2YYOA

Crystal sturcture of human spry domain
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
160
structure length
160
Chain Sequence
SGFKHILVDGDTLSYHGNSGEVGCYVASRPLTKDSNYFEVSIVDSGVRGTIAVGLVPQYYSLDHQPGWLPDSVAYHADDGKLYNGRAKGRQFGSKCNSGDRIGCGIEPVSFDVQTAQIFFTKNGKRVGSTIMPMSPDGLFPAVGMHSLGEEVRLHLNAEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal sturcture of human SPRY domain
rcsb
source organism Homo sapiens
molecule tags Structural genomics, unknown function
molecule keywords SPRY domain-containing protein 3
total genus 33
structure length 160
sequence length 160
ec nomenclature
pdb deposition date 2007-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00622 SPRY SPRY domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.920 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2yyoA00
4QT6A 4B3NA 2FBEA 3KB5A 4P9JA 2LM3A 5JI7A 3ZO0B 4N7UA 4B8EA 3TOJA 4WVMA 4X8PA 5C33A 4KG0A 2VOKA 2IWGB 2E63A 4P9IA 5F6LB 5JIUA 4N7IA 2YUEA 2YYOA 5JIAA 3UV9A 4X8NA 4XW3A 4WVMB 4P9LA 5JI9A 2WL1A 5F6KA 4V1PA
chains in the Genus database with same CATH superfamily
1JOJA 4J25A 4QT6A 4XURA 1LTEA 1FOD3 3O1OA 2A6WA 3OUHA 4KWUA 4RL7A 5A7NA 5FZ0A 2WJSA 1RXFA 2G9ZA 2ET1A 4P9GA 1HRV1 4XZUG 1NZIA 5APAA 3KT1A 2HWD2 1ZZ9A 4YLZA 2VMGA 1RUG3 3MF9A 4QMAA 1G86A 2BUKA 3VL8A 1CONA 1HQLA 2ES3A 3N9MA 2RJLA 5D8AA 4A42A 3LF7A 5JSRA 2PELA 1KITA 2XGXA 5IVVA 3ZSMA 1HRI1 1WW6A 3WDVA 1VAVA 1DQ6A 1DQ0A 2ZGOA 3S7IA 1NLRA 1JHNA 3M3OA 4IE5A 5LBBA 5A6ZA 1SG3A 3I2OA 2ZGRA 2F6BA 1KRIA 2AEZA 4DRVA 3HQRA 5E88A 3ZYRA 1Q5OA 4FPFA 3T0AA 4YW1A 3HMYA 4HXCA 4C90A 1LESA 4GB32 5A3MA 3V0AA 1CPMA 3WNNA 4Q4V1 3O1RA 2F17A 1EAH3 1OA3A 2ZOEB 1OFSA 1XOYA 4IV3C 4CDXB 3C7GA 4D69A 4BWOA 2E32A 5CFDB 5FZCA 2ZABA 2IWGB 4CCEA 1AJOA 5FYCA 3GM8A 1LHUA 1BMV2 4FO9A 3POWA 2Q8CA 4EV0A 1O7FA 4GH4A 4NROA 5HCAA 2JB8A 4Q0VA 3CF6E 3VZJA 1N1TA 1KS4A 1R1A3 3NWKA 2X5IB 3QCWA 1VBE2 5FTTC 2DURA 1EAH2 3IDBB 2AYHA 4OI4A 1ZZ6A 2R0HA 5DN2A 1HXS3 4BJ0A 2ERFA 2VCAA 1SPPB 1UPIA 3MDPA 1UYPA 1V9U2 5F3IA 2ZX4A 1DGWX 2DCTA 3MF6A 2OVUA 5EFUA 3TWIA 1AR81 3SQOA 1V6JA 4LBOA 2DFBA 1LHNA 2A70A 2R32A 1YO8A 1PO12 2D5HA 3NJZA 1WW4A 5CFDC 2BDRA 1YJLA 5ANNA 1CGPA 4HPKA 1CPNA 2ZGTA 3VDDB 5KC5A 2ZHKA 4GA9A 3EO6A 4JDOA 4Z82A 4AI0A 3WZ1A 1NCRC 1RVF3 2OX0A 4LHLA 1Q8VA 3PNAA 2ARXA 3CU7A 3DYPA 4DQAA 3NKGA 4ZU4A 3CO2A 1A8MA 4LKFA 4F7ZA 1UNBA 3RQ0A 4YWAA 4YG6A 3WW2A 3VZLA 2B46X 4ET7A 3LEIA 4N9IA 2YY1A 4CVUA 5C70A 1MPXA 2RS11 2PHRA 2WA3A 4QX3A 1PNGA 1QJY1 4MXWB 4GWMA 3RJRA 1CAWB 4MX3A 4W8JA 1G9BA 1VAKA 1DZTA 1MS1A 5FZ6A 4NAMA 4TWTA 3ZN4A 4CCLA 2WC2A 4NIHA 4RA0A 2B39A 3WX5A 3WW3A 4M3CA 4CUBA 3PL0A 2JIJA 1YUDA 1CESA 5D2AA 4MOAA 4UWDA 4E4ZA 3UJQA 1PGL1 3KSCA 2CAUA 5DAPA 3VBUA 4W4ZA 1MQTB 4IQPA 1CAXA 3IM0A 4QB2A 4LJHA 5J98B 4X8NA 1CD3G 3SC7X 4HONA 4NR1A 1ULCA 5FO7B 4AOCA 1S0IA 2WZ8A 2OPWA 2P34A 1K5MA 2EAKA 3ZKUA 5A7QA 4AFAA 3WNPA 4PBPA 4J1XA 1WD4A 2D5FA 3PUSA 1WCKA 2P3KA 4TZDA 4MV2A 2D6LX 3VD4A 3CHXA 4FXKB 1QY4A 2JDPA 5CYYA 2VTFA 4Q4X3 2CDOA 4PLNA 3WCSA 3V64A 1Z7S1 4AVTA 4QXKA 4Q8LA 2A6XA 4H14A 4Y26A 4GXLA 1I1EA 2D6NA 5FP4A 2UU8A 5J36A 3HWJA 1IS6A 5I8TA 5F8PA 1JUHA 4DUWA 4IE6A 3SHRA 3OCPA 3ZXEA 1JYCA 4ZXEA 3ZR5A 5F5IA 1SLTA 1ZZ8A 4N8MA 2XLAA 2WSUA 3J8F2 3PTYA 3RDIA 2PAKA 2DTYA 4QQLA 1UIJA 5CISA 2CGNA 4NHKA 2B45X 3A22A 2ATFA 5GZCA 1ASJ1 4FFIA 4IL7A 3UGGA 3ZXLA 4JGZA 4BM8A 1BYHA 1U5ZA 1DYOA 2BP6A 4X6RB 4AGRA 4QDSA 4XE9A 1GKBA 2RMU3 4ZXKA 1NA1A 3VBHC 5JXHA 3HT2A 4RS5B 3ZFGA 4LBLA 3ZYHA 3LEMA 3MIHA 4WVWA 5FDBA 3EMRA 2ZX0A 4BMBA 4BQWA 1QDOA 2VW2A 5IYYA 3ELNA 5GZEA 2XJTA 5A7OA 3I49A 1OI6A 2FHRA 2BWAA 4AXOA 1F15A 1MVEA 1QHDA 1ZM1A 3ON7A 4RR3A 5EYXA 3IDAA 3ZYJB 5BY5A 1MQTA 2HEYF 2HWF1 3H42B 5EJ1B 3WT3A 4AQSA 1TME3 2P4EA 1XQNA 4IV3B 3WVJA 3KZ4C 2OA2A 2XJVA 4BQYA 3KV6A 3MW3A 2YHJA 4YW7A 3ROUA 4CDUC 1MS3A 2AUYA 5JZGB 1GP4A 5FOJB 2ZZQA 1PGSA 4AFCA 3SKVA 1QWRA 3KD4A 4XJUA 4SBVA 5BPXA 1HQNA 4KI5M 3MO4A 3W20A 1ONAA 2P3JA 3ABZA 3ORJA 3RVHA 5JLVA 2VBDA 4ES8A 1REFA 1WA6X 4CEWB 5ACA3 5HCHA 4LKSA 3OPWA 3DYMA 5L9VA 2DV9A 3AXEA 2OS2A 1B09A 1W8TA 3IMMA 4BQXA 5EQUA 4QPWA 4AF9A 2JICA 1H2NA 1X9PA 2WQ8A 1GNZA 4GB33 5C8CC 5CB7A 1UAIA 2OZ6A 1ZREA 3ACLA 3OGGA 5FY1A 2WNVC 1H8TB 2ZGUA 4NPRA 4IEOA 4RQPB 3SH5A 1BBT1 1W9TA 4LA2A 4ARXA 4FPEA 5BYNA 3KVAA 4JGYA 3H7JA 1VR3A 2CSGA 1YFWA 2AGSA 4RD7A 1UX7A 1O4YA 2WO7A 4DY5A 2VQTA 3NNJA 4LNVA 4AW7A 1W90A 2GMPA 3WQ7A 2B9VA 1I9RA 3TN93 3BTXA 2UYBA 1V00A 4Z07A 1PK6B 1COV2 3T1MA 2YDEA 4IEVA 5FPAA 3OGSA 1Y7BA 2EXJA 4N7IA 1IS5A 4FP3A 3P3NA 4V2WA 3SEPA 3ZSEA 1WLTA 4C91A 3NVCA 2ZTNA 3W9AA 1JS9A 5FPUA 2EAAA 2MEV3 2VNRA 3LSEA 4YZ4A 5FWEA 4BQ2A 1D4M3 2GN7A 3LOBA 3S7EA 3IDCB 5FFOC 2XHKA 3KV4A 1F5FA 2BWCA 2QQKA 4JX0A 4NWWA 4PQ9A 3JZVA 4XBLA 3I3EA 3ZR6A 5BXXA 4K8FA 4DRRA 1WLCA 3PIGA 4BXSV 2BEOA 1DU3D 2PHFA 2NMOA 4LEJA 3AKQA 4LO8A 2PTMA 1ZBE3 3I54A 4A44A 1C8M3 1E5SA 4FPYA 1LOEA 2YGMA 4B4QA 3ITQA 2E31A 2DVBA 4UFHA 1O6UA 3WW1A 2JDKA 3LCPA 3HNBM 3U4XA 3JBG3 3LEGA 2WNVA 3IPVA 4JKMA 5FYTA 2R0FA 4LLFA 3H3LA 1ENQA 4PLOA 2VNOA 4BISA 2QZ3A 5KXCA 2VUCA 3ES1A 3WHTA 2KA3A 5FZMA 1B35A 1R1ZA 4QKDA 4DXZA 1US3A 3GZTB 4YPJA 2ZJCA 2VUAA 4E4SA 2PFWA 1OD3A 2TNFA 4PF1A 3RZHA 1W6PA 1GOHA 5EPAA 4M4PA 3U10A 4B3NA 4Q5OA 4NHYA 5M0TA 1VE0A 2DCYA 1R083 4FPJA 2HWC2 5KXEA 3I59B 4ITCA 3VDAA 4EJRA 5LY1A 2WT0A 3H8RA 1RUF3 2ZMNA 1RUJ3 5JXJA 1MZFA 1UW8A 2VZUA 5E6HA 3UESA 3B9CA 1W0PA 1WLWA 3K51A 1DGRA 1L7RA 3GHMA 5C7GA 1S1AA 4NPLA 4V2VA 4O9GA 1CWPA 2MPFA 2AC1A 5EJZB 1OSGA 2EVXA 2GC1A 3A0NA 1SLCA 4UFKA 1ZBE2 1JBCA 2Z79A 4CU8A 2GH2A 2JDHA 3ZYPA 4DMIA 3IT8A 4FAHA 3H9AA 2WDBA 4YM2A 5FWJA 3G6JB 4Q4Y2 1MZ5A 1X7NA 1W9YA 1QJX3 1SLLA 1UD1A 3MLLA 4PDWA 1JZ7A 3VBSA 2RMU1 1DDLA 4XUQA 4JHZA 1EPZA 4Q1RA 4A7KA 5BNNB 1JOBA 2WS93 5DPNA 5AC92 2WS92 4YW4A 3S5AA 1SLBA 3FJSA 4NPMA 3HPNA 1UU5A 2HJIA 4NHMA 4XUOA 2CYFA 2YBSA 4QXBA 4S2HA 4WV8A 4L97A 4Y1YA 1LECA 5C3RA 3VBSC 5LK7B 3U14A 1BEV1 1PIV2 2I07B 2RS33 4UBHA 5T5LA 1WBFA 4BYYA 4YW5A 3RYRA 4RHV3 3MLJA 1GZ9A 3N3HA 1U5YA 2GSYA 1NUKA 1VBB1 3ILFA 1OHFA 1AUYA 4FPOB 3SCHA 3K48A 1AR72 2WQ4A 2V5YA 5LEKA 1JYTA 4Q26A 2YROA 4KH9A 1SLAA 5DG1A 4CEYA 1W6QB 2O8QA 3SCGA 3HT1A 1QKQA 2WSVA 5CIRA 3BU0A 1YFUA 2ZPXA 3OPZA 4JQTA 5F6LB 4A7ZA 1ULFA 3EJKA 3K3OA 5HV0A 4HANA 3MIBA 1X9TA 3U37A 2HLEA 1W2UA 1NQDA 5DZFA 2FD8A 1UYYA 1H30A 4L92A 1RHI3 1O3SA 3AKSA 2UURA 3BALA 4JKKA 4URAA 4UOJA 1HRV3 5A33A 2RR12 4FPKA 1SMVA 4H7LA 4LA3A 3BVCA 5AVPA 1RUC1 1JU4A 2G4IA 3T3YA 1MEC1 1OLMA 4S2DA 5CAZA 4GWIA 2VW0A 4P08A 1HB4A 1QQP2 2FMDA 2WYSA 4BK4A 2QQJA 2GP3A 5FIXA 4C8DA 4R52A 5G05L 3VKNA 3USSA 4KNCA 1Z78A 1ND3A 4QX5A 3K4AA 2D3RA 2RS52 4D7SA 2RJ2A 3B69A 2ZGLA 1OH3A 3HVDA 4AQ2A 4OHZA 1W8UA 2R062 1UOJA 4N53A 2D6OX 3NV1A 4WM7A 2J1RA 1RUG1 3WG3A 1QOSA 4ONUA 2XBO3 4XQ4A 2PQQA 1NYWA 4YZ1A 3I3MA 1JI6A 5DDJ3 1LHVA 3VN4A 1RXGA 3B00A 2W52A 3THDA 1IQAA 2H6CA 1AL21 2UWCA 3KF3A 4XFBA 4TN7A 4O9EA 3N35A 3ZYBA 5KHIA 1OF4A 3GBGA 3WDTA 2BNMA 4HVOA 5B4NA 4XJ8A 4JV4A 3KGZA 3NSTA 2WRAA 2HWE2 3ZYGA 3J7LA 5HCFA 1X36A 2RS13 1AHSA 1GQPA 1LU2A 2E63A 2P6HA 1JOPA 2RS51 1PMJX 2WAAA 3VZMA 4E4HA 5JIUA 3HQXA 1K5MC 3M8LA 2C26A 2DUOA 3CL1A 5EZWA 1OLME 2Y8KA 2ZMKA 1LJ7A 3AXDA 5JMOA 2B4KA 3LDKA 4DOUA 1VBD1 1QQP1 2LS6A 1CQ9A 2QDRA 1MEC2 5L7OB 3JBG1 4LO4B 2F4LA 2BW8A 5I93A 1N3QA 2W68A 3LSDA 2RR11 1OD5A 1ZZBA 2R041 3VBUC 2NM1A 4W6XA 4AG4A 3N7MA 4LBKA 1N47A 3ZFFC 1W03A 5JMCA 1HXS1 4MGTA 3PDQA 1Y4WA 1NCQB 1PZ9A 4Y33A 3R4SA 5A32A 3POFA 5K0UB 3AYAA 5L73A 2VPVA 3VKMA 1L7LA 1RUD1 4P5YA 5JR2A 3LEKA 4OQ8A 2AZ5A 3K4DA 1VB4A 2E7QA 2W39A 2HH9A 1GYKA 2BGOA 2ARCA 4AVBA 2OZJA 2R16A 4Y1VA 4EQVA 2VCBA 2UY9A 3HJRA 3VD7A 4CUGA 2R071 1DYKA 4CDUA 1OA4A 1RVF1 5FMOS 4HVQA 3VZNA 4AVAA 2DVGA 4JZRA 4X6QB 3GDBA 3MBWA 4CE8A 2HWD3 2JIGA 3MPPG 1BEV2 5SV5A 4QU1A 4GALA 1MZEA 3OEAA 1Q8OA 5DZGA 4CDWC 2VL4A 5HV4A 4IEUA 4YVSA 2Y38A 4RR3C 3O1TA 1NAEA 4ASMB 4ASKA 3W5MA 4ZONA 3KVBA 4MGSA 4QM8A 1GZTA 4AHZA 2WS91 3KHBA 3ZFEA 3DV8A 4Q29A 2DBIA 2GDFA 5GLZA 5FOBB 1RJ7A 4UFLA 5FO9B 2XQRA 1YXWA 1CIYA 5FPZA 2WN2A 3H8XA 1CIWA 3FE5A 3INAA 5AFBA 5F37A 1RITA 1UU4A 1FPN3 3M4FA 4BCUA 5GJ6A 5HXMA 1NCRB 4PF5A 5JZGC 2PAEA 4Q0UA 4KBBA 4GH4C 5FQ0B 1MS8A 3JQWA 3ZVXA 2WBKA 1GU3A 1W8HA 2Z5WA 4WVVA 4DEQA 3VHOA 4CUAA 5JSOA 3AMQA 1MS9A 1Q43A 3VZKA 4HOOA 5J1XA 4R8HA 4XYXA 3FWEA 3JD72 2PHTA 2QQMA 1GSLA 2ZBJA 5FLHA 3NV3A 1SBEA 1LR5A 3Q8BA 4B1LA 5E16A 2E51A 4UW4A 4RGGA 2IXIA 2XQXA 3D5OA 4KWJA 4JKLA 4YG3A 4AI3A 4JTNA 3GZUC 2G1MA 1AR92 3OY8B 1GOFA 1JYWA 2X5IC 2GU9A 4AEDB 3WSOA 4E8DA 4QX7A 4CU9A 4IW3A 4RFT0 2BRTA 4CDWA 2DBNA 2QQPA 2RDQA 4XTMA 1QXJA 2VZSA 1RUC3 3FUOA 3WNOA 2GMEA 5FKBA 5F1RA 2FDKA 4COZA 4CEYC 3JUUA 1OPMA 3URFA 1VMHA 5FYBA 5LCWL 2JE7A 4META 2XVKA 1REDA 1US2A 4HK9A 1S2EA 1S0JA 5LRSA 3KQRA 3M3IA 3IBMA 4XXPA 4FCAA 3BGAA 1CAVB 5A7SA 4Y4YA 4A3ZA 4H7MA 1HB3A 2FMYA 1LCLA 3GNEA 4MLOA 3POIA 4AFBA 4CYDA 2JDYA 1QEXA 4YVSB 2NN8A 1W6OB 1OBNA 4E2GA 3NMBA 5FP3A 2LM3A 3JCIA 5DDJ1 5A7WA 3WF0A 1HRI3 2VQAA 4MGKE 3PUQA 4ZU5A 4WZFA 2O0OA 1LU1A 4D7TA 3E6BA 4QPGA 4OI1A 4XF1A 1QH7A 5C6CA 2LROA 2JKBA 4HKLA 1CN1A 3DL3A 4NMIA 4UT5A 5BNOC 2RDNA 3OYWB 4XCBA 1XNKA 1RUOA 2XONA 3QH7A 3V56A 5GZDA 3H3ZA 3T2QA 1AR91 1OOPB 2ARBA 5EV7A 3VD9A 2EIDA 2ZXQA 4OCTA 5F6KA 1FYUA 1I6XA 3QACA 1QOTA 4LXLA 2VTXJ 1ZBA2 1E57A 3WQ0A 4QX0A 4E2SA 4QGMA 3DPRA 1AR73 4PBOA 1PVC3 1XE7A 1YRZA 2P3IA 2VXJA 3A0KA 2ZX1A 2YXSA 3AZZA 3OUIA 4IEXA 4R9DA 2VD7A 4XTPA 4M3CB 5I8SA 2PAMA 3ZXFA 1VMJA 5FRAA 1JH5A 1IS3A 1AX1A 1QJEA 5F3CA 4CUCA 4AEDA 3B93A 4QU2A 2W46A 5T5PA 1U12A 1CR7A 5IK5A 3Q8CA 3C8XA 3M7AA 5FZGA 1B35C 4PJYA 4UW6A 3B9IA 5FZ1A 3RZMA 2JENA 5LWBA 1FPN2 3AP5A 4CU6A 4DFSA 4GD4A 4N53C 1PGW2 3CZJA 4BB3A 5FZHA 1BBT3 3BCWA 4UAPA 2W94A 1XNAA 4PIZA 4Y20B 1IS4A 3I3BA 2JG9A 3KCXA 4F8AA 4Q0QA 1RMU1 3KGLA 4MADA 3LA3A 3UYJA 1AJKA 2PA7A 3FX3A 3O0VA 4W6YA 1W9WA 4XZPA 1TVGA 5CBLA 4BQ4A 5FBZA 4AGGA 1RVF2 1W6OA 1X33A 4HFSA 2YC0A 4XC9A 3LGRA 2CY6A 2YB7A 2FCVA 4IV1C 1F31A 1NX9A 3J7HA 5LEJA 1YEWA 1DFQA 1L7QA 3NV2A 3OSDA 3WNKA 1AYM2 1H8TC 2YPDA 1G6NA 4LUKA 4AVVA 1OVSA 3IB3A 2PXJA 3LIGA 1W2TA 2QFEA 4P5HA 2RM21 5JXIA 2Y6LA 4B4PA 4YM0A 2WNEA 2XUEA 3FLTA 3AP4A 1H2LA 3NAPB 2P17A 3PVNA 4BH9A 2XLGA 3EXUA 3RMXA 1BHGA 2BOIA 1H1IA 2K9ZA 2VG9A 1DGRN 4XF4A 5F9TA 1S0FA 4JGZB 3D3AA 4BLJA 1HN1A 3QOPA 1SACA 4IERA 2Q8OA 4N43C 2JG8C 3NJVA 1LKNA 1LULA 3J8F1 1ND3C 4IDZA 1VBC3 1Q56A 1OLQA 2VR4A 2C0ZA 1RUF1 4M3CF 2W5FA 1YLLA 4OUEA 3W21A 4BQ5A 3HR9A 4RS5A 4QQOA 4KU8A 5KHGA 1SDDB 1POQA 4QM9A 3C7EA 3OBAA 5IWFA 2IFRA 1LGNA 1ZA4A 1M06G 2IFWA 3RJ2X 1TEIA 3PJQA 1LHOA 3TOJA 4Q2FA 1Z7S2 1AL0G 1Z7S3 2QQUA 2PQSA 3OBRA 5DAVA 2ZEZA 5F39A 5FCCA 1ZZCA 4GIQA 5FJKA 1REEA 2IVJA 1YIPA 2YFZA 4WM7C 4AEJA 2AACA 5ANQA 4F83A 2FDJA 3LKJA 4QAWA 1KDMA 4QHBA 4LHNA 1F4AA 1W8ZA 5DAQA 4NIIA 3VDDA 2WNUB 4XUTA 1H6YA 2VQ0A 4TXWA 5FKCA 4DS0A 4K9SA 5GLTA 2FQPA 4HLTA 4OHVA 2YU2A 4B7KA 4BQ1A 5BUVA 1G9FA 2WIIB 3KM5A 4CDQC 1OXCA 3WDUA 1WA4A 5FV3A 5GZFA 3TB0A 3CIHA 5IT6A 4Y22B 2R30A 3HNMA 5FPBA 1WCUA 1YI9A 3ETQA 5T3NA 2W87A 2V73A 1HLCA 3GBFA 3H0OA 4RN5A 5C4WB 4KWKA 1CJPA 2DWRA 4CPBA 4CDQA 1O3TA 1Y9MA 1Y43B 3QD6A 4AFMA 2Y6HA 2QQIA 3JB8A 3LDRA 1BQPA 3H8UA 4K7JA 4KGQA 2EICA 2QZ2A 3WP3A 3WUCA 4XMAA 1J3RA 3ZDVA 3L2YA 1XYOA 5FLIA 4NWVA 5EHDA 4EZHA 3B94A 1OVPA 4D6SA 1ZX5A 2NMNA 1VALA 5FZ7A 3T2TA 1GWMA 3VBUB 1PO13 5FMOL 1RUF2 5CFCA 3DXUA 4A3XA 1JN2P 5FK8A 1RUC2 4IE7A 1GZWB 3WV6A 3ZFGC 2ZAHA 2WUHA 1WUVA 2RS12 1UZZA 1Y3TA 3ZPYA 1RJ8A 1W0OA 3BTYA 1CX4A 2Y64A 1DLCA 1LOFA 1UMHA 4A2UA 4EYUA 1JZ8A 1PNFA 1YNAA 3CJIC 1W3XA 1XSQA 5GM0A 1ZYBA 3DYOA 4K3UA 1EUTA 1HB1A 4MZUA 5BV6A 4D94A 5DUUA 4L99A 2RM22 1PVXA 3WDWA 3H1YA 4B7EA 5K8SA 1AR71 2XVLA 2Q30A 1UZVA 5KC6A 3VL9A 3PVBB 5IVCA 5B2GB 5KHHA 5EXOA 1VBB2 5DAWA 1NKGA 2CL2A 1UWWA 5GLWA 1JTZX 4XXAA 2I45A 1STMA 5J96B 4XF9A 2WYFA 3CBNA 5A3NA 3C7OA 1DLLA 1PIV1 1RMU2 4Z92B 3T0DA 1IOAA 2X05A 1H8TA 1O4TA 5FPXA 4OI2A 2PYTA 4WVMA 5KXDA 4KG0A 4NRPA 1AVBA 1V0AA 3ZXJA 1UZWA 4E8CA 4N43A 4L2NA 1Q8PA 4K1ZA 4JGYB 3DXTA 3VBRC 3IN9A 1QMJA 1YQ6A 2GNTA 4CA9A 1LGCA 3PVOA 1JXNA 2RVAA 4QB6A 2RMU2 4ZU7A 3CLPA 1C5IA 3LFMA 2P6CA 1LAJA 2BPA2 2E33A 2JG9C 4TLGA 5DQ0A 5FZKA 4GB31 2XWJB 1QXPA 3NL1A 3ZFGB 4UF0B 3OBTA 2A5ZA 5A6QA 1GUIA 3R4DB 3V0BB 1CJDA 1KGYA 3NNGA 3I97A 2G19A 4IE4A 4E2QA 2W91A 3KF5A 3VHRA 4M01A 3AL6A 1WMDA 1HRI2 1A8DA 4IV1A 1PO22 5L7OA 2CGPA 1ODMA 1CZSA 4LBQA 2V5DA 4E4DX 3X29B 3WF3A 5BNPB 4CP0A 2BGCA 2OQ7A 2DVAA 2VTXA 3D6EA 2HWD1 4FT8A 4YGEA 1XNTA 3POSA 4YNIA 2BYVE 4RS5C 2I74A 1NCQA 1U5XA 2GC2A 1KS5A 4GULA 3RS6A 4PQQA 3OGVA 1FNYA 1OKQA 1OH4A 4FOWA 2RS53 1W8OA 3S0MA 1AX0A 1W6NA 3EBRA 2VBBA 4AVCA 2W9XA 2DVDA 4I0WB 5JOWA 1RUD3 3RSJA 4BA6A 4LULA 1OA2A 2ORZA 3PU8A 3VBSB 5BNPC 3LQCA 4I01A 5C8CB 1GQHA 1H9PA 4GQ7A 1PVC2 3KHCA 1XNDA 1COV3 5DDJ2 2A7AA 4XQWA 3PVEA 3S6PA 4YGDA 4ATFA 1ZRIA 1OUSA 2P37A 4JHTA 3BTZA 5JPMB 1RGSA 4I09A 5FR3A 2HWC3 2HYKA 5DUVA 1O91A 2G9GA 2QNKA 4IETA 5L36A 1FMD1 3WY6A 3RZZA 4OI0A 5A1AA 3AFGA 5FY9A 1XU1A 3USUA 2WL1A 5D8AB 1W2NA 2BTVC 2ZEYA 4MUVA 4OVEA 1PX4A 4NAOA 1SBFA 4N43B 3RWKX 4A4AA 4FBFA 1K5JA 3B02A 5ABJC 1R082 3QH6A 3KS7A 3ZSJA 1POV0 2KD7A 3I8TA 4DPNA 5IVYA 1GNHA 3GBWA 1KFXL 2VCMA 4FTBA 2JE9A 2R073 4HPKB 2C5DA 5LK5A 1PK6A 1J83A 1W8WA 2XKOA 3CJIA 4QHZA 2GC0A 4MXVA 1GP6A 4UF0A 1PMHX 1QIQA 4GWNA 4COWA 1NOVA 1FV3A 2DU0A 1CAUA 1N1SA 4TTGA 3GZAA 2XUMA 5A3PA 2JEMA 4AVSA 1ODNA 4P9WA 3IIIA 2UWAA 4IV1B 3WNXA 3JD71 3WXPA 4CU7A 4JRAA 1UMIA 1PO21 2ARAA 2JDNA 2PHLA 4LHSA 5JOZA 3T2PA 3I2FA 2WA4A 2B8MA 3A23A 2Y60A 4Q4W3 4XMIA 4C0BA 1XPWA 4QDRA 2Q1ZB 4GMP3 2GC3A 2HBTA 3T4VA 1FNZA 5FZ4A 4D7YA 3VZOA 4AQTA 4EN9B 3MGUA 4R9CA 1W6NB 2V4AA 4LO7A 1Y9GA 1QH6A 1QF3A 3MPBA 4FTSA 2LW8A 4M4RA 1XXNA 1TQ5A 1KDKA 4Q8KA 4IE0A 4ARYA 3FHAA 3F2ZA 4HT1T 1Z0HA 4A6OA 2IXHA 2B5HA 2D6KA 2VZVA 1DYPA 5GLUA 1S0EA 1HV0A 1ULPA 3E5QA 2EXIA 1ST8A 3VDDC 5H9SA 5A6YA 1HW5A 1W6PB 2DDUA 4K6BA 4TYSA 1LHWA 1AXYA 4QX1A 4NIDA 3RGBA 4B8EA 2X8KA 4LO6B 2PN5A 2JKXA 4A7YA 1RL3A 4QPIC 4L11A 3ZSLA 1W99A 2R7EB 2D97A 3AVRA 2HWF2 4UI9L 2VMEA 3E97A 3WF4A 2W1WA 5EWSA 1NLQA 5A7WB 1AR63 2RV9A 2WLPA 2VZRA 3GCXA 4NRMA 5FAXA 2YV8A 5LA2A 3DECA 1I5PA 2E7AA 1LRHA 1UO9A 2W3JA 3PHMA 2E53A 5CA6A 3ACFA 1D0HA 2XPJA 4LK7A 1GR3A 4YARA 1ZBA3 3N4MA 1RUD2 4MVTA 4PDWB 5DMYA 1SHWB 5FLJA 1I5ZA 4XFHA 1NG0A 4D6RA 1BEV3 2ZGMA 4HKWA 1HXS2 3OB8A 2HWB2 5DAXA 2ZGSA 4D6QA 2A73B 2R042 1IG0A 2GMMA 4NE9A 3DPRB 1EUUA 3C2UA 5SV8A 1VAMA 1EY2A 5FMCA 5JR7B 4KQ7A 4DINB 3WDYA 4OHWA 2UWBA 1VBD2 4XW3A 3EB7A 3BPZA 4P9LA 3ZX7A 2RG4A 2HWF3 3QLQA 2HWB3 2P2KA 5DABA 4KU7A 5C9AB 1OUXA 3ES4A 2FZ1A 4LKEA 5FXWA 1URXA 1PZ7A 4OHYA 4CZSA 4RR3B 2X29A 3NV4A 3MFAA 3R6SA 1X82A 3WCRA 1D2SA 4Y5TA 2E6VA 3H1WA 1KJLA 2VOKA 2WFF1 1VBD3 2YFUA 2AENA 2PHWA 3KCYA 3NAPC 3LWCA 4J6GA 4YW3A 2WKKA 2GP5A 2H0BA 3NO8A 3HOBA 4YG0A 2BGPA 4UFMA 2R49A 3HD8B 4QDQA 3UJOA 3CDZB 4I0AA 1RUG2 4BPZA 5IHRA 1MZ6A 1TZOA 2AH2A 3O0WA 4HZFA 1G9DA 3BKZA 3PUIA 1DBNA 2VVDA 1RMU3 1VMFA 2BFUS 1K45A 2WO3A 1DHKB 4HKOA 5FMBA 2JE8A 2D43A 5C8WA 5LBCA 1V6KA 1PGL2 2JWPA 1XBFA 3N7LA 1C1FA 2DUPA 3T08A 3VBOA 4OZXA 4B4RA 1I3HA 3C7FA 3RZKA 3B5LB 4AEMA 3U4SA 1W8FA 4CP2A 3ZIWA 3RZLA 3AKTA 1A3KA 3TEWA 3DN7A 5H9QA 5KHJA 3VBOC 5JDBA 4O65A 1J3PA 1MS0A 5C5TA 3HQUA 3GXUA 2LUWA 2VXRA 1UQXA 1IHMA 3O1SA 1A78A 3VDCA 1C8NA 1VIWB 1RUE2 3A21A 3SNMA 4Y4RA 3ZXDA 4AQ6A 5BNOA 3AMMA 2XVGA 4TSVA 4FPCA 3IIAA 1S55A 3AMHA 1Q3EA 1W6MA 3Q8AA 3ZM8A 3ZPOA 4CRQA 1DQ5A 2VCCA 2BQPA 1PO23 1KQRA 1AYM1 3ZFFA 1IQDC 1SDWA 1UY3A 4JDNA 4IUGA 4XDOA 4BXFA 1WW7A 4HSLA 5FPVA 4I30A 4AAPA 3PUHA 1JHJA 4NIGA 2WABA 1VRBA 5E8AA 5FPLA 5D21A 5BNQA 4GMP1 3AKPA 5FYHA 5T5JA 2WWUA 1UOFA 1JMUB 2Q1FA 4P9XA 1HB2A 1O8SA 1SBDA 1YQ8A 4LE4A 2EIBA 2O8OA 1MVQA 4GKYA 2OUHA 1FX5A 5JOXA 1VRH1 2VU9A 3NRUA 3AM2A 5FYYA 1R091 4NN0A 1G7YA 1CZVA 3POGA 4D3WA 4RQPA 1RUNA 1H1MA 4AHYA 3J8F3 2ZKNA 1JZ5A 1VBC1 3T09A 5FY4A 4XAEA 1H9WA 3POEA 1MR5A 1OLRA 1PGW1 2WINB 5H9RA 3WP4A 3FFZA 1FPN1 5ABJB 4UW3A 1WW5A 1NY72 2XOMA 4ZS2A 5K4LA 1ULGA 1YJKA 5L9BA 4Q4Y1 2WT1A 2C6SA 4FSJA 1G8WA 2ZX3A 3J4UH 3AYCA 2OUJA 4MGZE 4I02A 2ZGNA 1H2KA 4Y24A 2E9QA 2Y6JA 3OBZA 1XB9A 4H55A 4LE3A 5FJHA 3KLSA 4YZ3A 5FZLA 3RG0A 3VBOB 4PIYA 2BJSA 2PLV3 4UFIA 4BOWA 4F3JA 3ACIA 4AGVA 4LHKA 4QKNA 3O12A 5FXZA 4XACA 1ULOA 1HQWA 3GGLA 2X10A 2RHPA 1AXZA 1E5HA 2OIIA 2V72A 4N90A 4Z2AA 1QXRA 4AL9A 4OLLA 2A6ZA 2VOTA 4MSVA 1Y9QA 1ZBA1 4YZ2A 4XJAA 4A45A 2E26A 4KG8A 3GZEA 1BJQA 3AKRA 2JDAA 2SBAA 4LORA 5JZGA 1OQDA 1WCSA 5FUIA 1VBA3 2ORXA 2CWSA 4Y5Z0 3KT4A 2YYOA 3NW4A 2IZWA 1S0CA 3FL7A 1DF0A 4AWDA 4LBNA 3E5UA 5C3PA 1W9SA 1U0AA 2WNUC 1NXMA 5FUPA 4FFGA 1C5HA 3RFRA 1FI2A 2WNVB 3ACGA 3IPVB 5JVVA 4ZZ5A 1XRUA 5JWPA 4YVWA 3WOGA 1QJX2 3V0AB 3W58A 4KL1A 3LIHA 3MYXA 1UF2C 1NQJA 2CHHA 5FZOA 3PU3A 4OMCA 2Q1MA 3W59A 5I0DA 3WUDA 2R1DA 5I91A 4HVRA 4CDXC 5IFTA 1IZ3A 1Q8SA 3NNFA 1UOBA 1GWKA 1PM4A 4GH4B 4PI2A 3WQBA 3S30A 4R4ZA 1ND2C 4MG2A 1PIV3 2RS32 1KFUL 3P5BA 4Q27A 4AE2A 1C4RA 1XU2A 3WDXA 2FDGA 1XNCA 4EN6B 1BVP1 3MV11 4GJZA 3UL2A 3R05A 4QXCA 4SLIA 4CXYA 2ILMA 3WD5A 1V6OA 3CNAA 4QKFA 4DUXA 5C33A 1HDKA 3GJAA 2GALA 1OPOA 1OQ1A 1RHI1 3I2GA 3RYPA 2FCTA 3PIJA 3KQ4B 4G4FA 4L0PA 3CEWA 2QQNA 5IW0A 1U5IA 1OQEA 4D8MA 3TEXA 1UN1A 1G9CA 3J9SA 5FZEA 3JU9A 3WNLA 5F5AA 4AI1A 4M3CE 5DUXA 3B01A 5A3WA 3WP6A 1QNYA 2Y0IA 5JPNB 2QUOA 5FZBA 5JUVA 3C3VA 2DUQA 2VMHA 3I3DA 2Q4SA 4IEWA 4XEZA 4FQZA 5BNPA 3ZYFA 3VBFB 1ZRRA 2ZGPA 1JZ3A 2R6QA 1JW6A 3APBA 5F5CA 2OXBA 2OW4A 2QDNA 3CJXA 4LK6A 3WG2A 3EQEA 2PHXA 5FY0A 3IZOA 4EE2A 3RYKA 1AR93 2XB6C 3DF0A 2J1UA 4QKBA 3ALQA 2ETEA 4CP9A 4N53B 3E6CC 1TMF1 3FN9A 3L9JT 4EWAA 1SLIA 4IGOA 1WD3A 4FI9A 5C8CA 1B35B 1KXGA 4XILA 4OZOA 1VJ2A 2DCJA 3GCWA 4TLFA 4J1WA 4XFFA 2DFCA 2XBO2 2Y26A 4WVZA 1QJFA 1OMIA 5FZOB 4ASLA 4FPLA 4ZPIA 1O4ZA 3T0BA 5L7OC 3M1HA 1IKPA 4IXLA 1IGOA 1GQGA 1AX2A 2GN3A 2J1VA 2EXHA 2C4XA 3BB6A 4Y22A 4EN8B 3DCQA 1K5MB 1J59A 2EALA 2JX9A 4YGBA 2Y6FA 4JGYC 5FMDA 1N1VA 5JSPA 5L9RA 1UKRA 2A75A 3U78A 2A6YA 2R072 1RTVA 1HN0A 1R093 4PCRA 4XPVA 3SMHA 3S57A 2RM23 3WG1A 4YRDA 1C28A 5FY7A 4E27A 5K7PA 1UU6A 2J1TA 1JYVA 4I2OA 1FAYA 2HKXA 2MEV2 1JU3A 1OOPC 1SCRA 4M0NA 5F3EA 4PLMA 3RRDA 4LTAA 4URTA 1P8JA 4XIKA 2D6PA 4YGCA 3UK9A 5A1FA 4MGQA 1MQTC 2GNMA 1TG7A 1C3HA 4Q4Y3 3MIFA 4Q4X2 2LALA 2Z69A 3AMNA 5J37A 2DCKA 3KV5A 4WM7B 4LBQD 4UBGA 2XJQA 4FXGB 5A6XA 4YW2A 3TNQA 2ZA9A 1ASJ2 3MHZA 3ZO0B 2WNUA 4AI2A 3NKTA 1PMIA 2X53S 1ZRDA 3ZN6B 2QCSB 1RB8G 1DQ4A 1ND2A 2WR9A 4YM1A 3JBG2 2HEVF 1VLNA 3N9NA 1Q8QA 3PMSA 3VBRA 3N9OA 4AHXA 1J58A 4QQPA 1WCQA 2VH9A 2ZS6B 3MICA 5ISLA 4RHV2 5LATA 5HPOA 2D3SA 2WZR3 1C57A 4Q4W1 4Y1UA 2E7TA 1UMZA 2VECA 1H1AA 1GV9A 1NE6A 2XLFA 2P1BA 5LA9A 3AP6A 4CCOA 2HWE1 4YVWC 2YZ4A 4BHPA 2NQYA 1QJU3 4QB1A 1W6QA 1GLHA 2VY0A 3ME2A 1ZVFA 1YFYA 4W50A 2Q8DA 5J48A 1LB2A 2ZAAA 4R9BA 1PZ8A 2DU1A 4QPGC 2H0VA 5CFCB 4XUNA 3SISA 1UY0A 4GWJA 4PT6A 3SEEA 5IFPA 4XIOA 1AL22 4N9HA 5FYVA 5IK4A 2OQ6A 4NVPA 4YSFA 1YQ5A 2W1UA 3VHPA 3ST7A 1T6BX 3ZDSA 4NJ4A 2HBUA 4B29A 2DYCA 4DXTA 2R061 5A80A 2YG0A 1TME1 1BLZA 3DKWA 3RWNA 4NIAA 1JZ4A 3RNSA 2BNOA 4JCKA 1LOFC 4LITA 2NZ9A 2VM9A 4RQPC 2XDVA 4YYOA 1H2MA 1YHFA 3WR0A 4CEWA 4Z2WA 1AYN2 5CEHA 1IG3A 3LA7A 1JUIA 5GZGA 2Y34A 4QWNA 5FXVA 2WWJA 3RZJA 2L9LA 4CCNA 5CFCC 4LKDA 2WAOA 2Z42A 4FOQA 1XC6A 3FC0A 4DIQA 3BOWA 3J7MA 2NP0A 4I3GA 2VC9A 2G9FA 1D7PM 3N36A 1J84A 2QBXA 3WP5A 2VOVA 2D93A 5T50A 3WINE 3HBZA 2OT7A 3IMNA 1WCDJ 2VOWA 1EYBA 4INDA 2YBKA 4AYUA 4XHBA 1GOGA 2FDHA 1X8MA 2WZPP 4C1XA 3OY8A 5CZKA 1FXZA 1ND2B 2W1QA 1AXKA 3A4UA 1W3VA 3R0RA 4CP1A 2PHUA 4Y5SA 1W06A 5FZIA 4CDWB 4ISQA 3VBRB 1OC1A 1BCXA 1PO11 2Q5TA 4K8RB 4CPBD 3HBKA 1E5RA 3N7KA 3KV9A 4G3YC 1AR83 1AR82 2YBPA 1NZCA 1RUI3 1VBA2 1H4HA 3VLBB 1V9U1 2D44A 3D8CA 4RGAA 4GKXA 5B4XA 2X09A 4UW5A 2Y0OA 5IVBA 1YWKA 4KMQA 2N7GA 1D4M2 4H2AA 3TRSB 4DUVA 1EAH1 1VBE1 2IC1A 2YC2A 1MACA 1VP6A 2XJSA 3EHKA 4EWDA 2BOJA 2VO5A 3TAYA 2WFF3 4S2GA 5A33B 4MXWA 3ZFEC 1QDCA 4LBQB 4D0QA 3VB9A 5AC91 1BMV1 2OYZA 3V65A 4ZHNA 3D0SA 5H9PA 1D4M1 3B3QE 3I2JA 2O14A 5F32A 4KGGA 4AHWA 4CCCA 4YM3A 2XL7A 2D3PA 2XKPA 1SFPA 5CNAA 5F7UA 3E5XA 4COUA 3LPFA 3OG2A 3AVSA 2A6VA 1ZBE1 4AFDA 4R4XA 3ILNA 4LLOA 4NRQA 5CKMA 1UOGA 2AREA 2ADDA 4S2FA 5CFDA 3AZXA 3AFKA 2QTWB 4LIVA 3K4ZA 1LGBA 1GP5A 2OKXA 3UKVA 3FBMA 1ULDA 3UKTA 5JAXA 3W5NA 2FCUA 1UPSA 4L9BA 5IK7A 1FATA 4CCJA 5JI7A 2HWC1 3RI8A 4AAXA 3I59A 3LPGA 5A70A 3N7JA 1HRV2 2WLQA 4WM8B 2ENRA 2ZEWA 5HCBA 3FHQA 1XJAA 4IGPA 4JVAA 1M4WA 3LZZA 5KR7A 2KXLA 3POYA 2GNDA 4IEQA 2MHFA 4NO4A 4ATEA 1BXHA 2ZCWA 1S0DA 4FFFA 4M00A 4AZZA 1LOGA 4CXWA 2D98A 3POBA 5EYYA 3FHIB 1DCSA 4OFGA 5IUQA 2TBVA 5I0SA 2TUNA 5IATA 3TBDA 1EP0A 1F5JA 2WO1A 2NLRA 3MUZ1 2Q0AA 3ZMNA 2FBEA 3ZLIA 1MS5A 2O1QA 2IUWA 2VZ3A 4CDXA 2VVEA 1DGLA 2IXJA 1O59A 3VGIA 3WEZA 4QX2A 2QKDA 4HN1A 2FDIA 2C9AA 3KCCA 4KWLA 1QJU1 4I3PA 1BKZA 3JD73 5FZ9A 5D8AC 3IAPA 4AK3A 2XWBB 4H3WA 1GNYA 3DUIA 2NYYA 3GHNA 5T52A 3RPQA 1H8VA 3JQXA 1NXD1 3OD0A 2BZDA 2J1EA 2KR2A 2ZMLA 3VD5A 1WZXA 2Y33A 2Z4FA 3K77A 4XVHA 4QHOA 3DPRC 4HK8A 1COV1 5IVEA 3AP7A 1FOD2 2OPKA 2JXAA 3R4UA 1ENSA 1APNA 2JD9A 4UYBA 5FP9A 4A41A 3HN1A 3I2KA 1V6LA 1KEXA 4MYEA 4RHV1 4CDUB 2JDZA 3FMGA 3JXSA 5CKNA 1JYXA 1UYZA 1KJRA 3F95A 4CEYB 1W9FA 4HL0A 5IAVA 1S0GA 3ILRA 2SLIA 4XAAA 5A1LA 4Z8BA 1GZCA 2IXCA 4IV3A 4OUMA 1V70A 1LOBA 1N3PA 5EJ3A 1DGWA 4BE3A 3M3CA 2HEWF 3KMHA 4BQ3A 2CTVA 2GAUA 2XG3A 1BBT2 2Y6KA 3G7DA 1V6IA 2XJPA 3MZHA 1ZA7A 3FUQA 4QPIA 1CZTA 2A3YA 5DXDA 4UFJA 4XETA 1WMXA 5C3OA 2XJUA 2XH6A 4Q4X1 3RI9A 1YCIA 3D4KA 1GBGA 3K3NA 1ZNPA 3USUB 3N9QA 1CAWA 5A3TA 4WBBA 4CXXA 2W2IA 1JZ2A 4P9JA 1VB2A 5I0TA 4DXRA 3ZOIA 1O5LA 2WO2A 3OD4A 1AR61 3T2OA 1POV1 1UYXA 4G9SB 1V6NA 4EROA 4YVWB 3ZYIB 4IGQA 5FZFA 3VD3A 3AJYA 3H50A 3BUCA 3S5QA 2ET7A 4PIXA 3NJXA 1W0NA 5KHKA 3BYWA 1OT5A 2VUDA 3I2IA 1ZRCA 3VHNA 4K21A 4XF0A 4XUPA 4NOTA 4JDMA 3P1IA 1BVVA 1DG6A 1V9U3 2V4VA 1GICA 2B7YA 4EN7B 4I0BA 1XE8A 4CCDA 4FAGA 3O1VA 2TEPA 2XBO1 1YFXA 3UETA 1YQCA 4O7XA 1VBE3 1JODA 3ZN5A 3HIFA 1XNBA 1LNSA 2YC4A 5FUNA 2MNGA 4Q0PA 2ZEXA 4HBNA 1UIKA 2Q8EA 4HSJA 4BU2A 2A71A 1A34A 4L8QA 1OKOA 1ZZ7A 1RIRA 2VQUA 3FBYA 4QPYA 2DVFA 2YUEA 4PDWC 3TNPB 5FYZA 3LE0A 1LEMA 3AC0A 1TNRA 3UV9A 2BU9A 3ZXGA 5JOYA 4LPLA 4MGIE 4OMDA 3OOXA 4OHXA 1CAVA 3Q8FA 3Q8EA 3ASIA 3LD8A 1D4VB 2EA7A 5KXBA 3BI3A 1H4GA 1GFF2 3ENRA 4QXHA 1AYN3 4YW6A 3TEYA 4P02B 4XFIA 4P00B 1OFNA 1R1A1 2A3XA 1S0BA 1K42A 2CU5A 3UT0A 4QPIB 5K0UC 4WM8C 4XBNA 4LO5B 3L2HA 2R043 1NCQC 3FLRA 5A32B 4CCMA 2RDSA 5ACA1 1XYPA 3E1F1 3U0ZA 3RMYA 1IKQA 5FP7A 4XOGA 1UXZA 3ZXKA 4NUBA 3UGFA 1SZBA 4IEPA 4YVSC 1FOD1 1D0GA 1S4CA 5IK8A 1CVNA 1QJZA 4YFZA 1SCSA 3N9PA 2FZ2A 1OOPA 3OTFA 4QGLA 3WQ1A 4IEYA 1R64A 4K1YA 3T1LA 1V6MA 3NAPA 1W2AX 4QGNA 4WZCA 5FYUA 1RUH2 5LRRA 1TMF3 1CX1A 1GZWA 4GJYA 4MHRA 5DZEA 2AEYA 2IXKA 3DEMA 2DCZA 2YGLA 1RUI2 2QJVA 1E5IA 1DQ2A 1GANA 1SPPA 1W04A 3MEPA 3HEIA 5I8YA 5HBAA 3AYDA 1W28A 2C1FA 3P6BA 3CKHA 1H0BA 3MIEA 3VKLA 4QX8A 5CKQA 3U11A 1J3QA 4DNYA 3KWVA 3ZMOA 4Q4V3 2CAVA 5D1IA 1IPSA 1WGPA 1O8PA 3VUOA 1FV2A 1WBLA 5LA1A 3E6DA 1W6MB 4LBMA 2PLV2 3LA2A 2VNVA 2UYAA 2W95A 2WNOA 2QQLA 1HJFA 3JB4C 4CTEA 5LA0A 1ZRFA 4FPGA 1C1LA 2W92A 3H1MA 3ATGA 1DP0A 1QGLA 2LTNA 4JC1A 2D7FA 1QJY2 4R9AA 2CDPA 4Y20A 1EV11 3HNYM 3TYJA 3PLQA 1WMEA 3LAGA 3BODA 3GJBA 2JB4A 5A3LA 1LEDA 4CEWC 2P5BA 2ZZJA 2VW1A 4BZ4A 5HI0A 2XR4A 3MUY1 3B7MA 5CG8A 1XSRA 2B9UA 1IPJA 4XJ9A 3BN6A 5T54A 5LW9A 2WN3A 2GH8A 2VJXA 4GZ9A 5C9AC 1AYM3 2CGOA 3H3UA 3H7YA 2R1BA 5FZAA 1BZWA 1GMMA 2JJ6A 4XQDA 4CCKA 4ISRA 4COVA 3GYDA 3C7HA 5C4WA 2B42B 3GF6A 4MH0E 4OULA 3ZKYA 2VMFA 5CU1A 2VUJA 5F5QA 2R063 3O0XA 2A1XA 5G04L 1CAXB 4KBZA 3UGHA 4LQRA 4PI0A 1FMD3 4QD2A 1VBB3 4M0HA 4IEZA 1VRH3 4FVVA 1J1LA 5K9YA 2K46A 1FT9A 1NY71 5HXVA 3O1MA 4Y3OA 4EN0A 3V0BA 1IPKA 4DB5A 1F4HA 3ZIXA 4LUMA 3MFCA 1W05A 3AX4A 3I2DA 4JTOA 3WG4A 2EIEA 1VPHA 4XJZA 1QJY3 1VBC2 5LZ6A 3MW4A 1R092 4FOYA 2XXZA 1VRH2 2QVSB 2WFPA 2W08A 3UKNA 4LR4A 1YIFA 3AYEA 1LENA 1QNWA 2BBVA 1MS4A 3N9LA 2RDRA 3IKWA 2QQVA 4UXAA 1VBA1 4Q4V2 3FFQA 5JCTA 3AL5A 1UY2A 4AR2A 3O14A 3THPA 1O3QA 1K12A 1G9AA 2K2SA 3M2MA 4QQHA 1SFNA 2ZHMA 2PMWB 2AR6A 1MEC3 2BBAA 4QPGB 5E89A 5GKAC 1DIWA 5LASA 4B1MA 3TEZA 5T55A 1YC61 1WWYA 1QOOA 2VZQA 3PJYA 4XDPA 1SEFA 3OF1A 3ZFFB 2IXLA 1ACCA 5BNNC 5LBFA 3OYWA 5BNNA 5IAXA 5L19A 1ASJ3 3FLPA 4U2AA 5EP9A 2ZHNA 1RUE1 5IVFA 3OGRA 3T4HB 4LT5A 4GMP0 1W39A 2JG9B 3WW4A 3K46A 3MW2A 3MV01 4K20A 4RSUA 4O61A 3BPSA 5A7PA 4W6WA 2JDUA 4RGKA 4Q1PA 4LOTA 5E1RA 2ZKLA 1F2NA 1F9KA 2VZOA 1PK6C 1EV12 2VMDA 1S2KA 4XABA 2XHNA 3AJZA 4LOSA 5JXGA 1NA1B 1N1YA 5I0RA 2DTWA 2Z2SB 3UNPA 2BVBA 3ZSKA 2D40A 3VBFC 5ABJA 2EXKA 3VKOA 3HAGA 3SXWA 1AYN1 3U75A 4COYA 4OQ9A 3WLUA 2EIGA 2J42A 2PLV1 3U1XA 2YPJA 4K40A 3QBQA 4W65A 2JECA 5JIAA 1GWLA 2VMCA 1RINA 3I7DA 3KT7A 5JI9A 3O7OA 1TME2 1DZRA 3OPTA 3BOPA 3PTRB 4JQRA 2W1SA 3AZYA 3KB5A 2CNAA 1RUI1 2HYXA 1QQP3 1CAUB 3I2HA 5A3OA 2CWMA 4Q0SA 4N7UA 2VBPA 3ECQA 5LB6A 5FY5A 3GALA 1OF3A 2WWSA 4YFWA 5AVAA 2I2SA 1RUH1 2J1AA 5FXXA 1L3JA 2JG8A 4JRLA 2RR13 3AMPA 3OJBA 5I0UA 3SH4A 1AL23 1UKGA 1ULEA 2W0XA 2WFF2 3MIGA 2ADEA 3D0JA 4MO3M 4A6SA 5FO8B 5LY2A 2J7MA 5F2SA 4DY3A 2ZHLA 2ZACA 3MI8A 1YYNA 2BFUL 5FK7A 1RC6A 4HMZA 4AEKA 5AC93 5ERLA 4BK5A 1ND3B 4ES9A 1WLDA 3SLIA 4Q4W2 5FBJA 4RFRB 4Y1XA 3D82A 4AI8A 5AFEA 2BV4A 1ENRA 3OEBA 1UCXA 3J26N 2ZGQA 4DO0A 4BMEA 5CADA 5ACA2 5CG9A 1S2BA 3PUAA 4XFAA 3SH3A 1F8VA 4BLIA 3SCFA 3WF2A 1HJGA 4AI9A 5KWRA 1R1A2 1A6CA 3AK0A 4BIFA 1PX3A 3VKFC 4NHLA 1RYYA 2WQZC 1WKYA 4HN0A 5TSWA 4AEDC 3H8OA 1UZ0A 5J09A 2KM2A 1LOAA 4PHZA 2HWB1 1NT0A 1DQ1A 4OYUA 3A7QA 5FY8A 3TN91 2NPIA 2WT2A 1OURA 1EV13 1UY1A 1JYIA 1RUJ2 3M3EA 5FP8A 3LOIA 3VBHB 1X50A 4WM8A 2VMIA 4U36A 4CDQB 2WZR2 5A3UA 5C9AA 2C9KA 4FTEA 2A3WA 2QQWA 2VZTA 1J1TA 5FYMA 3BU7A 1O3RA 2XJRA 3IWZA 4QQ2A 5FQ0A 3SKJE 2MEV1 1EPWA 2D6MA 2IVIB 3I4IA 5DUWA 2VULA 1T2XA 2JD4A 1SQ4A 2WZEA 3POJA 1ALYA 4XJWA 3K75B 4IESA 5FZDA 3AP9A 3O1UA 1HKDA 4ZS3A 3NQHA 5FZ3A 4FFHA 1NE4A 3T30A 4ZKTB 4XBQA 4C0HA 1C8M1 1W2OA 2VE1A 3CMGA 3NNLA 1C8M2 2VVFA 4HETA 1NLSA 5IJRA 5K0UA 4XFGA 4CSWA 2PHDA 3J7NA 5IVJA 4C1WA 2JDMA 2RJKA 4YZ5A 1UY4A 1JZ6A 3ZN6A 3LFIA 1D2QA 3P3PA 4MHUA 3THCA 5FREA 2JG8B 4RYDA 2BERA 5C5UA 5KBFA 1DZQA 2GZWA 2ZX2A 4E9KA 3WF1A 1TMF2 2XL9A 3PMEA 1AZDA 1H6XA 3VBFA 3NJYA 5FYIA 4FQ4A 4Z1VA 4JGZC 1AR62 3WHUA 1F35A 3MLKA 4FP2A 3OUJA 3BIEA 2EF6A 5GLVA 5C3QA 2QE3A 4ZY9A 1K3IA 1W8NA 4P9IA 1SFYA 2WZR1 3ACHA 4EZ4A 3MIDA 3PURA 4CP9B 3Q9OA 1RUJ1 1YQ2A 5F2WA 1UX6A 2HWE3 3TN92 1ENXA 1POV3 3LB9A 4XHXA 5T5OA 1HX6A 2ZGKA 3AZVA 2CV6A 3VDBA 4WVMB 1HIXA 1PHMA 2LRPA 4BDVB 1UL9A 1WMFA 5DG2A 2H6BA 1UXXX 3DKQA 4MGYE 4XDQA 5BNOB 4JAAA 1JYNA 1TE1B 4XF3A 4Y1ZA 2J1SA 1T6GC 2VZPA 1PM7A 1RUE3 3FZ3A 2UY8A 4LIUA 5LBEA 1HV1A 5J3UA 1LODA 1O5UA 4X8PA 1QU0A 1RHI2 3LDBA 5FZ8A 5GALA 3RZGA 1X8EA 3VBHA 1NA1C 3I3QA 3NNMA 2F4PA 2VNGA 2FDFA 1TNFA 3AZWA 2Y6GA 3K2OA 2VGDA 2C24A 3CJIB 3BTAA 2DF7A 4GAZA 3U07A 2YU1A 1XYNA 1N3OA 5J7MA 1R081 3IAQA 2GNBA 1YI7A 3ETPA 3OGJA 4V1PA 4OUSA 4XCAA 1UZYA 2RS31 2VOXA 1QJU2 1BK1A 2X5IA 1LOCA 1XE0A 2ID4A 3DGTA 3O5SA 5FYSA 4LMFA 2BVVA 1BK0A 1FMD2 2V09A 2W47A 4ORFA 2YMZA 4P14A 3EYPA 3VV1A 5EIYB 3WNMA 2BNNA 2J22A 2P3YA 2VAUA 3IDEA 2XMLA 4BIOA 4DEVA 5C71A 5C3SA 4DXSA 1AF9A 4FPHA 3ZFEB 4NHXA 3M3QA 3THTA 4FOVA 5C4WC 3AB0A 1PVC1 3CZUA 4HG6B 3ZXAC 1KD7A 1QJX1 2VZ1A 3BIWE 2RE9A 3M70A 4LBJA 5F3GA 4EWEA 4ZZ8A 1RUH3 5CVRA 2K0GA 3CQOA 3HN3A 3SITA 4P9YA 4XFCA 3O1PA 2QQOA 1NCRA 4DZGA
chains in the Genus database with same CATH topology
1JOJA 4QT6A 1LTEA 1FOD3 2A6WA 4RL7A 2WJSA 4P9GA 2ET1A 1HRV1 3KT1A 2HWD2 1ZZ9A 4YLZA 2VMGA 1RUG3 3MF9A 4QMAA 1G86A 2BUKA 3VL8A 1CONA 1HQLA 2ES3A 2RJLA 5D8AA 5JSRA 2PELA 1KITA 2XGXA 3ZSMA 1HRI1 1WW6A 3WDVA 1VAVA 1DQ6A 1DQ0A 2ZGOA 3S7IA 1NLRA 1JHNA 3M3OA 2ZGRA 2F6BA 1KRIA 4DRVA 5E88A 3ZYRA 1Q5OA 4FPFA 4YW1A 3HMYA 4C90A 1LESA 4GB32 5A3MA 3V0AA 1CPMA 4Q4V1 1EAH3 1OA3A 2ZOEB 1OFSA 4IV3C 4CDXB 4D69A 4BWOA 5CFDB 2ZABA 2IWGB 1AJOA 1LHUA 1BMV2 4FO9A 3POWA 4EV0A 1O7FA 4GH4A 5HCAA 4Q0VA 3CF6E 3VZJA 1N1TA 1KS4A 1R1A3 3NWKA 2X5IB 3QCWA 1VBE2 5FTTC 2DURA 1EAH2 3IDBB 2AYHA 4OI4A 1ZZ6A 2R0HA 1HXS3 2ERFA 1UPIA 3MDPA 1V9U2 2ZX4A 1DGWX 2DCTA 3MF6A 2OVUA 5EFUA 3TWIA 1AR81 1V6JA 4LBOA 2DFBA 1LHNA 2A70A 2R32A 1YO8A 1PO12 2D5HA 3NJZA 1WW4A 5CFDC 1YJLA 1CGPA 4HPKA 1CPNA 2ZGTA 3VDDB 5KC5A 2ZHKA 4GA9A 3EO6A 4JDOA 4Z82A 4AI0A 3WZ1A 1NCRC 1RVF3 4LHLA 1Q8VA 3PNAA 2ARXA 3CU7A 4DQAA 3NKGA 4ZU4A 3CO2A 1A8MA 4F7ZA 3RQ0A 4YG6A 3WW2A 3VZLA 2B46X 4N9IA 2YY1A 2RS11 2PHRA 2WA3A 1PNGA 1QJY1 4MXWB 4GWMA 3RJRA 1CAWB 4MX3A 1G9BA 1VAKA 1DZTA 1MS1A 4TWTA 3ZN4A 2WC2A 4RA0A 2B39A 3WX5A 3WW3A 4M3CA 1YUDA 1CESA 4E4ZA 3UJQA 1PGL1 3KSCA 2CAUA 3VBUA 1MQTB 4IQPA 1CAXA 3IM0A 5J98B 4X8NA 1CD3G 4NR1A 1ULCA 5FO7B 1S0IA 2P34A 1K5MA 2EAKA 4AFAA 4PBPA 4J1XA 1WD4A 2D5FA 1WCKA 2P3KA 4TZDA 4MV2A 2D6LX 4FXKB 1QY4A 4Q4X3 4PLNA 3WCSA 3V64A 1Z7S1 4AVTA 4QXKA 4Q8LA 2A6XA 4H14A 4Y26A 4GXLA 1I1EA 2D6NA 2UU8A 5J36A 3HWJA 1IS6A 5I8TA 1JUHA 3SHRA 3OCPA 3ZXEA 1JYCA 1SLTA 1ZZ8A 2XLAA 2WSUA 3J8F2 3PTYA 3RDIA 2PAKA 2DTYA 4QQLA 1UIJA 2CGNA 4NHKA 2B45X 2ATFA 5GZCA 1ASJ1 4IL7A 3ZXLA 4JGZA 4BM8A 1BYHA 1U5ZA 4X6RB 4AGRA 4XE9A 1GKBA 2RMU3 4ZXKA 1NA1A 3VBHC 3HT2A 4RS5B 3ZFGA 4LBLA 3MIHA 4WVWA 5FDBA 2ZX0A 4BMBA 1QDOA 2VW2A 3ELNA 5GZEA 2XJTA 1OI6A 2FHRA 2BWAA 4AXOA 5EYXA 1MVEA 1QHDA 1ZM1A 4RR3A 3ZYJB 5BY5A 1MQTA 2HEYF 2HWF1 3WT3A 4AQSA 1TME3 4IV3B 1XQNA 3WVJA 3KZ4C 2OA2A 2XJVA 3MW3A 2YHJA 3ROUA 4CDUC 1MS3A 2AUYA 5JZGB 5FOJB 2ZZQA 1PGSA 4AFCA 1QWRA 3KD4A 4XJUA 4SBVA 5BPXA 1HQNA 1ONAA 2P3JA 5JLVA 4ES8A 1REFA 4CEWB 5ACA3 2DV9A 3AXEA 1B09A 4AF9A 2JICA 1H2NA 1GNZA 4GB33 5C8CC 5CB7A 1UAIA 2OZ6A 1ZREA 3ACLA 3OGGA 2WNVC 1H8TB 2ZGUA 4NPRA 4IEOA 4RQPB 3SH5A 1BBT1 4LA2A 4FPEA 5BYNA 4JGYA 3H7JA 1VR3A 1YFWA 2AGSA 4RD7A 1O4YA 4DY5A 4LNVA 4AW7A 2GMPA 3WQ7A 1I9RA 3TN93 2UYBA 1V00A 4Z07A 1PK6B 1COV2 3T1MA 2YDEA 4IEVA 3ZSEA 1Y7BA 2EXJA 4N7IA 1IS5A 4FP3A 3P3NA 4C91A 1WLTA 3NVCA 2ZTNA 3W9AA 2EAAA 2MEV3 2VNRA 3LSEA 4YZ4A 1D4M3 2GN7A 3LOBA 3S7EA 3IDCB 5FFOC 2XHKA 4E2GA 1F5FA 2BWCA 4PQ9A 4NWWA 4XBLA 3JZVA 5BXXA 4K8FA 4DRRA 1WLCA 2BEOA 1DU3D 2PHFA 2NMOA 4LEJA 3AKQA 4LO8A 2PTMA 1ZBE3 3I54A 1C8M3 4FPYA 1LOEA 2YGMA 4B4QA 2DVBA 3WW1A 3LCPA 3U4XA 3JBG3 2WNVA 3IPVA 2R0FA 4LLFA 1ENQA 4PLOA 2VNOA 5KXCA 2QZ3A 3ES1A 3WHTA 2KA3A 1B35A 1R1ZA 4DXZA 3GZTB 2ZJCA 2VUAA 4E4SA 2PFWA 2TNFA 1W6PA 3U10A 4B3NA 4FPJA 2DCYA 1R083 5KXEA 2HWC2 3I59B 4ITCA 4EJRA 2WT0A 1RUF3 2ZMNA 1RUJ3 1MZFA 1UW8A 3B9CA 1W0PA 1WLWA 3K51A 1DGRA 3GHMA 1S1AA 4O9GA 2MPFA 1OSGA 2EVXA 2GC1A 3A0NA 1SLCA 1ZBE2 1JBCA 2Z79A 2GH2A 3ZYPA 4DMIA 3IT8A 4FAHA 3H9AA 4YM2A 3G6JB 4Q4Y2 1MZ5A 1X7NA 1QJX3 1SLLA 1UD1A 3MLLA 4PDWA 3VBSA 2RMU1 1DDLA 1EPZA 4Q1RA 4A7KA 5BNNB 2WS93 5AC92 2WS92 4YW4A 1SLBA 3FJSA 1UU5A 2HJIA 4NHMA 2CYFA 4S2HA 4WV8A 4Y1YA 4L97A 1LECA 3VBSC 5LK7B 1BEV1 1PIV2 2I07B 2RS33 4UBHA 5T5LA 1WBFA 4BYYA 4YW5A 3RYRA 4RHV3 3MLJA 1GZ9A 3N3HA 1U5YA 2GSYA 1VBB1 3ILFA 1OHFA 1AUYA 4FPOB 3SCHA 3K48A 1AR72 2WQ4A 2V5YA 5LEKA 4Q26A 2YROA 4KH9A 1SLAA 5DG1A 4CEYA 1W6QB 2O8QA 3SCGA 3HT1A 1QKQA 2WSVA 5CIRA 1YFUA 2ZPXA 3OPZA 5F6LB 4A7ZA 1ULFA 3EJKA 4HANA 3MIBA 1W2UA 1NQDA 5DZFA 1H30A 4L92A 1RHI3 1O3SA 3AKSA 2UURA 3BALA 1HRV3 5A33A 2RR12 4FPKA 1SMVA 4H7LA 4LA3A 5AVPA 1RUC1 2G4IA 1MEC1 4S2DA 5CAZA 2VW0A 1QQP2 2FMDA 4R52A 3VKNA 3USSA 4KNCA 1Z78A 1ND3A 4QX5A 2D3RA 2RS52 4D7SA 3B69A 2ZGLA 4AQ2A 4OHZA 2R062 4N53A 2D6OX 3NV1A 4WM7A 1RUG1 3WG3A 1QOSA 4ONUA 2XBO3 4XQ4A 2PQQA 1NYWA 4YZ1A 5DDJ3 1LHVA 3VN4A 3B00A 2W52A 1IQAA 2H6CA 1AL21 2UWCA 4XFBA 4O9EA 3N35A 5KHIA 3GBGA 3WDTA 2BNMA 4HVOA 4XJ8A 4JV4A 3KGZA 3NSTA 2HWE2 3ZYGA 5HCFA 1X36A 2RS13 1AHSA 1LU2A 2E63A 5JIUA 2RS51 3VZMA 3HQXA 1K5MC 3M8LA 2DUOA 3CL1A 5EZWA 2ZMKA 3AXDA 1LJ7A 4DOUA 1VBD1 1QQP1 1CQ9A 2QDRA 1MEC2 5L7OB 3JBG1 4LO4B 5I93A 2BW8A 1N3QA 2W68A 3LSDA 2RR11 1OD5A 1ZZBA 2R041 3VBUC 2NM1A 4W6XA 4AG4A 3N7MA 4LBKA 1N47A 3ZFFC 5JMCA 1HXS1 1NCQB 1PZ9A 3R4SA 5A32A 5K0UB 3AYAA 5L73A 2VPVA 3VKMA 1RUD1 2AZ5A 1VB4A 2E7QA 2W39A 1GYKA 4AVBA 2OZJA 2R16A 4Y1VA 2UY9A 2R071 1DYKA 4CDUA 1OA4A 1RVF1 5FMOS 4HVQA 3VZNA 4AVAA 2DVGA 4X6QB 2HWD3 3MPPG 5SV5A 1BEV2 4GALA 1MZEA 1Q8OA 5DZGA 4CDWC 4IEUA 4YVSA 2Y38A 4RR3C 4ASMB 4QM8A 4AHZA 2WS91 3ZFEA 3DV8A 4Q29A 2GDFA 5GLZA 5FOBB 1RJ7A 5FO9B 1YXWA 5FPZA 1CIWA 3FE5A 3INAA 5AFBA 1RITA 1UU4A 1FPN3 3M4FA 4BCUA 5GJ6A 1NCRB 4PF5A 5JZGC 2PAEA 4Q0UA 4KBBA 4GH4C 5FQ0B 1MS8A 3JQWA 3ZVXA 2Z5WA 4WVVA 3VHOA 5JSOA 3AMQA 1MS9A 1Q43A 3VZKA 4R8HA 4XYXA 3FWEA 3JD72 2PHTA 1GSLA 2ZBJA 5FLHA 3NV3A 1SBEA 1LR5A 5E16A 2E51A 4UW4A 4RGGA 2IXIA 3D5OA 4KWJA 4YG3A 4AI3A 4JTNA 3GZUC 1AR92 3OY8B 2X5IC 2GU9A 4AEDB 4RFT0 4CDWA 2QQPA 4XTMA 1QXJA 3FUOA 1RUC3 2GMEA 5F1RA 4COZA 4CEYC 3JUUA 1OPMA 3URFA 2JE7A 4META 2XVKA 1REDA 4HK9A 1S0JA 5LRSA 3KQRA 3M3IA 3IBMA 4XXPA 4FCAA 1CAVB 4Y4YA 4H7MA 2FMYA 4MLOA 1LCLA 3GNEA 4AFBA 4CYDA 4YVSB 2NN8A 1W6OB 2LM3A 3JCIA 5DDJ1 1HRI3 2VQAA 4MGKE 4ZU5A 4WZFA 2O0OA 1LU1A 4D7TA 3E6BA 4QPGA 4OI1A 4XF1A 1QH7A 5C6CA 2JKBA 4HKLA 1CN1A 3DL3A 5BNOC 3OYWB 1XNKA 1RUOA 3QH7A 3V56A 5GZDA 3H3ZA 1AR91 1OOPB 2ARBA 5EV7A 5F6KA 1FYUA 1I6XA 3QACA 1QOTA 1ZBA2 1E57A 3WQ0A 4E2SA 4QGMA 3DPRA 1AR73 4PBOA 1PVC3 1XE7A 1YRZA 2P3IA 3AZZA 3A0KA 2ZX1A 2YXSA 4IEXA 4R9DA 4XTPA 4M3CB 5I8SA 2PAMA 3ZXFA 5FRAA 1JH5A 1IS3A 1AX1A 4AEDA 3B93A 4QU2A 5T5PA 1U12A 1CR7A 5IK5A 3M7AA 1B35C 4PJYA 4UW6A 3B9IA 2JENA 1FPN2 3AP5A 4DFSA 4N53C 1PGW2 1BBT3 3BCWA 4PIZA 4Y20B 1IS4A 2JG9A 3KCXA 4F8AA 4Q0QA 1RMU1 3KGLA 3LA3A 1AJKA 2PA7A 3FX3A 3O0VA 4W6YA 4XZPA 5CBLA 5FBZA 4AGGA 1RVF2 1W6OA 1X33A 4HFSA 2YC0A 3LGRA 2CY6A 4IV1C 5LEJA 1F31A 3NV2A 1DFQA 1AYM2 1H8TC 4LUKA 1G6NA 4AVVA 4P5HA 2QFEA 2RM21 4B4PA 4YM0A 2WNEA 3FLTA 3AP4A 1H2LA 3NAPB 2P17A 3PVNA 4BH9A 2XLGA 3EXUA 3RMXA 2K9ZA 1H1IA 2VG9A 1DGRN 4XF4A 5F9TA 1S0FA 4JGZB 4BLJA 3QOPA 1SACA 4IERA 2Q8OA 4N43C 2JG8C 1LKNA 1LULA 3J8F1 1ND3C 1VBC3 1Q56A 1OLQA 2C0ZA 1RUF1 4M3CF 1YLLA 3HR9A 4RS5A 4QQOA 4KU8A 5KHGA 4QM9A 2IFRA 1LGNA 1ZA4A 1M06G 2IFWA 3RJ2X 1TEIA 3PJQA 1LHOA 3TOJA 4Q2FA 1Z7S2 1AL0G 1Z7S3 3OBRA 5FCCA 1ZZCA 4GIQA 4F83A 1REEA 4WM7C 1YIPA 4AEJA 3LKJA 1KDMA 4QHBA 4LHNA 3VDDA 2WNUB 2VQ0A 4DS0A 4K9SA 5GLTA 2FQPA 4HLTA 4OHVA 4BQ1A 4B7KA 5BUVA 1G9FA 2WIIB 3KM5A 4CDQC 3WDUA 1WA4A 5GZFA 3TB0A 5IT6A 4Y22B 2R30A 1YI9A 3ETQA 5T3NA 3GBFA 2V73A 1HLCA 3H0OA 5C4WB 4KWKA 1CJPA 2DWRA 4CDQA 1O3TA 1Y43B 3QD6A 4AFMA 3JB8A 4K7JA 1BQPA 3H8UA 4KGQA 3WP3A 2QZ2A 3WUCA 4XMAA 1J3RA 3L2YA 1XYOA 5FLIA 4NWVA 3B94A 1ZX5A 2NMNA 1VALA 3T2TA 3VBUB 1PO13 5FMOL 1RUF2 5CFCA 4A3XA 1JN2P 1RUC2 1GZWB 3WV6A 3ZFGC 2ZAHA 1WUVA 2RS12 1UZZA 1Y3TA 3ZPYA 1RJ8A 1W0OA 1CX4A 1LOFA 4A2UA 1PNFA 1YNAA 3CJIC 5GM0A 1ZYBA 4K3UA 4MZUA 5BV6A 4D94A 5DUUA 4L99A 2RM22 1PVXA 3WDWA 3H1YA 4B7EA 5K8SA 1AR71 2XVLA 2Q30A 5KC6A 3VL9A 3PVBB 5B2GB 5KHHA 5EXOA 1VBB2 2CL2A 5GLWA 1JTZX 4XXAA 2I45A 5J96B 4XF9A 1DLLA 1PIV1 1RMU2 4Z92B 1IOAA 1H8TA 1O4TA 5FPXA 4OI2A 2PYTA 4WVMA 5KXDA 4KG0A 1AVBA 3ZXJA 4N43A 4L2NA 1Q8PA 4K1ZA 4JGYB 3VBRC 3IN9A 1QMJA 2GNTA 1LGCA 3PVOA 1JXNA 2RMU2 4ZU7A 3CLPA 1C5IA 2BPA2 2JG9C 4GB31 2XWJB 1QXPA 3NL1A 3ZFGB 3OBTA 2A5ZA 3R4DB 3V0BB 1CJDA 4E2QA 3VHRA 4M01A 5L7OA 1WMDA 1HRI2 1A8DA 4IV1A 1PO22 2CGPA 4LBQA 4E4DX 3X29B 5BNPB 4CP0A 2BGCA 2DVAA 4FT8A 3D6EA 2HWD1 4YGEA 3POSA 4YNIA 2BYVE 4RS5C 2I74A 1NCQA 1U5XA 2GC2A 1KS5A 4GULA 3RS6A 1FNYA 1OKQA 4FOWA 2RS53 3S0MA 1AX0A 1W6NA 3EBRA 4AVCA 2DVDA 4I0WB 5JOWA 1RUD3 3RSJA 4BA6A 4LULA 1OA2A 3VBSB 5BNPC 4I01A 5C8CB 1GQHA 1H9PA 4GQ7A 1PVC2 1XNDA 1COV3 5DDJ2 2A7AA 4XQWA 3PVEA 3S6PA 4YGDA 4ATFA 2P37A 5JPMB 1RGSA 4I09A 2HWC3 2HYKA 5DUVA 1O91A 2G9GA 2QNKA 4IETA 5L36A 1FMD1 3WY6A 3RZZA 4OI0A 3AFGA 1XU1A 3USUA 2WL1A 5D8AB 2BTVC 4MUVA 4OVEA 1SBFA 4N43B 4FBFA 3B02A 5ABJC 1R082 3QH6A 3KS7A 3ZSJA 1POV0 3I8TA 4DPNA 1GNHA 3GBWA 1KFXL 4FTBA 2JE9A 2R073 4HPKB 2C5DA 5LK5A 1PK6A 2XKOA 3CJIA 2GC0A 4MXVA 4GWNA 4COWA 1NOVA 1FV3A 2DU0A 1CAUA 1N1SA 3GZAA 2XUMA 2JEMA 4AVSA 4P9WA 3WNXA 2UWAA 4IV1B 3JD71 3WXPA 4JRAA 1PO21 2PHLA 5JOZA 2WA4A 2B8MA 4Q4W3 4XMIA 4C0BA 2Q1ZB 4GMP3 2GC3A 1FNZA 4D7YA 3VZOA 4AQTA 4EN9B 3MGUA 4R9CA 1W6NB 4LO7A 1QH6A 1QF3A 3MPBA 4FTSA 1XXNA 1TQ5A 1KDKA 4Q8KA 4HT1T 1Z0HA 2IXHA 2B5HA 2D6KA 1DYPA 5GLUA 1S0EA 1HV0A 3E5QA 2EXIA 3VDDC 5H9SA 1HW5A 1W6PB 4K6BA 4TYSA 1LHWA 1AXYA 4B8EA 2X8KA 4LO6B 2PN5A 4A7YA 1RL3A 4QPIC 4L11A 3ZSLA 2D97A 2HWF2 3E97A 5EWSA 1AR63 2WLPA 5FAXA 2YV8A 2E7AA 1LRHA 3PHMA 2E53A 5CA6A 1D0HA 2XPJA 1GR3A 4YARA 1ZBA3 3N4MA 1RUD2 4MVTA 4PDWB 5FLJA 1I5ZA 4XFHA 1NG0A 1BEV3 2ZGMA 4HKWA 1HXS2 2HWB2 2ZGSA 2A73B 2R042 2GMMA 3DPRB 3C2UA 5SV8A 1VAMA 1EY2A 5JR7B 4DINB 4KQ7A 3WDYA 4OHWA 2UWBA 1VBD2 4XW3A 3BPZA 4P9LA 3ZX7A 3QLQA 2HWF3 5C9AB 2HWB3 2P2KA 4KU7A 3ES4A 2FZ1A 1URXA 1PZ7A 4OHYA 4CZSA 4RR3B 2X29A 3NV4A 3MFAA 3R6SA 1X82A 3WCRA 1D2SA 2E6VA 3H1WA 1KJLA 2VOKA 2WFF1 1VBD3 2AENA 2PHWA 3KCYA 3NAPC 3LWCA 4J6GA 4YW3A 2WKKA 2H0BA 3NO8A 4YG0A 3UJOA 2R49A 3HD8B 4I0AA 1RUG2 4BPZA 1MZ6A 2AH2A 3O0WA 4HZFA 1G9DA 1DBNA 2VVDA 1RMU3 2BFUS 1DHKB 4HKOA 2D43A 5C8WA 1PGL2 1V6KA 3N7LA 1C1FA 2DUPA 3VBOA 4OZXA 4B4RA 1I3HA 3B5LB 4AEMA 4CP2A 3ZIWA 3AKTA 1A3KA 3DN7A 5H9QA 5KHJA 3VBOC 5JDBA 1J3PA 1MS0A 2LUWA 2VXRA 1IHMA 1A78A 1C8NA 1VIWB 1RUE2 5BNOA 3SNMA 3ZXDA 4AQ6A 3AMMA 2XVGA 4TSVA 4FPCA 3IIAA 1S55A 3AMHA 1Q3EA 1W6MA 4CRQA 1DQ5A 2BQPA 1PO23 1KQRA 1AYM1 3ZFFA 1SDWA 4JDNA 1WW7A 4HSLA 4I30A 5E8AA 5BNQA 4GMP1 3AKPA 5T5JA 4P9XA 1SBDA 4LE4A 2O8OA 1MVQA 4GKYA 2OUHA 1FX5A 5JOXA 1VRH1 2VU9A 3AM2A 1R091 4NN0A 1G7YA 4D3WA 4RQPA 1RUNA 1H1MA 4AHYA 3J8F3 2ZKNA 1VBC1 1H9WA 1MR5A 1OLRA 1PGW1 2WINB 5H9RA 3WP4A 3FFZA 1FPN1 5ABJB 4UW3A 1WW5A 1NY72 1ULGA 1YJKA 4Q4Y1 2WT1A 4FSJA 1G8WA 2ZX3A 3J4UH 3AYCA 2OUJA 4MGZE 4I02A 2ZGNA 1H2KA 4Y24A 2E9QA 4H55A 4LE3A 3KLSA 4YZ3A 3RG0A 3VBOB 4PIYA 2PLV3 4BOWA 4F3JA 4AGVA 4LHKA 3O12A 1HQWA 2RHPA 1AXZA 2OIIA 4N90A 1QXRA 4OLLA 2A6ZA 4MSVA 1Y9QA 1ZBA1 4YZ2A 4XJAA 4KG8A 1BJQA 3AKRA 2SBAA 5JZGA 1OQDA 1WCSA 1VBA3 4Y5Z0 2CWSA 3KT4A 2YYOA 3NW4A 2IZWA 1S0CA 1DF0A 4AWDA 4LBNA 3E5UA 1U0AA 2WNUC 1NXMA 1C5HA 5JWPA 1FI2A 2WNVB 3IPVB 5JVVA 1XRUA 4YVWA 3WOGA 1QJX2 3V0AB 3W58A 4KL1A 3MYXA 1UF2C 1NQJA 2Q1MA 3W59A 3WUDA 2R1DA 5I91A 4HVRA 4CDXC 1IZ3A 1Q8SA 4GH4B 3S30A 4R4ZA 1ND2C 1PIV3 2RS32 1KFUL 4AE2A 4Q27A 1C4RA 1XU2A 3WDXA 1XNCA 4EN6B 1BVP1 3UL2A 3R05A 4SLIA 2ILMA 3WD5A 1V6OA 3CNAA 5C33A 1HDKA 2GALA 1OPOA 1OQ1A 1RHI1 3RYPA 4G4FA 3CEWA 1U5IA 1OQEA 1G9CA 1UN1A 3J9SA 3JU9A 4AI1A 4M3CE 5DUXA 3B01A 3WP6A 1QNYA 2Y0IA 5JPNB 2QUOA 3C3VA 2DUQA 2VMHA 4IEWA 2Q4SA 4XEZA 5BNPA 4FQZA 3VBFB 1ZRRA 2ZGPA 2R6QA 1JW6A 3APBA 2OW4A 2QDNA 3CJXA 3WG2A 3EQEA 2PHXA 3RYKA 1AR93 2XB6C 3DF0A 3ALQA 2ETEA 3E6CC 4N53B 1TMF1 3L9JT 4EWAA 1SLIA 5C8CA 1WD3A 1B35B 1KXGA 4XILA 1VJ2A 2DCJA 4TLFA 4J1WA 4XFFA 2DFCA 2XBO2 2Y26A 4WVZA 5L7OC 1OMIA 4ASLA 4FPLA 1O4ZA 3M1HA 1IKPA 4IXLA 1IGOA 1GQGA 1AX2A 2GN3A 2EXHA 3BB6A 4Y22A 4EN8B 1J59A 1K5MB 2EALA 2JX9A 4YGBA 4JGYC 1N1VA 5JSPA 1UKRA 2A75A 2A6YA 2R072 1RTVA 3SMHA 1R093 4PCRA 4XPVA 2RM23 3WG1A 4YRDA 1C28A 4E27A 5K7PA 1UU6A 4I2OA 1FAYA 2HKXA 2MEV2 1OOPC 1SCRA 4M0NA 3RRDA 4PLMA 4LTAA 4URTA 4XIKA 4YGCA 2D6PA 3UK9A 1MQTC 2GNMA 1C3HA 4Q4Y3 3MIFA 4Q4X2 2LALA 2Z69A 3AMNA 5J37A 2DCKA 4WM7B 4LBQD 4UBGA 2XJQA 4FXGB 4YW2A 3TNQA 2ZA9A 1ASJ2 3ZO0B 4AI2A 2WNUA 3NKTA 1PMIA 2X53S 1ZRDA 3ZN6B 2QCSB 1RB8G 1DQ4A 1ND2A 4YM1A 3JBG2 2HEVF 1VLNA 1Q8QA 3PMSA 3VBRA 4AHXA 1J58A 4QQPA 2VH9A 2ZS6B 3MICA 4RHV2 2D3SA 2WZR3 1C57A 4Q4W1 4Y1UA 2E7TA 1UMZA 2VECA 1H1AA 1GV9A 1NE6A 2XLFA 3AP6A 2HWE1 4YVWC 2YZ4A 4BHPA 2NQYA 1QJU3 1W6QA 1GLHA 2VY0A 3ME2A 1ZVFA 1YFYA 5J48A 1LB2A 2ZAAA 4R9BA 1PZ8A 2DU1A 4QPGC 2H0VA 5CFCB 3SISA 4XIOA 1AL22 4N9HA 5IK4A 4NVPA 4YSFA 3VHPA 3ST7A 3ZDSA 4B29A 2DYCA 2R061 1TME1 3DKWA 3RWNA 3RNSA 2BNOA 4JCKA 1LOFC 4YYOA 2NZ9A 4RQPC 1H2MA 1YHFA 3WR0A 4CEWA 4Z2WA 1AYN2 3LA7A 1JUIA 5GZGA 5CFCC 2Z42A 4FOQA 3FC0A 3BOWA 2NP0A 4I3GA 2G9FA 3N36A 3WP5A 2VOVA 2D93A 5T50A 3WINE 3HBZA 3IMNA 4AYUA 1WCDJ 2VOWA 1EYBA 4INDA 4XHBA 1X8MA 2WZPP 4C1XA 3OY8A 1FXZA 1ND2B 1AXKA 3A4UA 3R0RA 4CP1A 2PHUA 4CDWB 4ISQA 3VBRB 1BCXA 1PO11 2Q5TA 3N7KA 4G3YC 1AR83 1AR82 1NZCA 1RUI3 1VBA2 1H4HA 3VLBB 1V9U1 2D44A 3D8CA 4RGAA 4GKXA 4UW5A 2Y0OA 1YWKA 2N7GA 1D4M2 3TRSB 1EAH1 1VBE1 2IC1A 1MACA 1VP6A 2XJSA 3EHKA 4EWDA 3TAYA 2WFF3 4S2GA 5A33B 4MXWA 3ZFEC 1QDCA 4LBQB 1BMV1 5AC91 2OYZA 3V65A 3D0SA 5H9PA 1D4M1 3B3QE 4KGGA 4AHWA 4YM3A 2XL7A 2D3PA 2XKPA 5CNAA 3E5XA 4COUA 2A6VA 1ZBE1 4AFDA 4R4XA 3ILNA 4LLOA 5CFDA 2AREA 4S2FA 3AZXA 3AFKA 1LGBA 3UKVA 3FBMA 1ULDA 3UKTA 5JAXA 1UPSA 4L9BA 5IK7A 1FATA 5JI7A 2HWC1 3RI8A 3I59A 3N7JA 1HRV2 2WLQA 4WM8B 2ENRA 5HCBA 4JVAA 1M4WA 3LZZA 2KXLA 3POYA 2GNDA 4IEQA 2MHFA 4NO4A 4ATEA 1BXHA 2ZCWA 1S0DA 4M00A 1LOGA 2D98A 5EYYA 3FHIB 4OFGA 5IUQA 2TBVA 5I0SA 2TUNA 3TBDA 1EP0A 1F5JA 2NLRA 2Q0AA 3ZMNA 2FBEA 1MS5A 2O1QA 4CDXA 2VVEA 1DGLA 2IXJA 3VGIA 2QKDA 4HN1A 2C9AA 3KCCA 4KWLA 1QJU1 4I3PA 1BKZA 3JD73 5D8AC 4AK3A 2XWBB 4H3WA 3DUIA 2NYYA 3GHNA 5T52A 3RPQA 1H8VA 3JQXA 1NXD1 3OD0A 2ZMLA 3DPRC 4HK8A 1COV1 3AP7A 1FOD2 2JXAA 2OPKA 3R4UA 1ENSA 1APNA 3HN1A 1V6LA 4RHV1 4MYEA 4CDUB 2JDZA 3FMGA 1KJRA 4CEYB 4HL0A 1S0GA 3ILRA 2SLIA 4Z8BA 1GZCA 2IXCA 4IV3A 4OUMA 1V70A 1LOBA 1N3PA 5EJ3A 1DGWA 4BE3A 3M3CA</