2YYSA

Crystal structure of the proline iminopeptidase-related protein ttha1809 from thermus thermophilus hb8
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
284
structure length
284
Chain Sequence
b'MREEIGYVPVGEAELYVEDVGPVEGPALFVLHGGPGGNAYVLREGLQDYLEGFRVVYFDQRGSGRSLELPQDPRLFTVDALVEDTLLLAEALGVERFGLLAHGFGAVVALEVLRRFPQAEGAILLAPWVNFPWLAARLAEAAGLAPLPDPEENLKEALKREEPKALFDRLMFPTPRGRMAYEWLAEGAGILGSDAPGLAFLRNGLWRLDYTPYLTPERRPLYVLVGERDGTSYPYAEEVASRLRAPIRVLPEAGHYLWIDAPEAFEEAFKEALAALVPALRGPL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proline iminopeptidase-related protein
publication title Crystal structure of the proline iminopeptidase-related protein TTHA1809 from Thermus thermophilus HB8
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Structural genomics, unknown function
total genus 94
structure length 284
sequence length 284
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2yysA00
2AJDA 4RE5A 4LIPD 3AIKA 2B61A 3L1HA 1L7QA 1O6FA 4UHFA 5CT4A 1FSSA 1UZAA 3A2LA 3F9CA 5AOCA 4OUKX 1SC9A 3G0BA 3KDAA 5HKBA 3ESCA 4J0DA 3STYA 4DTCA 2J4CA 4J0HA 1U65A 4ZGBA 3IVMA 2ACEA 3DL4A 1WHSA 1L7RA 3BJMA 1VJ5A 1YS1X 4EY6A 3KXPA 5DJ5A 1TCAA 1QO9A 2DQYA 4MQMA 5I9IA 5CURA 1PJAA 3X3HA 1SCKA 2XE4A 4L72A 3VJKA 4DMKA 1R9NA 4RPCA 2E3JA 1JJFA 2GZSA 3DOIA 4Q3KA 1X70A 3G9XA 3AZQA 2P8SA 3HEAA 3G7NA 3M3DA 3WZLA 1T4MA 5SYMA 5E4JA 4CCYA 4FDMA 1AMNA 2HHAA 1R50A 4GXNA 1QIGA 3I6MA 4LXHA 2R11A 2G4LA 1CQZA 4F21A 4QDXA 2FX5A 5C7YA 4B0PA 1ZI9A 4RE6A 4Y7DA 1EDEA 3WWCA 4OB6A 1W75A 5K3AA 5E2IA 3OC0A 4Q82A 4KR0A 3C87A 4GECA 5AKLA 4BCCA 3OURA 1FFBA 2HFKA 5HF6A 3QMMA 2RHWA 4CIAA 3C5WP 4HZGA 3QPCA 5A71A 1DINA 4UBNA 4YX9A 2O2HA 2WTMA 1RYYA 1XZFA 1J07A 2JGIA 2RHTA 3W2TA 5HK9A 2AXEA 5AIAA 2WUEA 3KWFA 5T4BA 3H0CA 4A5SA 2WIGA 2ECFA 2WTNA 4PV7A 3PUIA 2V97A 1FFDA 4G4IA 1QIMA 2PSEA 4MQLA 3H1AA 2WG2A 5LIPA 4LKOA 1WCYA 2OAEA 4EA6A 2OXEA 4UUQA 1HBJA 1U4NA 4UFPA 4FFWA 4E46A 4W1QA 5ALVA 4GW3A 1XROA 2DFPA 3R3WA 4MXDA 2WILA 4X6YA 3JW8A 4OU5A 5JD6A 3DYIA 5AKYA 1M33A 3VVLA 3SK0A 5ALQA 2PVSA 5DLPA 4B81A 2HA4A 5CH5A 1LLFA 3GROA 3U0VA 1HDEA 2QVBA 4N8DA 4OYYA 5AI9A 3I2JA 2OCKA 2Z3WA 5ALPA 4MEAA 3E0XA 5EIHA 3ZWQA 1UKAA 3GELA 5FOQA 4FFVA 3DNMA 1VE6A 2QXUA 5ALJA 1JJIA 3C45A 4J0KA 2WIKA 1MTZA 4BTVA 4EY8A 2GYVA 1AC5A 3ZLTA 2C7BA 4BAZA 1CUDA 3HSSA 4UPDA 3DCNA 2XUOA 5EIAA 4LHEA 5AP9A 1DWPA 5AKIA 5D3ZA 2CMFA 4AMZA 4XX1A 4M0EA 3B5EA 5ALLA 4F5ZA 4BAGA 4B6GA 5C8XA 5ALNA 3G0CA 3QM1A 4JEIA 3R41A 1P0MA 3WA6A 4GEGA 4G5XA 5FXMA 3WYNA 3R3VA 3R3ZA 2PPLA 1K5PA 2K2QB 4C01A 5IVKA 2QJRA 4G8DA 2PSJA 4KJXA 4Y2UA 2OG1A 3ZV7A 2C4HA 5D3KA 2V98A 1EH5A 4J0JA 4B9EA 4Y2PA 1N8SA 4DSZA 4D9JA 3DDUA 2WG1A 3BDIA 5JANA 1AKNA 2XUHA 2WUDA 1XLVA 2WUFA 2VT6A 2NW6A 1WM1A 1U8EA 1EVEA 2G63A 1H2YA 4MWTA 3V1NA 2XMQA 5FUMA 5AM0A 5DNVA 3K6KA 4IH1A 1A8QA 4N8SA 4DNOA 4DMHA 3FYUB 2GYWA 1MNQA 2ZVDA 5T4FA 4AXBA 2JGMA 1XRLA 3DYVA 5CT9A 1CUVA 4KE7A 2XMBA 3H1BA 2O2IA 3ANSA 3NUZA 5DYWA 1C4XA 1ZJ5A 5FKJA 1YAJA 4B83A 4G9GA 3O4JA 4UBJA 2CZQA 3B3QA 1QFSA 5HCUA 3ESDA 3I2HA 1VKHA 4UBKA 1AQLA 4KE9A 3HYSA 4UBLA 5ESRA 1ACLA 3PE6A 1EVQA 1QTRA 1GPLA 1Y7HA 4Q05A 5DWDA 5E4TA 1KU6A 3FCXA 1GPNA 1WB4A 3FSGD 3WWDA 1X2BA 2BAGA 1AUOA 1THGA 4H7DA 4WDQA 5CXXA 5K3FB 5JZ9A 2Y2VA 1VOTA 1MT3A 5LZ5A 4M0FA 5AKGA 1XQVA 2OCLA 4INZA 5AM4A 2HA7A 5ALFA 2Q0XA 4ZWNA 5KREA 3BF8A 3D3NA 2WJ3A 4CG2A 1SCIA 3EBLA 4BC1A 4KRYA 4BCDA 1CRLA 1CV2A 3DEAA 2XUAA 4WFJA 4B7ZA 3I28A 5K3CA 1QIIA 3LP5A 3TEJA 1QE3A 1CUCA 1E8MA 2J3DA 1SFRA 4J3JA 5AI8A 3AZPA 4BB0A 5BWCA 1LPSA 1CEXA 4G9EA 1HPLA 4PNZA 1USWA 5H3HA 1ZD5A 1BROA 1Y37A 5JADA 1TRHA 4UHHA 5JARA 1HLGA 1LZKA 2WJ6A 4KE8A 4CIBA 5LZ4A 5HF5A 1LPMA 3QH4A 2C5GA 4C4XA 1YAHA 5FRDA 4P9NA 1K4YA 1QIHA 2OGZA 2J3QA 4BP8A 7YASA 3KOOA 1Y7IA 3OPMA 1R9MA 2YASA 4Q34A 3AJAA 1FFEA 4L3WA 4OPMA 5AK4A 3E4DA 2BGNA 4G4JA 4WY5A 1GGVA 4AZ3A 4Q3LA 1CVLA 5CT6A 2EDCA 5CT5A 4RNCA 5AO9A 3K9BA 1T2NA 3VKFA 1C7IA 2VA9A 2JGJA 3W04A 4H7EA 1ZIXA 3C6BA 1DX4A 2PKYX 4F0JA 5HFNA 3P2MA 5ALSA 1CUXA 5EIEA 2Z5GA 5AM3A 1XZLA 4N5HX 3GA7A 5BWBA 1DQZA 4WCVA 2WJ4A 4FLMA 2CKMA 5AKKA 3IDAA 1GKKA 5YASA 3ZLVA 1A88A 3D2CA 4C4ZA 1XZEA 3F96A 1W76A 2XMDA 1ISPA 1D07A 3V9AA 2QM0A 2WHRA 3FVTA 2CBGA 1TQHA 3PF9A 3FYUA 3O4HA 3STXA 3VJLA 3AUKA 3MVEA 2XUDA 2ZJ6A 3F97A 2HU8A 4JUIA 1IMJA 1BN6A 4JYMA 4MJ3A 1UK7A 3ED1A 4JNCA 1ZICA 5AICA 2CB9A 3N0TA 1MX1A 1GZ7A 2Y1KA 1AZWA 1CUGA 3ESBA 3WKAA 1LGYA 1XQXA 3OM8A 1QIJA 4EUSA 5IVDA 4Y2YA 1YA8A 3T4UA 3QPDA 5F4ZA 1CQWA 1OXMA 2Z3ZA 3R40A 1QGED 2PU7A 3BIWA 1YA4A 3FOBA 3BWXA 2H9YA 3M83A 4OCZA 4A16A 1JI3A 2Z8ZA 3H19A 3IULA 4TVKA 4GDMA 1JMKC 4CG1A 4JYPA 5D7BA 5JAUA 4K6KA 4AMYA 1FFAA 3EQ9A 4RGYA 4QDUA 1JFRA 5LLSA 3PI6A 2WFLB 3KSRA 1F6WA 3D0KA 4E14A 1JU3A 3PICA 1J1IA 5ALWA 2VATA 4H77A 2OQVA 2Z8XA 1QIKA 1WOMA 1CR6A 4K2AA 1XZIA 1L7AA 2RONA 5IVIA 1F0NA 2G5PA 5IVHA 1XZDA 3NGMA 5EHQA 2EDAA 5CRIA 2XMGA 5BOVA 1XQWA 1XLWA 5AOBA 2QKYA 1OCEA 4X3CA 2PM8A 3HABA 2ZYSA 2C0PA 4HXGA 1SCQA 3WKDA 1XZAA 4ZRDA 2IIVA 1J06A 2QMQA 4Y2XA 1KEZA 3WKBA 1P0PA 3D59A 4KACA 2ZSIA 3CN7A 5AI4A 4G4GA 3WI7A 1ACJA 2QS9A 3F67A 4TPKA 3W9UA 1XZJA 3A70A 1ZOIA 4O08A 4BP9A 2GBIA 1UKCA 2B9VA 4U2BA 4DNPA 3LLCA 2FJ0A 4ROTA 1BCSA 4BRZA 1WHTA 4LXGA 5ALEA 4HAIA 1N1MA 1W4LA 3D2BA 3E1GA 2WQZA 3C70A 2RIPA 1CUZA 3LS2A 2FUKA 3V1LA 4UHDA 3FYTA 4DM7A 2JGFA 2HFJA 1YCDA 3O4GA 4ZV7A 4H35A 4J0GA 5AI5A 2WUGA 2QOEA 3MUNA 4C6HA 4W1RA 5SYNA 3MGAA 4C4YA 2GBFA 4W1PA 1W52X 2QTBA 1BN7A 2VEOA 3DS8A 3G0DA 5DYTA 3RK4A 5EI5A 1ZD2P 2WG0A 3IUJA 2QT9A 2AJ8A 1QONA 1GQRA 3IB3A 4OSEA 4P93A 5KBYA 3QITA 4N8EA 3A2NA 1XZBA 2OQIA 2VQ6A 1LPAB 3QBJA 5CBKA 3F8SA 1H2WA 2X8BA 4UHBA 1MO2A 2GBCA 1ZJ4A 1IZ8A 5CH8A 1VLQA 2XDWA 3WKEA 5HZGA 4NMWA 3AINA 3RARA 1LPPA 1AX9A 3L1IA 5LZ8A 3OOSA 3WL5A 2LIPA 5KWJA 2PU5A 3D7RA 4AX4A 3I6ZA 2PSHA 3B12A 3H04A 1XRNA 3PF8A 2OGTA 2C58A 3FWHA 5JZBA 2XUPA 2BUAA 1BS9A 4ARAA 2DCMA 2WU3A 3CN9A 4U2DA 4W63A 5JAPA 3NWOA 1E3QA 3R0VA 3WWEA 4EZIA 5FDFA 2ONCA 2WHPB 1CLEA 1NU6A 3E3AA 4KE6A 5A6VA 2WFLA 1EDBA 3HZOA 1EX9A 2G5TA 4EY5A 2I3ZA 4G8BA 4BATA 1UK6A 2V96A 4BAUA 1TK3A 3O0DA 1XLUA 5LP1A 4W9RA 4OU4A 4LYEA 5A2GA 5A7HA 4BE4A 1K63A 1XKLA 2AJBA 1J2EA 4UFNA 2VT7A 1TCBA 3RLIA 4B80A 3IIIA 1LBSA 4A23A 1ODTC 5HKAA 1MX5A 3WIOA 3W06A 4AQDA 3A6ZA 2DHEA 3CCBA 5ALYA 1XZGA 1BEZA 4H18A 2QZPA 2QR5A 1VA5A 3EQ8A 3AFIA 4B85A 3O4IA 3H2GA 3AIMA 4Y2VA 1CUSA 3FSGA 4QDOA 3RKSA 4DGQA 1LNSA 1FJ2A 1GQSA 1MU0A 5JALA 3O9MA 4X90A 5AK5A 2W22A 1WB6A 2CUTA 3FVRA 4FOLA 2JEZA 4E15A 2GZRA 5FPPA 4AN1A 1TCCA 2J4FA 2ACKA 2XUFA 5EGNA 3FAKA 1DX6A 3WK5A 4EBBA 3GZJA 5J3JA 5LZ9A 3C6ZA 1DT3A 4KAAA 2VF2A 3O9VA 4EY7A 1EK1A 3M81A 1XZHA 1CUEA 3HJUA 3GBSA 4IHAA 4QZVA 3A2MA 4BE9A 2HRRA 4K6GA 4X92A 1R3DA 4J0IA 4QE3A 4FMPA 1UWCA 1NX9A 1XRRA 3BDVA 1XKTA 3EQ7A 3RM3A 4J03A 1LPNA 1RP1A 5ALUA 1XRPA 1W1IA 3L1JA 1LZLA 4N5IX 3WK8A 1E8NA 5JYCA 1LPOA 3D2AA 3H2JA 3F98A 2WIFA 2B20A 3WJ1A 3VISA 3FLAA 2XUKA 4NZZA 1Q0RA 4PQEA 1VA4A 4ETWA 4IO0A 4FKBA 2OLEA 1IUOA 1ODSA 2VAVA 5AKZA 1EI9A 2UZ0A 4Y2SA 2VAXA 2WKWA 1VZ3A 3NOXA 2BFNA 5FP0A 2O7RA 3TJMA 3QZUA 3DKRA 2XUGA 4XJVA 3EIOA 4HTAA 2WSLA 1NU8A 1VE7A 2B4KA 2ZJ7A 4JH0A 1B41A 4CG3A 5ALOA 3QMWA 4AB1A 1QJ4A 3STTA 4AN0A 4L0CA 3HLKA 4QWWA 4M0MA 5AKHA 2PSDA 2V9ZA 2Y6VA 2PX6A 4DIUA 5LKAA 4S0XA 5AM5A 4ZI5A 3ANTA 4QDTA 3PFCA 4UBOA 4PSCA 4KEAA 4B84A 1HQDA 3DLTA 4H7KA 3S8YA 1H23A 4BRSA 2D0DA 4B82A 2WHPA 1QO7A 4QA9A 3JWEA 5K3BA 3H2HA 1TKRA 1UOQA 5CH3A 3QVMA 1SOMA 2ZYIA 3LIIA 2QXTA 1E66A 1WPXA 4V2IA 2HA6A 4I4CA 4P08A 4QNNA 1EA5A 4BCBA 4X97A 5AKJA 2HU5A 2DHCA 3D5EA 2XMRA 2QUBA 3WWPA 1F0PA 1VXRA 5EHZA 1ODCA 2WIJA 4C88A 5K3EA 4BBZA 4C87A 1CIJA 4YASA 5AKXA 4LYDA 2CEKA 3ZI7A 1F8UA 3U1TA 1UOOA 1IZ7A 3HI4A 1JU4A 4BC0A 1H2XA 4BVLA 3VJMA 3G0GA 5BV7A 2XQFA 3WLAA 2XQGA 5JASA 5DNUA 2ROQA 5LYYA 5HFAA 2IX9A 3GUUA 4XWGA 2HA0A 2HA3A 2GBGA 3I1IA 2X5XA 1EB9A 2WLSA 3Q8WA 3FLBA 2X76A 5DTIA 4TGLA 4BZWA 1P0IA 4HVTA 1P0QA 2ZJFA 4DLNA 5K3DA 3WK6A 5K3FA 4AO8A 3SWWA 1AGYA 3KD2A 1UOPA 2ZYHA 5HF9A 5LZ2A 4PF1A 4MWSA 2ZYRA 1MJ5A 2WFZA 1QIEA 4FHZA 3CCCA 2IITA 2HRQA 3HRHA 3VVMA 3HXKA 3C6YA 2HDWA 1G5FA 1MX9A 2HA5A 2DQZA 2HL6A 3FYUC 4OB7A 2WU4A 5DNWA 5C81A 4GBGA 3QYJA 4Y2JA 1VXOA 1E89A 4WDRA 4X91A 1QTIA 4HXEB 1G42A 2DR0A 2RAUA 5JAHA 5HQ3B 1DWOA 4H7JA 5C8VA 3G9ZA 3W9BA 1OILA 3PFBA 2JGKA 2XQIA 4FNMA 1EHYA 5AM1A 2WM2A 3VXKA 5FLKA 2GYUA 2RGUA 1MAHA 1CPYA 3W05A 4ARBA 3MUOA 3V48A 1Q84A 5AHXA 3ZPXA 3VDXA 4ZV9A 1CUUA 1QLWA 5CMLA 2XQKA 3STUA 2XQJA 1WPRA 2WFMA 5CXUA 5ISMA 5HK8A 3QPAA 2H1IA 1XRMA 3R3YA 4NVRA 3G9UA 4L9AA 2YH2A 2I03A 3WL7A 2XMZA 5C8ZA 1O6GA 1DTEA 3AZOA 3DKKA 3I2FA 4YK7A 4X71A 5ALZA 1Q0ZA 3R3UA 5D6OA 3CXUA 1THTA 2PSFA 2OCGA 1ETHA 2O2GA 1UFOA 1H2ZA 3C43A 1ZD4A 4H0CA 3C8DA 4Y9SA 1CFJA 2PUHA 1B6GA 2BKLA 2JEYA 4DYHA 2OPHA 3WWOA 5JZSA 5T4HA 4U2GA 2HA2A 1ZGCA 3FNBA 3PDCA 1U2EA 3IUNA 1EXWA 1CUFA 3OTQA 1UKBA 1BU8A 5EHNA 2HADA 4Z49A 2XB6A 3C6XA 3EF3A 1LBTA 2FJPA 3IURA 4Y2QA 4OD0A 4PSUA 5HF8A 3WKCA 3ESAA 4DNFA 1LPBB 5I8PA 1QFMA 1YSCA 5DYYA 4NS4A 4DSAA 1PFQA 1H22A 4IH9A 1MPXA 1N5RA 3WJ2A 1EB8A 1CUYA 5K5EA 1XZCA 4UHCA 2D5LA 2PUJA 3G02A 2H7CA 2QRUA 2PBLA 2JGEA 4GI1A 3AILA 1GT6A 3YASA 1EK2A 2ORYA 4QEKA 2H7YA 3BL8A 3LCRA 4OB8A 1A8SA 2I78A 1XQYA 4DMFA 3LIPA 4QDZA 1ZD3A 5DTJA 3K2IA 1A7UA 5ALRA 2HU7A 3WL8A 5JATA 1S8OA 2BCEA 2XMCA 3HC7A 5KWIA 1K6EA 3IA2A 4MYSA 2JIDA 1CUJA 4UHEA 2WHQA 1YR2A 2OCIA 3SX4A 4B9AA 3WK7A 5JD5A 3OG9A 4E11A 5JAOA 1E5TA 3I2IA 1WB5A 1Q83A 4U2EA 4H7FA 3O95A 2OGSA 5FPQA 3BF7A 4FLEA 1ORWA 1XFDA 1K8QA 3I1YA 1MAAA 3BIXA 2ES4A 2PL5A 4MYDA 3I6YA 3H2KA 4IH4A 4X85A 1BE0A 2QUAA 4FLFA 2CJPA 2W6CX 4QLAA 1YB6A 2YYSA 4X00A 4J0CA 1CUWA 2VJBA 4X6UA 4PSDA 4GHWA 2OAGA 1ZIYA 4K5QA 1UT6A 3STVA 1DU4A 4GLBA 4Y2RA 4K6HA 4X6XA 2JF0A 1TIBA 4HXFB 5HQ3A 1EDDA 5E4YA 5AM2A 1GPKA 3WZMA 1R88A 3WA7A 2VJDA 5A7GA 2XUJA 5AK3A 2R8BA 4BDTA 2VJAA 4Q3OA 2XLCA 5ALGA 2HIHA 4BZZA 3DQZA 4FBMA 4KRXA 5EFZA 4ITVA 1EINA 3G9TA 1R4ZA 3GFFA 4BDSA 2Y2UA 5A7FA 3UUFA 4FBLA 1IUNA 3BE8A 5AI0A 3TGLA 3STWA 3ICWA 2AJLI 5A62A 5JD4A 1ZI8A 4HS9A 4G8CA 3AIOA 5CTAA 4DMCA 3DD5A 3IUMA 4MEBA 4G1FA 3WMRA 5IH7A 4QWMA 5AH0A 5LZ7A 3PUHA 3ICVA 4AZ0A 1UK9A 3DL7A 1YS2X 1G66A 4CI9A 5ALTA 2I3DA 3WL6A 4BVJA 5ALDA 3WYDA 4BYMA 1TAHA 3WIBA 4Q1VA 2HM7A 5ALIA 3TRDA 3DOHA 4I19A 4CFSA 4C89A 1ORVA 4X7BA 3UUEA 3SC2A 2XT0A 4OYLA 4DNQA 1GKLA 4ZXFA 2DHDA 5AKEA 4HRYA 3G8YA 5ALHA 1QOZA 2C0QA 3JYHA 5EHXA 5T4EA 3UMJA 1A8UA 1IVYA 1ZGBA 2YXPX 3KWJA 1N5MA 3H2IA 1BCRA 4CCYB 1JKMA 1BEEA 4WJLA 5JIBA 1JMYA 4BTLA 1I6WA 3Q0TA 3WK4A 1DQYA 4B0OA 1Z68A 2C5FA 4KAJA 1R1DA 4U2CA 2QJWA 4J7AA 1IUPA 5ALKA 4KYVA 2BUBA 4UBMA 3I2KA 3D4LA 2BGRA 2XMSA 4YPVA 1ZI6A 1GXSA 3C5VA 3IUQA 3WK9A 1XZKA 1DT5A 3ZLUA 2XI4A 5ALMA 4PW0A 4FWBA 5CT8A 2WIDA 5AIBA 1KU0A 1RWQA 4XVCA 2BJHA 4HRXA 2Y6UA 1C7JA 2EEPA 1W6RA 1MNAA 1HKHA 3H17A 4WY8A 4U2FA 1QIDA 4WFKA 3I2GA 2DSNA 4AO7A 1HL7A 4AO6A 4KAFA 1FFCA 4QLOA 3T52A 1YASA 4X94A 1PV1A 2XUQA 4I3FA 2VSQA 2AJCA 3N2ZB 4W1SA 5ALXA 3M82A 4GWLA 1DWQA 3V1KA 4F60A 2O7VA 6YASA 1YB7A 4UFOA 4FTWA 4PO3X 1UK8A 4EB0A 3DJYA 1JT2A 3ILSA 4X93A 1JJBA 3G0IA 4XIIA 1BRTA 1VZ2A 5CW2A 1UXOA 5FV4A 1X2EA 5LKRA 1XRQA 1XZMA 4WFIA 4H7IA 2RI6A 3S2ZA 4Y2TA 5AK6A 3BJRA 3FLEA 1CUBA 5AI6A 5AJHA 3IBTA 4FNGA 3C8HA 5IKXA 4EY4A 3R3XA 2XLBA 1MN6A 2JBWA 4P92A 3QMVA 2VTVA 2BUCA 1QIFA 1CUAA 4LXIA 4CCWA 3H18A 3HACA 2VJCA 3FCYA 1CUHA 2XUIA 1AURA 4X95A 4UBIA 1E8DA 1QZ3A 4H7HA 2ZSHA 1CUIA 5I7UA 5AOAA 3WQHA 4IQ4A 4ZREA 3V1MA 2JGLA 4BVKA 3BXPA 3FBWA 4EHBA 2H7XA 1G4HA
chains in the Genus database with same CATH superfamily
1R0RE 1KQOA 1ZVQA 2B61A 1Q3TA 2Y67A 5GIOE 3PKIA 3T7DA 1JEDA 4YV0A 3H3JA 2G6TA 1L7QA 3AI1A 5LA6B 2B98A 1MAUA 1RRPA 2O5VA 2WD8A 2JK1A 3DB1A 5HQTA 2ZUVA 3U19A 1T0HB 3GXBA 1Z5NA 3LPCA 1B3RA 3Q3JB 2OYCA 2IYOA 2DQ4A 3B6MA 1GRVA 5BW8A 1JIJA 3H7AA 4CMHA 1SC9A 2TYSB 3DOOA 3WGGA 4N5LA 1MOPA 3QLTA 5AW8A 2BFDB 2VOEA 1JYSA 2ECKA 4J0DA 3V97A 3AVXA 1VL5A 1TT7A 2IU6A 2QMUA 3QKIA 4KZPA 4OL9A 5CVCA 2ZBUA 3OU7A 4E2XA 2FWNA 4W9NA 5AVUA 1CBUA 3IAS6 3LWBA 3PGA1 3DL4A 4Z7JA 1A98A 3I9FA 4XDGA 2RG7A 3DFKA 1YS1X 2IS4A 4MV8A 5DJ5A 3HCAA 4KIUA 4YS6A 1QO9A 4D8XA 2FI1A 3D31A 2AFIB 4QXPA 1RIIA 4KMMA 1GPDG 4NH4A 5LJIA 4P4UA 1SXJD 3MGKA 4TTTS 5DYGA 4RVCA 3R0ZA 1Y8AA 1WZIA 3NHSA 5F9HA 2XE4A 3HB5X 2A67A 3T3IA 4HNAB 4TUYF 2X14A 5C8DA 4LNHA 5KJ6A 2Y1CA 4D3ZA 1JJFA 2UZ4A 3Q3VA 4Q3KA 3ME5A 1IVNA 2WYIA 4GFDA 4E6EA 1CS0A 1L7PA 1X70A 5JLAA 2VHVA 2WYVA 3T06B 3KOXA 5JS7A 4B33A 3QW4B 1NV9A 1OU4A 3V2UA 1BX0A 1BX3A 1C3XA 1YBHA 4DSNA 3EPJA 5FOWA 1H2AS 1QUFA 2X1MA 1G4UR 4KREA 1E63A 2ZSJA 1X7YB 4MS4B 1U6IA 1AMNA 2HHAA 3R5XA 1R6BX 3OT5A 1JN0A 1SVWA 3AF2A 4XQ9A 3OEEA 4Z4GA 2DJ5A 1YI0A 4GXNA 5L3SB 2DBQA 2ZJ8A 1D4FA 3C8UA 5KHLB 5JBNA 3KEQA 1HEUA 2LGJA 2ID7A 3HRKA 3UJBA 2YWGA 3VO2A 3X2SA 1BW9B 3A3NA 3HADA 3I6MA 4X60A 4EPTA 2R11A 3MCVA 1DP4A 5JTTA 5JCJA 4F21A 4C0JA 3A6FA 4Q5IA 3FPBA 4QGBA 2GMWA 1NI3A 3N8DA 1JDBC 2FX5A 1HYBA 3G82C 4EDHA 1AOXA 4TTIA 3L82B 4BLRA 3T9FA 4DCVA 1SU7A 1ZR4A 4RE6A 3VPBA 5AHRA 2YMQA 4Y7DA 5FTWA 5FL7D 4NCJA 1X8KA 1KBQA 1GM5A 3DMDA 5IG2A 1IY2A 1VPLA 5D01A 4IZHA 4URXR 1TMOA 2JD1A 3Q7RA 5TNXA 4GECA 4B4KA 1AV7A 4V0ME 4D4LA 1KMQA 2FMTA 1YRAA 1P2UA 1Z45A 1YL5A 2RHWA 4IM7A 1Z4JA 5EUCA 3G2IA 4D5EA 1H4QA 1NRWA 5C5IA 5JWRA 4YN3A 3L7AA 2HTEA 4M60A 5A71A 3AHHA 4CQLB 3LVBA 3LPAA 1VYUA 2O2HA 3EA4A 2P0YA 2FPXA 4GE3A 4GVXA 4QBFA 4TWJA 3W2TA 2RHTA 3FOAA 1B15A 3ZHZA 3DT9A 1U8UA 4J76A 1G3UA 3ZJVA 3TLYA 1VPEA 2IYSA 1TJ3A 4J7UA 4RIGA 3KWFA 4MO2A 3C7KA 1FB5A 3PCXA 2HSWA 3E5NA 3IQWA 1PW5A 1Z28A 3OMWA 2ECFA 1SQSA 2DAPA 3WB1A 2VTEA 1XTIA 2RHRA 5ED0A 4TMYA 4B7XA 5I4KA 3B3GA 2JFGA 3OPYI 1UJCA 2QNIA 5DTRA 1XVVA 3TQQA 3FN4A 2BM0A 4BFCA 3FPEA 3BGIA 1BMTA 3K1YA 3F4BA 1G8PA 4G4IA 2ZTVA 5FFNA 2AYZA 3D8RA 1RU3A 4MQLA 1L5GB 1N0WA 3K6SB 2X42A 1HG0A 2P1DA 1G2OA 3NKVA 4ZT3A 3N3AC 4MKXA 1XWIA 4KWHA 4D45A 1FLAA 1WCYA 2GHIA 2OAEA 2N9UA 2R8RA 3DV0A 5EEHA 2OCPA 3ILXA 3ABZA 2WI8A 3KQVA 1U4NA 1L5RA 1SVIA 1WA5A 3DOCA 3GJSA 5BWNA 3E9MA 5LU8A 4O4JB 4RHCA 1U0EA 3D3KA 1RCUA 4U7DA 4GKKB 4JELA 1HDZA 1KY4A 1ZRSA 3OD5A 3DPSA 5ALVA 2CDCA 3S2YA 4US0R 4TYMA 4DJFC 1XB2A 1HUQA 2GILA 1SUAA 2PGOA 5C3UA 2ZBFA 5HZHA 1M5RA 1PKXA 3DLBA 4B4VA 4EB8A 2J3IA 7REQA 2WAMA 4RTJA 3TX6A 2BLLA 1Z3CA 1T24A 1CY6A 1UZUA 3MCWA 3DBRA 3VZBA 4DLSA 1MZPA 2Z57A 3JW8A 1AKQA 2F1HA 2XITA 3G5UA 2H1SA 3JQ8B 4O1IA 5KNCH 4OU5A 2K7FA 2C9CA 4M1KA 2HPAA 3D8NA 2QI9F 3PNPA 4CZ2A 2PA0A 2ZUBA 1MF7A 3CLHA 5A6SA 1TXGA 4L08A 3D02A 1FDVA 3SK0A 5ALQA 2YHAA 2FUCA 3JYNA 1PWHA 2OK7A 4AKGA 2DWOA 4G63A 1HI9A 2HA4A 3U17A 5AW1A 3E9RA 3IQDB 4K86A 3TR0A 2QSYA 2OGUA 1QC5B 5B3LA 2BEWB 5P21A 2OTCA 1HDEA 3QY0A 5BQOA 2WT4A 3PEEA 1Q12A 4XGNA 3THXA 3REFA 2ZB2A 2HO4A 5KHOC 4D6YA 2NVOA 4JL8A 5E7QA 1ZUHA 3UAYA 3UXEA 3ZGXA 3ZHUA 4BKRA 4LA4A 3FVWA 3RYCB 4TOIA 1SBYA 3QE4A 3T1OA 3HDJA 5EIHA 2Y0CA 2R47A 1RRKA 3ZWQA 3HB7A 5JSZB 5LNK1 3AHGA 2QLBA 2OHHA 1WNTA 2WZQA 4E2ZA 4GOJA 2PMBA 4CEJB 1JWAB 4IEEA 3ED5A 5FOQA 4FFVA 3DNMA 1WU7A 1VE6A 2VHYA 2NOAA 2BTOA 3JZAA 5D3MA 2QXUA 2QGFA 4YLGA 1B6RA 4TN1A 5L3ZA 3GDHA 2DPGA 4FOOA 3C45A 1E98A 3DDNA 4TTJA 5DBIA 4QG7A 4NJMA 4EG6A 2ZYUX 3CH6A 2HIAA 2ODWA 2WUVA 4FYWA 1C1YA 2ZPTX 1L6IA 3DL2A 3PXGA 1U11A 1FYEA 5CVTA 1GGNA 1YH3A 2E9SA 3CRQA 1C8BA 1J0XO 1Q92A 3E1SA 4BTVA 2K6GA 1GL9B 1UXJA 4H08A 3ZLTA 5BWLA 2C7BA 4XZ3A 3TPCA 4D0NA 4C07A 3ABSB 5CNJA 4DM3A 2CZCA 4FKMA 3SFVA 1QH0A 3S1SA 4Y8VA 3HSSA 2FZ5A 4N54A 4KHPB 2NGRA 1F7UA 4UPDA 3DCNA 3L7BA 5H80A 3CXRA 5AP9A 5B7QA 5AKIA 1FNSA 3FW1A 3TRHA 5BRJA 2XZTA 5EWJB 1H4TA 4PFSA 2W98A 1RWPA 4MVJF 3L8GA 2MSNA 3KT8A 4Y7CA 4QUBA 4AT1A 2Y9PB 1DOHA 4F5ZA 1G5IA 2BMAA 4FPXA 4B6GA 4FFLA 4D43A 5KTTA 2ZYVX 1C9DB 4O5OA 1I4LD 2XX3A 5TPWA 2ACWA 3WGJA 4DV6B 1Z3IX 3AP1A 4HUJA 4BMDA 1KEVA 3P2EA 1BS2A 5AHOA 3L6RA 2FK8A 3QA3E 3SYMA 1GCIA 4JEIA 2AQ8A 2G72A 2XUZA 4Q0MA 5ARCA 3R41A 1P0MA 1NFQA 4M38A 5J5VA 2AFHE 3DFMA 4NX2A 4BO9A 1K08A 2QN7A 4F85A 5BR7A 1U5BB 3PGMA 5HR5A 1CB0A 2Y0BA 3B1KA 5IUJC 2JJMA 4MWDA 2BFDA 3ZXIA 3MFQA 3R3VA 3A0UA 3BCUA 2VOJA 3QA9A 3ASUA 1RLMA 3QG1A 3S29A 4ETMA 2A2ZA 3UK0A 2VQFB 2IOHA 2PJRA 1A2KC 4DBZA 1D9ZA 4F7WA 1Z8FA 2B37A 3ZJYA 4JLDA 1M6YA 4QX6A 3REQB 2P67A 2XA9A 1K5PA 4IHJF 4HNTA 4XJSA 3T5TA 4MNTA 4YACA 4MRVA 2HHCA 3WVNA 3H5LA 4G8DA 3RF6A 3CVVA 5BSFA 3V55A 3PXDA 4WBNB 4KJXA 2J46A 3J81A 1RADA 2OG1A 4XAQA 4HL6A 1H94A 3L06A 1RC8A 3HDGA 1G63A 5L3RA 4D25A 1EH5A 2GLXA 2WP0A 1NIPA 4IBOA 2D7DA 1X39A 2NP7A 4Y2PA 1P1KA 3LHKA 3BRQA 3L0SA 1TF7A 2F17A 4HNAA 1EFPA 1Z2PX 3DDUA 1K4MA 3D8BA 2CJWB 3RD5A 3TIGA 1KI7A 1U9IC 4AJNA 1XLVA 2WUFA 1U0BB 2JAUA 3U9TA 1X1SA 3QFFA 3F4LA 4S2UA 5KOHB 2VT6A 3KX2A 2O20A 1BVRA 1UJBA 4UUMA 4D8YA 2XKJE 2GCOA 1WM1A 1YK1A 2ZUCA 1J39A 1SPXA 1U8EA 3MUFA 1IN5A 4TKVB 3SZ3A 3OAAA 1QRRA 3DO6A 4YRIA 3OQ6A 4LV5B 2FCAA 3WB2A 4MS4A 4JBGA 3WGOA 4ZI7B 3L9XA 5K45A 2I54A 2FQQA 1N7JA 5IF9A 5CIQA 2AC2A 4CM9D 1M72A 3K6KA 1L5LA 2L82A 2QN1A 2EJCA 1BW9A 2R7KA 2A1TR 4J6EA 4V0MA 4N6OA 2R6DA 2ZXUA 1WSDA 2R2GA 4NENB 4HXYA 2ZI5A 1CYEA 3QXJA 4GF5A 1ECPA 1JHVA 1TYAE 5T4FA 4PIMA 3ZXXA 4CBVA 1NV8A 2ZYDA 3OAAD 5GY7A 2OLJA 4B4OA 3O7MA 3GP8A 5F5XA 3ZWKA 2CHUA 4I66A 4WA7A 5EMLA 4DF3A 1CUVA 4CPDA 3RPEA 3VGJA 1G5HA 4YRJA 3CKMA 2O2IA 2E4ZA 3S2GA 3ANSA 5DYWA 4CLOA 5L7WA 1C4XA 4FEEA 1J9EA 4I6JA 5FKJA 4XM0A 4DLZA 1YAJA 4W5NA 3LC0A 2IYWA 4YP0A 3TSCA 2I6XA 3OF2A 5HKLA 3E9DA 3ENKA 5INTA 3U60B 1K6MA 4UBJA 3BX1A 4U0JA 3NHPA 2F4NA 3IEXA 3TYXA 1HURA 3B3QA 1TU0A 5FTNA 1QB8A 3Q6MA 4BKOA 4ZT6A 8ABPA 3NWPA 3EIEA 1E1CB 5HCUA 1QDEA 4DMRA 5DM2A 2A88A 2OCAA 2YWFA 1AQLA 1G2PA 4KE9A 3WTBA 2A59A 3PHIA 2KX7A 1A95A 1JDBB 3HRIA 1N3IA 4U02A 1W94A 5G2OA 3UUGA 2R60A 4OYHA 1H0SA 2WF6A 4G37A 2JKZA 2AEMA 1GQ2A 3NYRA 3PE6A 1HYQA 1JI0A 1GG5A 2B1JA 2ONJA 2VCEA 2AK2A 2GLTA 4NSNA 1XV5A 4BV3A 1DAHA 3O6VA 1VIMA 1JEJA 5JPIA 1O97C 5TVKA 3CEAA 4E0BA 1XPOA 1WXFA 1I2AA 3BH0A 2CXHA 3PPVA 2F3PA 4PFJA 4B34A 2BAGA 2R8XA 4A2WA 2JLWA 3K6SA 4LZPA 4YQEA 1M5TA 1XJCA 4FXOA 4V0KA 1JP7A 4OMFG 1V4NA 1VE3A 3FMGA 5JZ9A 1AH2A 4FYIA 3EA0A 4UVDA 1GLGA 1WV0A 2NTNA 4OLFA 3WJ7A 5LDHA 4LTMA 4XJTA 5BW5A 1PVDA 2OVFA 4LRYA 2WD7B 2SICE 1YOVA 4EVRA 5JSQA 3A4YA 3QVJA 3TRJA 4G07A 4M0FA 1R0YA 1A7JA 1V6CA 1UBLS 2FZVA 1RM0A 4EHHA 3VR2D 1P9NA 4C2UA 3HR4A 4LAFA 5AKGA 3NHLA 4V2UA 1HDGO 4OTZA 4YGYA 1IONA 1X19A 2FHSA 4C5CA 1YS4A 1EVIA 3VYRB 4DFDA 1OH8A 5AM4A 3DZ8A 1CQIB 3K1ZA 3GJ7A 1YU6A 2GPYA 4GC9A 5KJCA 2Q0XA 3ZDAA 4G0WA 4H15A 5KREA 3E5HA 2EP5A 4YUXA 3GJXC 1NR7A 4FYHA 2HW8A 3JQ8A 1SCIA 6CHYA 1NULA 3WLNA 2XCTB 1F3OA 3L7CA 4KRYA 4JSYA 3F7NA 4F4DA 4A26A 1CXZA 1JZQA 4KPGA 5HWSA 5EXSA 2RHBA 1UC8A 5IX8A 4RTOA 3ZCQA 4BVEA 5MF6A 2QBYB 2CN1A 2W6JA 4MYHA 1E9CA 1QIIA 2D2FA 5J59A 4ZU6X 4B7ZA 4KPEC 5F1OA 1I33A 1QE3A 2IUTA 1O96B 3CINA 2J3DA 4PTLA 2AN5A 3FNGA 3WLLA 2OKCA 2PVPA 1GN9A 4A91A 4RY8A 2ZUFA 1QC5A 1Y3HA 2BEWA 5G4LA 4Q1BA 3AZPA 4BB0A 3ZDBA 5BWCA 1LPSA 4L2IA 1OTYA 2NO1A 1CEXA 1GUFA 4G9EA 4BFTA 4D8WA 3PX2A 1TOAA 2VDUE 3G3EA 4HS4A 4C1BA 1HPLA 3FI9A 2YXDA 4GT1A 4GYJA 1E4OA 1VHTA 1QFYA 3RYCA 4LSGA 4PLTA 2CLHB 3K53A 2VS1A 3T0FA 5JSZA 1JQEA 4KFRA 1U4SA 4Q3AA 3TQCA 2P41A 3L4KA 2XZOA 3DFIA 3B82A 3HBAA 4CLEA 4G5OA 4CIVA 2AXNA 4KE8A 2G9RA 1E9DA 3DEKA 3UOAB 1NMQA 3HO8A 4FUQA 1Q2UA 2D7CA 3TNFA 1FBTA 4ND1A 4QASA 2H92A 4Q93A 1G8YA 2ODEA 1LH0A 3W6PA 2J0QA 3DXZA 3CW2A 4N3BA 4RDHA 2FWPA 3P45A 5KNDA 2BR3A 2R62A 3PA8A 2AYXA 4Y9RA 5CEJA 1LPMA 3GNLA 2FSUA 2ZAOA 1RWNA 5KX5B 5FRDA 1RKUA 3SY8A 4EBFA 3UKOA 1WY5A 1U98A 3A04A 3JD3A 5L40A 1NL3A 3MERA 3PE4A 4CF6A 2HU2A 2J3QA 2IGTA 1FS4A 1K27A 1MC5A 2A4KA 2Y1DA 3QV2A 1DARA 121PA 1KMNA 4FYVA 4C7MA 3PEVA 4P84A 3IUBA 4F9FA 1Q50A 3H11B 5A2QA 5HOQA 1F1JA 3EIFA 3NI2A 2ZRFA 3V1YA 3M6LA 3AJAA 4CYMA 3QVSA 3GAZA 2QT1A 4MO9A 4YLEA 3QW2A 4L3WA 1V35A 4KV9A 3HJHA 4XWOA 2AFHA 1NOJA 4JB3A 1RE0A 4WY5A 3PFWO 1KE2A 4DSTA 5EWJA 1P4HA 2BFOA 4DC0A 1U81A 5F78A 5CT6A 3EISA 2WPDA 3GCZA 4ZKDA 5A9SB 1MV5A 3PIDA 1XD2B 2EDCA 2REQB 5DGCA 4KNWA 1ADCA 1LDGA 2E21A 4ZN6A 2CNOA 4PTYA 5AO9A 3E35A 3SNKA 1V9CA 4UDYX 4FNAA 1FRNA 2ZBDA 5BN3B 3NCHA 1T2NA 1EUCB 1YZ3A 3TLMA 2H4WA 2Y68A 3DMFA 1C7IA 2XTAA 3TUJC 1O4WA 1IOWA 1W49A 2VSFA 4MYTA 2JGJA 3KSMA 1AO0A 1JAHA 4M53A 1PWYE 1ECLA 3LC7O 4H7EA 3W04A 4ZK2A 4NCBA 1AM4D 1U5BA 2IHJA 4X65B 3RC1A 2VP2A 5FFMA 5AW0A 4YRSA 3O3OB 1AXGA 2Q3HA 1V11B 1LX6A 3E7XA 4EW2A 3MJHA 1SA0B 2FP4A 1PJRA 3ESZA 3ZY4A 3NXKA 2G83A 4YCSA 2M9MA 5ALSA 5HFNA 2VK1A 5TQ2B 2GD6A 4FVTA 2BI4A 3REQA 4LDQA 1DBSA 1Y5MA 2IHKA 3ITKA 4EGJA 5EIEA 5G40A 1UJ6A 4J29A 4D46A 3ZE8A 1AMOA 4KNYA 4M0DA 3FPSA 4WBNA 3DZGA 3L79A 2NUAB 5TRTA 4EI2A 3ETCA 5FF9A 3GDFA 2D1YA 4JLAA 1FK8A 4FDTA 2C9MA 3K0HA 4F93B 2TRSB 4PLVA 5COAA 2ZWOA 3W90A 3IEMA 1XPRA 5C2JB 3PNYA 1SUSA 4MLCA 4HNSA 4PR0A 3UGKA 4F6CA 1DBRA 2O3QA 1JQ3A 1MOQA 4E1BA 3UOGA 5E1MA 1E18A 3Q8MA 2BCGY 3PC8A 2CJWA 5H5JA 1DKUA 5HS6A 3RG2A 3NQ41 3BGWA 4NU8X 3ZU4A 2MR5A 3VR5D 1GKKA 2CYCA 3N1UA 5JDIC 5KOHA 1NVBA 4MRMB 2PH7A 1E0JA 2XY4A 1TW2A 2D8MA 3ELDA 5ADVA 3TB4A 4TKVA 3BXEA 1FTWA 1K7SN 4BEWA 1GAXA 2UV8A 2V03A 1G6OA 3CBQA 4Z9YA 3N59A 3B1XA 4B32A 1ISPA 1BMQA 1TFUA 1CY4A 1EESA 1ECJA 1XAIA 2NO0A 2WHRA 3OCZA 4Z99A 5ETJA 2QYTA 1K97A 3HJRA 4LHVA 1GTSA 2IEAA 2B25A 2Q4OA 3BS4A 2YWCA 1DLJA 1TZMA 2PX2A 3GT3A 3SKYA 1UWKA 1YMUA 2NXNA 2NAPA 4FFBB 3WGNA 3C74A 1PV2A 2XNDD 3H1FA 3EMDA 3LKDA 3MVEA 1ECBA 3UHOA 4F1JA 2ZJ6A 3F97A 4PE5B 4JUIA 4RHFA 4W82A 1BN6A 2QU8A 3OLYA 1UK7A 4MJ3A 4JNCA 4B4DA 3FETA 3A28A 1DRKA 2JI7A 1G7RA 2CLCX 3BD6A 3N0TA 4G0QA 2C5LA 2HV8A 3I9KA 4A27A 3L6DA 4U6SA 4PNEA 1DBIA 1RXCA 2HSJA 2XCLA 4BQSA 3L04A 6REQA 2J31A 5JR3A 3W7BA 2C54A 5EMNA 1ZISA 2ADOA 3EHEA 1OH7A 1SVMA 2GZHA 4YJKA 3T1NA 4ZVRA 5CFPA 3CW9A 3KJNA 3ACDA 3FMOB 4DY6A 4YAIA 1E1CA 1UPAA 4AG6A 3VJRA 3DAGA 3Q8XB 4B3FX 3MTIA 3FFAA 3IJEB 3KYDB 1QYWA 4RVFA 1WRBA 5IHXA 1FLDA 2HUPA 2GJ8A 2QP9X 2ZQZA 2C96A 3FUXA 3PGJA 4E4TA 3TE6A 4BFUA 1U63A 3K2QA 1NE2A 1K6JA 4HDCA 4H0FA 4KWIA 1Y6FA 1IRXA 3MT9A 2X7JA 4BUZA 5K6AA 1NXOA 3FKQA 2I2CA 2VJQA 1HE4A 4MGEA 1JI3A 2Z8ZA 3KZOA 5K99A 5KOJB 4BBJA 5JH7A 5E3HA 1JMKC 1QVAA 2XTJA 1I14A 1L8QA 2DYKA 5D7BA 1DSSG 1L7BA 3L4BA 2E37A 4CG1A 1HMYA 3FPKA 5HKKA 1TZKA 9ABPA 4R8KA 4K6KA 3KYIB 3VBCA 1DBQA 3B2EA 3EQ9A 4IDPA 2PT5A 3PX3A 3R77A 2EFJA 2ZFUA 4EPVA 2Q62A 3DULA 4ES6A 3KSRA 1G291 1JU3A 3FNRA 5IBCA 1KEEB 1U1GA 4HGRA 4Y1RB 1FDRA 5J1TB 2LWIA 3DMNA 5KNDH 3C7TA 3QEMB 2YIMA 2WD7A 2VT3A 4BQPA 2C2HA 3LX8A 3FCSB 1H6DA 1LTHR 4RYLA 3LHIA 5HKKD 3UMCA 1J8QA 3WAGA 5HG0A 1P6QA 4HH3C 4KQ2A 5CA1F 1HZZC 2AI3A 4NJEB 5TMBA 3S0JA 3IOMA 2PR2A 2RONA 3EH1A 4B2PA 4BJ6A 1CQIA 1ZO8A 3KR9A 2BGKA 3RFTA 3OE4A 2OVBA 4OIMA 4IDHA 4Y6OA 4F06A 2I91A 4IGEA 4B43A 5D5PA 5EHQA 2BFEB 4GLOA 4OGWA 2A1IA 3OIVA 1MRSA 5CRIA 5CEEA 1O0BA 2HMUA 2XMGA 3M5PA 5C0OE 2XNHA 4LF6B 2V4MA 3C4VA 2JLYA 2OBLA 2HJWA 1VM6A 3B60A 1RYEA 3QUTA 4YJGB 5AJUA 2PM8A 2R6CA 3ZNPA 2C97A 3A6GA 3U7GA 4JKYA 1S3GA 3HGTA 4GI7A 3AYZB 4RSHA 2ZSAA 2XRMA 5ED4A 2JA2A 3ROQA 2BSQA 4OQNA 1XVUA 5K8LA 3AF6A 2HQ1A 1KQFA 4G0PA 4PFQA 3IV7A 3S81A 3V7FA 1KJJA 4KQ1A 3WKBA 2O2YA 1Y8RB 4F2HA 4GOLD 2B0JA 1P0PA 1XTTA 1H0KA 2QLJA 1Q44A 2H54A 2OWEA 3D59A 3WAKA 4UZSA 5I7VA 3QHQA 4FYXA 4QT0A 4JXXA 4RMHA 3BXHA 4EL5A 4G4GA 3L8ZA 1VDMA 3ZQUA 1P44A 2GF9A 1WE2A 1XRSB 2QS9A 3BGVA 2BFBB 4EFMA 2PRYA 1PG2A 2H52A 1M75A 3PIIA 1QP4A 1M1ZA 2ZTHA 2NYAA 2GQ0A 3R6TA 4IDFA 3IFSA 2KMLA 3H7IA 5I9LA 1HL3A 3LE8A 3A70A 2DTXA 2CL0X 1EXVA 1O1YA 1WSBA 2UXCB 1TECE 3MOIA 4BP9A 1H9BA 2CD7A 1WEKA 2QTRA 3KQYA 1KWGA 3IJ5A 3UJAA 1OB2A 4YDQA 3I9JA 3MEQA 4GPAA 4ETIA 2E4WA 3B6ZA 3GEPA 3OCUA 4DNPA 3LLCA 1NR1A 1VL6A 4BVBA 1EDOA 3HVHA 1MMFB 4WASA 5FA8A 4EKNB 2ZWPA 2Q6OA 5JVDB 1G20B 2A0XA 2P9YA 3E2IA 2OSBA 4JJGA 3D6JA 4L8VA 2I1LA 3ZY3A 2LKCA 4RK7A 4UATA 4GL4A 5LP6F 3H11A 1TO1E 5ALEA 3BB4A 3AF3A 1UFVA 4MUIA 3QU9A 4IIEA 3ZCRA 3G2HA 1EZ4A 1DAMA 4QRDA 4DR3B 4LHWA 4O4LB 1V4BA 3RS4A 3OIYA 4IIHA 4YAWA 1E3WB 1DV2A 1NJ6A 3IVAA 4V3BA 3MPOA 4LRSB 1GFSA 3G8CA 4HWPA 4WK6A 5IT0A 5LQSA 3TLAA 2H1HA 2GPBA 1G20E 1SD2A 3GVIA 4KXQA 1CUZA 1NBAA 1UEJA 1NXSA 3DLAA 1XD2A 2RE8A 2REQA 2ZQ5A 1L7VC 4TTAA 2HMYB 1C50A 4U00A 5JC8A 3K2EA 4UHDA 4Y2GA 3KLOA 2J33A 3N87A 2X58A 3LQRA 1EUCA 3S2IA 2YV4A 4DM7A 1HTTA 1OIVA 1T5BA 1N5KA 4L4UA 1IN4A 1QV7A 3O4GA 5EMHA 2Q4DA 1M2JA 2NXCA 3K9NA 2JLBA 3PKJA 2E85A 2XGGA 3CF6R 4M99A 1QRSA 3OLCX 1THMA 2WUGA 2PZ8A 1V11A 4J0GA 5AI5A 3SR4A 1SA0A 1MENA 2ZUSA 3MUNA 4RZQA 4C6HA 2A0FA 4IRXA 5SYNA 3MTEA 1NNEA 4DKJA 4FINA 1HE8B 3X44A 2G9QA 1Y48E 2C2MA 4IFTA 1HZJA 1BCRB 1OJ7A 3I9V6 4RLFA 3WGHA 4A0QA 2WYHA 3EZ6A 4MW0A 4UULA 2QTBA 4UAVA 5IKOA 2I7CA 4MICA 3WLJA 3R8CA 1BN7A 4RK5A 1GWNA 1MB3A 2VEOA 3E9NA 4TS9A 2IHBA 2VT2A 2YIVX 1C0KA 2ZSFA 1DKQA 3WSVA 4MHOA 1ZNXA 1GPAA 1ZD2P 5KYKA 3QKRB 4FP9A 2AJ8A 1QONA 1Z6QA 2YJNA 5EG5A 3VMFA 4XYLA 4Q4LA 1GQRA 3IB3A 4UUBA 3IESA 1PR3A 2BZ1A 3KRTA 2X86A 4CL3A 2WJJA 5KBYA 4N8EA 1LFDB 3S2SA 1ARZA 2WWGA 4JWTA 5CVJA 4UTVA 3FLMA 4GKVA 4MRMA 3HXTA 3T4EA 2FAXA 1O0CA 1ESZA 4XFKA 3W1WA 1DKRA 3L6EA 4LC1A 1YULA 2VQEB 3MELA 4AG5A 1V7QA 1QZUA 1SPBS 3QQ5A 4LQLA 5LQRA 5K2OA 2X8BA 3QEBZ 1CEYA 2DLCX 1XC7A 4CLHA 5DXAA 2Q4BA 1RQNA 1MO2A 3IMFA 3TJZA 2IYNA 4IV8A 4IJ5A 1ONNA 1XWWA 4C03A 2Q5FA 1VG0B 4IIGA 4JV5B 5CH8A 4D0GA 5HZGA 1G16A 3MTBA 5C8YB 2BTEA 1ORRA 2PCLA 3G0OA 1SB8A 4X8HA 1Z6YA 4RV5A 5SZJA 3X1XA 3B53X 3NDJA 1IATA 3AJDA 4FCTA 1M1NB 1XI2A 2CBZA 2W2VA 4QUKA 4ZRMA 2PJZA 1LBQA 1U9IA 1XCPA 2AMJA 1RAHA 2AOXA 4HB0A 3E05A 2BGMA 1CZKA 3WGYA 1K7YA 1AKEA 3A7EA 4EX7A 4RXTA 2W4MA 4R1MA 2C9YA 3I6ZA 3NETA 2C84A 2GAFA 2PSHA 4NE9A 2B4AA 4R9NA 6Q21A 1NBIA 3B12A 1A69A 1KR5A 3KBBA 4QOFA 3CTPA 1EMDA 1YRHA 1KYVA 2VP3A 3QEKA 4BGDA 4RZXA 3SU8A 1GAQA 3NBFA 1AKUA 2XUPA 4YBZA 4BEVA 2QB5A 4PHTA 2SECE 1EZZA 3RHTA 3CVOA 2SKCA 1BS9A 1KVQA 4TL9A 1ZW1A 4A82A 2Y99A 3KYDA 1GPJA 2VH5R 1KYQA 2D5BA 1Z82A 2CXUA 4BQNA 5CVUA 4RV4A 4BO2A 4IWNA 2G28A 3AV0B 1VI2A 3N8GA 2JJ2A 3KB6A 4HGOA 2CXQA 4W63A 1HX7A 1M54A 4YP6A 1E3QA 2FUG6 3T15A 4XVQA 2PN1A 4DJTA 4JLSA 2I66A 3NH9A 4ND7A 1QVVA 2MIIA 3SX0A 1MEJA 4UQLA 1HG1A 1LI4A 2LR0A 4HB2A 4DCGA 1O3YA 3LCCA 5CVVA 4PINA 5KOJA 1NJFA 1WX1A 2JAPA 2ONCA 1E2GA 1L3IA 4NEGA 5LC1A 1CF2O 1ESMA 3OCCA 1XMPA 3E70C 4H6XA 4LV8B 4ML3A 4TXHA 1A8HA 3TL6A 4P4TA 3SSOA 4B87A 1YCHA 2MT9A 1YQWA 2IW3A 3LCVB 1K92A 3NOOA 3ONVA 2JJ2D 4FM9A 4KE6A 5CX4A 3OJXA 1U3GA 5DCUA 4PG4A 4QGAA 4DDUA 1QX3A 5F7ZA 3WFJA 1NKTA 4G84A 4CM4B 3PIRA 4EFKA 1KEEA 2PKWA 1I1HA 2BV3A 1N78A 4Y1RA 3N2GB 1Z8HA 1PVVA 2G3YA 2I3ZA 3QEMA 4OGFA 4WZAB 4EY5A 5FI3A 4XWWA 1QYIA 2MINB 1NNSA 3F9RA 2G0TA 4L4SA 1VKZA 3EF0A 4H2DA 4JIMA 4P7JA 4UTPA 3B1ZA 4BO7A 1W7AA 1IDOA 3PITA 3ODGA 1NSTA 2IYRA 2QRZA 1OHHD 2FSSA 2QRNA 3EXEA 4NJEA 1R6VA 1P7VA 2F1KA 1RRCA 4POOA 2Q3CA 2DF8A 4RQBA 5B1YA 6GPBA 2BOVA 3C98A 3PVCA 3TBHA 1YZYA 3AY7A 2B3DA 3ZWMA 1JG3A 5A7HA 4EAAA 2Q3BA 2BP7A 1GZUA 1K63A 2AJBA 2P3SA 4LISA 3KR0A 1ZG3A 3AEUB 4UFNA 1W6UA 1SC4A 4LX8A 5HCIA 4D4HA 3BGDA 4PLZA 1K2VN 2AA3A 4S24A 3IOEA 2IX3A 1PHRA 4IP0A 4YJGA 3QIVA 3EC7A 2DUWA 4BLWA 8AT1A 1JILA 4ALNA 4ON9A 1SN7A 2I8LA 4MV4A 3EG9A 1RDFA 2DX7A 2J8ZA 2D1FA 4OA8A 1AZSC 3FPAA 5CTJA 1OGJA 1FRQA 3WIOA 3VHXB 4AQDA 4LZJA 5LYJB 4YJ2A 3A6ZA 2GX6A 1DHRA 2OZEA 5ALYA 4ZAFA 1FXUA 5CLGA 4H18A 4FCCA 1PNRA 1D2GA 3GT4A 1PQYA 1XUOA 2JKYA 1KKLA 2QR5A 3P2KA 3PRHA 5TQJA 2Z98A 2C5HA 1XMOB 1QHIA 2W2NA 3BK7A 5JAIA 4MQEB 4GGPA 2QX9A 1RRGA 3F2VA 1IIRA 2BFBA 2IZ7A 4YUZA 2FFRA 2H9AA 1O94C 5GGYA 2NACA 2XTZA 5DISB 1US8B 2DUJA 2QVZX 2HDOA 1NJGA 3QQPA 4MOWA 4DGQA 3NANA 1SKYB 3C7CB 3CZRA 3GJYA 1MU0A 4NDNE 1YB5A 5A04A 5BWMA 1Z4IA 3O9MA 4DR2B 2C5AA 3OF5A 4RF4A 3AUYA 3UATA 3BREA 4HFNA 4RGQA 3RODA 3AKZA 1E7QA 2EZUA 3H2SA 4HHEA 4B3GA 4R16A 3EPRA 4H3KB 3F6SA 2CUTA 4UHKA 2ZRPA 5G0WA 3R7SA 2JFPA 1ZCAA 3MRVA 1JQKA 5FPPA 2YYAA 5LDDC 4IJWA 1TCCA 1NI5A 4Y1EA 5L7YA 1ZWLA 3QOXA 1ODIA 1OI2A 3H5WA 5JVDA 1G20A 1XJQA 5ADHA 5J2UF 2HZBA 4MUNA 1I8TA 1AS3A 3GC6A 3OKPA 4X9XA 2XUFA 4KPYA 2CXXA 3C6MA 3HJGA 1AO3A 5EGNA 3FTNA 3FAKA 3LA8A 3WK5A 4ZYYA 5KCZA 3GZJA 4II2A 3S70A 5J3JA 4JUCA 4ZYZA 4O4LA 5C51B 3DZHA 4CKZA 4EYSA 1PF7E 5JAZA 4F3TA 1E3WA 5LZ9A 1WR8A 1G5RA 3KG2A 5L4LA 2GEBA 3C6ZA 1GUYA 4R1NA 4C43A 2QD4A 2VF2A 4DIEA 1QGZA 1EK1A 2QTTA 3IA7A 4MR9B 4MVJI 2ZRCA 5DV9A 3GJ6A 4MQ6A 4MS3B 2A86A 4TLLB 2QGZA 3PLNA 1V2HE 5JSYA 2HNBA 4X92A 4WLVA 1R3DA 1YBMA 2A7QA 1Y63A 3AP3A 4REQB 2Z95A 5JQGF 1YIAA 4B4WA 4LK2A 4DLXA 4DIFA 4R3WA 4DIDA 5LSAA 1N2OA 3JR3A 3AJEA 5IKEA 5TLSA 3DAOA 1UBJS 4TT8A 3RM3A 4RKRA 5GV7A 1RP1A 3WLSA 1JF8A 1XRPA 1BTOA 3ZV5A 3TXYA 5LUAA 1X86B 3SR3A 3B89A 1GKYA 1NF9A 2HJGA 2G9NA 3R5FA 3J7TA 3R8XA 4KN9S 2VDWA 1GFIA 1EXDA 3EAFA 4LC0A 1GQQA 4NMXB 3W3ZB 2NVBA 1SC3A 4DLAA 3CNHA 1UM8A 4FJ0A 4QBHA 3I72A 3PNOA 2DBZA 4B45A 4Z51A 1E8NA 1R0XA 1DKOA 2PX5A 2VPTA 2XVXA 3HBJA 2CNWD 2NO5A 2BMJA 1Z4OA 3GOHA 1XMXA 2O52A 4NYIR 2B1IA 3OPYB 4MUKA 2PJUA 3PHBE 3QKRA 1ZHFA 4Y1GA 1ORHA 1UMDB 3DVAB 4IWYA 1ZUIA 4J9VA 4O2AF 4UREA 1QXSA 5T57A 5JHHB 2XUKA 2QZJA 1Q0RA 3JQFC 1QANA 4XYMA 3BCHA 1Y9JA 2PG3A 1BDJA 2AVNA 3NUQA 1NW8A 3OA2A 4Q4DA 4QFMA 1P2FA 2YV5A 4QJ3A 2CD9A 3HS3A 5CJ2A 1I3NA 2XBUA 3QWIA 3ZDEA 4YUAA 2HMWA 4R2MA 2M6SA 2OLEA 2QJTA 2VAVA 5BQPA 4MKGA 1Z08A 1QF6A 3EPHA 1TUEA 1YBAA 2AG1A 1NQUA 1P74A 2PD4A 2HJSA 4K9LA 2P4HX 4KL8S 2R1VB 4U1RA 4R40A 4D3SA 5K8CA 3WKEA 4MVJP 4LYHA 1M73E 3F6RA 3JALA 1G64A 2CWWA 3KOUA 2HC9A 2R3SA 4L0MA 5BSGA 4FYKA 5KVQA 2JVJA 5F76A 4R7ZA 5C8YA 3NP9A 2O7RA 1ZMOA 5ES4B 4PVDA 4PC2A 3K1JA 3A1UA 1XEXB 3H2YA 3SHQA 3C3DA 1UEIA 1M1NA 2H48A 2I4RA 2AN4A 2WJYA 3HHEA 3P4XA 5ENDA 4HTAA 4RL4A 1E2BA 2HJHA 5ESWA 1VE7A 4KKXB 1F9AA 4RZSA 3GN2A 5BSTA 2FZEA 3VO1A 3LUDA 1B41A 2CLMB 2GJ4A 4JI4B 3VKWA 3LD9A 3Q7EA 1JDSA 4NCKA 1TEZA 5F73A 3VZRA 3I3SR 1XEWY 3JQBA 4AN0A 4IQGA 4FDLA 2EF1A 3E9QA 3RS9A 4QWWA 1PI3A 3UK7A 3JASA 4LOIA 4YMSA 3RVQA 2Q6VA 4MKFA 1TQ6A 3E48A 1ORIA 2SKEA 1MG0A 3WWZA 1ID8A 3QE2A 4BTEA 1XMIA 2X9GA 2Y6VA 2FQWA 4GI3A 1Q7RA 4W8GA 2XRZA 4CF5A 2WYOA 4DIBA 4NOLA 3SC3A 1CC1S 1VIYA 4S0XA 1NUSA 1NW3A 3G88A 1EQ2A 3PFKA 2DFKB 4ARZA 3LBNA 2AF3C 3QOFA 2HWYA 1FRFS 2OCDA 3LV8A 5UKDA 3TQSA 2COEA 4ILEA 1TAUA 4RH0A 5KQSA 3PFCA 3H83A 2PQ2A 4PSCA 3ONDA 5CIWA 2I65A 5F33A 3SJAA 5EKSA 5EJAA 1L5VA 2CFIA 3TOSA 3DLTA 3W2FA 5EWMB 1BRMA 2WV7A 3AB8A 3S8YA 1DTWA 3T54A 4BRSA 5BY2A 1E6MA 4D74A 2ODPA 4CM3A 6PFKA 3OE7D 5IABA 4DOMA 4I9UA 3HDHA 2ORIA 1UP4A 4BQIA 4BQOA 4G1CA 1M0TA 2UXBB 2EZTA 2XSZA 3OFNA 2V6GA 3D0QA 4CM4A 1UOQA 3M0EA 5CH3A 1IXKA 4Z8XA 4P1ZA 1BE1A 3BWYA 3H5VA 3LIIA 3S7TA 5K8UA 2GVDC 3N2GA 4HEQA 3CUKA 3ESYA 3MQ4A 4OHVA 4R8LA 5BSWA 5G02A 1RI1A 1D6NA 3GCGA 4V0QA 3GRPA 3RS2A 4ASUA 4CTJA 3L7KA 1E66A 2B99A 4OMDA 2BJWA 4G2NA 3A1SA 3D6FA 2FR8C 4V2IA 4C78A 4FHEA 2D0IA 2HLDD 1P81A 3T1QA 2OZVA 2YUTA 3HNRA 3UJ9A 2BBWA 3UJHA 2W2PA 4IDGA 1POXA 3B51X 3LZCA 3KWLA 4L8YA 2PNJA 1JBQA 2HU5A 2GEFA 2V65A 4O2LA 4WIAA 1VMKA 1N92A 5EP4A 3KR2A 2F48A 3D5EA 3T5CA 1JV2B 2WW8A 1X8LA 5DN6A 3D3JA 2QVYX 2XMRA 3TTTA 2QUBA 4KQGA 1P7YA 3AEUA 4MSUA 4X63A 4YDRA 1IOLA 3RBVA 2V6JA 1DJOA 3A9UA 4TLDA 4LNUA 2UVQA 1FUEA 1YIOA 5I01A 3RRYA 2IP2A 2YC2C 5CYOA 4A2PA 4BBZA 3VR0A 1ZZGA 3P97A 4YV7A 3OPVA 2QRVB 3SM9A 3T5MA 3QWBA 4C87A 3WRXA 1Y9AA 1ENYA 3OZAA 1HDRA 4YASA 5AKXA 3LXUX 5FV7A 4LYDA 4QGSA 3S55A 4F71A 1WMFA 2EJUA 3LXMA 3I32A 4NR0A 1PRYA 3GLFB 1F8UA 3ZLJA 2N42A 1JU4A 1NJSA 3KCQA 2CUNA 1HDCA 3O4FA 3VJMA 4RD6A 2ZRNA 2ZKIA 2E55A 3COWA 1BVUA 2H9IA 3OZ7A 3UJ8A 3UMBA 4JXKA 5JJBA 2XQFA 3UY4A 1NYTA 1OGIA 2O50A 1E4EB 4KXUA 4YUWA 2C4TA 4MQEA 3O8BA 2GD1O 2OYSA 3AR5A 4EELA 4QVIA 5T3YA 5LYYA 1DUIA 4B3IA 3GUUA 3P0HA 1RQLA 1US8A 2OFOA 1EFHA 3SBEA 4RO0A 4ZOQI 1VSQA 2GLUA 3N8KA 4M49A 1XCOA 3AESB 2ZJ3A 1EWYA 1OWLA 4R2IA 4XWGA 4AWXA 1FFYA 5CHYA 1NQOA 5CLIA 1NP6A 2COKA 1TEVA 2HA3A 3SLGA 1EGMB 2XADA 1EB9A 3NEAA 4JI1B 4CQNA 1RHRA 3DHEA 4NOMA 4DY4A 4B09A 3X1DA 1I7DA 4V24A 1A4IA 2C7PA 4G1UC 1ECCA 4MVXA 3TIFA 5DTIA 4TGLA 5SY6A 3OX4A 3T7RA 3OPXA 1EFUA 1LWNA 2M6KA 1JH9A 1N9KA 2FPRA 4DR4B 1AK2A 1M0SA 4OLBA 4IEFB 2RHLA 4LJ7A 1IZYA 1L4GA 1O9GA 2NO6A 4PSKA 4E12A 3WK6A 5DM0A 2PZGA 4O4HB 1I3CA 5HBGA 3PNQA 1OBFO 2G40A 3ORSA 4ZKEA 4AROA 4NNJA 2ZYHA 5HF9A 3K5HA 4DUYB 4FYMA 3DZDA 1BKSB 4NS1A 3QIAA 3E61A 4MWSA 3MCUA 1ZH6A 4PIPA 2I99A 3C3WA 2YKGA 1MJ5A 4EHAA 1JIXA 2P2GA 4BQRA 4AJ9A 1QIEA 3GFGA 3IT1A 4MR9A 4CW7A 4N4AA 3JWHA 2Q3EA 4YRNA 3HRHA 1LBHA 3VVMA 4C4TA 1GG8A 2Q6KA 3C6YA 2C4UA 4MS3A 1V9SA 2HDWA 2LE0A 2ZTSA 1VYHA 3GA0A 5F9MA 3R9KA 3VGPA 5CFNA 4L5IA 4U4AA 5DZSA 2BGGA 4NG5A 2HL6A 4FEAA 2XBLA 1Z37A 4KN8A 5AK0A 3V4PB 2QAGC 2CDRA 2FKNA 1UXIA 1U4OA 2EZ8A 3BCSA 1FMFA 2J5KA 3ZZNA 5ILOA 4GBGA 2AMVA 4OHWA 4RVNA 4RF5A 4I4TA 5CDGA 1BYIA 1E89A 1CHDA 2B1QA 1IEQA 2NUTB 4WDRA 4X91A 2QW8A 2A58A 3ZDCA 1L1QA 1GGEA 3WLTA 4MI9A 2FZLA 3ZWXA 2GEUA 1QTIA 1DZ3A 1OGYA 1I6KA 5EINA 1G42A 1SUBA 3HJNA 5JXGA 2CV0A 1E64A 1Q1GA 2NAFA 1CEEA 1ZJ6A 2DR0A 1T5DX 2RAUA 2ZG6A 4Y30A 4XD7D 1NMXA 1P1IA 5DCYA 4DKXA 5JAHA 3RVMA 5BORA 1KJ8A 5C8VA 2PEYA 3G9ZA 1NURA 2C9ZA 1RQPA 1C4OA 3PU6A 4Q7MB 2O3JA 3DKIA 3PTAA 4I50F 1C3EA 3HCFA 3W9BA 1OILA 4ZJUA 5KEIA 1TGVA 1TLTA 3MJEA 5REQB 4EUEA 2GHRA 3SEQA 3NT2A 3RSCA 5FLKA 5C7OO 4LE2A 1RPAA 1JR3E 1PZHA 5DI9A 1PJ2A 5DI3A 3C3KA 5A0FA 3W05A 4ARBA 2OO5C 3T61A 4EO4A 1D5CA 2ZSUA 3V48A 3ZVRA 3T9BA 2Q1XA 4XB6B 1ZM9A 1VIAA 2I2BA 3LX5A 5AHXA 3ZPXA 3VDXA 3R7AA 1RKXA 7MDHA 1GSOA 3EW7A 3LYHA 4JDUA 1NT2A 1A9XB 1NBEA 1KPGA 2XHZA 3EZNA 4EJFA 5GZ3A 3FCUB 4JLJA 3O1HB 3QLVC 3ZZUA 1CUUA 5DGHA 5BRAA 2ZIZA 1LU9A 5CMLA 1SIBE 1MO6A 1COWA 3AB3A 1SAYA 1IFXA 1SCNE 1NW4A 3KZMA 4L0QA 2R1VA 3IXQA 3SSAA 4CM7A 4UOZA 2GN1A 4IMPA 3ROTA 2HUNA 3UQZA 3ICCA 3V46A 1ND5A 2F1RA 3K0CC 4JBIA 3LKVA 2FLKA 2Y0EA 5HK8A 1U3TA 3KYBA 5P8WA 3K16A 1KNQA 2C2OA 3ZW8A 3WIVA 5JXHA 2A5DA 3W4KA 1T6XA 3ZKWB 5K8VA 1QQAA 3FWKA 4WKPA 2NSHA 1XEXA 5CPFA 4F3CA 4YJ3A 1U1EA 3E7FA 3WL7A 4L75A 3QOWA 4NE2A 1T29A 4YRPA 1O6GA 3VPGA 4AUEA 5U9CA 1GP2A 1B16A 2I87A 1EUDB 1RXWA 4HWSA 4F9EA 3WMEA 2PQ6A 2XE7A 3ZOZA 3V6MA 1JECA 2WQ7A 3UJPA 3SC2B 2R00C 3ON5A 5IN5A 1QK4A 1T2VA 4RTQA 4RHUA 1B14A 5DIFA 4BJ5A 4M0KA 3RHFA 1ZA1A 2IHTA 5ICSA 3LFUA 4NBUA 4XEUA 3EDQA 2HK6A 3UHJA 4ZZ1A 2EL9A 3OHSX 4IVPA 1ETHA 5JZVA 4CI0B 3ZX5A 5KQLA 3EDOA 3RJZA 2X8JB 4MP3A 1ZD4A 1JDNA 5KAPA 4ZI2A 3GH3A 1JEYB 1FNCA 3B1YA 1LXCA 5EQDA 2AEFA 3LUFA 1IWPB 3HB4X 5U4QA 3C3JA 2REBA 1F12A 4OHCA 3LXRA 3A0RB 4H9GA 3R74A 1Y4ZA 1W581 4KXXA 4QBKA 3TLBA 4CHTA 1TU4A 3TAHA 4U2GA 5CLFA 4HN2A 1SXHA 1HRKA 2HF8A 3A11A 3OJWA 2CXSA 1G6HA 2IEDA 3UCEA 4JGGA 5EWMA 3BXOA 2FWMX 1U2EA 3IUNA 4TTQA 1H5QA 1P4SA 4TVOA 3IQXA 4MV5A 4BO5A 3GEMA 3PR3A 4ZAWA 2O2SA 1G9TA 3LGXA 5TMPA 3OFVA 3CKYA 3WHPA 1T3TA 3C6XA 2WF7A 3U4DA 1K8ZB 2B8NA 1WUYA 3FHJA 1ZGJA 3IURA 1YE5A 4Y2QA 3ZCSA 4PSUA 2JD0A 4KTTE 1XDDA 1BAPA 4GKJB 2Q50A 1KYWA 2NPOA 5TS2A 3WKCA 5KSWB 2FV8A 4YTEA 1ZHHA 1TUIA 3K35A 1L4KA 2IT1A 2OY0A 3DBHB 1K88A 3QJ5A 1C3JA 3CC8A 4JP2A 5NULA 3KSAC 2XF8A 2HTFA 2IU4A 2WWFA 4OF4A 1B93A 3R0IA 1GXSB 4K9NA 4OVKA 3IAEA 4YP7A 3RTDA 1FSPA 4TTRA 1JE1A 1BHJA 5FL3A 3FRIA 3WJ2A 2OR3A 2YW2A 1EB8A 1T1RA 1CUYA 1X77A 1BKYA 2MU1A 3KZNA 3L43A 5AFSA 1QMGA 5K5EA 2QZ9A 1XN1A 4UHCA 4C3UA 4L95C 3ZIDA 4BYGA 4EPYA 2XMPA 3HYTA 3CO5A 3KB2A 2H7CA 2QRUA 1KEPA 4JN6B 4LJSA 1X1EA 2RAPA 4L16A 1RLTA 1KYXA 5IEBA 2ETVA 4ACAA 4LEIA 4RYDA 1R4MA 3YASA 1EK2A 3CW8X 4OXNA 2ORYA 4TMXA 1ISSA 1CY2A 3SYLA 5T6BA 1KQ3A 2H7YA 3DZKA 3LCRA 2JIZD 1KK1A 4DPKA 2BYTA 1E3DA 2I78A 3E5RA 4HDSB 1W4RA 2CBXA 1T10A 3RQSA 2ODTX 5JY1A 2JLVA 4EPRA 1CRQA 2C83A 4PAGA 1Q16A 2JARA 1WDMA 2JAOA 1YQUA 5ALRA 3H9CA 3N86A 2XPCA 4P2GA 3VTFA 5K01A 1U3FA 2FG6C 2Y71A 4TV9A 5JATA 2GVZC 1E2UA 2BCEA 2XMCA 3CH5A 1BDIA 3EEFA 3KKMA 1KO1A 3OZFA 1E4EA 2CWDA 4K7JA 4H3HB 4R2LA 1BHSA 1S1MA 1YR2A 3TECE 2WUWE 1Z5ZA 2E5FA 2PGDA 1MEEA 1R0KA 3AI2A 4LSZA 4UUNA 3ZCTA 2I80A 2XWPA 2CHEA 3GT7A 3P5SA 5JAOA 1W5EA 2LV8A 5IDQA 3PQ3A 4FMDB 4EVQA 4XI9A 4E08A 1Q83A 2VDKB 4HK4A 4K1XA 2I8AA 3EUFA 1A5SB 3CRMA 2J0EA 4H7FA 3TQIA 3EFOB 1M3SA 4HQ6A 1LC3A 1M2HA 3O95A 3BJIC 4PHGA 1U9ZA 3TLZA 3VYUB 1M1YB 4CE6A 1LW7A 1RJ9B 1DXQA 3QXGA 2QR3A 4LOHA 1CRPA 3WSWA 4PLFA 2X15A 3IIKA 4FLEA 5CDTA 5JAQA 3Q10A 1ORWA 2AOUB 2OFPA 2VYVD 4BNDB 5JNWA 5KS2A 1J9ZA 3UO8B 1L1RA 1K8QA 4O4HA 1MAAA 2KE5A 4N0EA 4ZVUA 3RREA 3UWDA 1P2BA 4N7BA 4OM7A 1WOYA 3NOQA 4Z5XA 3L5OA 2O3UA 2HHHB 2H65A 4UUPA 3I6YA 1Y8CA 3DLIA 4O4IA 2G5CA 1FDWA 2CYBA 1JG7A 1SKQA 2QRGA 3R23A 1DEXA 1ZPDA 4X85A 2XCRB 3LVRE 4PGFA 5ECGC 4J4TA 2CJPA 2J5RA 2D59A 3PJEA 5F2NA 2YYSA 2ZR7A 3G2JA 4FKZA 4KPFC 1KVUA 1NUUA 4TXMA 3ZY6A 4QQ8A 4QXOA 1UDBA 3GMIA 4J0CA 1CUWA 4ECEA 2DKOA 4FC6A 5M34A 1ZGHA 1GILA 1ND6A 1G38A 1O94D 3R7BA 2YHBA 5ICCA 2UUOA 2OAGA 1ZIYA 1OI7A 5FIUA 1YD7A 3CR8A 1O8CA 3EN0A 3OEYA 4XGQA 3U7JA 4D4GA 4J07A 1DU4A 2NUTA 1R0SA 2Z43A 3ZHOA 1I30A 3GD5A 1AK9A 1L5WA 3C41J 4QPZA 5TV2A 3IDZA 1NI4B 1P5ZB 4LHXA 3H99A 3EC1A 2J3KA 5BSMA 5K8TA 2DC1A 2VUUA 1JR3A 2AGVA 3HY6A 5B7PA 1LRKA 5FBKA 4JLBA 5EZYA 4PN3A 1K2WA 1GPKA 3H9UA 2C31A 1R18A 4RVGA 4KWEA 5K0LA 1R7RA 4FZ3A 1K3TA 1YVRA 3A36A 4BNYA 5IFLA 4KDFA 5REQA 1WSWA 4BDTA 2VJAA 3HR8A 2XLCA 4EWLA 2GOYA 2XTMA 2QAGB 4FBMA 1F2DA 2RG1A 3JD0A 4YJDA 3A9TA 3BXZA 3ML1A 5E2BA 3DEFA 1PZNA 4LSWA 1UBCA 5BVGB 2B78A 1Z17A 4JB0A 4PX3A 1DJMA 2NU9B 3UUFA 1G8GA 3D6VA 1ULHA 1NDHA 1LW6E 2QI9C 2ZSBA 4MJ7A 4YWHA 4KXFB 1CG6A 4IZIA 2X23A 2FRVA 3ZVKA 1S2DA 4D3DA 1RXEA 1UP7A 3LKZA 4H16A 2VZ8A 3ICWA 1UBRS 1ZI8A 1I1OA 1A9XA 1GITA 1CEQA 1VYVA 4NARA 4DPLA 2QRJA 3LRTA 3BB1A 4G67A 4G8CA 4MDEA 5CTAA 2B83A 2PD3A 1RI4A 5FO1A 3HVKA 3IUMA 3LTNC 5IH7A 1P0FA 5TDHA 5HP4A 3VC7A 1WABA 5LZ7A 4DEVA 1O9BA 1WF6A 3RGWS 4CMEC 1N9GB 1UK9A 2IE8A 5HOEA 3MWLA 2X19A 4XUDA 4LOJA 1S96A 1EAMA 2PGLA 4XCXA 3EIWA 4B44A 4RTNA 3GCXA 3KSBC 2R79A 1G66A 1PG0A 4CI9A 4PZLA 4YNBA 3L0OA 1M1UA 1M0WA 1M10A 3ZKWA 4KJZA 3AF5A 2I3DA 3WL6A 4L6IA 3JQFA 3UUWA 4ID3A 5DX1A 1TYCA 4M0LA 2JFFA 2HK8A 3CBGA 3BZUA 1UBMS 5J4KA 4NXNB 2GEKA 5M2QA 1YB4A 5DHRA 3FROA 5ALIA 3DOHA 4IGIA 4GPD1 3GQBB 4XTRA 4NCIA 1I7PA 4EYEA 2A3NA 3IV6A 2FWBA 1ORVA 2PT7A 4I1OA 4IUDS 5HPYB 1TTTA 4KO2S 3CUTA 3PD0A 3N0XA 4RM2A 1WD5A 2NVWA 3SC2A 1T3SA 3SIPA 4BNUA 2MMGA 3HV2A 4DNQA 3GEEA 3KKOA 3TR5A 1PQWA 2RI1A 4DCMA 1YGYA 5CCXA 1C7EA 3NHWA 4ZXFA 4C0SA 3EB9A 1F0KA 5JNVA 1E6EA 5J2TB 1JSCA 2J3EA 3E23A 4I5FA 3TEFA 2ZBPA 1S1CA 1NZJA 1QM5A 1QOZA 2ARKA 2C0QA 3AO0B 3JYHA 3QENA 2PQMA 5C4MA 1WLSA 3BCRA 2X8JA 2E48A 3PQ8A 4Q16A 5T4EA 3ZWNA 1NBMD 1ZJZA 4IQ8A 4Z4EA 1IVYA 1V1RA 4D02A 2KSQA 2VFAA 3I6QA 1JEYA 1TMKA 4A1OA 3KWJA 1P5FA 3AY0A 5DASA 4KAXA 3H2IA 5B37A 1RQRA 1W4BA 2IFTA 2ZRKA 2HNAA 2XGSA 4LYYA 5F2OA 1JKMA 1QG6A 4CCYB 2C3YA 3T12A 3UOWA 3BXFA 2I6GA 3NPAA 3QVKA 3X1YA 1MGOA 2Z6VA 3F4KA 3TX2A 3FIJA 2FMKA 2GUGA 4DT1B 4CM1A 2O6LA 5AVOA 1NAHA 1YDWA 3EC2A 1NJ1A 4Q1DA 1JIVA 4BTLA 3Q3HA 1X87A 3OKAA 4RPIA 2E4AA 4QTZA 1GUAA 3QPVA 4KGVA 4G6ZA 3ENVA 1NM5C 2OA0A 3V34A 2YS6A 4DDWA 1JYEA 4IGAA 4KQCA 4WBNF 4WGGA 3TFQA 4A0FA 3NASA 5ALKA 1J24A 4KYVA 3BBPA 3TRKA 3INYA 4QTUB 3H1PA 3U37A 1PBTA 1EBFA 2W2LD 4YRMA 2ZAMA 3DBHA 1UJ5A 5E1BA 4QYXA 1ZI6A 4I81A 2BM8A 1G1AA 1GXSA 3ZYCA 3IUQA 3WK9A 2JDID 4OOEA 1KXJA 5GJCA 2YMLA 5J40A 4B3DA 2LTAA 3E18A 4PY2A 2PUWA 2REOA 2EYQA 1ZVJA 3UC9A 2P6UA 4DA9A 4YRZA 1USKA 1ZN9A 4NG4A 5CYFA 4UU7A 2IY8A 1B6TA 2Q2NA 1KU0A 2JLAA 2DT8A 5AW3A 2BJHA 3F3YA 4HRXA 1KOLA 3SS8A 2J9GA 1QFZA 4WOKA 1WXDA 3TMYA 2BGLA 4M76B 1FS6A 1DAGA 1S0UA 1LTKA 2IYLD 2Y6UA 1C7JA 3UAVA 4LRTB 2B4YA 5HSGA 2PE5A 1DEAA 3LCUA 1W6RA 4WZZA 4YHBA 4F3RA 4WY8A 4B6JA 4US1R 4V0LA 4P0PB 1E2JA 4HDSA 2XVZA 3R7NA 4C6TB 3IXMA 4DUPA 2XVAA 3C1UA 4OIFA 1DKPA 1OXKB 3DZCA 3ADCA 4ESOA 2FR8A 5AHWA 3SCZA 3VHRA 2GEJA 5BV2P 5LB4A 3SGLA 4MB6A 1UIRA 4Q47A 5AVKA 2HX1A 1N57A 1R6XA 4ND8B 3W3AA 4QLOA 3ZDQA 4F3KA 1XEFA 3T52A 3T3DA 2NSDA 4Y6GB 5TS3A 1QVRA 5LBIA 4D8TA 5C1OA 3BFPA 2X41A 4D0SA 1QHHA 2ZJAA 2GWRA 1MT0A 1PV1A 2DFLA 2GSDA 5M04A 3RNOA 4RULA 1Z0DA 3O8OB 4XTCS 5BV0A 3KL4A 5BO5A 3S28A 5BV1A 3HLYA 1VBMA 5KQRA 3R2JA 5B12A 1OT5A 5DGTA 3IP7A 2G0NA 3F6CA 2B7CA 1P7PA 2D0OB 1VFPA 1PDWA 2V7UA 2MSEB 4TUYB 3VOAA 4GWLA 1DC4A 2QLMA 1DWQA 2WT9A 4NOKA 3TMAA 2NWQA 4ILKA 2WOOA 3V1KA 4F60A 3A9VA 3EFOA 1YB7A 4JGIA 4XWAA 2J32A 3GLUA 5C80A 1SD5A 2X77A 3OICA 5JD3A 1UK8A 4ZAGA 5IM4A 1RJ9A 2H1VA 3NHAA 1GEGA 2A7XA 1JQDA 4EB0A 1SQ0A 3LHSA 3TW0A 4BV2A 2EWVA 3E3MA 3I09A 3ZKAA 1MIHA 1RLOA 3GEIA 3MA0A 2PXHA 1FVFA 1QNLA 3NHKA 2V4UA 3MJVA 2XKBA 5D87A 3FWNA 4XIIA 1JLKA 2X0JA 3LLMA 3SDZA 5L53A 2R8EA 5K0BA 4AJIA 1BMFA 3COPA 1KI4A 2A9KA 2DOKA 4PPGA 1CDDA 1GL7A 1WZUA 1E9AA 5CW2A 4ARSA 3FA2A 3MTQA 4IQ0A 4IJ6A 1Z0ZA 4KRGA 1YHZA 4UCWA 5TVGA 5JH7F 3GGSA 3L4JA 1EVKA 1M8JA 2BM1A 1U0FA 2FE1A 2ASVA 2W2KB 3V4VB 5LKRA 4RKQA 1D1QA 3NHRA 2OV4A 4IDDA 4A0HA 2MYTA 1LNZA 3QKWA 1G5PA 1BOOA 1NBWB 1P60A 4LYGA 3S2ZA 1FQJA 4LNAA 1EX7A 4P3PA 4PG7A 3ND5A 2QL9A 4Y2TA 3BMXA 2Z3VA 3BSYA 4BFYA 4F7DA 2H16A 2HXGA 4NV1A 3BJRA 1LK5A 1LSUA 3H6GA 3OX1A 4HX9A 4B6PA 2PZBA 1XZQA 1D9XA 3KQHA 1BX1A 1DIOB 4FNGA 4H4DA 2Z8YA 3C8HA 4ICIA 5AQEA 5K3FA 5LWHA 1XDUA 2FUEA 4EY4A 1FSZA 3NIWA 2XLBA 2D3TA 3U9SA 2JBWA 3SJ7A 3L40A 1ONBA 5CFLA 1M2WA 4J8PA 1NXTA 3CS3A 3MHTA 4FSXA 1IULA 1TQ4A 4CCWA 1IM2A 3FCCA 3H18A 3HUTA 3FCYA 3Q7SA 4U8GA 3U81A 1RTTA 1YWGO 3HBNA 4HNQA 1AURA 2HIMA 1FTSA 1DZIA 2A33A 4WGFA 5DXFA 3EAGA 4IHQA 3TE7A 2EQ5A 3PL5A 3IOBA 4B3XA 3ONNA 4NYMR 5FBZA 4F86A 1MH1A 3IKTA 3V3KA 2CNKA 1QDLB 1E8DA 4LRXA 2P0AA