2YYZA

Crystal structure of sugar abc transporter, atp-binding protein
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
358
structure length
358
Chain Sequence
PSIRVVNLKKYFGKVKAVDGVSFEVKDGEFVALLGPSGCGKTTTLLMLAGIYKPTSGEIYFDDVLVNDIPPKYREVGMVFQNYALYPHMTVFENIAFPLRARRISKDEVEKRVVEIARKLLIDNLLDRKPTQLSGGQQQRVALARALVKQPKVLLFDEPLSNLDANLRMIMRAEIKHLQQELGITSVYVTHDQAEAMTMASRIAVFNQGKLVQYGTPDEVYDSPKNMFVASFIGNPPTNFLRDFSVSVENKQTILKRDDVIIKLPEPVDVKLKEVVVGIRPEHCRISRERVENSIPGVVYVVEPLGRDIIVNVKTEKGEIIKVFGDTGKAPQPGENVFLVPDLRKIHLFNPETEETIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Sugar ABC transporter, ATP-binding protein
rcsb
source organism Thermotoga maritima
molecule tags Transport protein
molecule keywords Sugar ABC transporter, ATP-binding protein
total genus 88
structure length 358
sequence length 358
ec nomenclature
pdb deposition date 2007-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF08402 TOBE_2 TOBE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2yyzA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2yyzA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2yyzA01
4BBSH 2QBYA 1CEEA 4RG1A 3VQTA 2F1HA 3CCRA 1J7KA 2NOAA 4A3CG 5JS8A 2IK8A 4P71A 4DR1Q 1FQKA 1ZUNB 4DT1B 3QKRB 4PMWA 1OJLA 4RFVA 5B57C 1ZU4A 1KRSA 2DNEA 1Y14B 1E2GA 2FSIA 1I50H 5M5YH 1LS6A 3OEEA 2V9PA 5TARA 1OHHD 4KHZA 3TLXA 4F7WA 4K46A 3I73A 4P4UA 2A6EC 1LUZA 1Q8KA 1Z2CA 3DHWC 3H86A 3I8SA 5AJXA 2PMZE 1AS2A 4C0JA 1NN5A 4YCWA 2K7VA 3E1SA 3PSIA 4Q1DA 3IBGA 3OESA 4UNQA 3J81k 3FHCB 4JI3Q 1WE2A 4POAA 1E2QA 4XWKA 2QT0A 1Z29A 4YWKA 1PLJA 3C41J 3HKZG 1L2FA 1F2UB 2XB4A 3MWJA 4L15A 2HYDA 4DEXA 2RGEA 1X9NA 3U7HB 3Q8DA 3WWVA 2ZJYA 3GJ5A 2A30A 3KXKA 4DR5L 4IPCA 1E0JA 3NTUA 1CUKA 4GNKA 2G0NA 4Q9IA 5C46F 1KO1A 1RPZA 4M1SA 5BR8L 4OQNA 4QHTA 4DB4A 4A3BG 1KI8A 2F52A 4ASUD 4OK6A 4DLTA 1EFWA 2R93H 3G48A 1FVIA 2O8FA 1HNWL 4K0KQ 2FPLA 4F4IA 1X6VA 3OAAD 2EJMA 1GG2A 1YZKA 1MO4A 2BDOA 5M3MH 1DEKA 1MABA 2Z0MA 1YHQA 2Q3MA 1ZNXA 3S14H 2UXBQ 3AKCA 2MQHA 3W1GA 2K33A 2MMGA 4HLDA 5KHOC 3EPKA 3CF5A 3STBC 4HJ9A 4TSFA 2I1QA 2WKQA 3K8YA 4LJ9A 4QM6A 4GRAA 3WDNA 2VPPA 2PCFB 1W0JA 4JBKA 1B8AA 2DFNA 3QG5A 3OEHD 1RKBA 3K0AA 2XTIA 4BFYA 3AVTA 1I4LD 2FJUA 2ZRCA 2ZRAA 3NBXX 4BFSA 3A7AB 3LX5A 4BE7B 2QORA 2OBNA 2YYZA 5B64A 3H0KA 4JI1Q 2QAJA 4UNRA 3REFA 3GTMH 2AKWB 1IN6A 2ZI6A 3KKMA 2H5EA 5GJCA 2HT1A 4PZZA 4TYPA 4JI6Q 2ZE8A 3LLUA 4BWYA 1ZM2A 1U81A 4LJ4A 4DIEA 4L4UA 3I62A 4DWJA 4LYJA 2ZM5A 3U9SA 3Q5EA 4WBSA 4NYIQ 3R7WB 4KKUA 4UQOA 1R7RA 3TK1A 1VQAA 2CNWA 2O5JC 2W00A 4NCHA 3S1AA 4KI0A 4DUGA 4MDEA 4WZ6A 2IEYA 1IXSB 3EIQA 2ZUDA 3PG5A 4B71A 1UBFA 1OYWA 3TGPA 3PEYA 3KTAA 4G5SA 3QENA 4V03A 1QVFA 4DV0L 1EG7A 4M1YA 4EFNA 1ZJ6A 5JEAJ 2QQEA 3AVWA 3CZQA 1TQ4A 4GZMA 2HEIA 4APVA 1AE2A 1KKMA 1TPZA 1PHJA 1VQHA 2KENA 1BS1A 5HZHA 4OGQC 1BKBA 4NU0A 1CSPA 4BY7G 1FZQA 5M3MG 1AH9A 2AMCB 3OTOQ 2GVZC 2ASEA 2JEOA 1U0HC 5GAGC 4FXPA 4EPRA 1CLUA 3EC1A 4GT1A 1JB7A 3EIVA 4RZ3A 3PUYA 3K70C 2PI2A 1NY4A 1RW4A 3TKLA 2RGXA 4JLKA 3LFUA 4Q4HA 1N34L 3ZGXA 2C99A 4A3BH 1JALA 4LBVA 3K0SA 1TF2A 1QHGA 2QMOA 3KOJA 1WCMG 1SHZA 2RHMA 4KYIB 1E2PA 5AJYA 4TSFD 4LFAQ 1US8B 2WAYA 4IEIA 1S9HA 4DB2A 4DR7Q 3I2ZA 3NIBA 2UXDL 4V02A 2XB2A 3NEMA 2IX1A 4X65Q 2ATWA 2A5DA 3LXXA 4F92B 1OXSC 4DV5Q 4AQYQ 1DE0A 2C95A 4IOJA 4LGMA 3U3RA 4C0BA 1TWHH 2K4KA 1NVXQ 1XFAA 2VQSA 4B3MQ 3KXIA 2A5GA 1OHHA 4TLBA 4CEHB 3A1TA 1VIYA 3JVUA 2P67A 3U3JA 1XTQA 1RYFA 2QSZA 3VDYA 3JC66 4LHZA 2JLZA 1UKZA 3NXSA 4LZZA 4D0LB 3EW9A 2ZSDA 3B1ZA 1RYHA 3CD6A 2ZTSA 2ZJOA 3HOYH 4LFBL 1ONLA 1OPXA 3LGJA 1YKSA 4BBRH 3B13B 1ZAKA 4ESHA 4CIDA 4IPGA 3BZKA 1U5KA 4QIWE 1I94L 4A3MH 1IN4A 4HB0A 1OLOA 1HR0L 5EXPA 3FOZA 1MABB 2J46A 4RFSB 1XD8A 3ZZ0A 1U8AA 4JS0A 4BA2I 3J81j 3STBD 2YWFA 3RRMA 4C9BA 2B63G 1F2TA 3IKJA 3LO5A 4RD6A 4D26A 3OTOL 1R9TH 4POGA 1IHUA 4DK3C 1R5NA 3K0AB 2B7CA 4QL5A 4LJZC 1G1MA 5SZKB 4C7OB 1QVRA 3VR1A 1EQQA 4HAVA 3AF3A 4F93B 1OE0A 1P61B 1X56A 1ODFA 4Q9HA 5AJWA 5C2JB 4YMUA 3C5HA 4ZKDA 2ZI4A 1SXJD 1HTWA 3L0SA 5DHAA 1NRJB 3VKHA 1A82A 4NH0A 4YMVA 3CPHA 1IOZA 3LAWA 4X8LA 4X64L 2QI9C 3E2IA 2VRWA 2FDCA 5KO2A 4B3TQ 2C77A 1KSFX 1N0WA 3GLGA 3P27A 1JXMA 2BBTA 3FVQA 3SJBA 1UEBA 3G71A 4A3DH 2Z5FA 2WP8J 4O2RA 4JT2A 3NH6A 2VQFL 5EUQB 2AK3A 4DK1A 3CXCA 4XWAA 5E7JA 2XXAA 1KK1A 4X8OA 5AUPB 4O0MA 3KTAB 1A2KC 3ZS8A 4JV5Q 2QP9X 1VQ5A 4LFBQ 4HDOB 1UADA 1S8FA 4FMBB 4MRRA 3OAAA 5DE3A 2ZS9A 4PAOA 2GXQA 3PO3G 1TQ2A 2GEUA 3PCRB 3CONA 3NDBB 2WPDA 1Z0AA 3ZLJA 4A3MG 5BN4A 2YTVA 2VHJA 4LRWA 2BV3A 3RS4A 4CEIA 4ZDWA 3O8DA 3BH0A 1Z0DA 4DV7L 4KKTA 5JEDA 1UJ2A 5DI9A 1G41A 1NSTA 4NYIR 3OZXA 3RHFA 4U7DA 1GUOA 4HZUA 2MO1A 4CEJA 4DUZQ 3QI2A 1AKEA 4JYBA 4KVAA 3EZ2A 5JJIA 4G7OC 1QZXA 3DEFA 1B9MA 2V7QD 3GFPA 4TT3D 3KX2A 4KHPQ 2ZREA 2G88A 3PUVA 2ZR9A 3GFOA 4JKIA 2Q3FA 4EPWA 1W1WA 1XTDA 4O0AA 1VQLA 1CRQA 1US8A 4MRPA 1HJPA 1FJGQ 2QEXA 2QN6A 4PHFA 3ADBA 3U44B 4X6AH 3A4NA 1E98A 4GMXA 3BC1A 1W0JD 1WCMH 1E2JA 1X8KA 4PHHA 3X1WA 4PZYA 1VQPA 1XEXA 1ETUA 1B23P 3A58B 3GFTA 3HU2A 2VBCA 1XF9A 4TQ9A 1G64A 3TNFA 4RD3A 3ADDA 5AK0A 1XJ0A 3U50C 2Y0SE 2F4VL 3EQLC 8OHMA 1VKJA 4CRWB 1ZYRC 2A69D 3KUDA 1W36B 4ITRC 1J8MF 1DGSA 4BASA 1XNQL 1VCNA 1HV8A 2Q9AA 3I72A 2N3SA 2IYVA 1BOFA 4URUR 4DVGA 1UEJA 3CCVA 4DR6L 2BJWA 4PAQA 5DHFA 5L3RA 3AYHB 1DAKA 2IA5A 2R6FA 1EYGA 3ZH9B 2A2ZA 1PH7A 2WWHA 2DBYA 5HTKA 2EWWA 4OQLA 4B3CA 1HPCA 1KMHA 3CCJA 5ELNA 1JAIA 3CCLA 2YC2C 1F2TB 4LJ7A 3UMRA 3WNDA 1TX4B 4P31A 4A3DG 2IS4A 2TMKA 4CVNA 4LF4Q 2Z6KA 1OFHA 4JI4Q 2A5FA 2JATA 2PLFA 3QF4A 3THXB 3GJ4A 5GVRA 1LV7A 3AP3A 4TYWA 3IPXA 1XMOL 3CPJB 4US1R 5BN5A 5FR2A 4A3JG 2ZU0C 1X3EA 5FLXc 1W0KA 4PSKA 4C0LA 4EQ6B 4JI7L 1L1OC 2WAQG 1HNZL 1UBEA 1VYVA 4Q00A 5KPDA 2ZSFA 1HEIA 1NG1A 4GKKQ 1II9A 3QXSA 1GUNA 1N6KA 1N6IA 1KKLA 1DAMA 1EGAA 2BKEA 2ZJ8A 5FBQB 2HXYA 3L8ZA 2HIXA 3SS8A 2XTMA 3FB4A 3SYLA 2VL7A 4MUBA 3SC3A 1MO3A 2VHQA 4PO1A 4B32A 2BE5C 1HA3A 2NGRA 3S1NH 1SXJE 4M21A 3R9XA 1AIPA 2ZUCA 1HE1C 1DAFA 3IBYA 4KFTA 5FUWA 2C9CA 4P4SB 2NN6G 3D0FA 2CCKA 1XBTA 2QRZA 3FDIA 1GVPA 1LM0A 2E74C 1ZM4A 2JA5H 4H13C 4LHVA 4BY1H 1E9BA 2QQ0A 2VLIA 3EZ9A 1XNQQ 4UJ3A 3UMSA 1NY5A 4L5TA 5K8LA 4IQZA 1QJOA 2AUKA 4A3KH 3A8TA 4OI2A 3A5UA 2IW3A 3M4YA 1E2EA 3LQQA 2AK2A 2VF8A 4PG3A 4JI3L 3ADKA 3TQYA 2DWPA 2C2HA 2ORVA 4MRNA 5M3FG 4OQMA 3PO2H 4URXR 3NEYA 3SFZA 3DL0A 1AN0A 4CEIB 2QAGC 1U99A 3K9GA 4JI0L 4DV3L 1Z6GA 4N0EA 1VQJA 2BVNA 2JLWA 3L7ZC 1KIMA 1P75A 1TUIA 1T6NA 1JJCB 1W2BA 1K83H 1Z9FA 4LF4L 2WJYA 2QMUA 4HZUB 1EFRA 3CB4A 4CEJB 3C8UA 5D3QA 3K70B 1Y8NB 1YVDA 2CJWA 4CT4B 1M7HA 1BDOA 2VL6A 4JL5A 1LW7A 2ZJQA 3RS7A 4X8HA 5C0XG 2IHEA 3E9IA 1JBKA 4QBIA 5B30A 3OW7A 2B92A 4M22A 2YTYA 2N49A 4LUZA 3KQNA 2PT7A 2PL3A 4B3SL 4DNIA 4K0KL 1ESNA 4M8NE 1KK3A 4MGZR 2IXGA 1QVGA 5FL7D 3RS0A 4BGDA 1YQTA 3CRRA 1GHKA 4QY7A 2BWJA 1TQDA 2C03A 4JOIA 1MO6A 3KF8B 3TVDA 1QG4A 1E9DA 2HF9A 4FMCB 1XTSA 2QGNA 4H0LC 2XJ4A 1EOVA 1L1OB 2BMDA 3OIYA 2WSSA 5M5XH 3LXRA 4TZ6A 3TRFA 3FP9A 3PUXA 3GJXC 4NCJA 2OCYC 1KXLA 4EJSC 1X3SA 4IOKA 4Q66C 4TQAA 5BXQC 4L9SA 3CWQA 2EVBA 3WMFA 1N9WA 1HNXL 2VP9A 4KN7C 1JEEA 2GF0A 1ZM7A 5G3YA 3L82B 4Q4AB 3MWLA 3TUIC 1C1YA 2W2TA 4IVRA 1KSJA 1L8QA 1VG0B 2LXJA 3RN2A 1P6XA 3NC0C 4ESVA 4NCKA 3ZQJA 5J4LA 3TMKA 2R65A 4ILEA 2ANCA 4JLPA 1IZ6A 4YHHL 2JLRA 3NH9A 1XTJA 2NQ2C 2ZI9A 4TMWA 5ANRB 3CC2A 1OT3A 2RB4A 4V0MA 2IS6A 1P4SA 2GBLC 4EAQA 4HJ8A 2DUDA 4OBEA 3ER0A 4HI0E 4DR3Q 1Z2AA 4FMDF 4Q03A 2D3WA 2W6ID 3HOYG 3HU3A 1R4AA 2VSFA 2GEVA 1VECA 2P3SA 1X55A 3OIWA 4W5JA 5FPYA 1K8MA 4NL4H 1J5EL 4HEJA 3VKWA 1OTCA 4OWWB 1DAHA 1KC8C 3U6BA 3B6EA 1TUEA 3B1XA 4MYTA 1G5TA 2F3RA 1GD7A 4F38A 1NN0A 2IHBA 2YWGA 4LF8Q 2AKYA 4JVMA 4WXPA 1D8TA 2E2JH 1DAEA 3CRMA 4YWMA 4B3RQ 1KI9A 2IUSA 4P4SA 4IDNA 1UDWA 4R2HA 1UF9A 3K0FA 2PX0A 2F43A 4P72A 1IN8A 3E9HA 2GESA 2B6HA 1H65A 2F1MA 5H8WA 2BMJA 4LCBA 4LYHA 4HB4A 3KFXA 3TW8B 2ZI3A 1UFQA 4NDZA 1ZW6A 4RD0A 3ZJYA 3FMPB 4YY3Q 3UXMA 4DR7L 4DLWA 3FHTA 4GDFA 2J45A 2EFDB 3NWJA 1G7TA 3LWUA 4DV5L 4AQYL 1VQBA 5CDFA 3S2DH 1SVOA 4GNXA 4B3ML 3SGIA 2JLQA 3UDXA 2KCCA 1XU4A 4JCVE 1GP2A 2G6BA 2QY9A 2ZJBA 3GJ8A 4O25A 1QUQB 1SN8A 1G19A 4NXNQ 1WI5A 3CX7A 1GL6A 2CJWB 3UWOA 5BW8A 2QNRA 1XCPA 2ZJ2A 5KOYA 3HOUH 3GTLH 1T5LA 1YBYA 1XNJA 4ABYA 4HAZA 4A75A 2J5XA 1SVWA 3UPUA 2NZOA 2ONJA 1OKKA 4L16A 1DAGA 2G1KA 2HXSA 2ZYVX 4KLZA 1TWFH 2WBLC 1UEIA 4LSGA 3CF2A 5AJZA 2ATVA 4HAUA 4KJZA 3TR5A 3B1VA 1TTTA 1AK2A 4AK9A 1VQDA 1VQOA 1X86B 2E9SA 2VF7A 3OEED 1GVNB 5EXXA 2XZPA 1XD9A 4WAUA 1NTGA 2JQOA 1OFIA 1W4AA 4W7SA 3BWDD 2CW0C 3REGA 1CR2A 3U4ZA 4FDBA 2V6IA 3QF7A 5G53C 5KU1A 1IW7C 2ZI5A 3K9HA 1R0ZA 3IIMA 2LSSA 1K9MC 3T35A 1ZKOA 4DUZL 3D6TB 2P6RA 3AB3A 5LPNA 1KO5A 1L4UA 1IJEA 4BFWA 1AJEA 4IFBA 2A9KA 2B7BA 2CK3A 4QG7A 4B3BA 1EXMA 4BFZA 2AWOA 1M2OB 3MGCA 2FMXA 1FP7A 3WBJA 4BFUA 1N33L 2R6CA 1SXJC 4B3TL 1ZBDA 1VCOA 5KNDA 3FFBA 1FX0B 2R2AA 2ZS8A 3MSXA 5DO9A 4CF7A 5M04A 4AKGA 4DXAA 1E0AA 4LDJA 3QOFA 3GEHA 5DSZA 3HOXG 3CRW1 2UXCL 4M9ZA 3F0TA 2GTPA 1IY1A 4DR2Q 1TEXA 2VA8A 2IUTA 4MTNA 1E24A 3KLWA 2ASBA 2I4IA 4R2IA 5FPTA 2QROA 3TR0A 4DZZA 4JI1L 2JA6G 4FD2A 3VNVA 4XSGA 4JI5L 4OK3A 2N1BA 2CEAA 2OEPA 4QL3A 4A15A 3H1TA 2P6UA 5IT5A 3KF6B 3S1QH 1WQ1R 2CWAA 4DLUA 2FXQA 4IJLA 4IXMA 4MKFA 3BZCA 4FN5A 2OBMA 4PPNA 4AY2A 4JYCA 1Q46A 4BBRG 3EASA 1RRPA 2C04A 3AVQA 1P2UA 1VQCA 3B78A 1L7VC 2OAQ1 2CL6X 3K0FB 1UWVA 1O7LA 2MO0A 2PPBC 3LVQE 4MQBA 4KXFB 2REOA 1NVWQ 2Y8EA 4MDFA 1KI3A 4KHPL 4DEYA 1LACA 1XMOQ 3I8XA 3K0CC 3WHLA 4UXJA 2I0QA 1PVOA 4QBHA 4Q4JA 4L8GA 4R9UC 1GRQA 3CBQA 3RABA 4M1MA 4TYYA 1P7CA 2IF0A 5FPKA 1PUJA 4O2LA 1U94A 1E2MA 1UM8A 1W44A 2BBSA 4C30A 2G3YA 3PIRA 2EYUA 1KK0A 1F60A 2ZS7A 5FUXA 4BLPA 4A82A 1OIXA 2VQEQ 5JHGB 5K8TA 5IE8A 4GNXB 3GLHE 3FFAA 1VIAA 2JA8G 1TXYA 2YOGA 4IVQA 3AVPA 4QGUA 4ZO4A 3CZPA 1E2HA 2CXXA 3Q5DA 3MWYW 4DR2L 1UE5A 3VR3A 5FPHA 3BERA 1KRTA 1FPMA 2IF2A 1NMGA 4GBMA 3TREA 5C44G 5FPSA 3WY9A 3CMAA 1KO4A 2Q9BA 1GM5A 1T4GA 2ZRMA 4ZPXA 4GOXA 1W7AA 5K8UA 2UVQA 3NBYC 1Q12A 4B75A 2ZTCA 3BGWA 4PZ6A 1HZAA 2RF4A 1MRNA 2HDNB 4MH0R 4RZXA 2J41A 3W5IA 3ND9A 1VG9B 2H8KA 3NEJA 2I5LX 3I7FA 3SFVA 3AVOA 4GSYA 1VQMA 4EIWA 1NKTA 1P9WA 4YC7A 1KI6A 2OQKA 2HLDA 3QIAA 4A0GA 1YJNA 1SFOH 1BYIA 3DO6A 1G9XA 1AGPA 2QG6A 3NBZC 4QC2A 2VH5R 1SMXA 1V43A 3MUFA 1LFDB 4OO1G 4ZKEA 2YWEA 1W3SA 2EQSA 3UK6A 3X2SA 4E22A 3CF6R 4D2IA 2LKCA 2D0PA 2OFXA 1LNZA 4LHXA 1R10A 1KL9A 1XEWX 4DR4Q 3EA0A 4DLSA 1XPUA 4QJ3A 1WJJA 2EJFC 3LLMA 1PYBA 5IWAQ 1X54A 2CKZB 3HOZG 2AXPA 3H15A 2CWPA 1T8UA 1EK0A 4HSEA 5CIWA 3I4LA 3U7FB 4KV9A 1T0HB 2QPTA 4OJKA 1G6HA 3CC7A 4Q48A 1K8AC 3EWSA 4YDSA 4DUYQ 2B8WA 2ZI7A 4TL9A 1KO7A 3TAHA 5F3WB 5FOVA 1VF5C 3AUYA 2E76C 1VQ6A 3K1JA 4A2QA 2GCOB 1H9SA 2Q3HA 5AJ3Q 4LC1A 5DI3B 1N8RC 4AKEA 2UUAQ 3TW4A 3X1ZA 3D31A 5DH9A 4DV4Q 1GRNA 2CLSA 1T5EA 2GILA 4M2LA 4U02A 5TVKA 3RWOA 2IXFA 3Q7QA 4RCYA 5H1YA 4AD8A 1OIVA 3AM1A 1W36C 3VU9B 1CIPA 4N1AA 3UANA 4JLMA 2IYQA 2N8NA 4LW1A 4LJAA 1Z63A 1VQEA 1IYUA 2A68D 4NZYA 2D4HA 4Q5IA 3SBDA 2NVQH 3LBNA 4O3MA 2W6IA 4WIAA 2QTFA 3SBEA 2ZSBA 3QEJA 2YOHA 4BFXA 5CM8B 1NVUQ 2JXMB 3KDFA 4CT5A 3BFVA 2A6ED 421PA 4BQSA 1VS0A 1IM2A 3EARA 3T15A 1E6CA 5FTJA 4X8MA 3TSOA 5KDDA 4PR0A 1E2NA 4I1UA 1X6OA 2OCEA 4PZ8A 2CE2X 4DR3L 5CLQA 1G6OA 2OTLA 1R0XA 2ZYUX 4JMPA 1QG2A 2WWGA 1WP9A 4PZ7A 4HAWA 4ARZB 1CKMA 3KYHC 1I2DA 1J5EQ 1W4BA 3L0OA 2KBFA 4PC2A 3R8FA 1LF0A 2MMCA 2J0VA 1EUJA 5JSZA 4DV7Q 5IYBG 2PH1A 5L3SA 4GOKA 2PEYA 4L9WA 4MGKR 5IP9H 3KKNA 4D4LA 3GTPH 4IO9A 3AKEA 2EFGA 2D2CC 1NLYA 3L2PA 2DCUA 4IDQA 5C4GB 4A2PA 1OFUX 3MD0A 3I4MG 1ZMXA 1FQJA 2VSOA 4G5GA 2F1IA 2D06A 4LY6A 3VHLB 5D3MB 3RS2A 4B2IA 1DVRA 3WNBA 1K6MA 4Y0VA 3SJCA 3VKGA 4QNRA 1SROA 4DV6Q 5CK4A 1TWGH 1D6JA 1HNXQ 4IPDA 3U7EB 1DTSA 4B74A 3THWB 5JJKA 3A1UA 4LF9Q 4EPVA 3ZYCA 3HPRA 4NYJR 2WJJA 1Z8FA 1CJVC 2GA8A 1DO2A 4X62L 1X1RA 2RGCA 4HAYA 3RANA 4HUTA 5KTYA 4OQFA 3U3OA 4NYMQ 1R8SA 4URYR 4DK0A 2V1CC 1WFQA 1AM4D 1T8TA 1YJ5A 4A8JA 3PFIA 1AS3A 4TMXA 3RYTC 2J7PD 5FI0B 1C9OA 3AQ4A 3VNUA 1ZP6A 2WM9B 1R2QA 2ZJAA 3EC2A 4TZ0A 3RC8A 1JAHA 4A3LG 1COWA 3M4OH 1CULC 2RGAA 3GJ7A 2VIIA 3D3QA 1YU9A 2RHDA 2H5XA 2KHJA 3W6NA 5HR5A 1RC8A 2XX3A 1RFLA 1CSQA 2J0SA 3QBTA 2ZE6A 4QGFA 4DV0Q 1MT0A 1RE0A 1XMJA 2Q6TA 1E2FA 1RJ9B 3C15C 5DLQE 1SXJB 3T1VA 3FPPA 3WBKA 5KSPA 1IYJB 1P8LA 1Q20A 1U0JA 3IO5A 1X8LA 2RCNA 3QVVA 3PCOB 3UDIA 1G8FA 3KL4A 1M1YE 3A74A 3B85A 1GUSA 3GTKH 2ZANA 2C9YA 1NMYA 1AZTA 3QKSA 3KQHA 1KDPA 1OFTA 3CCEA 1FL0A 2NG1A 2WKRA 1CS4C 4Q7KA 4QGHA 3U4QA 4LBWA 1N5LA 1E2IA 2VW9A 2E87A 4URZR 4AIMA 2HYIC 4C2TA 4AH6A 3LW7A 5JMTA 5KYKA 3I61A 3RR5A 1E1QA 1UE6A 2JIZA 2PLRA 2BE5D 2JDID 3HPQA 1GZSA 4DHEA 5IDVA 1Y69U 2ZEJA 2EW1A 3VU9A 2YJTD 2ZRPA 2VSXA 3FKIG 3CH4B 3A8IE 3FGNA 4NTZA 3UWKA 4KCGA 4B3XA 4PTLA 2XOKA 2GJSA 3J81c 4OX9Q 4RCZA 3LY5A 1N33Q 5EE9A 2Z0SA 3P4XA 4DLVA 4HDQB 1FUKA 721PA 5E7NA 3N5CA 1KHTA 3E5HA 3M9BA 4PZLA 5HY6A 3KDFB 2K52A 4MRVA 5L3VA 2RGNA 3T1YQ 2YKGA 4JT4A 4FINA 2IYZA 3VFDA 1EFTA 1HYQA 3ZZUA 2ERXA 3WRYC 3SU8A 4OHVA 4B35A 1VQFA 4A3GH 4HIMA 2UKDA 4JJKA 2R7DA 1XMIA 3PEWA 2CE7A 2O8DB 1PYSB 2HHHQ 1T3SA 1K5DA 3DZ8A 4ARZA 2ECKA 3CCMA 4I1SA 4JBXA 4JLJA 2FEMA 3TE6A 4C0QC 3G82C 1EQRA 3GP8A 1PH2A 4ASUA 1E96A 3T1OA 1IBLQ 1GUTA 1II8B 1XJCA 4TMZA 5LB4A 5FOSA 4GFDA 3QPVA 5IYDH 1VQGA 3AP1A 5L3SB 3CRLC 1CJKC 2AXNA 1CJTC 3DZDA 4TTRA 4IVPA 4EFLA 4M1OA 1HQYE 2HUPA 1T3LA 2R9VA 2KWIA 4NP6A 2ORWA 2WJGA 4BPBA 4C3IH 3A6PC 3HR8A 1E4YA 3HR7A 4RKFA 4BLOA 4IOCA 2DFTA 3I92A 1Q90A 2JEBI 1TAGA 2GAAA 4P0TA 4Q1CA 5FL3A 4LK1C 2J87A 4IRUB 3CH5A 5D3MA 2R92G 2ZUBA 4FWTA 5KSZA 2NN6I 2O8CA 3GQBA 1JQJC 3AF4A 4XD7D 1XXHB 2OT3B 1U8ZA 2WSSD 4PO9A 1IBMQ 1HUQA 5UKDA 3ASYA 2D2FA 3TQFA 1SRUA 1RIPA 3PV0A 1HE8B 3WRXC 5A4JA 1ZNWA 2OFWA 5DYGA 4URVR 5IP7G 3FMFA 2F3TA 1X8JA 4BZPA 2GZHA 1Z22A 4PSVA 2WB1E 1CR4A 2X8AA 3S16H 1RVDA 3L0IB 4ACBA 4DSUA 1FJGL 3DKVA 3W8RA 4BLTA 3OOCA 4NYMR 1HQCA 4UY8C 1M7GA 4Q9JA 5GJWC 2JJQA 2QAGA 3GLFB 1SGWA 1N2CE 4YONB 1N32L 1T0JB 2WB1G 1QHHA 4CGZA 4LWCA 2A8VA 2AL7A 2R6AA 4D4JA 2J0UA 3T5DA 2GJ8A 1WXQA 3RSLA 1KNXA 3ZIAA 1Q44A 3PEVA 5EXSA 1KYIA 3T1TA 3BJIC 1E79A 2R7ZH 1JJ2A 1L4YA 2F4VQ 4GOPA 4NCNA 3GJ0A 3THOA 1NIJA 4TKOB 4JBJA 3PIPA 2NO7A 2WIBA 3RS3A 3FWYA 4HYYA 4YHHQ 3U3MA 5EAYA 1NJFA 4DR5Q 1H8ED 2A1AA 5IYDG 4DR6Q 3QKSB 5LB2A 3ICEA 2OWOA 3RZDH 3OFND 5E7IA 1IYVA 1M34E 5G40A 3AFQA 2ERYA 3SI7A 1RL2A 4JI8Q 3H3VH 4L5QA 2AX4A 3EIHA 4OI0A 3NE5B 2QM7A 5EE5B 5JHHB 1QHYA 4OO1H 4XVQA 1PLLA 1PH9A 2DR3A 4JOIC 4I1VA 2ZVPX 1P62B 3BU2A 5CJ2A 4X66L 2GN5A 2N78A 3KJIA 1I4DD 4EQ5A 2LMCB 2IYSA 4FCWA 2OFOA 4XIGS 1S4QA 4M1KA 3T06B 3B9PA 2QBYB 3H94A 4ZDJA 2XNDA 1HZCA 2NIPA 2ZAMA 3Q8XB 1S72A 3CNNA 4Q7MB 4DT1A 3N6RA 1YHBA 1DXMA 2NO0A 4GMDA 4YMWA 1MJCA 1LB1B 2ODNA 3R8CA 4GOPC 1HNZQ 1DO0A 1HQMC 4LF6L 4TN1A 2UU9L 2DWOA 1YNNC 5JI3E 2JIZD 4JKYA 4GKKL 4KKSA 3B7GA 3L8YA 4P4TA 4NKRA 3QUSA 5FLMG 1A4RA 1G3IA 4AURA 2CHQA 3ZS9A 3TBKA 2O8DA 1VQ9A 2UUAL 3EPJA 2W0SA 3T34A 5GJBA 2D5DA 4P3YA 1J70A 2R6GA 1QDEA 4BLSA 1G18A 1E3MA 3G6EA 1YVCA 1KI2A 2GBLA 5BN3A 3DMDA 4Q1AA 2HQLA 3H3VI 5JLJA 3VR5A 4TLAA 3V4FA 2ZM6Q 1KZGB 1KI7A 5FJ8H 1GJXA 1YNXA 2JJ2D 4FWIB 2IS2A 3AKYA 1SMYC 5C1BA 1FFHA 1GNPA 4NXNL 3AF2A 2W58A 4UKDA 5K36G 1S40A 2WOOA 1NIPA 4JYAL 2BIFA 4JI4L 2FEOA 2QP4A 1ZD1A 1VF7A 4IKEA 4LBZA 3KB2A 1ELOA 1ONBA 4I4LA 2V8OA 4DDTA 3EBEA 4R7ZA 2GEDA 2O8FB 1X65A 1CRPA 4YXWA 3K09A 4MUAA 3A4LA 5J5CA 4RY2A 4LC0A 4GKJL 4B2LA 4NXML 1K5GA 2B8FA 1GIAA 1TNDA 5J4VA 2PX3A 4EX5A 4C0SA 3CW2C 3T5GA 1XDBA 2QSYA 4EUNA 1A7JA 1EFHA 1Q21A 1E4VA 4ZCIA 4M9QA 3KKQA 2GWHA 3B1YA 3CCQA 4FCTA 3RLNA 4R98A 4YXWD 5BQ5A 1HZBA 1KDTA 3M7NA 1P73A 2CQOA 4IFDI 2ZYTX 2N42A 1A8VA 4XOIA 2V3CC 2FPMA 3UE1A 1RZ3A 2QAGB 3M6AA 1AZSC 2X19A 4CYMA 3KQUA 5FTKA 2VYFA 2H7VA 1NKSA 2NVYH 1SZPA 1CF4A 2FFHA 2XITA 3A8JE 1ZCAA 5H70A 2IWHA 3WYGA 4GLVB 4KITB 3IHLA 4UNNA 4GOPB 4Y0AA 1EX6A 1G20E 1KJWA 1KK2A 4BLRA 3G4SA 3FKSD 4MGIR 4PC3A 1VQ4A 1Z83A 4EPXA 5FTLA 2QE7A 3R7WA 1K8RA 1YNJC 1XD2A 2QEQA 2GVDC 1XEWY 5DGXA 1S2MA 2IT1A 2XAUA 1IBRA 4R4IA 3ZVRA 4BZXA 4PHTA 3CAMA 2QTHA 4US2R 1B9NA 2QMHA 2BDTA 1VPLA 3RNLA 4IDOA 1NVVQ 2Q21A 4Q4LA 2C98A 3P32A 4URWR 2O5IC 3X1DA 5L8VA 5GQOA 1XMSA 2ZXUA 2VUMG 1DPFA 1EFCA 2YTXA 3A7LA 1D7QA 1T3HA 2XZOA 3ICQB 1BO6A 2QP3A 1SVSA 5F98A 3IO3A 4GKJQ 4IPHA 1P9NA 3QSYA 521PA 2ZRGA 3BK7A 5KNBA 2O0JA 5FR1A 1YIJA 4RD1A 1IN7A 2H17A 3NHBA 4WVFA 2LWIA 3DM9B 3VR2A 4DCVA 5LMNW 3OIVA 1Z28A 2J59A 2W0MA 2IYLD 1YI2A 3EZ7A 4Q21A 1D2EA 4Q4HB 4XH9B 1KAWA 1CKNA 3ZQ6A 4A2WA 2OE2A 4P75A 2WJIA 2ID0A 3W34A 5J3BA 3BE4A 4POFA 1N36Q 2ZRIA 1FUUA 2FN4A 1U2RA 1I6VC 1XPOA 3O47A 3ZVNA 1E69A 1KDOA 4ME3A 3AVVA 1Q1EA 2J7KA 2WICA 4L5SA 3DOEA 5HE9A 4LF9L 4QGGA 5C0XH 1C4OA 5BWMA 4TL8A 5F2EA 4GLAC 1FP6A 3KFVA 3N2EA 3CCSA 4LPSA 4OL0A 5FOXA 4Y52H 3CLVA 1ZU5A 4PANA 2K5NA 4GNXC 4D25A 1OXVA 3MG9A 3JZMA 4BXXH 3HFZB 2DFKB 1JNYA 3FE2A 4LBYA 4A6PA 2W2VA 5DN6A 5IP9G 4OHWA 1Z08A 1A63A 1KNQA 2GKSA 5AUQA 4YCVA 5IK2D 3VHXA 4KVGA 4R4TA 1E1RD 3LBHA 2XTZA 4Q47A 4RFSA 5JJLA 4OWXB 4DCNA 4DUGD 3KDSE 2GETA 3IFTA 2G77B 4PPQA 5IP7H 5HCNA 4EFMA 3GTOH 1W2GA 3BAFA 3QXHA 4I1OA 4NE2A 4ZI3A 5GROA 2FE4A 2O5VA 4F91B 3VA7A 1VDZA 1CP2A 5C3EH 5JWHA 3HJNA 4IDHA 5JCZA 4C7OA 4JLBA 4RSGA 4PC1A 2WHXA 5A0FA 4MA4A 1V8QA 3P20A 4QFMA 1GTVA 2V6JA 4XVUA 3PENA 1KSHA 2C9OA 1TMKA 5F9HA 3QEOA 5IYBH 1N5KA 3K70D 2R8RA 1NE3A 3RC3A 3H0GG 3OEHA 3IRBA 3HOVH 1BKDR 1BH2A 1BVSA 2JAQA 3L2OB 5FOTA 4OX9L 2DFLA 4B34A 4NHOA 2VNUD 1KHIA 2Q2IA 4UP8A 3ULJA 2VUMH 5IT9c 4BFTA 1H95A 1XD2B 4DLYA 3VR4A 5KPJA 1Y8PB 1X3FA 3U61B 1YR6A 3BH7A 2QA4A 4TTPA 3KZ1E 2P6NA 3NBHB 1E7ZA 1H9KA 4KFUA 3DM5A 3ZVLA 1NN3A 2CLDX 3BIFA 3FMIA 3OFNA 4HB3A 5FFMA 1DARA 3AVXA 2ZQ5A 4PQYA 1T91A 3MAAC 4E09A 2EJGC 2I5HA 4B48A 2DY1A 4ZCMA 3LNCA 4B44A 4DNRB 1KQSA 1A1VA 1TEVA 1XMQQ 3HKZE 5FUVA 3MEFA 1R8QA 3U7GA 5EE0A 2C5LA 2EXDA 2AN9A 2GNOA 3OIUA 3PJRA 1ANKA 4LX0A 5HGQA 1MKHA 4Z8YA 3U4VA 1JJ7A 5EXTA 1K8OA 2VP4A 4LV5B 3QKRA 1PV4A 5EQTA 2D74A 3IILA 3WP0A 4CW7A 1E1TA 3AF0A 1WBDA 3SQWA 1X3GA 1N0UA 3B60A 1LTLA 3H84A 5TV2A 3I4NH 4Q1FA 1XPRA 2MSCB 4UNSA 2JLYA 4MYHA 3EXAA 4IEEA 4E5UA 4BXXG 2C78A 4A92A 1HR0Q 1OXXK 1GUGA 1R0WA 2D2EA 4TMVA 2DGYA 1G7SA 3A4MA 4JI8L 1YZGA 3IIKA 4K81B 4ZIRB 3QNUA 1XZQA 2Q9CA 1W46A 3P1JA 3BOSA 4C3JH 2FZ4A 3LX8A 3U44A 1F2UA 3T12A 3QPWA 4HDCA 3X1YA 4JC0A 1E9RA 4B2PA 4IJHA 2QL6A 3H2YA 4BRWA 2ZE5A 1JE5A 3EAQA 1NBMA 1IBKL 2KI5A 4S35A 1EESA 2NTYC 4AYWA 3U2QA 1U8YA 1ZC3A 3A37A 3NKVA 3CX6A 4D6PA 1N6PA 5JWOA 3GLIE 5K36H 2FFAA 5CDFE 4Z1MD 4XSHA 2ZRLA 4JLVA 1W0KD 2NZHA 2DN8A 3EWAA 3LWNA 2CHGA 2FSFA 3FKIH 1KAOA 4LF6Q 4QHSA 2QGQA 2WVJA 4NYJQ 1MIUA 1G51A 3GTQH 1XNRL 2P2LA 5CB8A 4PQFA 1EFRD 5B2ZA 3AUXA 2YVUA 4NPSA 1N32Q 1XCMA 3P26A 2VQEL 1G7RA 1NP6A 3O8RA 2OHFA 2UUBQ 1HZ9A 4I81A 4IFEA 3JAMi 4Z1MA 3F1ZA 1Y1WG 1AGRA 2L0XA 4I99A 1B7YB 1IXRA 2HV8A 2WTUA 1E22A 1BBWA 2KHIA 1A62A 1M90C 1AS0A 4LOAA 1KO8A 2OLJA 3S1RH 4X65L 2EDGA 5HE8A 3UMFA 1FOEB 2CMKA 4RVCA 3THXA 1AE3A 3QF4B 1G8HA 3CPWA 2FU5C 2K5UA 2RGGA 2ZR7A 5AWFC 3UG6A 3BB1A 2H57A 1CJUC 4KSCA 1C0AA 3IPYA 2Q8IB 2DWQA 3UDGA 4L5BA 2G1JA 3SQXA 2ANBA 1Z6HA 4LV6A 2WWWA 4AG6A 4BUJA 1M74A 3TS2A 4AC9A 2LXKA 3LH5A 2VP0A 2RGBA 5HKKA 4JVLA 1KY2A 2AFIE 2PMKA 1N6OA 4EDHA 6Q21A 1YE8A 4TL6A 5J47A 4B3SQ 2XSZA 5JEAG 3BFXA 5EP3A 3C7KA 2CL7X 3FMOB 1Z07A 2GF9A 1XX6A 4LYFA 1IBKQ 2B3GA 1D9XA 1E94E 3K09C 1Z6YA 2FF7A 4BECA 4A3FG 1IXRC 5AUNB 3GLIA 1DBSA 4DCTA 1UPTA 1GDDA 3HWSA 4FIDA 2ALYB 2IHFA 1V9PA 4DV1Q 2UU9Q 3SE0A 2K5VA 1PH6A 4C2UA 1Q57A 5C4XG 2PNHA 4MNOA 3CW2A 4YMSA 1W5SA 3KB1A 4DR4L 1ZNYA 4MRSA 3IQXA 1FW6A 2ZTDA 4NMMA 3VAAA 3DM3A 2PCLA 4PV1C 1E1RA 3AV0B 3C16C 3V00A 1G291 4NB3A 1VQKA 2BM1A 1KD1C 3LVRE 3MJHA 1SVKA 2UUBL 4IHQA 1G3QA 1EWHA 2WPDD 4C2MH 1DAIA 4GS3A 1S3SA 1E1OA 3A0JA 2EYQA 4RJLA 1CJMA 5H68A 2BC9A 3K0EA 3AKDA 1H8HD 3B9QA 2KE5A 4DK6C 1VHTA 1Q7YC 2HCJB 2X77A 5CJPA 3TSWA 5LMNL 3RNUA 4ZV4A 1P3JA 1S9DA 3CPEA 1M8PA 2FWRA 2JCSA 4A3FH 5E4FA 1U98A 2VS1A 3C4JA 1S0UA 1TQ6A 4TWZA 4ZIRA 2FG5A 4QJFA 4OK5A 4TQUS 3VMFA 1ZCBA 3LBIA 2IWRA 5E3HA 1PJRA 1Q0UA 1Y1VH 2I5MX 2E2HH 2C96A 4TLCA 1I3QH 1DOAA 2EQBA 4NXMQ 5FH9A 2E5LL 1E9CA 3OF5A 4AI6A 4CEHA 3AH8A 4IOMA 3I56A 3OPOA 4PAMA 2IS1A 2ZR0A 2BJVA 4A3CH 2VHCA 2WZQA 1E2VA 2W6JA 2V4DA 4QJ4A 1E32A 1NMXA 1LABA 5LD2C 4RMFA 1QHIA 3IEVA 2OILA 4JI2L 3BFKA 4GP7A 4DJTA 1VTKA 1W4RA 1A0IA 2QT1A 1UE7A 1HT1E 5DN6D 1BBUA 4AYBE 3S2HH 1Q22A 1SQ5A 4KO8A 5C4XH 4XWOA 2G0TA 1XJQA 2REBA 1XZPA 4PC7A 1K0RA 1IJFA 4ACAA 3LW8A 2MNAA 3IDQA 3BS4A 2EFCB 3SZRA 2ZJRA 1G8PA 1U9IC 4DSOA 4ZI2A 1E2ZA 2C35B 1WDTA 3I1FA 2PMDA 2WWIA 2Z43A 1Y1VG 1CR1A 2K5HA 3PF5A 2D7DA 4US0R 2PBRA 4PFSA 1YRAA 3E70C 2NVXH 1IONA 4KBGA 1J2JA 2BM0A 4BBSG 4Q1BA 1JPNA 2WMOB 1II0A 1N0VC 3RSOA 2REXB 1CU1A 2G83A 3FMCA 3PO2G 4H9GA 3PXGA 5KNCA 1B0UA 2FGKA 3CRQA 4IJMA 4YCUA 4GN4B 1PLKA 2PCJA 3ZDQA 5TY0A 3CKLA 5DLQC 4Q7JB 3RRZA 2WAXA 3J80i 3GLGB 1OH6A 3TAUA 2ODEA 2FSGA 1YZNA 2BBOA 2QPOA 1HURA 3J81i 4QJ5A 3IQWA 4ZDKA 4JIMA 3EZFA 4DSNA 2R62A 4NONA 1Z0KA 4CZ2A 3GLIB 1XRJA 2GXSA 4NBSA 4W9MC 3O8CA 1D9ZA 1W36D 1A6XA 4LV8B 5ELOA 3F5FA 1CKOA 3I4OA 1V1QA 1E2LA 2F43B 3RWMB 4RKEA 4HLCA 5DNYB 3KLRA 2B8TA 2RAPA 3ZJYC 3H4MA 4UXIA 2NPFA 3BJUA 3EPLA 1O78A 3BDOA 1R5OA 1GO3E 2CVFA 5FBRB 1N36L 1KTVA 2ONKA 3KXLA 4JBYA 4DLRA 4JI7Q 5C4JH 2V7QA 1KOFA 1YR9A 2CBZA 4G7ZC 2BH2A 1GUAA 2H16A 3BXZA 3CCUA 2IY5B 1SULA 1IY2A 5CYPA 3HOWG 2F9LA 3W6OA 1XTRA 3BBPA 4CDGA 3U60B 4G7HC 3K9NA 3PGZA 3MXUA 1EWQA 2OBLA 1S1MA 3VTKA 1QUQA 4JVNA 1GRRA 3A5ZB 4DAYB 4GPTA 3MRSA 4U00A 3K9LA 2A6HD 4YWLA 4H1UA 3TJZA 1C9KA 4LF5L 4LUVA 1VG1A 1YRBA 2VP5A 1YJ9A 3ZZTA 2PQAA 4KU4A 1GOTA 1W49A 1ZIPA 4JLNA 5KSOA 3F2DA 3RRYA 3HOVG 1YZLA 4G3XA 5CM9C 1ZINA 3EPHA 4JI5Q 3AVUA 3M3YH 4R1JA 2A78A 3SOPA 1W5TA 2OXCA 2E8GA 1XEXB 2NMVA 4TVAB 2ZRBA 2A6HC 1D8LA 3QXXA 1JR3E 1FMLA 1RRCA 4E07A 4WW0A 2MSEB 4BEJA 2ZRDA 3SYKA 4HR7B 4A9AA 4B3DA 4TYQA 4A3LH 3RDPA 3D4RA 4P73A 4DIDA 3ADCA 2SHKA 2P5TB 1T5IA 2OZEA 3DDCA 1HY3A 5KDLA 2BCGY 3N70A 4RCNA 1IBLL 4FMCF 4A0RA 4LF7L 5HZKA 5JEEA 5GADl 4R4QA 4LHYA 1OIWA 5JECA 2KCMA 1JB1A 1VQ7A 5FTMA 4G5RA 2HJVA 3CC4A 3E0EA 4XTRA 1KMHB 2ZSEA 2QENA 1XJVA 1TL7C 3NG1A 4H1VA 4BY7H 5BR8Q 1ZC4A 1S96A 1WF3A 4RD4A 2I3BA 4A6XA 1GILA 3W8NA 1R5BA 4D0NA 3PUZA 2DYKA 1GHJA 1DCZA 1Z0FA 5DIFA 2JJ8A 3EZ6A 3PIOA 3AB9A 3SJZA 1WCV1 3T51B 2VZAA 3J80c 1HNWQ 4UXHA 2JA8H 1XB2A 2ZVQX 3FKSA 5E95A 4E03A 1E79D 4M0LA 1UKVY 4EQ6A 2JASA 1ZM3A 4IXNA 5CK5A 3KJGA 3AVYA 1BIFA 3TS0A 1TU3A 4FW9A 3EIEA 4KLKA 1G4UR 1FL9A 2NZJA 3F8TA 2RGDA 2ZRKA 2UZ3A 2F1JA 3CRVA 2DB3A 5C44H 1OW3B 1O87A 3NELA 2HHHL 2QM8A 4KN4C 1IN5A 3CRKC 2IYTA 1Z6AA 3M0EA 5C18A 3KJPA 1SKYE 3BB4A 2BA1A 3H0GH 3KJEA 1QHNA 5IF9A 3MCAA 1P9RA 4C4PA 2O0HA 4D4MA 2YV5A 5L3QB 3VX3A 4A0HA 2QA5A 3GO5A 1K8GA 3K0CA 1GITA 3SEAA 1MH1A 3EA5A 4C3HH 2F3IA 2WFWA 5GADC 3QG1A 4HATA 4KSBA 4OJQA 3KJHA 1M7BA 1OV4A 5JWRA 1MRSA 1KJYA 2AD5A 1NG9A 1NVVR 3QXCA 2ZRHA 4M4SA 4P33A 1KY3A 5CB6A 1UE1A 4OXPA 2BBWA 4B76A 3QKTA 3TUZC 1NBME 3U3KA 2IC5A 1YZUA 3UG7A 3RRNA 4MKIA 3A1SA 3CR7A 3GPLA 2JA7H 4JBMA 1PH8A 4G1UC 1Q1BA 1OH5A 3KJOA 1QZHA 1YHNA 1G17A 5CYOA 1VQIA 3ERSX 4OWTB 4DUYL 3LD9A 1IY0A 4P32A 2K75A 1KAGA 1UDXA 2ODBA 4GZLA 1OXTA 4Q9KA 1P5ZB 2R44A 2K32A 2PQAB 4PO8A 2F6RA 2JA1A 5EE1A 4AWXA 1TF5A 4D0GA 5B58C 5FBVB 5IHPA 1PH1A 1UBCA 3UDFA 4QBFA 4BLQA 3WXMA 3PO3H 3BD9A 1VCIA 2PI2E 1ZRHA 4ON9A 3VX4A 2OUKA 3CM0A 4HB2A 5AJVB 1NNEA 1FYCA 1QHXA 4JG2A 1FNMA 4JL8A 5C0XJ 5LDDC 1KI6B 4MGYR 1L1OA 2OLKA 5TMPA 3OYYA 4K8OA 4Q19A 4GOJA 1GL9B 2FZLA 4G5QA 4O2DA 4N0DA 5FTNA 3F3YA 4XD7A 4AG5A 4B3FX 2AD1A 2J3EA 1S1CA 2ZJ5A 5LMNQ 1EWIA 2BMFA 4PX9A 3WYFA 3ULLA 4MITA 4OI4A 3U4QB 2F55A 1KJZA 1SVIA 2F9MA 4YMTA 2FV8A 3U6KA 1JJGA 1XWIA 3TRZA 1KGDA 4OQXA 3P4YA 1OH8A 1N25A 1KIXA 2R6DA 4Q4AA 3SHWA 4BZQA 4TL7A 4B73A 3GD7A 1HH4A 5EZ6B 3SNHA 4DV3Q 1CTMA 1E0SA 1HT2E 1RIFA 2P0EA 3GTGH 5JI2E 4XTCS 5BYJA 2V54A 2Q2UA 2R7FA 4OI1A 2PZEA 2VHUA 1LS1A 2QGZA 4OYHA 2B29A 2AUJD 2CFMA 1QZGA 3N2IA 4Q7LA 1GL7A 4B47A 3GJ6A 2WJVA 3QQ5A 3TIFA 4DV1L 1Q3TA 4H44C 2HCBA 4Z51A 3MMPA 1F3OA 2VO1A 3FHWA 5IK2A 3EX7C 4JI2Q 2N46A 4TMKA 3S24A 4LI0A 2ZTEA 5AUOB 1IL2A 2X1VA 1MOZA 2XNSA 2Z83A 2ZPTX 3AGPA 4MKGA 2IX3A 5F9FA 1E99A 2OSBA 3UKDA 3CP0A 5DYIA 5M5WH 4B3GA 2ZRNA 3CPFA 3LNNA 1ZD8A 3I32A 5G3ZA 2IYRA 3W3ZB 3RAPR 4C0HA 3Q85A 1VHLA 3CNOA 1Z06A 2JLUA 4DR1L 3NVAA 2V55B 2OXRA 3B82A 4R4CA 2V1XA 4A0FA 1DADA 4GN3B 2OG2A 2JA7G 2UZIR 4IW3B 1KSGA 2OQ0A 2JGNA 5L3QA 2HF8A 3HOXH 2LKDA 4A1FA 3M4PA 621PA 2QE7D 1CFMA 5TB5A 4DPGA 4IOAA 2O0KA 4X64Q 1PFSA 1YZ6A 4L5RC 3GMTA 4C3ZA 4DBLC 2ZT9C 1LF5A 2IYWA 2XEXA 3D7MA 4GP6A 4EKDA 2VTKA 3GLGE 3W1BA 4ALPA 3U58A 1NY6A 2FA9A 3CMEA 3G5UA 1F6BA 4YQFA 1PZNA 1BYUA 1YZTA 3R9IA 4BFVA 5J40A 3HOUG 4LYAA 3I5XA 2JA9A 3GLHB 3OW2A 2PEZA 3PITA 4JV5L 1D2NA 2GJKA 3GEIA 4LUOA 2KSQA 2CCJA 2YC4C 5A5GA 1WB9A 4DLZA 3W6PA 3CX8A 2BA0A 3QJYA 4HJ5A 2MSDB 2Z4SA 3WYAA 2PZGA 4J15A 1VMAA 2B8GA 1G3UA 4LWZA 3PUWA 4A3JH 3NC1C 2JLSA 2XGTA 3IGFA 1LVGA 1FTSA 1G5RA 2RGNC 2VHTA 2R7ZG 2L5TA 2IHYA 3ZD7A 4F4CA 4DKAC 2J0QA 1ASZA 2JE6I 1NMZA 3JZAA 2FX3A 5FI1B 4LF8L 3M4QA 1U90A 1NSFA 3WP1B 1E9EA 3TEHB 5C3EG 3HOWH 2NO6A 3BH6A 5FOUA 4JLOA 4TYNA 4DAMA 2Z4RA 1RRGA 4A8JC 1OB5A 2GHIA 1SKQA 4V0KA 4IFDJ 1ZUHA 4DDVA 1SE8A 5ELXA 2ZU6A 1XCGB 2GVBA 1Q1QA 3HKSA 2CNWD 1TWAH 2WWFA 3NDPA 4UJ5A 1SR3A 1SVLA 3L43A 821PA 1XXHE 1DS6A 121PA 2J1LA 1P2VA 5FJ8G 4AYTA 4TTQA 1G7CA 4JI6L 2B63H 4FCVA 3RZOH 1L2TA 3I5YA 1E1QD 1DG1G 3K7AH 2VEDA 2OAP1 1RJ9A 4JSYA 2YINC 1FX0A 3T56B 1SXJA 4FMDB 1Z47A 1OB2A 1JEDA 1EFUA 4DCUA 1GFIA 1AKYA 3SJAA 4M53A 4V0NA 4QQBX 4MYCA 4QOSA 3G0HA 3S17H 1OYYA 4FI3C 1HTPA 2NO9A 1GKHA 4HUQA 2YOFA 2V1UA 1JMCA 4HLUC 1I4TD 2I1VB 3SYNA 4AKIA 2Q2HA 1TADA 3PQCA 2ZE7A 1FMJA 4OHYA 3CNLA 1OKKD 1I6HH 1MKYA 3A36A 3AGQA 5DISB 5LD2B 3ULPA 4UP7A 3GJ3A 5M3FH 3MWKA 3VR6A 5CLLA 5EZ5A 3TH5A 5JS7A 2P65A 4I7ZC 3KF6A 3J7ZC 1Y3AA 3QBVA 5KSYA 5GAEC 1R0YA 1V5WA 1Q1ZA 3AEVA 1UAAA 1WMSA 2GK6A 4UNPA 4DRZA 1CBUA 1FGUA 3GDEA 5CITA 2GK7A 3BG3A 2JJ1D 3IIJA 2ZRJA 2BEKA 1JJVA 2GJAA 4QM7A 1OSNA 3I4MH 1E2KA 1WYDA 4JSTA 4BEBA 2E1RA 2GDJA 4Q1EA 1VYUA 2IXEA 3WMGA 3ONWA 4TMTA 4B6FA 4D4KA 1N34Q 2FFBA 1JR6A 1TWCH 1Z0JA 2PNRC 1ZD9A 3X1XA 2UUCQ 1ZM9A 2YU9H 2IYYA 1QRAA 3Q9LA 2GCPA 3KQKA 2WWXA 4WZAE 3UATA 1OH7A 4Q4JB 2A19A 2ZSAA 1ESMA 4ZCLA 3CUEF 1DG3A 3RLOA 1QHSA 1ZNZA 3KKPA 1W48A 1B70B 2YZ2A 4HAXA 4LJYA 5GJVC 1M1KC 4Q01A 2GXAA 3ETLA 1XEFA 1WA5A 3OHMA 4G01B 3NENA 1GSIA 2W6JD 1XP8A 3EG5A 3GLHA 5CIQA 2A69C 3SN6A 2UXCQ 1KZ7B 4QXAA 1E0KA 3DMNA 1PH4A 1VCMA 4M9XA 4Z8XA 4A93H 1G16A 4YLGA 4A3IH 1XTKA 2OESA 4HIDA 4PPGA 4V0ME 4WA7A 2FH5B 4L8JA 1QBKC 5J4KA 5GVSA 5FBLB 1E2DA 4DV2L 3K80C 2K50A 2RMKA 4PC6A 1D2MA 2BEJA 2O8CB 2QTVB 4YDHB 1HR0W 3GEEA 4JI0Q 5HKKD 1ASYA 4Y7NH 3MXNB 3HDTA 2D7CA 2H18A 1Q81C 2ZIAA 1AQYA 2KJQA 2KCTA 1JI0A 2NPIA 5IYCG 1JR3A 3WNCA 2D62A 5FOWA 1SVMA 2IL1A 4TLDA 4R4OA 3T1HL 4OHXA 4LPKA 4II7A 4JVSB 1TU2B 2JEAI 1NBWA 4M9SA 5H1SE 1U0LA 3RLFA 3IHWA 1YEZA 1QF9A 1WBBA 2MFIA 5JEAH 5E7MA 2NO1A 3LQRA 2V4ZA 1T9HA 2YHSA 5G41A 1E9AA 2CL0X 2FOLA 2IYUA 2IBMA 1EWRA 3BRWD 3CO5A 3DVLA 5P21A 5JBQA 5TXGA 3GLFA 2EU8A 4KAXA 3Q3JB 2EIFA 4PSAA 1QHHB 2RH5A 3SR0A 4QNMA 5AR1A 4B33A 2J0UB 2RHSB 2XNDD 4AYBG 4DSTA 5EP1A 1XTIA 2WIAA 1Q82C 4WOPA 3WHKA 4B43A 1H9MA 5FLMH 4DV6L 5J4HA 3SHFA 1YHAA 2PZFA 2X2FA 1XMQL 4QGAA 1GNQA 1PUIA 1ZUIA 2CHVA 4BRUA 3O8BA 2CCGA 2BH8A 2ZITA 4UP9A 1N3BA 2GAOA 1GNRA 3THYB 3T61A 3QPUA 4X62Q 2OO7A 5SZJA 2O8BB 4HUQB 5A35A 2NZ8A 4A3GG 4OHZA 2GCOA 1H9SB 4A3IG 1GWNA 2XSZD 2ZAOA 3QY0A 5DI3A 3A8KE 5C0XI 1DD2A 3FTQA 4KFRA 1JPJA 4DV2Q 2QZ4A 4JYAQ 5FBWB 3W90A 1Q3HA 4JLDA 4PPFA 4WXRA 1N6NA 3HU1A 4F4JA 2XOKD 1K73C 2Z6VA 1PH5A 3GCGA 1EIYB 2OCPA 2P5SA 2F1RA 3JAMc 5EE3A 1FTNA 4P74A 3DLLA 4A4DA 4EJSB 4RD2A 2A68C 4N3NA 1BMFA 2A7QA 2JJ2A 3HYTA 3HYRA 3L0PA 4Q18A 2OTJA 3TSZA 2QUZA 4D81A 2IUUA 1G4AE 2A3RA 1KDRA 2XGJA 2CCZA 2HJGA 3T1HQ 3B8HA 3D8BA 1W2HA 1Z6TA 1OF1A 2VY3A 4A3KG 4GL2A 3LDAA 5C4MA 2CDNA 2NVTH 1J6QA 1KMQA 3PVSA 2O8EA 1N5JA 1O3YA 1NJIC 3B1WA 4B6EA 2Z6KC 3DPUA 1Y8OB 3LRPA 5SZIA 1QVCA 1N6HA 5EUMA 2QU8A 1SHKA 1GKYA 2QRNA 5FL7A 5KUTA 1O7IA 2FNAA 1W4CA 1XNRQ 2QPAA 4LUCA 5K8IA 3F2BA 4EPTA 1PA6A 3S1MH 2QMEA 1VQ8A 5IYCH 1CI3M 5JSZB 1JECA 1UKYA 4R71A 2ODWA 4GLXA 3AP2A 1P2SA 2J7PA 2BCJQ 1FR3A 4LJ6A 2OV2A 1IAQA 1GAJA 1IW7D 1AA9A 2GVAA 1BMFD 1QVAA 1F5NA 2EFHB 2ZETA 1YJWA 2ATXA 4W5HA 5AJ3L 1A5TA 2KA7A 2FPKA 4WJ4A 4H02A 1ZVQA 4DV4L 3K0XA 4JJZA 2JA5G 4YY3L 2ZYWX 2FSHA 2DNCA 3T1YL 3C14C 1ZYUA 3PEUA 4KYUA 4RZ2A 4DC9A 4LFAL 1PMRA 4A3EG 4IOLA 3TQCA 3FHOA 2Y0SG 5LMUQ 1E2WA 4WZBE 3K81C 2WV9A 2O52A 4DDWA 3M85A 3I4NG 2EFEB 3RVBA 3THWA 3R9WA 2EVWX 3ASZA 1H8EA 1L0WA 3B5JA 1CTQA 4OONA 2G9NA 4MZ9A 1MO5A 1NL3A 1UBGA 1Z0IA 4V0LA 4HIKA 3SDZA 4HJ7A 2GZDA 1TU4A 1NLZA 2CK3D 4A8JB 1R6BX 2A5YB 4QKQA 2DPXA 4DLXA 4GI7A 2EWVA 3IEUA 3CF0A 4BY1G 1JXOA 221PA 1MR3F 2AR7A 3A1VA 4KBFA 3OE7A 2WAQE 2JLVA 3Q7PA 3KFUA 3S15H 2ZROA 3B2EA 4PHGA 3JVVA 5GAHC 1Y1WH 3ZD6A 3K7UC 1I94Q 4B3RL 4LF7Q 2XTNA 3CWZA 4LJ5A 2E5LQ 4A36A 2RHQB 1NN1A 1TF7A 2R92H 2JJ1A 3KKOA 4Q02A 2JLXA 3GTJH 3QE0A 2HIVA 4V0OA 1F48A 3RN5A 1G6PA 4PQRA 4TLEA 1NF3A 2WKPA 5EP4A 1SKYB 4Z54A 1NBMD 2HLDD 1X1SA 1S3GA 1LYLA 1E9SA 2PJZA 3W5JA 2ES2A 2WMNB 4DDUA 2JDIA 3K8AA 4UPAA 3AQQA 3AF1A 3BORA 2Q2TA 1N5IA 3QXJA 4DCSA 2O8BA 1KI4A 3FYHA 5HCIA 3HP1A 1CXZA 4LJ8A 1SLJA 4OKSA 4EPYA 2AHOA 4G0NA 2OCAA 1UKEA 3QKUA 3A1WA 3NBFA 4MKHA 2UXDQ 4D82A 4LHWA 4AKHA 3R20A 1P60A 4M1TA 5LBIA 3RS5A 2GZAA 4EJSA 2IEZA 5LMUL 2HT6A 2ORIA 1Z6XA 2XJ9A 1Z5ZA 4BA1I 2AFHE 1OXUA 1A2BA 5EP2A 2ZM6L 3FKQA 3MLEA 2H1LA 1IXZA 1VYTA 3DXJC 2AKAB 4G5OA 2VQFQ 2B21A 1COWD 2XZLA 2L15A 4A4IA 1J90A 1P16A 4S2EA 3TUJC 1GKUB 1G5PA 4KLNA 5JRZA 2KBNA 1H9RA 3HGBA 3B6YA 1J99A 1YR7A 2O8EB 2PJRA 4W5WA 4HJAA 3Q72A 1VG8A 2IX0A 4AYXA 2GXUA 4ERNA 3DOFA 1CKNB 2H92A 3TZUA 3UIEA 1N6LA 4IDPA 5HPYB 3WMEA 2KBEA 1K3RA 5J4YA 2YNMA 1S3OA 1GKIA 1JT8A 3ND8A 2F7SA 2VP6A 1HH2P 1YZQA 3K53A 3NHAA 5JFGA 3ZVMA 4RZUA 1E3PA 1YR8A 3T53B 1H8HA 1LY1A 1II8A 4IFDH 1I5FA 1YITA 2WJHA 4X66Q 2W83A 4OO1I 1I2MA 4AIIA 3MFYA 4TT3A 2ZJZA 4A3EH 1VQNA 3C5CA 1Z7TA 4U5XA 1NLFA 4PXAA 3LV8A 1TKWB 2C8VA 1H9JA 1M6NA 3AFPA 4HIOA 1G21E 2GCNA 1Q86C 3MJRA 5JCPA 2ZJPA 4LFCQ 2WSMA 4D80A 1ZIOA 3PR1A 3W5OA 2E2IH 1G8GA 2ZRFA 1C7YA 1P2TA 2JK8A 3BB3A 1G3RA 3DKPA 1EIFA 1NI3A 1WRBA 3UE0A 2UUCL 4NCIA 1WOCA 3FPAA 1U9IA 1XXHA 4QHYA 5BYKA 4JL6A 4MYUA 4DKXA 3I3SR 2IYXA 3IUYA 1D5CA 1NJGA 1W47A 3KUCA 4XVRA 3W3AA 2WWYA 4GZYC 2E75C 2VP2A 2FFQA 1FNNA 3HOZH 1JR3D 2R93G 4NPHA 5EJEA 4GN5A 2LCFA 3KQLA 3V4RA 1HCZA 2CVHA 4JK1C 4Q9LA 4IFDG 4QRHA 5IY0A 2RKOA 3CR8A 1NMFA 1AQUA 1RRFA 1E9FA 2BHRA 4JLAA 2GRJA 4WJ3M 5JRJA 2BOVA 1PH3A 1XMVA 2W2XA 2JA6H 4QBGB 1G8YA 2A5JA 3M1IA 3I55A 1G3MA 4LK2A 4ZDIA 2BKUA 1Y63A 1EX7A 3F2CA 2DHRA 3PF4A 1IQPA 2GJ9A 2Q0HA 3CQZH 3LA6A 4J0QA 5FUYA 2XXAB 2FGJA 1CKEA 2YWHA 3GLFE 5IRCD 3QVUA 2NN6H 3J7A5 4KODA 3TVTA 2PT5A 3EN2A 4HLQB 4XJXA 4A93G 5JZVA 3OE7D 2BMEA 1MV5A 3T1QA 3W9YA 3S1AB 4DNTB 3AEZA 3ECCA 2J9RA 3U5ZB 3THYA 1N6RA 4LNQA 1CR0A 5TDHA 4JBWA 1MJEA 2OCBA 3CIOA 2KB0A 2CLCX 4JZKA 4HLUA 3V9PA 4KMUC 2AWNA 2D0OA 5KDOA 4LFCL 1JQLB 2QF7A 3ZIAD 1LTQA 4A76A 2WOJA 2AHOB 2OM2A 4C0KA 1KI1A 1Z3IX 2X2EA 4M1WA 5SZHB 4C0AC 1IBML 1J8YF 1DELA 5IWAL 2UXBL 4KFSA 1P72A 4LF5Q 2K14A 4HZIA
chains in the Genus database with same CATH superfamily
1DB3A 2CHUA 1UZNA 2AE1A 4EB8A 1IY9A 2C3OA 5M5XB 1PWYE 1PO7A 1QIMA 1ZH2A 4LJAA 3CCRA 2FPGB 2JARA 3D3EA 1J7KA 2NVOA 5EINA 4A3CG 5CVVA 5LOVB 4DR1Q 1M4VA 1LH0A 1NONA 1ZUNB 1T4MA 4PMWA 3HVKA 5E2AA 5J9FA 4DT1B 5MFPA 4EJMA 1Y14B 1E2GA 2FSIA 2OL4A 3S7TA 1T1JA 1I50H 2O2ZA 1LS6A 5FO7B 1NLMA 4FJ2A 3TLXA 2EWMA 5IMBA 3TOZA 4FYJA 4IIUA 2AI2A 1WDLA 3QLUA 3D6WA 2PQ2A 3LQKA 1HG1A 1ZZEA 4L0CA 3RIGA 1P6UA 1AS2A 1U9JA 5KNDD 1NN5A 3K6KA 2K7VA 3E1SA 3VZDA 2E2DC 4Q1DA 2RHTA 4UNQA 3J81k 1E2QA 5JS2A 4W63A 2K5WA 2LY7A 2B3DA 4BCDA 4L4ZA 4ZHQB 1JAZA 4L15A 1S7GA 2HYDA 3T4PA 3WGUA 2F0MA 1AOXA 1DX6A 4V1CI 3U7HB 4BY9E 2NYZD 2ZJYA 3GJ5A 1M72A 4Y1RB 3ANYB 4RQBA 1ORIA 1R0BA 3KXKA 1PZHA 2NT3A 1E0JA 4GNKA 4HNVA 1RKQA 1WXEA 1ZYRD 3AF6A 1DRJA 4BKMA 1V35A 3AW8A 5BR8L 1EX9A 1LVUA 2FYTA 3H2SA 3IV7A 4U7PB 3PVZA 1UFKA 4TWIA 4P7KA 1IBCA 1Y8CA 1EYCA 2F52A 1ZN8A 2BTQB 5C5CA 5BQXA 3FTFA 3GUYA 4QA9A 1S2LA 3G48A 3GH1A 2O8FA 2B4AA 1XHEA 1MEOA 2FPLA 5T5QA 4JDUA 2I76A 1SPBS 5TLSA 5BV7A 1MO4A 2BDOA 5C5MA 1YHQA 3TFQA 2ZB7A 3S14H 4HLDA 3AKCA 2MQHA 2WUGA 1DTWB 3MEQA 4XIIA 2PDAA 4HJ9A 3F6SA 1L7MA 2ZB3A 2GD6A 1SOAA 1NM5A 2GO1A 2BCOA 3MCWA 4GRAA 4JI3B 4Q7EA 5TGTA 5MGNA 1W0JA 1FNCA 1LDGA 4N3GA 1H2EA 4IGAA 4BZWA 4DRYA 4U2DA 3EEYA 1C3VA 4X64B 2XTIA 3AVTA 5CG2A 5C3EB 1A8UA 3EFOA 1I4LD 1WXHA 3HCCA 2XA1A 3NBXX 3QB3A 2CVZA 3C24A 4J2OA 4KK3A 3ODGA 3OLXA 1CCWA 2YHUA 1PSDA 2I22A 2VCYA 4KP7A 4NV0A 3UB2A 1J1ZA 1QJCA 2BMWA 3GTMH 2AKWB 1BQ4A 4PIVA 3REFA 3V8NA 4UNRA 5DYNA 3KKMA 5AD1A 2H5EA 3OLVA 1N3LA 5DBIA 3C2QA 3TEFA 4EF5A 4JI6Q 2ZE8A 1LRLA 4OMCA 4AJJA 4BWYA 1FUIA 4W9NC 5KTMA 5C51B 2G09A 5BV2P 3D4WA 4P5DA 1YC5A 4H27A 4IDFA 4DWJA 3N6XA 5CB4A 2IOYA 3VBEA 1JAYA 4AP9A 5L4SA 1RYMA 3QU5A 4KKUA 3OF3A 4UQOA 3RUDA 3S1AA 1PDWA 1XZAA 4NCHA 4KREA 1Q8IA 2EGUA 1R6VA 2BFDB 3FPGA 2FXIA 4WZ6A 2AOUA 2IEYA 3OPXA 1CB7A 1IXSB 3NHRA 3EIQA 1I3MA 1BHQ1 1LDYA 3PG5A 1R6DA 3P9QA 4UULA 1UBFA 2FSVA 1RWQA 1F4VA 4TSSA 1D4OA 1SIUA 2QQ5A 2WFLA 3NTVA 4GQAA 2H5LA 2XCOA 4OVKA 4Q3LA 3EVQA 4ZMSA 3MUEA 4BP9A 4N3BA 1NVFA 1T36B 2QLTA 3V2TA 2HA5A 3EDYA 3NB0A 3CZQA 1AGNA 1R4NB 3C5EA 1SCUA 4ZQEA 3K71B 2LCIA 2GSWA 4P35A 3QFRA 3V1YA 1NE7A 3NORA 5HZHA 1T8SA 5HW0A 3Q7IA 1BKBA 2G1PA 3QFHA 4R9VA 1FZQA 4RS4A 5M3MG 1AH9A 2AMCB 1EL0A 3OTOQ 2LIVA 4UZEA 4E15A 2JEOA 1VA4A 3DMYA 3HFJA 4K28A 4GT1A 4HQRA 2XMRA 2VYNA 1X92A 5AHKA 1NY4A 1Z56C 3TKLA 4AJ1A 2M2LA 4WL0A 1Y8QA 3LFUA 1N34L 3ZGXA 5HOQA 4WSOA 2C99A 2ECFA 3CZAA 3RASA 2MJLA 4NW2A 1P5HA 2XGGA 3F6CA 5C37A 3K0SA 1N7HA 1POXA 4Q1VA 2ZCVA 2RHMA 1WCMG 1SHZA 3H5AA 3V2GA 4U7JA 1P7VA 5E0OA 4LFAQ 3L7KA 4BGEA 1UKBA 1US8B 2WAYA 4IEIA 1XYGA 4REMA 4H6PA 1QGDA 1EFVA 3D6VA 2IX1A 1ESEA 2ATWA 3GLQA 2XE6A 1DE0A 4DV5Q 1MNAA 3U3RA 1CPYA 1DKLA 2C95A 5CVDA 4N0QA 2PUEA 1TWHH 4B3MQ 3KXIA 2A5GA 4J1SA 1OHHA 5T3YA 5IGEA 2P67A 3U3JA 3HO6A 5LHY1 3ZCVA 4B3JA 2QWXA 4NFHA 4QVIA 1MO2A 2JLZA 2G9HD 1O58A 2Q1XA 1QIHA 2HGSA 4D0LB 5BWOA 1K68A 3CD6A 2ZTSA 1ZVKA 2BFBB 4G1MB 3ANSA 2AN4A 3FMGA 4RPHA 4NY1A 4BBRH 2PY6A 3EUAA 4R5HA 3VH1A 1YK1A 3A6FA 3BZKA 2IPOA 3T3PB 2A9FA 3AESA 3AINA 4YGXB 3M7IA 4FX2A 2J46A 4PSCA 3VPDA 2QRQA 4CM4A 1XD8A 4CV2A 4QGSA 3K2QA 1TYDE 3U0VA 5JFOA 1DTWA 5BWNA 3SF0A 3AWIA 4C9BA 3STBD 4RGTA 1QLWA 4B46A 4Z5XA 3C1UA 3IP3A 3HRZC 3EUEA 3LO5A 4RD6A 4LQ4A 4PVCA 3UCXA 1J00A 4KJOA 1SCQA 5GM1A 4XQJA 3O94A 5SZKB 1QMGA 1QVRA 3LUCA 4YRLA 1AW7A 3PQ4A 3LRTA 2P41A 4HAVA 2YZNA 3MW8A 1W2WB 1QYWA 5A0TA 1OE0A 1X56A 1ODFA 3CXRA 1UXKA 4MR7A 2P9HA 2ZI4A 1A2OA 2GZMA 1KEZA 2OV3A 3L0SA 1I7NA 1NRJB 4QBTA 1QR6A 1A82A 5ENVA 1IOZA 5JVG3 2G72A 2NSHA 3DT6A 4X8LA 1VE9A 5DM60 4CR8A 2FDCA 2P9FA 2ZYIA 1B41A 1KSFX 4S1NA 3FVQA 3K9FC 2I2AA 3SJBA 2BHLA 3EFHA 1XL0A 2WP8J 1PX2A 4KXUA 1EY4A 3HVIA 1KDAA 3RUCA 5LU9A 2VQFL 3PE4A 4QTZA 3CXCA 5J2UB 5AW0A 4XWAA 5E7JA 1KK1A 5EXEA 1Z7GA 1XL1A 1LBEA 4MQEB 4O0MA 5EG5A 4XDXA 3KTAB 2OBXA 3JWHA 1HNWB 3ZS8A 4K8JA 2PUJA 3GG9A 3H9JA 2QP9X 3M4OB 3DPIA 4C20A 1FJXA 4H1HA 2P7IA 4EY7A 2FUCA 4BBJA 5LP6A 1R15A 3L1JA 2ZS9A 3QUQA 3UXYA 1BAPA 3K5MA 3EH2A 4GKBA 3L0DA 3CONA 3W04A 3NYQA 5BVHB 5G3LD 4A3MG 2QG4A 4BTEA 2YTVA 4M9QA 2BV3A 3IJ5A 4D42A 2YIMA 4ZDWA 4P3KA 3HR4A 3TVYA 2NVXB 1ECBA 3G8YA 1N2JA 2FRVA 1G41A 1NSTA 1OD6A 4NYIR 4ZVLA 1TYZA 2C31A 3FY4A 1WZCA 2PWBA 4HZUA 2MO1A 2ON6A 4RW0A 1KDBA 3VM6A 2H2WA 1M8GA 1G38A 3DBRA 1QZXA 4G7OC 3EZ2A 4DMLA 3I01M 4MCAA 2LZ0A 2QTRA 3TTWA 4BE9A 3V1LA 2ZR9A 2EDCA 2YBEA 3C4QA 3IMFA 3LKDA 1STAA 3Q98A 4ZCQA 3UW1A 2CUKA 3AI7A 4CBVA 3U9TA 2XCRB 1XTDA 3EUWA 3FCAA 2DQYA 1YL6A 2C2WA 1IAVA 3H3XA 2J6IA 3ZN2A 1E98A 1P44A 2HU8A 4GMXA 3BC1A 2W6NA 5IT0A 4IDDA 1H66A 1FXWA 1WCMH 4R2MA 4PZYA 3W5VA 1VI5A 5AVUA 4JBIA 3A58B 1BROA 1DXOA 4TQ9A 3TNFA 1U7UA 1RC1A 5LFAA 4DRXA 2JFNA 3MB8A 4QICA 1EVEA 4XAQA 1DFGA 1JQKA 2A69D 4NBRA 4U9UA 3T7RA 2Q5IA 3O9MA 3UAZA 3IBTA 1DGSA 2BFBA 4BASA 2DUUA 3EHDA 3KLBA 3I72A 5K5PA 3MINB 5SY4A 4EY4A 4DVGA 1BOFA 3LL4A 4URUR 1SHLA 1UEJA 1YGPA 2OOSA 2LFNA 1LPBB 1UOQA 5BO5A 1TWFB 3I6IA 5L3RA 7MDHA 3ZE8A 1RTTA 3HJTA 3PPXA 4LGVA 2A2ZA 1PH7A 4LDPA 4ZI5A 3ZH9B 4Z99A 2R7MA 1VLZA 2EV9A 5CH8A 2EWWA 5BUCA 1VSUA 1HPCA 1KMHA 4KZKA 1JAIA 4G8JA 4RNCA 4UU1A 3HOUB 2YS7A 5B7QA 3RUZA 2XMSA 4IX9A 3F4BA 4P31A 4A3DG 4YI3A 1A97A 4M36A 1LTRD 1AXGA 3SD7A 1QNKA 1L1QA 2YQ5A 4JJKA 4XB6B 2JATA 1OBOA 4PZ0A 5AVXA 5JNUA 1OI4A 2P4HX 2CV2A 3GJ4A 4KQIA 4J90A 1LV7A 1LLCA 4PLPA 5JCJA 3L9AX 4EGVA 1EGHA 1OAAA 2J33A 3M2TA 3ZQKA 1XMOL 5TT1A 1X3EA 5FLXc 4GQBA 4MUMA 5BYBA 4Z7NB 3FFWA 4H1TA 4M98A 5JDCC 4B6GA 1QXSA 1UBEA 1U0OC 1VYVA 5C1PA 1F0YA 3IKLA 3IQEA 1NG1A 5ELDA 4GKKQ 4MMZB 1W5EA 2EC5A 4GYJA 3QX7A 5ALSA 1GUNA 2I4TA 2EDAA 4RSMA 3P7JA 1TLFA 2WT8A 1PJCA 3CNQS 4IUTA 3V4SA 1SNYA 2VT6A 3SQOA 1ND6A 4HKTA 2KQ3A 4RHYA 3SS8A 2RSNA 1OPRA 4G9EA 4TSRA 3SYLA 2AFHA 2NGRA 1MAUA 1QTRA 1RCTE 3S1NH 2BW0A 3EISA 4M21A 5J2UA 1AIPA 3WWCA 1DAFA 1FDVA 3EY4A 4L4XA 4C89A 4XGIA 1TAHA 1IUOA 2NN6G 4S05A 2O7NA 1XBTA 2V6MA 1K6EA 2B98A 3FDIA 1T3GA 3DP9A 4INZA 2E74C 1QZTA 2ENUA 4LHVA 1P19A 3NHUA 3WR5A 4UJ3A 4B6FA 5IUKC 2C2XA 3UMSA 3HDVA 4IJ5A 2DBQA 3Q3IA 3UOWA 4IQZA 4OI2A 3A8TA 2NNLD 4L5IA 4CV0A 3A5UA 5ALZA 1CYDA 3SYMA 2QR3A 3QLVC 2CXRA 3ADKA 2DWPA 1PRTB 1H6DA 4GBJA 1GZDA 4DM7A 3HB7A 2COEA 3FCYA 4EYEA 1U99A 3K16A 2Q50A 3TLAA 4XWTA 4DV3L 1TCBA 1J8FA 3P96A 5FV4A 1KIMA 1KQNA 3IUBA 3TL6A 3ZBUA 1EXVA 4CEJB 1M0TA 4PSUA 5JASA 3K70B 3LT1A 3SG0A 2HMVA 5H16A 1YVDA 2Q45A 3II6X 4KPUA 5C8YA 4CT4B 3A2NA 2PIAA 4JL5A 4DJJA 5K8JB 3MTSA 5C0XG 5BW6B 2D4AA 2HF2A 1V8PA 3G7LA 5B30A 5BR8B 1XNGA 4G4KA 3D4OA 2FEKA 3GPIA 4M22A 3DLHA 2PL3A 1ESNA 2SICE 4IDBA 4JB3A 5EERA 3V8QA 4D4HA 1TLTA 4X1KA 1OWNA 5T57A 2BPOA 3JARA 4WFJA 5HS6A 1GHKA 1V26A 4KVFA 3U7JA 3HM2A 4RA6A 3KF8B 2HSEA 1JPUA 3HFGA 3TVDA 2X0RA 2FUKA 1XO1A 3EJ6A 1KBQA 4QAJA 4CPDA 5E3JA 1E7RA 2ZCJA 4LXYA 2EJTA 1ISRA 1YOBA 4KK7A 1I13A 1L1OB 2FW7A 2XBLA 2BZ0A 2XJ4A 3DEHA 4FP9A 3I4NB 4NSNA 4A16A 1E1YA 1EA5A 3TRFA 4NCJA 2L69A 2RQXA 1X3SA 4MZDA 4TQAA 4WKNA 4RULA 3G7UA 1WDMA 2EVBA 3TSYA 2CLKB 1N9WA 3DEZA 2VDKB 3DFUA 3LGAA 4LE1A 5CFNA 5K6TA 1JFSA 3MWLA 4C2TA 5AVYA 2AN1A 3UUFA 2W2KA 4DSAA 2AIRA 1L8QA 1PBNA 2X0NA 4L8VA 2I7CA 5F7ZA 3UO8B 4GEGA 3WYEA 1DL5A 3NC0C 4HGYA 1T1SA 3R7FA 1MTOA 3KSMA 4IMRA 4ESVA 1GAXA 3P0EA 2R65A 1IZ6A 3NH9A 2Z56A 1O89A 4AP6A 4AFNA 1BHO1 1FSFA 3SXHA 3CC2A 2RB4A 3LP6A 1PRYA 2ETXA 2XUQA 3ROMA 3UAXA 5LLTA 2DUDA 1MZPA 3F5DA 3ER0A 1Z4LA 4YHBA 1Z2AA 3O5AA 4EX7A 1G6Q1 2W6ID 3HOYG 3HU3A 4KJXA 1BS2A 2VSFA 4O2BF 3U62A 1FLNA 1VECA 4W5JA 1Q7TA 1K8MA 5KTRA 1J5EL 4ZV7A 2NP6A 4LDAA 3V8MA 4BLWA 4DNXA 3EEFA 3PNKA 3VKWA 2VK1A 4O5OA 4OHKA 4D46A 2Q49A 4OFBA 2HCFA 4EEXA 3G2OA 2C7GA 1Z2OX 2VG8A 1KEKA 3C1TA 1HFWA 4O3FA 3N52A 1VXRA 2QRVA 4WXPA 4XFJA 3ZWNA 1IRXA 2GEKA 1DAEA 4ZGBA 2IUSA 1CS0A 3EIFA 2AC4A 4IDNA 1UDWA 1FS4A 3K0FA 3NBQA 1ODTC 1B2RA 2F43A 4ZKCB 2J3DA 3E9HA 4PMBA 3DWEX 2B6HA 3K6RA 1H65A 4YEDA 5KHAA 3RYIB 1PU2A 2XH8A 2PZ8A 4HB4A 2Q4RA 4WXYB 2XUIA 4CUKA 1U11A 1ZW6A 3LHKA 4CF6A 2QVGA 8ADHA 1E66A 3C8DA 5B7NA 4BYMA 3PC4A 4PN3A 4GDFA 4CL2A 3IODA 1X3QA 3P2IA 4FLFA 4H3HB 3SDSA 3RZDB 4C04A 4NPCA 1SOWA 4DV5L 3KQTA 2VC2B 1VQBA 3ERQA 1PGNA 1E7MA 1SVOA 1JIJA 4B3ML 2PA0A 3SGIA 1WIWA 2JLQA 3I6BA 4K9MA 4MWOA 4PHCA 4AULA 1Q0RA 3UJBA 1JU3A 1D5MC 3OIDA 4CKWA 3CX7A 4KPUB 3F3MA 2VBFA 3GYBA 2QNRA 1XCPA 5NLLA 3FKJA 4ER3A 3D8SA 4RXMA 3AM1A 2X5XA 5FRDA 3GTLH 4J0CA 1K98A 4M99A 1H4SA 3HRHA 5CG1A 4L16A 3DOIA 3N28A 2ZYVX 4KLZA 3PQDA 5IU6A 3CF2A 5A7FA 3WISA 4OMFG 4RABA 4HAUA 3TR5A 3IDFA 3IXQA 1LX6A 3NC4A 4DCMA 2DT5A 1VQDA 2E9SA 2UXCB 5TR9A 4ER6A 2YVKA 4ALMA 5BMVF 2XZPA 1XD9A 4KYTA 1OFIA 4WE3A 5DNAA 3ZLJA 2CW0C 5EN4A 5G53C 4B9XA 4X71A 5IEJA 3V05A 1EUDB 1PEYA 2Z95A 3KJXA 4L0DA 4BVLA 4INAA 4DCOA 1A9YA 3K9HA 3CF4A 3MTGA 1K9MC 4M38A 4JROA 2R66A 2ZJFA 3AB3A 2EFJA 2VJMA 3J80L 1R00A 2B94A 3EGWA 4AJIA 4D99A 3TFOA 2AKEA 1OLUA 4QG7A 2NN3C 2QLLA 3HNRA 4QODA 1WXIA 2FMXA 5ER6A 4O4LF 1NXTA 4RKWA 2A5HA 5A4FS 5GM2A 1JDVA 2FEAA 4HDAA 2G67A 4U7TB 5KNDA 3FFBA 1FX0B 3G2HA 3MSXA 5CUQA 5TGZA 4DXAA 5HMLA 2EJBA 5CP8A 5DSZA 1RYEA 4QQ8A 1J06A 3CRW1 1HLFA 3GHHA 2UXCL 3O9ZA 4QU0A 2DKOA 3F0TA 2OPBA 1IY1A 3FIJA 4FGKA 1DMRA 5CIYA 1TEXA 5F3WB 4MPRA 1E4EA 2OXTA 2VA8A 1MJGA 1NNI1 1SWWA 3GTJB 1E24A 4GOOD 1ZK2A 5IX8A 2OZVA 2WFMA 2WUWE 3FFTA 3HCRA 4A3EB 2R7LA 3D5TA 4LJLA 5E3FA 3H0CA 4ME6A 4R8SA 4YRJA 4JI5L 1L0YB 2CFOA 4HNAB 2A9PA 2CEAA 4A26A 1SBQA 1XZKA 2P6UA 3SM3A 2P1ZA 1F0KA 4U6NA 2E4AA 1NOIA 3GTQB 3Q3GE 5JYEA 4IXMA 1MP0A 1KQGA 2OBMA 3AI1A 3WLLA 4KN8A 1RABA 3N2LA 4KDEA 1E5XA 1Q46A 4XT3B 3O38A 1W34A 1W29A 4JUAA 4B3RB 2C04A 3VNSA 1MD2D 1L7VC 3LQ1A 3DAFA 3EE6A 3K0FB 1Y9JA 1O7LA 1RZUA 2GB4A 2QOEA 3LVQE 2FP4A 4K9SA 4MQBA 4KXFB 1U7XA 2I62A 2RI6A 4ETWA 4DEYA 1XMOQ 3WHLA 3ET5A 3EVBA 1N9ZA 2AW5A 4E94A 4RTRA 1PVOA 1FFEA 5GOZA 2OO3A 3PNBA 3RABA 5FPKA 3N7UA 4O2LA 4RZIA 4L02A 4F6CA 2V3WA 3RSFA 2BBSA 3PPWA 5FNZA 4OQPA 5L7YA 4QIHA 4A82A 2JKZA 1OIXA 5JDCA 1C48A 1H3EA 1Z2DA 2BEWB 1VMKA 2I6QA 2Z1DA 2L9HA 2JA8G 1U1GA 3LG2A 4CF5A 4BMNA 2B69A 3AVPA 5B3JC 1TY2A 2CMGA 4DZTA 3UBTA 1E2HA 1EINA 1L8AA 3MB5A 3V34A 3Q5DA 1CUXA 5DKFA 1ZVMA 2Z30A 5FTWA 3ZY2A 1Z6ZA 3CYFA 1NYRA 3KEFA 3VR3A </