O6FA 3CTTA 1RURL 5EO0B 2WCPA 4TNWK 4ZX5A 3CN3A 1GPOL 2ISDA 1OSZA 3EJYD 3L81A 3SEPA 2BZ7A 3T0EC 3APMA 1OSEA 1QFWH 2BHZA 3DX8A 2BVQB 2PP9A 3OKLA 4J23A 2VZUA 3QAZB 4JDZA 2IFGA 3QPXL 3DHJA 4HEPG 4UQ2B 1HJCA 5GGVY 1B0RB 2OR7A 4PRIB 4ZMPA 4GRLA 1YNTA 3ETSA 3QRBA 2NYYD 5IMLA 1PIGA 3HZMB 5TH2B 4MZ2A 1MKFA 4AXWA 4J3WA 4R0LA 4M1GL 3ILPA 4YC2B 3VX0A 4U7KA 3DGGA 1ETB1 3KPTA 2C9SA 4KKAD 1MHPL 1O6SA 4AKOA 3TV3L 2F19H 2Y2YA 5H37A 2A4CA 3WNNA 2ZUVA 3JYBA 2VCOA 1SXBA 3AWFA 4X98A 3AVEA 4EDWL 1E9PB 3U30B 3DOSB 1H8OA 5GS1C 1W0WA 3DDGA 1KXQA 3VXNA 4K94C 2X70B 3M8OH 3GTVA 1S9VA 1QEXA 4JJHA 5F1KC 4R7XA 5EO9A 5EC2A 1LO3L 2BVUA 2NY5H 1N7ML 2FL5B 3QDJA 4PBVC 2MNJB 2JCCF 2VDOB 5EU6A 5DD3L 3IKCA 1KGYE 5ES4B 1KZQA 2WJ7A 5HGGS 3MCKA 5I2IB 3K1KC 3KPPB 2IPUG 1TFPA 3BGMA 1SBSH 2CHNA 3ILEA 4LDLB 5DJ6B 3D50A 1N0XL 3RKPA 5B3JE 5C2BH 5J11C 3NZSA 2CR0A 2XRAH 3AM8C 1OLLA 2APWA 2H26B 4YDMA 2HFGH 4MLIA 3MBEC 1PVHA 3GNMH 4IYKA 3FUFA 5KBLA 1IO4C 4JGMA 1C5BH 2P8LA 4F58L 1F41A 2WIIA 1UQSA 3QXTA 4HUCA 1CFVL 1NDGA 3WTVA 4YHLH 3VFNB 4H8UA 1KLGB 1RCYA 4HALA 4N9OB 3T6VA 4LBEA 4F5CA 3PDOA 3EJZC 4Z7AA 2VDKB 3JWOL 3ZK0A 3MRBB 4JFHD 3M1CA 1INQA 1J1OL 1JSYA 5EUOB 1PKQB 4HS3A 1U8NA 2LLLA 2QJDA 1FQ9C 3V0WL 1OB1A 1HZKA 3SGDI 1XBRA 1BAFL 1EX0A 2C3WA 4ONGL 3II1A 5DJYB 1OTTD 1UOLA 4NKOB 4DZ8B 4YGAB 3WEBA 4PW3A 4JFEB 3JV0A 4MMXB 2X87A 4LHQB 1FRGH 4LSQL 4H1LH 3SYOA 4UZUA 4IHOB 5JHMA 1FYTA 4LZKA 3RVUD 4WI2A 2H7WA 3W56A 4ZBJA 2YEZA 1D5RA 5DEGB 4AYFB 4R2GD 3P3YA 5FLVA 3MZGB 1ZJBA 1QSEA 4OFYA 4Q6IA 3APFA 2APBA 4LLWB 4NQSB 3UJIH 3CHXA 1XIWA 2BW5A 2OJEB 4KZ0A 4X9GA 3X11B 2MWCA 4MMZB 2X4SB 2WLNA 2APSA 2VC2H 1N59A 3TN0A 5D7KE 1RU9L 3E0GA 2K45A 3LZFH 3CBJB 3TOPA 1UOWA 2ADJB 2IWKA 3GIZH 1GGCH 4J3OD 2HX9A 5DMKB 5FO7A 1N59B 1KCUH 3H0TA 4JE4B 1SOKA 2HTKD 5AFAA 6FABL 3ZE1F 1BPLB 4FNTA 3ALXA 1FZKB 2Q2EB 4N6RA 2BSRB 2EYRA 4LNVA 5F7DB 5AVRB 4WNSA 4KDVA 1TQTA 3RNQB 4FG0A 5HD8C 4HIEA 1T04B 4OVVA 2CLZB 3CFCH 3FUKA 5EPMA 3BEVA 3S8FB 3R7RA 1SEQL 2OQJB 3K2UH 3AWEA 3A23A 2W92A 4XXCC 2X7LA 1BGXH 1G7HB 1MH5A 3FB5B 1PZSA 3ARED 3B3IB 5DS8A 4KXZH 4X4MA 1THCA 1I1AD 3SY0A 5D2LE 5DQDH 1HKFA 5IT2L 4D0DA 5E9NA 1S7XA 3FU5A 4YDVB 2Q6WB 1NUNB 3CPLA 2Y24A 4GSDL 5BOPA 3CSPA 1HESA 5IOPB 3O4LB 4NZTH 4QHMA 5MEND 1IFHL 4XVJL 1OP9A 2D3LA 2LFGA 2RMNA 1IBHA 1BQHA 1WAAE 1FG2A 5CP7A 2EXSA 1KN2L 2C3HA 3G6JB 4N90E 4QHLA 1WBXB 5EZOL 1JZEA 4NZRH 5IESL 3SGJA 3SE8H 2HYMA 4P2RD 4HS8H 4EOWH 5KVEL 5EF1A 2QLVB 2Y7LA 1HT6A 3TA3D 3G7TA 3OZKA 4JCWA 2NY3D 2ZP0T 3UZQB 2F54D 5F7WC 3MRJA 2YUVA