2YYZA

Crystal structure of sugar abc transporter, atp-binding protein
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
358
structure length
358
Chain Sequence
b'PSIRVVNLKKYFGKVKAVDGVSFEVKDGEFVALLGPSGCGKTTTLLMLAGIYKPTSGEIYFDDVLVNDIPPKYREVGMVFQNYALYPHMTVFENIAFPLRARRISKDEVEKRVVEIARKLLIDNLLDRKPTQLSGGQQQRVALARALVKQPKVLLFDEPLSNLDANLRMIMRAEIKHLQQELGITSVYVTHDQAEAMTMASRIAVFNQGKLVQYGTPDEVYDSPKNMFVASFIGNPPTNFLRDFSVSVENKQTILKRDDVIIKLPEPVDVKLKEVVVGIRPEHCRISRERVENSIPGVVYVVEPLGRDIIVNVKTEKGEIIKVFGDTGKAPQPGENVFLVPDLRKIHLFNPETEETIL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sugar ABC transporter, ATP-binding protein
publication title Crystal structure of Sugar ABC transporter, ATP-binding protein
rcsb
source organism Thermotoga maritima
molecule tags Transport protein
total genus 88
structure length 358
sequence length 358
ec nomenclature
pdb deposition date 2007-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF08402 TOBE_2 TOBE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2yyzA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2yyzA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2yyzA01
4A8JB 3EZ2A 2I4IA 2ZYUX 1U99A 4KHZA 4IEEA 2L15A 5F2EA 3ZH9B 5H1SE 2F9LA 2XSZA 3SNHA 3J81i 4KYIB 1VQLA 3JC66 4A3EH 2V8OA 4A4DA 2KE5A 4AD8A 4AKHA 3IBGA 1WRBA 3UPUA 4DR5L 3H3VH 2EVWX 3CZQA 3L82B 4WA7A 1QDEA 3QE0A 2E75C 3FKSA 2CCKA 3C16C 3T15A 3CLVA 4LJ6A 4JYCA 4QXAA 1N2CE 1ZAKA 3TAUA 2WJGA 2HQLA 5C0XI 2FH5B 2J45A 1R8SA 3W5OA 2KHIA 5DYIA 5IY0A 1FUUA 3AVQA 3A8JE 3L7ZC 4P75A 3RLOA 3H84A 4DUZL 3GEHA 5LMUQ 4YY3Q 2GRJA 1KDOA 5C18A 3RYTC 5DLQC 4A3FH 2WAXA 4Q47A 1O7IA 2FGJA 1OH6A 3TREA 3I5YA 2JLVA 4M1TA 1KKMA 3U3RA 4X65Q 1PH5A 4WIAA 3NC1C 2MQHA 1N6IA 1CR4A 3NE5B 4Y52H 3KJHA 4JKIA 4UP9A 1E2DA 4KAXA 4RD4A 2XXAA 3EA5A 2IS4A 4D0LB 4LDJA 3HPQA 3UE0A 2IXEA 2QP3A 3QKRB 3J7ZC 4KLNA 4MRRA 1YNNC 3PEWA 4ZCLA 3VR1A 3B9PA 2PQAA 1I2DA 1H95A 4AIIA 1I4TD 3GJ6A 3AVPA 5DHAA 3ER0A 4KU4A 5C0XH 1KY3A 4JBKA 2O8FA 1MO5A 821PA 1NY4A 2ZJ8A 4B2IA 1FTNA 3P26A 4V0ME 4BXXH 4J0QA 5HCNA 2ZPTX 3WBJA 1MR3F 1TWCH 1KJYA 2CL6X 3F2CA 4TMTA 3WXMA 4DKXA 721PA 1XTSA 4ERNA 4ACBA 3WNCA 1U9IA 1PA6A 2ZRMA 2F4VQ 3KKOA 3HJNA 2R62A 5IK2A 1C1YA 2F43B 2ZU0C 3RC3A 2D3WA 2W58A 5KOYA 2GVAA 1NN3A 4L5BA 1HEIA 1AKYA 5LDDC 3CONA 2JLZA 3G5UA 1CUKA 1JJVA 1US8B 1E0SA 2ZSDA 2QAGA 1JB1A 3K8AA 3NELA 1T3SA 1ASYA 1P61B 1TADA 4E09A 2BOVA 3QIAA 1VQBA 3GTQH 5DSZA 5LD2B 1E94E 3DPUA 1LF0A 4G7ZC 2FPKA 1OYYA 4AG6A 5JS8A 4BBRG 3HOYG 4FMCB 1CKEA 4KLZA 2KCCA 1E2QA 1LV7A 2AXNA 4DC9A 4TMVA 5JLJA 1UWVA 1AZSC 3EQLC 1VG0B 4NONA 4PHHA 2GZAA 3T1QA 5CITA 2IC5A 2AD5A 3B1YA 4C2TA 1KAOA 4X66Q 5K8TA 3ZDQA 1GRQA 4U00A 4GKJL 1X6OA 1H8HA 4DHEA 2I5LX 2R2AA 4DCNA 2C8VA 1IAQA 1WA5A 2ZE7A 4LFBQ 5GJWC 3I92A 3PCRB 5CB8A 1HNWL 4RCYA 2FU5C 5JEAG 4JLBA 1X3EA 3I73A 4DR6L 1YRBA 5KSYA 4NCNA 1J8MF 3T35A 5IWAL 4BLSA 4CT4B 3FPPA 1E9BA 1RJ9B 2RGNA 3CO5A 4ZKEA 3UXMA 5FLXc 5JEAJ 1XMOL 3CC4A 5BYJA 3VR4A 2HF9A 1VQMA 4Q1FA 4GNXA 4BPBA 1S72A 2CDNA 1E2IA 2IYUA 3KDSE 4W5WA 1OXTA 4DBLC 2KB0A 5E7IA 1OXUA 3WNBA 5JMTA 2HYDA 4KKSA 2BMFA 3FYHA 1KNQA 5AWFC 4AC9A 3PUZA 3SC3A 4JI2L 1I4DD 3P4XA 1X6VA 2JQOA 3OFNA 3NBZC 5TDHA 2RGXA 1L1OC 4BEJA 5J47A 3IPXA 2Y0SG 1HQCA 5BYKA 2VZAA 5J4HA 4B71A 4EKDA 4JBJA 2F7SA 3ADDA 2HJGA 2RMKA 1OPXA 1HTPA 4CEJA 1AM4D 1IQPA 1N6OA 3PQCA 3EIQA 1UBEA 1TF5A 1X1RA 4OGQC 4JI3L 421PA 1EX7A 2CJWB 1OTCA 2JJ2A 2IYQA 2YOFA 4C0SA 1GKIA 1IXZA 1Q90A 4KXFB 5FL3A 4LF7L 1RRGA 4B3SL 2A6EC 1UADA 1NNEA 221PA 1HQMC 3G82C 5GADl 4GKKL 5GJCA 4DR5Q 4DLRA 1FZQA 3W5JA 2O5JC 1H8ED 1I94L 1LFDB 3T61A 3ULLA 4RD2A 3RANA 4EPWA 1J90A 3BK7A 5J40A 4N1AA 2V1UA 3HYRA 5H68A 2Q2TA 1A63A 3J80i 2NN6G 2WFWA 1QUQB 4KN4C 3U3JA 4DUZQ 3OEHD 2PPBC 1E2KA 1W2HA 2ZUDA 3T1VA 3H4MA 3KJIA 3KXIA 3PIOA 1MO4A 1NY5A 2X77A 1U8YA 3C14C 1VYVA 2IX3A 5J4LA 1TEVA 2ZI5A 2QF7A 2V4ZA 1VQCA 1E2PA 4OWWB 1PH9A 1B70B 1IONA 3J81k 3IO3A 3SJZA 2ZM6Q 1GIAA 3QPVA 2ZRBA 4LJAA 3THYA 4KJZA 3CWZA 3R9WA 4Q1DA 3E70C 3PR1A 5E4FA 2VSFA 3CM0A 4B6EA 1C9KA 4XJXA 2OQKA 4EQ6B 4QGGA 5H70A 2OQ0A 4A3LH 4FCVA 1UFQA 1UJ2A 4MYCA 2K50A 1GKYA 2DFLA 4DSTA 1CKNB 4DKAC 3C15C 2E8GA 1SVOA 4ZPXA 2WIBA 2IWRA 1BKBA 1X9NA 2IBMA 4M9SA 2WPDA 1B9MA 1TQDA 3OHMA 2E2HH 1WYDA 5C4JH 1G8FA 3GTGH 1QBKC 4A3CG 1IN4A 1ZM4A 2JXMB 3CZPA 4TYNA 1KI8A 2HXSA 2VQSA 1PH7A 1IY2A 2WWXA 3ERSX 2JA1A 4LY6A 2VHTA 4JV5Q 2W6JA 4M2LA 1PLLA 3TUIC 4D26A 2BDOA 4XH9B 1OFTA 4HLCA 2R7ZG 4XVQA 1W4RA 1G6PA 3X1YA 5HZKA 2GXUA 3AKEA 3OAAA 3RRYA 4IO9A 3T1YL 4NXML 4QQBX 4DLTA 2Q2HA 5HE9A 5E3HA 4DEYA 5LBIA 4ESHA 4TYQA 1E0AA 5IP7H 3V4RA 3OIUA 3RS3A 3CRMA 1SR3A 4A15A 4WXPA 4KODA 1EUJA 4M4SA 1QVGA 4N0DA 2K32A 4JBYA 5CLQA 2B21A 4BFSA 4BFVA 4FI3C 3S14H 3EC1A 1Y1VH 3KF6B 4I81A 3DLLA 4Q21A 5AK0A 2NPIA 1OLOA 5GAEC 3I4MG 4TMKA 5E7MA 2ZYWX 5GVRA 1SXJE 3KDFB 4GKJQ 3DMNA 1UKVY 2NVYH 4MKIA 5BW8A 1I5FA 2XEXA 4P4SA 1FFHA 2HV8A 1D8TA 1NL3A 3O8DA 4G5QA 4JLMA 4LF5L 1L1OA 2VQFL 1FTSA 4NH0A 4YMSA 5B57C 3GJ8A 5IWAQ 2UXDQ 3NBXX 2KHJA 2JA8G 3M0EA 1NJFA 1NBMA 3GPLA 3W1BA 3F5FA 3GLFB 3S24A 1G3UA 1N0VC 2BCGY 1FUKA 1G64A 1VS0A 2BM1A 3KUCA 3U3OA 1N6LA 1IY0A 3RNUA 4QNMA 1HNZQ 4BBSG 1ONBA 1E3PA 4OK5A 1I6VC 3B1XA 2ZTDA 1X86B 1LVGA 1NLZA 2BM0A 1VCIA 1EQQA 5L3VA 2YU9H 4JI2Q 1P5ZB 2GILA 4NPHA 5EP3A 1X1SA 5HKKD 1QHSA 3LX5A 4YWKA 1E1QD 1ZC4A 2AR7A 2OHFA 3IIMA 3KB2A 3KOJA 4G5RA 5CYOA 1QHGA 4LF6Q 4AH6A 3R9IA 1HR0L 4US0R 1R5BA 3IRBA 1NN0A 2RH5A 3F0TA 3FMFA 5EJEA 3FOZA 2PNRC 2ID0A 1M7HA 1N5KA 5G40A 2Q3HA 4OI0A 4MYHA 2FJUA 1G8GA 1P9WA 3U6KA 3KQUA 2E74C 2QTVB 3B5JA 3GTOH 3MSXA 1LB1B 2ASEA 2ZYTX 4IDQA 4MGKR 4Q9HA 3ZIAD 3KKMA 4B44A 4XVUA 3CF2A 3AF3A 1E2ZA 1DG1G 3GFPA 5FJ8G 2RHMA 3VDYA 3MRSA 3ZVLA 4B3SQ 2D7DA 4AY2A 1U8ZA 4R4OA 4KSBA 3RRMA 1TU4A 4A3IH 1F2UB 2QPAA 3CF0A 4JL5A 4KHPL 1G19A 3I4NG 1FNMA 4OQLA 3PEUA 5KSPA 2NVQH 2OTLA 3T51B 4DVGA 4QL5A 1KMHB 1VYUA 1I94Q 5F3WB 1MRSA 3LA6A 5FH9A 2ZIAA 2IYSA 3AM1A 3LNNA 3QF4B 4DR2L 3FKQA 4JI5L 4C3JH 1ZINA 3PJRA 3PENA 2EFCB 2A68D 4W5JA 5FTMA 1SXJD 3ADKA 3RLNA 3PO2G 2JLWA 2VHQA 4IW3B 4B3GA 1WQ1R 4KO8A 3CRW1 1C0AA 3TSZA 3DHWC 4A6XA 3QI2A 1SFOH 3L0IB 1OFIA 4TL8A 1IBKL 3STBD 2J59A 2YINC 5J4VA 2KCTA 2VQEL 2QSYA 1ASZA 2IYXA 2J0SA 3GEEA 3DEFA 3A8IE 5FLMH 2KBNA 1VQNA 4Q9KA 3W3ZB 4DAMA 1ZNYA 4B73A 3DL0A 5JHHB 1BDOA 3PUYA 2JLQA 3KLWA 4GN4B 1U90A 1SULA 3MMPA 4G7OC 5FI0B 4DLWA 2C9YA 4WZ6A 3TLXA 3AP3A 3MWKA 4O0MA 2IL1A 1W3SA 3QKSB 3GQBA 2UUAL 4C0QC 1YRAA 1N32L 3ICQB 4Q48A 3M4YA 1YIJA 3CR7A 2A78A 2B8FA 5CM8B 4DR4Q 1ODFA 1Z3IX 5JS7A 1UBCA 2JCSA 2GDJA 4HAUA 3GTMH 1YZNA 2Q3FA 2QQEA 3CX7A 4B3FX 4E22A 1LYLA 4C3HH 2PI2A 1KIMA 3CNLA 1XPRA 2O0JA 1W48A 3AQQA 4CF7A 2R6DA 4Q02A 2NO0A 3OIYA 4F4JA 4RCZA 1QVCA 3BBPA 1Z29A 1YR6A 2OFXA 4ITRC 4LV6A 3Q85A 3IEUA 3A4NA 3KXKA 1Z6XA 3GTLH 3DXJC 4PMWA 1PHJA 3LBIA 1IXRC 2OV2A 2ZQ5A 3HYTA 5GAHC 3SOPA 2FPLA 3OIWA 5KHOC 3T1YQ 1AH9A 1DAGA 2RGAA 4BZQA 4NYIQ 3CCMA 4O0AA 4EX5A 3V9PA 3CPWA 1OJLA 2CE2X 1KI9A 1R7RA 1QVRA 4HJ8A 4NP6A 2GCNA 2YWEA 3IHWA 1X8KA 3QNUA 2G9NA 1J8YF 3CPEA 3C7KA 2OCBA 1JJCB 4V0NA 4A2WA 4LUVA 1H9RA 3I8XA 2J7KA 1SKYE 1Z0IA 1S0UA 2GF9A 4L4UA 1SKYB 1G20E 2ZSFA 1DG3A 3F8TA 3AVOA 3B7GA 4IFBA 1F2TB 1XMQQ 3GLGA 1L8QA 4BFXA 4OX9L 3T34A 4A75A 1LABA 4HJ7A 3I4LA 4IRUB 2QBYB 1EG7A 3LW8A 5TMPA 2DNEA 2K5UA 2VP0A 4TQAA 2D62A 1Z0DA 4ZDWA 4BQSA 2FXQA 4Q7MB 4LJYA 1I50H 3CW2C 4JVSB 3X2SA 1JI0A 1XZQA 4FMDF 2D0OA 1G16A 2LWIA 2VP9A 4TL7A 3UWOA 2N1BA 2QGQA 1X3FA 2VPPA 3PFIA 4U7DA 4TT3D 1R4AA 4YMUA 1KK1A 4KVGA 3SJAA 1G5PA 1KJWA 2VF8A 4DV4Q 1KNXA 3A4LA 3CBQA 4XSHA 1OSNA 1DCZA 2ZI4A 2A30A 1PH2A 1OHHD 1MT0A 3Q9LA 4NXNL 2NQ2C 4Q9JA 1W4CA 4QM7A 1M34E 2IS1A 4APVA 3HOVH 2UXBQ 1DOAA 1ESNA 1JPJA 4QHYA 4MDEA 5IE8A 2N42A 1HR0Q 1K83H 1LS1A 4WOPA 4OHZA 2QTFA 4FMDB 4IFDI 4I99A 1KGDA 4NCIA 3S17H 3B60A 1JEDA 3BJUA 3MXNB 2QSZA 1HQYE 2ZS8A 3FDIA 3HR7A 1TTTA 3T5GA 4NHOA 4NCHA 2Z0MA 3QG1A 3IDQA 3BRWD 3DM9B 5LPNA 2J0QA 1S4QA 4GLVB 1HY3A 5DI3B 1RKBA 5TARA 2BJVA 1VQHA 2W2VA 4M9XA 2KJQA 3ICEA 4X64L 4PSKA 4DV6L 2QE7D 1V43A 3T53B 4KHPQ 1XEWX 4DV5L 2J7PA 2KSQA 4URWR 4JYAQ 3NHBA 1YHBA 1PJRA 1EGAA 1QVFA 2WSSD 3GLHB 1E2FA 2VIIA 2ZE6A 1T3LA 1T9HA 4OJKA 4DR2Q 2JDID 1W36B 4DT1A 3HWSA 4TVAB 3OE7D 1N34Q 4UNNA 4IFDH 3Q7PA 4LJ5A 5JSZB 1XBTA 4YXWA 4B43A 5JBQA 1EXMA 4PZ6A 5K8UA 4EQ5A 2V4DA 4HAWA 3CPFA 4UXHA 4QFMA 5CDFE 2LKDA 1GZSA 3NDPA 4CZ2A 1ESMA 4V0OA 1TEXA 1GSIA 1U0LA 4P73A 1TXYA 1ZU4A 2CK3A 5AUQA 1UKZA 1S9DA 3AKDA 1RIFA 2WAYA 3P32A 3TW4A 1E9CA 2F52A 3S2HH 3NH6A 4KBFA 4PO1A 3NDBB 1E24A 4LYAA 5HR5A 1G7CA 4A3GH 2UUAQ 4LF4L 2OE2A 4KITB 5E7NA 2QGNA 1XEXB 2N78A 3S2DH 2NGRA 2IF2A 2BDTA 1XMSA 3GEIA 4QM6A 4K81B 1YR9A 5KPDA 4ARZA 1G3QA 3CMEA 3JAMi 1K8MA 1GP2A 1CLUA 1YHQA 2EU8A 1G41A 4JMPA 4B2PA 3TUZC 3GD7A 1PLKA 4IDPA 2N8NA 1E2NA 1W0JA 3CX8A 1FOEB 4F93B 2J5XA 2NIPA 4OONA 1RRPA 3AVXA 5J5CA 2R93G 1FL9A 3QG5A 4A1FA 3BAFA 2I0QA 3QKTA 3SEAA 1Y14B 3ECCA 4JS0A 4CW7A 1S3OA 2A5YB 3BB4A 4UJ3A 1JR3E 4UNQA 4D4KA 1II9A 4JLJA 2D06A 4WJ3M 1VIYA 2E2IH 2QI9C 1ZM7A 4PAOA 3TE6A 1DEKA 2LXKA 5JRZA 2D2EA 4L8GA 3BDOA 4FD2A 3TRZA 4Q4HA 2OCPA 1KSJA 3KTAB 1KRSA 1XCPA 3K1JA 3L0PA 4G5OA 2CWPA 2WJJA 4TTQA 3DVLA 3IPYA 4NBSA 5TY0A 2ASBA 3ZZ0A 4UXJA 3WMEA 2RGEA 4BZXA 4B3ML 3TQFA 4MDFA 1B7YB 4DDTA 1E1RD 3LQQA 4PPNA 1W46A 3WYAA 3TEHB 3FKIH 1YNXA 1JQJC 2XB2A 1IOZA 2OEPA 3FMOB 4B34A 4QJ3A 2GJSA 2DGYA 1PYBA 3BH7A 3K9NA 1TUEA 4LJ8A 4R2IA 1UEJA 5DN6D 3NG1A 5IT5A 2BVNA 2REOA 4LHXA 1VDZA 4P33A 1VQ6A 4HAYA 5IYDH 4TLDA 2OUKA 5JI2E 3CPHA 2OFWA 3LGJA 4YY3L 2ZVPX 4LSGA 4LWZA 3VKWA 3C5HA 3SYNA 3TBKA 3TUJC 1YR8A 4HATA 4JLNA 3WNDA 3E1SA 5AJZA 2OXCA 1ONLA 4A9AA 4JJZA 1HZCA 2AHOB 1DD2A 2JK8A 4X65L 3G71A 4FDBA 4NXNQ 1P4SA 4HSEA 4M21A 3BB3A 2AWOA 1PH8A 1TU3A 2Q9BA 1B9NA 2QM8A 4DV1L 3SJCA 4QG7A 3GLIB 2QNRA 3MFYA 5IP9G 4U02A 3A6PC 1S96A 1TKWB 5J3BA 1KZGB 1KK2A 3X1WA 4DV2Q 4C7OB 2GTPA 3LWNA 1NVVR 3L43A 4OHXA 4A2PA 3GJ0A 4B35A 3GDEA 4S35A 3Q7QA 1JR3D 2GCPA 2HF8A 3VU9B 2MMGA 1XXHB 2C35B 2QM7A 3MXUA 4QHSA 1VQ4A 3ZS9A 4DV6Q 1T8TA 1GUSA 2P6RA 2Q6TA 4QL3A 3W9YA 4A76A 3U7EB 2AMCB 1N0WA 2C96A 4NYMQ 2F4VL 3BU2A 2OBLA 4A3MH 4R98A 3K80C 2AKWB 4O2DA 3E9IA 5C4XG 4GBMA 2EWWA 1Z0JA 2YKGA 2CWAA 5IYBH 1E2VA 3IKJA 1ZNZA 1XD8A 2CXXA 2OM2A 2RGBA 3KB1A 121PA 3VKGA 5DGXA 1KO7A 3QENA 1W5TA 1QG2A 2ZI6A 1IXSB 2Q9AA 4IVRA 4GOPC 3K0FA 4Y0AA 4KV9A 3B1WA 5EXXA 3I1FA 4BECA 3KKQA 4DDVA 1HTWA 3PCOB 3VNUA 2BMEA 1ETUA 4L5SA 3U4QA 2VW9A 4HYYA 3K70C 5P21A 1N25A 2J1LA 2A9KA 2YOGA 4BASA 5C4MA 4K46A 1D9ZA 2XJ9A 2K5HA 3NXSA 4HIKA 2NTYC 1VQ7A 4JBWA 1M2OB 1W1WA 3EC2A 2G1JA 3A0JA 2QA5A 1LW7A 1PH1A 2GVDC 3IILA 1GHJA 4UP7A 4Q7LA 3RSLA 4A8JC 4LF4Q 1BBWA 1KRTA 3CQZH 4D82A 1NG9A 4MUAA 4FINA 1H9SB 4HIOA 1SKQA 2BKUA 2GZDA 3P1JA 4HB0A 4HUQB 3ZQ6A 2XZOA 1OH8A 1PUJA 4PQYA 4MGIR 3IQXA 2OCAA 5CM9C 1KK0A 2CHVA 4JOIC 4A2QA 3D6TB 4FXPA 3U7GA 2NVXH 1XEWY 3A1VA 3U60B 2Q8IB 1D8LA 4URUR 3K0XA 3A7AB 1AE2A 3WWVA 1P16A 4UPAA 1XTDA 1ZMXA 3FB4A 2GCOB 4Q9LA 1DXMA 1DAEA 2H7VA 1BBUA 2ODNA 2IHFA 1VHLA 4QGHA 4TQ9A 3QUSA 1V8QA 3TQYA 3W6PA 3A8KE 3I56A 1BKDR 1N33Q 2B7CA 2VS1A 1YBYA 1U8AA 3B1VA 3R20A 3REFA 1N6KA 5K36G 1ZCBA 2Q21A 3RAPR 1WB9A 3U3MA 1KI6B 4Z8XA 2ZETA 2ZROA 3HOUH 2LMCB 2BH2A 4JVLA 4JYBA 3AFPA 5FTNA 3LW7A 2PL3A 1UF9A 1VQ5A 1LACA 2B3GA 1KHIA 3A8TA 3FE2A 4C0HA 2YJTD 4YWLA 1IM2A 1ZKOA 2VHJA 2WM9B 4JI8Q 3HU3A 4B3MQ 1R9TH 2R65A 4OHVA 4RSGA 4A92A 3THWB 1CIPA 1AGPA 1TPZA 1RVDA 2Z6VA 1A2KC 2NVTH 1NVWQ 2XSZD 3CF5A 4ZCMA 1P8LA 1GD7A 4JZKA 4QBHA 3KQKA 4HZUA 4W7SA 3ZVRA 4TYWA 4DB4A 1KTVA 3FGNA 2HIVA 2KCMA 1FQJA 4MA4A 2BEJA 4QHTA 5DH9A 4LC1A 1FX0B 3ZVNA 1CBUA 3FKSD 4Q18A 3TRFA 1S1CA 2QZ4A 1K5GA 1Y3AA 3CRVA 4ZDIA 4C0KA 5C1BA 2ODBA 4OK6A 4NYJR 3H0GG 2WJVA 1YZQA 4PC7A 4DEXA 5FPSA 1UKEA 1Q20A 3EG5A 1GKUB 2BE5D 1GG2A 4HB3A 4MKFA 3BFKA 3S1MH 4X8OA 5CK5A 1OIVA 2GXQA 4DCTA 1GILA 4DSUA 4JLPA 4C30A 5B58C 2GZHA 2LSSA 1J5EL 2JA6G 2ZM6L 3B13B 5M5WH 3NEMA 4LFAQ 2N46A 2BMDA 4Q4LA 3UKDA 1OF1A 3I32A 4JSTA 4CDGA 4DLYA 4BGDA 1TUIA 4DV1Q 1JECA 2PBRA 3A7LA 3S1AA 1BMFA 2C98A 1TMKA 2QMOA 1CRPA 1VQPA 4BE7B 3Q5EA 1XD2B 2QP9X 2Q2IA 2HUPA 1U94A 2QENA 1M7GA 2YNMA 1WBBA 4GL2A 2O8BA 2QMEA 2ZREA 1SQ5A 3PG5A 3IFTA 5C3EG 4PXAA 3ZJYC 3DKVA 3REGA 3CRLC 1EOVA 1J7KA 1NVUQ 1XX6A 3QQ5A 4Q19A 1RC8A 3ZD7A 3QXJA 3D31A 4NZYA 3W8NA 1MRNA 1W4BA 2B8GA 4GOPA 1O7LA 1FP7A 4C0LA 3BIFA 1Y1WH 3H94A 2IYZA 1GWNA 2P5SA 3TR0A 4JV5L 2QPTA 4LK2A 4I4LA 3ASZA 2XJ4A 1IW7D 1UE5A 3NWJA 4L5RC 5KDLA 1ZM9A 3LVRE 5FUYA 1QHXA 3FVQA 2HCJB 5IK2D 2AD1A 5AUOB 3HOWG 2JEBI 4M1SA 4Y0VA 2OTJA 3U61B 2MNAA 3G6EA 4G0NA 4BY1G 3RR5A 2RKOA 2WMOB 1E9RA 4H1UA 4A8JA 5M5XH 1IN6A 5AJXA 4ZKDA 3CCEA 1DBSA 2XNDA 4A3KH 2N49A 5M3FH 3KXLA 5EUQB 4BLQA 2PCJA 1P3JA 3CNNA 3FHCB 4IOAA 2FX3A 1R5OA 3OOCA 5DLQE 4JOIA 1QG4A 1GJXA 3PO3H 2CCJA 4GI7A 4TTPA 1MKYA 4BFTA 1KOFA 3QKUA 1PZNA 4P4TA 3PUXA 2FE4A 4AQYQ 4ILEA 2DYKA 4LJ9A 1OH7A 1SROA 1I2MA 1IZ6A 2H16A 2O8DB 1HR0W 1ZBDA 1DTSA 2GWHA 3KL4A 1H8HD 3UE1A 1KQSA 2FFAA 2GXSA 2QQ0A 4JLOA 4MYUA 3SHWA 1E98A 3QEOA 2UXDL 5IT9c 5HE8A 2XB4A 1W44A 2FWRA 1WCMH 3CCLA 2Q9CA 4IPGA 5IF9A 2AUKA 2ZSAA 3RABA 3WMGA 4ZO4A 4ZIRB 1G1MA 2DB3A 1HNZL 3LWUA 2AX4A 3BB1A 2XITA 3LLUA 1YKSA 1Q22A 2IHBA 3KFXA 3A37A 1TWHH 2A6HC 3RS2A 3FMIA 3AKYA 2W6IA 1W2BA 3QKRA 1Q0UA 1XJVA 4KI0A 4LF6L 2OFOA 4P0TA 3CF6R 3ADCA 1OB2A 5TV2A 1G4UR 3P4YA 5FBRB 3TAHA 2FZ4A 3OFND 3U44B 2CQOA 1IBML 1YVDA 2E1RA 3QXSA 4NMMA 5DNYB 4RD0A 5AUPB 2PEZA 2QUZA 2RAPA 2YTXA 4V02A 4PC3A 3A5ZB 1NF3A 3S1RH 3T1OA 1YJWA 2RB4A 4YWMA 1T5IA 1GNQA 4GFDA 3W6OA 3EN2A 2H57A 1CTMA 4DNIA 4LHWA 4JSYA 4PPGA 3GO5A 2JJ2D 2A5FA 2B92A 2F43A 4AYWA 3DM5A 3LLMA 4YDSA 4K0KQ 1N3BA 4CEHB 2VA8A 1KI1A 1BYIA 3Q5DA 1US8A 1ZD9A 1KY2A 4LK1C 1SHZA 3A1TA 4GP7A 3TSOA 5ANRB 4R4CA 4GRAA 2GK7A 3HP1A 2BBTA 2Y8EA 4OQFA 1G9XA 1Q57A 4ASUA 4B48A 1IY1A 2J9RA 4R2HA 1BH2A 1HH4A 1EFRA 2WB1E 3GTPH 5KO2A 1FVIA 2VUMG 1JT8A 4PC6A 3Q3JB 1D2EA 5JWHA 1MO6A 2C03A 5C44G 2JA5H 1YZKA 3GCGA 3J81c 4GOXA 4KFUA 4XWAA 2DBYA 1J5EQ 3ZJYA 2ZRFA 1JR6A 1WJJA 4LNQA 2ERXA 1WE2A 3D3QA 2ONJA 4JVMA 4IPCA 3ZYCA 2XTNA 2O5IC 2N3SA 4KLKA 2ZAMA 4BY7H 4A82A 4DXAA 1YZTA 3A1WA 4NB3A 4P74A 1AZTA 5G53C 3I61A 2E5LQ 1DO2A 2FEMA 4CEIB 2PCFB 4A3BG 1NBME 2CLSA 2JEOA 2X1VA 4O3MA 4UKDA 1RJ9A 2FGKA 4EFMA 2A69C 1RIPA 4DR4L 2H5EA 2AUJD 4XIGS 1KC8C 2AWNA 2IYWA 1SVKA 1MO3A 2V1CC 1J99A 4EUNA 1SVMA 1ZNXA 4L16A 3MWYW 2XNSA 4Q1EA 1Z07A 2Z0SA 2WPDD 4QRHA 3ZD6A 5M3MG 2PMDA 1T0JB 3EWSA 3N2IA 2E9SA 4NL4H 4Q4AB 1Z9FA 4M53A 4TSFA 1Q1ZA 4ZI3A 4XWOA 1Q3HA 2W00A 3DOEA 1ZD1A 2EDGA 3EX7C 1Q1QA 4I1SA 4LV8B 1HNXQ 3EPHA 3EBEA 2W6JD 3B82A 1XPUA 5AJYA 5SZKB 4FIDA 1VTKA 4KKTA 2CEAA 2CJWA 3MG9A 1GOTA 2K5NA 5HTKA 1X8JA 6Q21A 2JEAI 3GTJH 1JJ7A 4A93G 2PLRA 3E5HA 3OAAD 3IO5A 5EE3A 4QJ5A 3GFOA 1KSHA 1N6RA 1NKSA 1B8AA 3MAAC 1XMQL 1AIPA 2A19A 1DAKA 2CNWA 1SXJB 4TMWA 4UQOA 4BZPA 4OO1G 4TN1A 5G3YA 2UUBQ 5AUNB 2YHSA 4P32A 3CUEF 3K81C 2ZJOA 5CK4A 3QPWA 5IYCG 4DR1Q 1QUQA 1XP8A 2DWQA 2K4KA 5KNBA 3HKZE 2NOAA 4LBZA 2QP4A 4RFSB 1Q1EA 3CX6A 1WDTA 4AK9A 1KSGA 5BR8L 1N5LA 3EA0A 4W5HA 2GEDA 1XJ0A 2REBA 1OXXK 1KMQA 4DV4L 1G6HA 4R7ZA 2C99A 4DV7L 4POAA 3VFDA 2Z5FA 5HPYB 1JEEA 1VQAA 2OAQ1 4B47A 1UAAA 4DB2A 3VA7A 1E9AA 1NBMD 4TZ0A 2O8CA 4HUTA 1N0UA 4OQNA 4TL6A 2VO1A 1X3GA 2OWOA 3EZ7A 3SFVA 3ULPA 2UXBL 1U81A 1E9DA 1CJVC 2GAOA 3WP1B 1Z0FA 5C4XH 5L3QB 1YZGA 2ERYA 4M1WA 4M1KA 3JVUA 3PF5A 4EQ6A 2AN9A 4Z54A 2GA8A 1WFQA 1Z6YA 1ZM2A 2ZR9A 5LD2C 2JGNA 1IBMQ 3QJYA 1CKNA 2DHRA 5FL7A 3SYKA 3WBKA 2A6ED 4P71A 1E32A 4RZ2A 3LFUA 4PZ7A 2PI2E 2ES2A 1BO6A 2UVQA 3U2QA 5J4YA 3U5ZB 3RLFA 2YTVA 4B75A 4ESVA 4C3IH 3L0OA 3AEZA 3DZDA 4LYFA 4F91B 4YMWA 4JYAL 2F3RA 3EAQA 3LNCA 2K14A 4D81A 1VQDA 1UDXA 1N5JA 3OIVA 4US2R 2WZQA 1CJMA 4LFCQ 1ZW6A 2XGJA 4B74A 1Z6HA 1N34L 2IK8A 1AS3A 2ZT9C 2GF0A 1NBWA 2QEQA 2DCUA 1A2BA 1V5WA 3KQLA 1AJEA 3W8RA 5A0FA 4DLSA 3B2EA 2I1QA 4DUYQ 2IYRA 4CYMA 2R92H 2E76C 1SZPA 2CLCX 4PV1C 3KF6A 3GLGE 3RS0A 3GJ3A 4URYR 2QORA 2QT1A 4WAUA 3KDFA 1G6OA 2ZXUA 4Q5IA 2HHHL 1Q82C 1NLYA 3H15A 2ONKA 2IX0A 2XOKA 4IFEA 3PUWA 2C2HA 4LUZA 5JRJA 4XWKA 4HIMA 4YCVA 1EESA 1GVNB 2P65A 3J81j 2J3EA 2BMJA 5FTJA 2JA7H 1J70A 5SZJA 3RC8A 1XNQQ 4O2RA 2CCZA 1OFHA 4JIMA 4W9MC 2O8EA 1NKTA 4A3DG 3BORA 3T12A 1Z6GA 3RS7A 2WKPA 3GLFA 3L2PA 1B23P 3IIKA 4RCNA 1KDPA 1I4LD 1ZC3A 2Q3MA 3ADBA 1KZ7B 2EFDB 1NIPA 4HR7B 4BLRA 4LBYA 4A3EG 1ZUHA 1E4VA 5LB2A 3UDIA 4PQRA 4QOSA 4A6PA 4Q1BA 3OW7A 3KJGA 1L0WA 1AE3A 1OXVA 2D2FA 1GUGA 1CJTC 4QGFA 2UKDA 4QBIA 3RVBA 2IS6A 3A36A 5FTKA 4KKUA 5GAGC 2DN8A 5L3SB 4M1YA 1A6XA 4LUCA 3WHLA 4LJ7A 1PMRA 1E79A 3BE4A 4Q1AA 1IBLQ 2CFMA 1VCNA 1XZPA 4MRVA 5IDVA 4ZI2A 1G8PA 4A3FG 2D2CC 4JI7Q 1H9JA 4KYUA 4LX0A 1VQKA 1TQ2A 2YV5A 3DOFA 4NDZA 1OV4A 3H0GH 4QJFA 3TNFA 1KI7A 3THXB 4I1OA 3MLEA 2RHSB 1F2UA 4EFNA 4TQUS 4B3RL 2IHYA 2NO6A 4NKRA 4M22A 3I3SR 1S9HA 4M9QA 2AKAB 2CLDX 4V0LA 5KDDA 1JAIA 1KMHA 1E4YA 2OLJA 3KKNA 3X1ZA 4P31A 2J0VA 1BVSA 2NO7A 4D80A 1TAGA 2P3SA 3QF4A 3MD0A 1RW4A 1H9KA 1RRFA 4DK0A 4DLVA 4TL9A 4CGZA 3S1NH 1XTQA 3CAMA 1GVPA 2HT6A 4IJMA 4CIDA 1C4OA 2AK3A 5FBQB 1G7RA 4UXIA 1XNRL 3X1XA 3AQ4A 5BR8Q 3EIHA 4DV0L 5FBWB 4BXXG 3BFXA 4A0GA 2KA7A 2ZU6A 2GNOA 2D74A 1XPOA 4IVPA 4JL8A 1NMGA 5C0XJ 4DLUA 4TTRA 4DV7Q 1QHHB 2HLDA 5F9HA 5EXPA 3AVYA 1ANKA 2H92A 4DPGA 1YHNA 2GJKA 4IXMA 3BD9A 1W36C 1X3SA 3CH4B 2FNAA 2VP4A 3K9GA 3SDZA 2BEKA 4KVAA 2QTHA 3SS8A 5AJ3Q 5DE3A 1LM0A 3IHLA 4X6AH 2WJIA 3OEEA 2JIZA 4G5SA 2QL6A 4UP8A 2ZE5A 3LO5A 3U6BA 5JECA 2YWGA 1KO8A 3U4ZA 2ZR7A 4RY2A 3QKSA 2DPXA 2G0TA 2IY5B 1D9XA 4IDHA 1VIAA 2OAP1 3LBHA 4DDWA 1G7TA 3A1UA 1VQ8A 4DV2L 1P6XA 2C9CA 5EXSA 4MRPA 4URZR 4RZXA 2IS2A 1K3RA 4PAQA 2XZLA 2GETA 3PGZA 5B64A 2KBEA 4BBRH 4A4IA 3HOYH 2GKSA 5FPYA 2I5MX 2WB1G 1OYWA 1HURA 2YWHA 1HJPA 1G17A 2ZI3A 5E95A 4PZYA 5TXGA 4EPVA 2EXDA 4MRNA 2A5JA 2MSEB 2V7QA 4B3BA 2WTUA 2FSIA 5H8WA 1SE8A 4FMBB 4N0EA 2WOJA 3NKVA 3OF5A 3FP9A 1NIJA 4DIEA 2GVBA 2J7PD 3ULJA 1K8GA 1P9NA 3FTQA 4QIWE 3HOXG 1JBKA 1E2HA 5JEAH 2TMKA 3NBHB 1P73A 1ZRHA 3TR5A 4HB4A 3AEVA 4LHYA 3T06B 1OB5A 2DNCA 1EK0A 2DFKB 2GBLA 5HGQA 3M4OH 1K6MA 1V1QA 2I5HA 5L3RA 5KYKA 4LGMA 2WWYA 1QZGA 1M1KC 1N6HA 3OZXA 2BBWA 3ASYA 1Z6TA 3QBTA 3AF1A 4B32A 4H0LC 4YXWD 4WJ4A 1F2TA 3B85A 3M6AA 2AKYA 2HHHQ 4M0LA 2EWVA 4LF9Q 4DV3Q 5FOTA 2ZRDA 3AFQA 1W0KA 2QBYA 1XFAA 5JJLA 1X55A 4FN5A 3NEJA 5ELNA 3AVTA 3Q8DA 1VHTA 1A8VA 3HU2A 3NHAA 2NN6I 2P67A 4X8LA 4TLCA 2VBCA 2RGCA 1UKYA 1LUZA 2CK3D 1N5IA 2WHXA 1JMCA 5EP4A 3ZZTA 3V4FA 2JLRA 1HT1E 4JBXA 1R0WA 1F5NA 1VQJA 1EWQA 1G5TA 1MABB 2JASA 4OI2A 4B3CA 1AGRA 1AS2A 3GLHE 4RFVA 5H1YA 4EJSB 4EFLA 2F6RA 4PO9A 4ZDKA 4LHZA 2EIFA 2NG1A 1CR2A 2PX0A 3R7WB 2Z83A 4OWTB 2QROA 2ZJYA 1EFWA 2ZRPA 4Z1MA 1TQ4A 4IPHA 3TVTA 1WI5A 3SI7A 4JI6L 5KSOA 1II8B 5D3MB 3KX2A 3EARA 4WVFA 2H18A 3J7A5 4RZUA 1W0JD 1TF2A 3BWDD 4XD7A 4H13C 4E03A 2FN4A 1N33L 2FEOA 5GJBA 1SRUA 2OXRA 1X54A 2R7FA 2NN6H 4ALPA 2J0UB 3HKZG 2IEYA 2MO0A 4IJHA 4JLAA 2OSBA 4LV5B 4PSVA 1IHUA 4Q4JB 4RKFA 1Z47A 5DI3A 5K8LA 4QC2A 4D25A 5G3ZA 3ZS8A 5JHGB 1Q1BA 1E6CA 2WWHA 2ZJQA 1M90C 4B3RQ 4URVR 5ELOA 4JI8L 1DGSA 1FW6A 2J41A 3GLHA 3K0SA 2HEIA 1XNJA 3FHWA 2CVHA 2FSHA 3MJRA 1KD1C 3RWMB 1G291 3O47A 2O0KA 1P7CA 4A3LG 3CC7A 4RZ3A 3W3AA 2W0SA 2IF0A 4O2LA 2OBMA 1DAHA 5C2JB 1E9FA 1UDWA 2ZRGA 1EYGA 1GRNA 1XNRQ 1N6PA 2IYTA 2FV8A 2JJ1A 4A0HA 1T3HA 4DV0Q 4A3BH 2JAQA 3GJ4A 3WYFA 1KAWA 1YNJC 1HH2P 1JB7A 1F60A 2F3TA 1A7JA 2QN6A 4POFA 2ZEJA 2VP2A 1W49A 2IEZA 4X8HA 3EXAA 4RG1A 3PV0A 3CMAA 1XTJA 3PIRA 1QZHA 2NO9A 2ORIA 3K0AB 3QSYA 2A5DA 4A3CH 2PJRA 2AXPA 4F4CA 4OO1I 1R5NA 1R2QA 1Z22A 2Y0SE 1LF5A 3TGPA 1E1TA 4LFAL 3ZVMA 2G1KA 2QMHA 1GHKA 3Q72A 3VHXA 4XVRA 4XSGA 5CLLA 4DCVA 1WF3A 2R7ZH 2IYYA 4DUGA 1OXSC 3K09C 4IEIA 3TSWA 3IEVA 4N3NA 5IP7G 4JJKA 4RD6A 2D5DA 5F9FA 5AJVB 2P0EA 2PMKA 1RPZA 1XEXA 1K0RA 2K7VA 1TWAH 4HZIA 4TYPA 3ZQJA 1GRRA 2VHUA 2W2XA 3DMDA 4YLGA 4BFZA 3CH5A 4IPDA 5KTYA 1Y1VG 3EW9A 1E7ZA 1E22A 4A93H 3UDXA 1BS1A 1UBGA 1KYIA 3QEJA 3AH8A 4HDOB 5FR2A 4KMUC 3RNLA 1Z63A 4NTZA 4D4MA 2UXCQ 3F1ZA 1SVWA 5FBVB 1XD9A 1M1YE 3I4MH 2MMCA 2ZAOA 2AK2A 3W34A 1E9EA 4OO1H 1OKKA 4OJQA 2J46A 4KFTA 3VR2A 2R9VA 2ZYVX 4GZLA 5IYCH 2LKCA 2BKEA 4DJTA 1YVCA 2IUSA 2ANBA 3RRZA 5EE1A 4PG3A 1SHKA 2JA8H 2V55B 5CYPA 4DCSA 4DSNA 4JG2A 1XB2A 2QRNA 2IW3A 1P60A 1DAIA 5E7JA 3K53A 4TMXA 4BBSH 5JJIA 1G8YA 1W7AA 1E1OA 4ZV4A 3HOZG 5ELXA 3CXCA 3RS4A 4B6FA 3CRQA 5F98A 3I8SA 1EWRA 4AQYL 2PMZE 4HB2A 4YHHL 4MQBA 4D0GA 2C77A 1BIFA 2I3BA 521PA 4XTRA 5JI3E 3EASA 3M3YH 1ZUIA 1FL0A 3LY5A 4M1OA 1COWD 2GEVA 5HY6A 4ME3A 4PANA 2RGGA 1UPTA 1LY1A 4IDNA 1A0IA 1R6BX 3L0SA 1S3SA 1VQOA 2RHDA 4LW1A 1EFCA 4P3YA 1Z8FA 4A3IG 1F48A 1CRQA 1OT3A 3AV0B 5FJ8H 4RMFA 1H65A 3EIEA 3BZKA 4KBGA 4LJ4A 4ON9A 3G4SA 4TLAA 2AHOA 3U4VA 1E69A 1M74A 4JLDA 3VAAA 3AP1A 4OQMA 4DK3C 2G6BA 4DK1A 3CCVA 4BLPA 3I4NH 5L8VA 4EIWA 1ZVQA 1NJGA 4IOLA 3ZGXA 4JI6Q 2XXAB 3AP2A 2WWWA 1S1MA 4C0JA 3CRKC 2PQAB 2WSMA 4LYJA 3PF4A 3GLIA 1SVLA 4G3XA 1Y63A 4C7OA 3BFVA 1KI3A 2GHIA 3O8RA 1ZD8A 4L9SA 3N6RA 1M8PA 1XRJA 1CKMA 2B29A 3D4RA 2O8FB 3JZMA 3PO2H 4LF8Q 2ZRHA 4IDOA 3AGQA 1XMJA 3VU9A 2RCNA 3U7HB 3F2BA 1XXHA 1ZCAA 3B1ZA 3HR8A 1KO4A 3SZRA 5FR1A 5FLMG 2ZI9A 4MKGA 4JL6A 1VQEA 1CXZA 2X2FA 1V9PA 4DLZA 2ZITA 1KI4A 1KSFX 3CWQA 3T1TA 5SZIA 1C7YA 4M8NE 1Y69U 4K0KL 1CFMA 4YCWA 4DNRB 1G21E 3TS2A 4I7ZC 2PT5A 3D7MA 1CP2A 4OHWA 2QAGB 2V54A 3L2OB 3AF0A 2Q2UA 4Z8YA 3BOSA 2OCYC 3BXZA 2ZJ5A 4KFSA 4DRZA 2QT0A 1L2FA 1Q86C 1KK3A 2PZEA 4A3DH 3K09A 4JLKA 2JA9A 1LTLA 3PIPA 4B76A 1SMYC 4BRWA 1ZIPA 1F6BA 1VCMA 1VQ9A 1GL7A 4V03A 1HT2E 1CTQA 4C2MH 1GDDA 1TF7A 4HDQB 4DIDA 1KKLA 3KKPA 4A3JG 5FTLA 1VQGA 1P62B 1QF9A 2C95A 4PTLA 4IOCA 1ZP6A 1AQYA 1NMXA 4IXNA 5HKKA 4E5UA 3M4PA 5FOWA 1DPFA 1VPLA 1H9SA 2PCLA 4HUQA 5BXQC 2E5LL 5TVKA 1XTKA 2AFHE 1MJCA 4LZZA 2G3YA 1FP6A 1P2VA 5GQOA 1BMFD 1XJQA 4GNXB 3RZOH 1NMYA 3KJPA 3AF2A 1ZYUA 3AUYA 1EFHA 3QPUA 3SR0A 3MWJA 2CL0X 1GAJA 2BBSA 5FPHA 4WZBE 2FSGA 1C9OA 2OLKA 1RRCA 4DR3Q 5LB4A 3VNVA 2NZHA 2KBFA 2GCOA 2R6AA 1SLJA 1GNRA 2D7CA 3CP0A 1TL7C 3KZ1E 2V6JA 2WICA 2ZRJA 4JI1L 3VHLB 2BA1A 1JALA 3RN5A 1ZIOA 4CEJB 2V3CC 2B8TA 1RYFA 4X62Q 5KUTA 1HNXL 3UANA 1KI6A 3LXXA 4OI4A 5EE5B 4WBSA 4E07A 1FMLA 1U2RA 4GSYA 4CRWB 1UBFA 3K70D 2VTKA 4M1MA 2O0HA 4KN7C 1Z5ZA 1XEFA 1FJGQ 2VF7A 1NLFA 3QVUA 4FMCF 2F3IA 4MUBA 3AYHB 3EPKA 4BFYA 4JI0Q 2B63G 1A4RA 1XCGB 2G77B 2WVJA 2OO7A 2Z4RA 1IBRA 1E0KA 2ZRIA 1NSTA 2ZSEA 3TMKA 3THWA 3HOVG 1HV8A 1NVVQ 3KFUA 3PUVA 2XNDD 1VQIA 3MEFA 4DWJA 1CS4C 4D0NA 4YHHQ 3RWOA 2UUBL 1UE7A 2XTZA 4AKEA 4BFWA 1E9SA 3OTOQ 1JE5A 3RRNA 3S16H 4Q7JB 5M5YH 3NC0C 3EPLA 1FX0A 4DR1L 2W2TA 3WRYC 1MIUA 4C0BA 2ATWA 4TKOB 1S40A 2O5VA 2ZSBA 3G0HA 2IXFA 2VL7A 4PR0A 3E0EA 4EDHA 3I55A 3MJHA 3EIVA 4YCUA 4MGZR 4HJ5A 1KHTA 4JI4L 5BN3A 4J15A 1NMZA 1ELOA 1NN5A 2ZRCA 4IOMA 1GL9B 1DELA 1HZ9A 3T1HQ 4NCKA 3THYB 1TWGH 4IHQA 1R10A 2GJ9A 2H5XA 2F1IA 1ZU5A 3K7AH 2WJYA 3BGWA 3B78A 2WOOA 2A7QA 1QZXA 2V9PA 4RD1A 1NJIC 2QMUA 4FCTA 4IFDG 3M7NA 4LCBA 2G83A 5HZHA 1Q46A 2KENA 1TQ6A 1XD2A 1Z2CA 3HOXH 1NMFA 4LUOA 4DK6C 3NH9A 1UE6A 4B3TL 2W6ID 2K5VA 2B6HA 3RN2A 1DAMA 1O87A 1PUIA 2ATVA 5DIFA 3UIEA 2C04A 1EFUA 5B2ZA 1QHIA 4IFDJ 3OPOA 1FPMA 3UG7A 3ND8A 1XMIA 4V0MA 3CRRA 1L4YA 3F2DA 1VKJA 5FPTA 2FSFA 4YONB 2FZLA 4DR7L 3VR3A 2EJFC 4QGAA 2CKZB 3GJXC 5FUWA 5JCPA 2IX1A 1YZUA 1KO1A 2I1VB 1CJUC 1JJ2A 1LTQA 4A3GG 3VR6A 1N6NA 2L0XA 2MSDB 2RGDA 3QF7A 4PPQA 3MWLA 5FPKA 1XWIA 2R6GA 2WAQE 2SHKA 3DDCA 4LFCL 3A1SA 2X19A 2ZVQX 3CB4A 1JPNA 1N8RC 4B3DA 1RFLA 3MGCA 3M4QA 1YZLA 2C78A 2C5LA 2Z6KC 2P2LA 2QAJA 4QJ4A 1H8EA 3SQWA 1ZNWA 4GLXA 4DUYL 3P20A 1N36L 2QPOA 4AI6A 1XJCA 4ASUD 2OT3B 5JFGA 2UUCL 5FOSA 1CJKC 2V1XA 4Z51A 4TLEA 1EFRD 2R93H 1BOFA 1QHYA 3OEHA 4P4SB 4C2UA 5KPJA 2EFEB 4L5TA 2GXAA 2OESA 1VG9B 4GZMA 2O8DA 3SE0A 1NY6A 1L1OB 2H1LA 2ZI7A 1HCZA 1HE1C 4OWXB 1XNQL 4EPYA 4K8OA 1P2SA 1FMJA 3T5DA 4IOJA 2A68C 2CCGA 4AKIA 1SXJC 5UKDA 4ZIRA 2YZ2A 3M1IA 1T5EA 2YYZA 3H2YA 3DM3A 2R6CA 4PHGA 3I5XA 3K0CC 3FKIG 2IUTA 4NYIR 2VRWA 4PZZA 4HLUC 3UG6A 4C4PA 4NYJQ 5IRCD 3STBC 2NO1A 3WY9A 3CKLA 2J87A 1TWFH 3FFAA 4EAQA 4JI1Q 4Q9IA 3KFVA 2P5TB 3CD6A 4YMVA 5IYDG 3IQWA 4UJ5A 3KJOA 3EZFA 3A58B 4XTCS 2NZOA 5DO9A 1GUTA 3U44A 4G5GA 1IBLL 2WBLC 4D4LA 3Q8XB 2R7DA 1RZ3A 1TNDA 3L8ZA 4TSFD 4JI7L 1OFUX 2FG5A 3LX8A 4IQZA 4GN3B 4QKQA 5EP1A 1E3MA 3QVVA 1A82A 3VQTA 5K8IA 4MKHA 1S2MA 2BBOA 1M7BA 2GAAA 4Q7KA 2JLYA 1KAGA 3W5IA 3U58A 4I1UA 4CEHA 2EQBA 4GNKA 2UU9L 3RDPA 1YHAA 3JVVA 2EYQA 5EQTA 1FGUA 4OK3A 1HA3A 1IJFA 3TJZA 1DO0A 5CIWA 3VMFA 1AN0A 3R8CA 2CNWD 1D2NA 4II7A 2VL6A 5IP9H 4HJAA 4YDHB 4RD3A 5EUMA 1G18A 1IYUA 1U0HC 4D4JA 2GJ8A 1JXMA 1ZJ6A 1UEBA 1XTRA 2H17A 2IYVA 1JQLB 1CI3M 2A6HD 2AFIE 1MOZA 3FHTA 1CEEA 1KIXA 4JI4Q 3SN6A 4B2LA 1DVRA 1NRJB 4NE2A 4CT5A 3WYGA 3U3KA 1Q3TA 4A3MG 4GS3A 3BJIC 2DWOA 1WXQA 1PH4A 1KJZA 1SMXA 5AR1A 2ZE8A 5IYBG 4ZDJA 5AJ3L 1QRAA 1N9WA 1HNWQ 1NI3A 1NSFA 4B3XA 2OG2A 4HIDA 1GUNA 1NN1A 5KNCA 1RE0A 4DR6Q 3PXGA 2GJAA 2XZPA 4HAZA 1VF7A 2ZJ2A 4CEIA 4B3TQ 4LC0A 3ZZUA 3GLFE 2O8EB 1Z83A 3WDNA 1XMOQ 3C4JA 1VG8A 4POGA 2FFHA 3BS4A 3IUYA 1U5KA 4MGYR 4C9BA 5B30A 1E1QA 2ZRKA 3GJ5A 4C3ZA 1BYUA 2W0MA 2ZS9A 2YC2C 4I1VA 1NG1A 4AG5A 3NEYA 5FL7D 5JCZA 3R9XA 4IKEA 3RHFA 4DR7Q 2Z6KA 3B6EA 2YOHA 3SBDA 2PT7A 2A2ZA 1G3RA 3HOZH 1YR7A 4M9ZA 3NVAA 1Z0KA 1XDBA 3LQRA 1PYSB 4PFSA 3ZIAA 3RSOA 1KDTA 4Q4AA 2ORWA 4PZLA 3O8CA 2BV3A 4IVQA 1B0UA 4OBEA 1WP9A 4WZAE 2F1MA 2YWFA 1T5LA 1YI2A 1SVIA 2BIFA 5FBLB 4JI3Q 2OILA 3AB3A 4DNTB 1KI2A 2RHQB 3PEVA 4AYBE 2IWHA 2PEYA 2ZTEA 3AVWA 2IA5A 1R8QA 1XCMA 4JCVE 4LF7Q 2F1HA 2R6FA 5DYGA 4YMTA 4QGUA 1N36Q 4PO8A 1T0HB 1PVOA 3BH6A 4GOJA 2ODEA 4Q03A 4F38A 4GKKQ 5JEEA 1W5SA 2UUCQ 3ND9A 1OIWA 3GLGB 4S2EA 3TQCA 1VG1A 1SXJA 5GVSA 4LF9L 4DV3L 4JKYA 1G3MA 5BWMA 1K8OA 1EFTA 2VP6A 2FOLA 3K0CA 4HEJA 3VX4A 1YZ6A 4H1VA 1CKOA 4RVCA 2A69D 5EZ5A 4HLUA 5JSZA 4GPTA 5J4KA 3MUFA 2GBLC 4UNSA 3K7UC 2HT1A 1XU4A 3QY0A 4RFSA 3J80c 3HOUG 1Z0AA 3GTKH 1QJOA 2XOKD 5K36H 2P6UA 2HCBA 1G4AE 3W1GA 4TWZA 5KDOA 1EWIA 4JK1C 3AVVA 2HIXA 2W83A 4JC0A 3I62A 3EZ6A 1SGWA 3HFZB 2VY3A 2VSOA 4Y7NH 2ECKA 1HZAA 1GUOA 1K9MC 2DWPA 5FUXA 2JATA 4RKEA 4FWIB 1D2MA 3F3YA 3QXHA 1YJNA 1L7VC 5G41A 5L3QA 4GMDA 4LBVA 3TKLA 4PQFA 3CCUA 2E87A 4TLBA 1E2JA 2MO1A 1IN7A 2YVUA 2A5GA 3SU8A 5IHPA 5SZHB 4R4TA 3H1TA 4GOKA 3DKPA 1SVSA 2ZRAA 5LMNW 5KSZA 1H9MA 1G3IA 3VX3A 5CB6A 5DISB 5FOUA 4BFUA 1IYVA 2Q0HA 2V6IA 1E79D 2VP5A 3I7FA 4LBWA 2CHQA 2K52A 2YC4C 1VCOA 2ZM5A 1GFIA 3AF4A 3U9SA 1FYCA 1CSPA 3UDFA 3HU1A 5FUVA 4B33A 1DADA 1T6NA 4BLOA 3WHKA 2JA6H 4X8MA 4UNRA 1EIYB 2UU9Q 1KXLA 1YE8A 4A3JH 4F7WA 3CC2A 2JLXA 1NTGA 2HJVA 3BERA 3NENA 3CIOA 1L4UA 5EE9A 4D6PA 4DT1B 1PFSA 4NXMQ 1WMSA 3AGPA 4QY7A 3PVSA 1S3GA 5C0XG 3OESA 2ZANA 4F92B 1CR1A 2EFHB 3NBYC 4FCWA 2LCFA 1IYJB 3SGIA 3FMCA 3LDAA 4KCGA 1QVAA 4HJ9A 3SJBA 2ZJPA 4EPTA 5C3EH 4DLXA 3M85A 2BC9A 3RZDH 3GJ7A 4GP6A 4OHYA 2HDNB 3VKHA 5CJ2A 3W6NA 4JT4A 4R4QA 1Y1WG 2PLFA 4HDCA 1Z7TA 5C46F 1Y8PB 4TYYA 2O8CB 1HZBA 1D7QA 2WWGA 5EP2A 1I3QH 1FR3A 1Q8KA 2X2EA 4TT3A 3VTKA 2HLDD 2WP8J 1VQFA 4H02A 1CSQA 1XF9A 2VYFA 4URXR 1A5TA 1WOCA 4LF5Q 2VQFQ 4MH0R 2WAQG 4RJLA 1O3YA 4V0KA 4EPRA 4DSOA 1TU2B 1G5RA 4TZ6A 1OHHA 1NP6A 4NYMR 2GVZC 3OEED 5CIQA 5M04A 3HOWH 2JIZD 2ZJAA 4QNRA 4A3KG 5M3FG 4AWXA 4ARZB 4GMXA 1X8LA 2WJHA 4BY1H 4PC2A 4JVNA 2GN5A 3PSIA 621PA 4U5XA 3PO3G 2X8AA 4MITA 2B63H 2WKQA 2QG6A 4Q00A 4GN5A 3TIFA 2P6NA 1GO3E 2UXCL 1Q12A 1OE0A 3UMFA 2FFBA 2JE6I 4R1JA 1U98A 3UWKA 2G0NA 3NTUA 3I72A 2VHCA 2WIAA 4US1R 5L3SA 2WWFA 3P27A 1IJEA 4EJSC 2QE7A 2DY1A 2V7QD 4Q4HB 3KJEA 5BN5A 2YTYA 1EX6A 1WCMG 3FMPB 4C0AC 1PH3A 2VNUD 2KWIA 2WSSA 3BH0A 3C8UA 3H0KA 2IHEA 5JWRA 1P75A 1E2WA 4L8JA 3KLRA 3NBFA 1X56A 1VECA 3THXA 4OL0A 1F3OA 4HLDA 1Z06A 2D4HA 1W47A 1II0A 1G8HA 3U50C 1K8AC 2F9MA 2JDIA 3HKSA 2XX3A 3DZ8A 1YJ9A 4NPSA 2QEXA 3EWAA 3OE7A 2PZGA 4G1UC 2K75A 1Q21A 4AYTA 3OYYA 2FA9A 2ZR0A 2O52A 4HI0E 2OBNA 1VMAA 2A3RA 2ZTCA 3R8FA 2CBZA 4LWCA 3A5UA 4JI5Q 1OH5A 1MJEA 2OZEA 1YU9A 3B9QA 1D5CA 4LRWA 3BC1A 1Q7YC 3GFTA 3K8YA 1EQRA 4AURA 3L8YA 1PH6A 2ZRLA 4NCJA 5KU1A 1W0KD 3VR5A 3CCSA 3KYHC 1HE8B 4GT1A 1AKEA 1E2GA 4Q01A 2ZUCA 3S15H 1E0JA 2EVBA 1IBKQ 2CW0C 3CPJB 2CVFA 2DR3A 3CCJA 3U7FB 2VQEQ 1Q44A 1QHHA 4OKSA 3A4MA 3LAWA 3KF8B 3MCAA 1IN8A 1GL6A 2VLIA 3GMTA 5JEDA 2B7BA 2NZJA 3N70A 1LS6A 2ZRNA 3LD9A 2NPFA 3B6YA 4OYHA 4DZZA 2GK6A 3SBEA 2XGTA 2ATXA 4PSAA 4BRUA 3HDTA 5FFMA 3ETLA 1G51A 5BN4A 4G7HC 3UATA 3D0FA 2XTMA 3W90A 3CNOA 2R44A 1N32Q 4Z1MD 2FF7A 1CF4A 1JXOA 4PAMA 3SYLA 2ANCA 2A8VA 1IXRA 2A1AA 4GLAC 2HXYA 1XMVA 3KUDA 4L15A 4JBMA 3G48A 1R0YA 4A36A 3LXRA 1Y8OB 2FMXA 2K33A 4LF8L 4IOKA 3NIBA 4LI0A 4XD7D 3UMSA 2BH8A 3FPAA 2JA5G 3UMRA 3T56B 4H9GA 4Q1CA 3QBVA 3KQHA 2VUMH 4BWYA 2UZIR 5EAYA 3C5CA 4P4UA 2BHRA 4MNOA 5C44H 4LOAA 3FHOA 3AB9A 8OHMA 3TK1A 1P72A 1T4GA 3DO6A 1T8UA 4G01B 4BY7G 1JAHA 2EQSA 1HYQA 2EYUA 2IXGA 4KFRA 3X1DA 5D3QA 5GADC 2JLUA 2WMNB 2OCEA 3M9BA 3HPRA 2PNHA 1L2TA 4QBGB 2CL7X 2WWIA 1GTVA 1WCV1 4OI1A 1Z2AA 5LMNL 1AQUA 2NMVA 1VF5C 2MFIA 3WMFA 3AUXA 3CW2A 4AKGA 1E1RA 2PZFA 2VH5R 1SN8A 4A0FA 3K0FB 3SFZA 1W36D 5AJWA 4MYTA 4R71A 4UY8C 1FNNA 2Z4SA 1WBDA 1RL2A 3IIJA 4MZ9A 3TVDA 3U4QB 1UM8A 4FW9A 5DN6A 4P72A 3IBYA 5CDFA 2JJ1D 4OX9Q 4BUJA 1NE3A 3HGBA 3A74A 1X65A 1E2EA 1CR0A 2XAUA 1GM5A 3GP8A 4GDFA 2IT1A 4PX9A 5M3MH 4ZCIA 1Y8NB 4MTNA 1CULC 3FFBA 4PHFA 2F55A 2BJWA 2BCJQ 3WP0A 3LH5A 2G88A 4O25A 4D2IA 4LHVA 4L5QA 2XTIA 2QGZA 1T91A 4BEBA 2NZ8A 1MV5A 5CJPA 2WKRA 1CU1A 4AIMA 3FWYA 4CVNA 4UNPA 4PZ8A 5LMUL 1MABA 1DE0A 2AL7A 2PX3A 4AYBG 4BLTA 4YC7A 2IUUA 4DUGD 4EJSA 1XTIA 1JJGA 2F1JA 1DARA 2PH1A 3LVQE 2DFNA 4OQXA 3QOFA 5HCIA 3THOA 3UDGA 1KL9A 3SHFA 1EIFA 1K8RA 2FFQA 3R7WA 4MRSA 2CMKA 4HAXA 1AS0A 1J2JA 2L5TA 2B8WA 3CCRA 2EW1A 3V00A 2BE5C 1K73C 1II8A 4DR3L 5D3MA 5GJVC 1NVXQ 1P9RA 2F1RA 4AYXA 5A5GA 3GLIE 5TB5A 2BWJA 1MH1A 2IYLD 1JR3A 1KO5A 3LBNA 2ZJRA 1GUAA 2MSCB 4GZYC 2QU8A 2ZJBA 3AKCA 5DHFA 5FI1B 3AVUA 3K9HA 1P2UA 1W2GA 4X62L 1LNZA 1GKHA 2J0UA 3KTAA 3QXCA 4JLVA 2D0PA 4Q4JA 1OKKD 1XXHE 1AA9A 2ZS7A 3LV8A 5EZ6B 4LPKA 4FWTA 2FDCA 3PEYA 4X64Q 1E2MA 4TMZA 5EXTA 1FJGL 4XOIA 1PV4A 1W4AA 3K0EA 2DUDA 5FOXA 1Q81C 4DV5Q 4JI0L 1YEZA 1OW3B 1TX4B 4WXRA 3UK6A 1DAFA 1HUQA 3N2EA 1FQKA 3IGFA 3SQXA 2REXB 1GITA 4DDUA 1DS6A 4Q66C 1RYHA 1Z28A 3B8HA 4PPFA 1K5DA 3BZCA 4BA1I 1ZYRC 4KSCA 2DFTA 1IL2A 2QRZA 4HZUB 5EE0A 5BQ5A 5JZVA 2EJGC 1YJ5A 4LPSA 1KDRA 2GEUA 2RF4A 3OTOL 3KQNA 1EWHA 5GROA 1M6NA 2CE7A 1AK2A 3PITA 1IW7C 4HAVA 4WW0A 5DI9A 4DAYB 4EPXA 3C41J 1U9IC 2ODWA 1UE1A 4OXPA 2ZTSA 1E99A 1O78A 5A35A 2ZJZA 2EJMA 1R0XA 2JLSA 4LYHA 3S1QH 3TH5A 4PHTA 3JZAA 1A1VA 3K0AA 2R8RA 4BA2I 4H44C 2LXJA 4A0RA 2UZ3A 2E2JH 4HLQB 4F4IA 1J6QA 4R4IA 4X66L 1P2TA 2QAGC 3T1HL 1COWA 2Z43A 3LRPA 3QXXA 5FOVA 3H86A 5A4JA 4JT2A 3TW8B 1D6JA 2VSXA 3TS0A 1VYTA 4LFBL 2CHGA 1ZUNB 2ZUBA 4R9UC 3S1AB 4ABYA 2FPMA 3I4OA 1E2LA 2QA4A 1A62A 1R0ZA 3N5CA 3E9HA 1G7SA 2H8KA 4L9WA 1JNYA 2WV9A 2PJZA 3EPJA 2O8BB 3E2IA 3K9LA 1I6HH 2R92G 3WRXC 1E96A 1UEIA 4LJZC 2KI5A 4YQFA 3H3VI 1YITA 5JWOA 3JAMc 2BA0A 1PLJA 4GOPB 1U0JA 2VEDA 4PC1A 4QBFA 1QHNA 4ACAA 5KNDA 3EZ9A 2ALYB 1IN5A 2GESA 3O8BA 5C4GB 3TZUA 3OW2A 1Z08A 2C9OA 2EFGA 4NU0A 2HYIC 1OIXA 3ONWA 3BG3A 3K70B 3CR8A 4IJLA 2JA7G 1GNPA 2QY9A 2RGNC 3ZLJA 5JJKA 3RS5A 2ORVA 4DCUA 1HPCA 5LMNQ 1MKHA 4GNXC 1YQTA 2JJ8A 1ZM3A 3I2ZA 1S8FA 3D8BA 3CCQA 2JJQA 1Z6AA
chains in the Genus database with same CATH superfamily
2SDFA 4KHZA 4DSAA 4EG1A 1FU8A 4Y1GA 5TSDA 1TJPB 3HGQA 1SEPA 1JPUA 2JD2A 2X4GA 3CLVA 5I51A 2WJGA 3ZW8A 3FVRA 3RRBA 4BNHA 3WK9A 1XGKA 3RLOA 1H4SA 1ZWKA 3EG9B 1O7IA 3K4PA 5K05A 2MQHA 1CR4A 1UDAA 4UP9A 3HPQA 5CDGA 2P2GA 2O2XA 3AVPA 5BV0A 2DQ4A 5I9SA 3ZE2B 4OF4A 3NXKA 3A56A 1X13A 4P7KA 3EGIA 4CQLB 2NVTB 3HJNA 2ZU0C 1ULTA 1HEIA 3CONA 1WEHA 2BCEA 5DSZA 2V3WA 1E2QA 1K98A 2WSIA 3MUOA 2VTBA 4PIMA 2HA5A 2GZAA 3WRXA 4DLKA 2I5LX 4OREX 3JWHA 2YXBA 2FU5C 4JLBA 4L0MA 2UVPA 3LUJA 3JD0A 4KTVE 1S72A 2CDNA 3BJZA 3NXWA 4DBLC 3VZCA 3TSYA 5F2OA 1AVTA 2BMFA 4AC9A 1KNQA 1I4DD 5HHTA 1SUBA 3O2JA 3I52A 3MT9A 4ZJPA 2PYDA 3UC9A 4QUEA 1N6OA 3ZJTA 1KWGA 1IXZA 1R4MA 5J23A 3MQ4A 3I34X 2G71A 4R68A 3EFHA 4ZICA 3FF4A 5BNIA 4WBXC 3BK7A 3M2TA 4YP9A 1E60A 4YRIA 3J80i 2WFWA 4RENA 3UAXA 4DUZQ 5DLEA 1QG6A 4XLZA 2WMDA 4N7BA 3KETA 3OETA 3IO3A 3SJZA 3OD1A 1WDKA 3ZQUA 3K5WA 2C0CA 4GX1A 4Q1DA 5AKIA 1JP7A 4B6EA 4O3FA 1VHQA 4RXUA 5FCDA 1M8AA 2EOAA 4D45A 5CFZA 3TL6A 4JN6B 2J9FA 3ONFA 1RHJA 4HWTA 3C5EA 4HXEB 3WGLA 5IP7H 2X6LA 3AFMA 2DTXA 2GM3A 5IYZA 4M4SA 4C7VA 1Y1VH 2B7LA 4U2GA 1VP9A 1LD3A 1MQAA 4DFAA 3ZE9A 3NYIA 4OFZA 1W4LA 4EQNA 4KX5A 1ONBA 1MW8X 3DBLB 3B1XA 3NORA 3DKIA 3I4CA 2QVXX 1YL7A 1L4FA 4OI0A 2MPMA 2OECA 1OD6A 3AF3A 3MRSA 3ZVLA 1QV9A 2Q5CA 3E3AA 4EUSA 5JE8A 5JSYA 4C3JH 4KQFA 4C4YA 4YRBA 3X1MA 2J9XB 5FTMA 4IIJA 1NATA 3WZ2A 4RK5A 1WQ1R 2OXFA 1A9YA 4UMVA 3E3NA 1SD5A 4F0JA 4MCAA 3W3ZB 4DAMA 3IMFA 3TQIA 2YVQA 3MMPA 3PTLA 4C0QC 3HBJA 2B8FA 1CQJA 3GTMH 2PA3A 5BPHA 2JLCA 4Q02A 3PHGA 3MB5A 2EYHA 5LQJA 2XD4A 3Q9NA 3E5SA 2WT8A 1E0BA 2WIJA 4OQEA 4PZCA 3DYIA 3C7KA 2OCBA 4EI8A 1RIIA 3HJTA 3LHFA 1S0UA 1FUEA 4AO8A 4AY6A 3PXCX 3F2IA 3I4LA 1I1QB 4Q7MB 3THRA 2IHUA 2LWIA 2QVBA 2CZCA 5CW2A 4HVCA 4U7DA 1PK9A 3TECE 2YVKA 2ZIFA 4O8ZA 1DOAA 1HDEA 1J1UA 2QB5A 4WOPA 4I99A 4GE0A 5B2FA 2MYNA 3G9QA 3IMCA 3T5GA 3E4CA 2O48X 2EF1A 3BJRA 4IUNA 4PO3X 4PSKA 1BJKA 2XE6A 1DV1A 2VAXA 1U8CB 2H29A 3K5IA 2XWJB 4BNFA 2XYRA 4NV1A 1L0XB 1I6MA 4B83A 2HDHA 3PHLA 4HAWA 3GLVA 4DJAA 3CS3A 5CDFE 3V32A 1ESMA 1FF9A 4G5HA 3OIFA 1HFGA 3AKDA 3TW4A 4KBFA 1WHSA 4BNYA 5HR5A 1M2KA 2DEUA 2OE2A 3H8JA 1OLUA 2NGRA 4TOIA 3OX3A 3UW1A 1FLAA 3GD7A 1OZAA 3AEUA 4HQLA 1ZAYA 3NHUA 1U0TA 2ZIZA 4JS0A 3MAGA 1EY4A 4CWAA 2P1DA 2ZDHA 4D4KA 2ECQA 3C1TA 5HF8A 4L8GA 3BDOA 3TRZA 3U7QA 3SF0A 1B26A 5JPDA 1CDEA 4ZVPA 1LPOA 4R1SA 1G8JA 3KLSA 1B7YB 3NK9A 3FYUC 3TEHB 3FDFA 1V4NA 4REMA 1T3TA 3HHEA 4LHXA 4PSCA 1UPXA 2BE9A 3TUJC 4R0VA 3WNDA 2XMPA 3G71A 1P4SA 3BB3A 1TS5A 1H3NA 3HDGA 4DR5B 1C50A 3GRFA 2I34A 3O03A 3A6PC 1KMMA 1NVVR 4Y6SA 3ZVKA 1Q1AA 3PFFA 5CTAA 2VUMB 2BKVA 3HC7A 1EE1A 1N2IA 2B2YA 2OC9A 4NDXA 4ER3A 2Y9PB 1F0PA 121PA 4A3BB 4CDMA 4F72A 2ZI6A 3AHFA 2VXWA 1RWXA 3USZA 3TZQA 3PCOB 3WO0A 2VW9A 1GZHB 3A3OA 2J1LA 1O7JA 2G7ZA 2QA5A 3Q7EA 1UFVA 4Q7LA 5I9LA 1KRTA 5FRDA 5JIBA 1OH8A 1M4VA 3GDGA 4KL8S 4RNDB 1KK0A 3LX6A 1JHVA 3A1VA 3SMQA 1JJIA 1Y5RA 3U56A 4IV5A 3VDNB 7ADHA 3V8QA 3W6PA 1U63A 3B1FA 1HNWB 4G56A 2BFEA 2DP4E 4PYJA 3O9MA 4OHVA 4B3MQ 4OLAA 3KQKA 3VPSA 3BSSA 4QHTA 3ZVNA 1XZJA 4ZDIA 3MTGA 3GCZA 2GXQA 3AUTA 2IXTA 5BSEA 3K8OE 1E62A 1TMKA 3INGA 2O7VA 3NBMA 4YQYA 2QP9X 3D7NA 4PXAA 3DKVA 1FFSA 4XYLA 3N2GA 1AN8A 4R16A 2VPZA 4PS1A 2Y1DA 1GQ2A 4GX5A 4I4LA 1IW7D 5FT9A 4GKBA 1TD9A 2AD1A 1GZ5A 2JEBI 4ERXA 4L28A 4QLBA 4KKXB 4HEA1 1MOPA 3CNNA 1E1CB 4TTPA 4BFTA 3QKUA 1YACA 2W42A 4MK4A 2JGRA 1SU6A 2QQ0A 2UXDL 3A9VA 4A3FB 2NACA 3EG9A 3VPXA 1QRTA 2B4AA 5CEFA 3OIPA 2DJFC 2AX4A 5K0GA 3VC1A 1EBFA 1ZL2A 4RA9B 5CMLA 4ETNA 3TTTA 5K0LA 4P0TA 1SOMA 3U44B 4RD0A 2MCFA 1NF3A 4MWOA 1V1PB 3TE7A 5DM63 3EGOA 1BDMA 4CQLA 4GD3Q 3UY4A 4HNSA 1RI1A 3HP1A 1PTOB 1G9XA 3P5SA 4ASUA 3UHPA 3TI9A 1BH2A 1IZ9A 3FTNA 1S2GA 2AMJA 3H09A 4OSEA 3ICWA 4LNQA 4JOQA 5HA5A 3VHRA 3ZYCA 3V8NA 1MIOB 3HOXB 2Y1CA 4UKDA 3WWZA 4W9RA 2CUKA 4O1MA 4XIGS 4RW0A 5ALYA 1UODA 1MO3A 5K0FA 2BN4A 2X1LA 5DMHA 1T0JB 2WP0A 3GF4A 1T10A 4AULA 1ZD1A 5JAQA 3UJ7A 2QTLA 5B7PA 1CCWA 4N5DA 4YUXA 3T5TA 1KSHA 1YQQA 3V1TC 2BRUA 3Q0TA 3C0KA 3EVQA 3CUEF 1H3FA 1SR8A 4YS6A 4IIFA 5B2EA 2REBA 1C9DB 2ENWA 3B53X 1G6HA 4C4ZA 1QH0A 2E1PA 4AMGA 4TL6A 3EZ7A 4F21A 4YCNA 3FGOA 3V4ZA 4N65A 4JK3A 3U2QA 5J4YA 2GASA 3N74A 1E92A 3GLKA 4YMWA 4ITVA 1X38A 4MUKA 2J0EA 4RDIA 4UARA 4YJKA 4OQDA 4B74A 1NYQA 1Q50A 2IK8A 2V7TA 1A2BA 4CF3A 4HWRA 1SYBA 2R92H 4M1UB 1KKUA 4YBZA 2DOKA 4X64B 1P1KA 3I01A 1ILWA 1IATA 2HV9A 1J70A 3GB9A 2CCZA 4MB0A 1NKTA 4JU8A 2WKPA 3DTYA 3DBLA 2XMCA 1JYFA 1V7PC 1C4KA 5FTKA 4FYIA 5EGTA 5L53A 3IOMA 2NSDA 1IBLQ 5BN5B 3TMYA 1GPAA 4NDZA 1TQ2A 1KP2A 3TNFA 2H4HA 4K03A 3ROQA 2NVQB 2O0MA 4NKRA 3MYRA 5KQMA 3IAYA 3X1ZA 4MQMA 2II6A 1E66A 2Q50A 3PSAA 4LMQD 4DV0L 2XRYA 5E1DA 2FMMA 2C5GA 1QHHB 8ADHA 3P9NA 1X7XB 1KA9H 3U3ZA 3OX4A 2GN9A 3U4ZA 1D9XA 4KQCA 2CV2A 1GUBA 1KMCA 5JBIA 2R86A 2Q2OA 5ALLA 1HJPA 2VJMB 2JA6B 3ZE6A 4N8FA 3NKVA 5ISMA 4BV9A 1B3RA 5JEAH 3AEVA 1OI4A 4LHYA 3VU3A 3QELB 3ASYA 3KAQA 3AF1A 1RRMA 3CVOA 3M6AA 4BP9A 1W0KA 4FN5A 3Q40A 4PSDA 3Q8DA 4YWHA 1PVDA 1LUZA 3PEFA 4P83A 1AGRA 1D8AA 2JCVA 1X2BA 1OX6A 2DUJA 1TQ4A 4IPHA 4FW8A 4KREA 3Q10A 5FA6A 2AEEA 5HIJA 2R751 4JLAA 1DRJA 4RKFA 3O84A 1MVOA 3R7AA 5JHGB 3C6QA 3R09A 3BG5A 4N3AA 1UM9B 3RWMB 1PIWA 3RVNA 1CZGA 4U2DA 3VDQA 4R05A 4E94A 2HSGA 2ZRGA 2J31A 1T3HA 4ZALA 1TVKB 5HRCA 4HV4A 1F60A 2KMLA 1W49A 3BXOA 5JPIA 3EXAA 3H5LA 4X7RA 4D57A 2HR1A 1F9RA 2BMAA 1E1TA 3X0DA 2C8KA 2QMHA 1QQBA 4C0WA 1A9RA 1F9AA 3MBKA 1VKZA 4MVCA 1JHRA 2DRIA 4HXGA 5I7AA 3N58A 1BS1A 1KYIA 3VBCA 3PRKE 3F1ZA 5CT8A 1M1YE 2ZBFA 3UK2A 4ALJA 1J5EB 5IN5A 2ANBA 2CHEA 3F67A 3HSKA 4TMXA 1UMBB 3DTTA 3FNQA 3RS4A 1IL8A 3CRQA 1SU4A 4FJ1A 3RC1A 2JVKA 3H8SA 2ZSJA 2A9RA 4XTRA 3AZQA 3LY5A 1MENA 4PANA 1A3TA 3L6CA 4LW1A 5F51A 1U0SY 1SKBA 3VAAA 3WJ2A 4AZTA 4OQMA 5TMDA 1GYPA 4A0SA 4U7PB 2QDBA 5DHQA 3NHWA 4LYJA 1SVLA 1E1KA 1BFDA 4CLXA 1RLUA 1YSCA 4INZA 3HR8A 4ZZ0A 2PYZA 1RHUA 1VPTA 3C3BA 1SCUB 3EOAI 3OHXC 3FOWA 4YR9A 1L2FA 4WKPA 4A3DH 1KDBA 1AKUA 4AJ9A 3NYWA 3NI2A 5TF4A 2PT6A 5ITSA 2VZ8A 1VFNA 3M4PA 4P5DA 3GH3A 4MUYA 1D5WA 4LZLA 1Y5NA 1EFHA 3EGCA 2HO5A 1L3IA 2QDKA 4ENVA 4JASB 3CP0A 3QWFA 3QMPA 1Z56C 3PD0A 4O0LA 4GSYA 2BGRA 1UBFA 2EARA 3UXYA 3S81A 5H16A 4M76B 1E0KA 1NVVQ 1D4FA 4DJDC 2XNDD 2WM8A 3A9UA 3W8EA 1NW6A 1RAGA 3EPLA 4FGZA 2WF5A 1QGYA 1I4RA 1O94C 2ENBA 1QZXA 1MT3A 4LCBA 3RUPA 5IKEA 3IALA 2GBPA 4NDAA 4IFDJ 5IYZF 3OPOA 3UG7A 1L4YA 3W77A 5JSFA 3L8HA 3PL5A 4ZOLB 3VR3A 4ZEXA 2C7BA 2RGDA 1XWIA 4LFCL 2BJHA 3DPIA 2ZVQX 3CB4A 1CUYA 2P2LA 5F52A 1H8EA 4LTMA 4L78A 1ZNWA 3SZUA 1GN9A 5EJMA 3LMKA 1E1CA 1EFRD 1Y81A 2EFEB 5IS2A 1HGXA 1PJBA 1HKHA 2XKKA 3AEXA 1MSGA 4K1XA 4F8MA 2A68C 3H2YA 2RHJA 3HFGA 2IUTA 4NYIR 4KFCA 5CXSA 4RA9A 4C4PA 3ZY3A 3WIDA 1I3KA 2FF5A 5AD1A 1EHYA 3B3GA 3U44A 3KJOA 1GQFA 4D4LA 2WBLC 4IIJF 1A3UA 4OXQA 1DBQA 1XHEA 3FW1A 2W7TA 3Q87B 1V1PA 3VQTA 4DMLA 1DX6A 2IV2X 3NM4A 2J9ZB 3AB8A 5ALWA 2GF2A 2QJWA 3JVVA 4B0OA 3WOVA 4JYZA 5IP9H 1O0SA 1O94D 1DX9A 2AQHA 4K8JA 3ZV5A 1KWKA 1PT6A 1UBOS 1PHRA 4M0FA 1V9SA 4UUMA 3D6WA 4YQEA 1NN1A 1P2BA 1MIOA 1QR2A 2GJAA 3HN6A 1E63A 3JQBA 1BYUA 1Q7GA 5AW6A 4I1VA 3K9BA 1JHMA 4WJLA 2JEZA 4XDZA 1D2GA 5ALFA 1O4WA 4PG4A 3TTVA 4L7QA 1QNFA 2Y92A 5B1YA 4H6VA 5JNTA 1EE2A 4N7JA 5CV4A 4D9NA 2TYSB 3ZY6A 1G3MA 4XQEA 3K0CA 1RJGA 5KC8A 4KR2A 4MTCA 2WTBA 2RCFA 4CHTB 2QLNA 4RPHA 1XA3A 4AL4A 1D2MA 1QSGA 4CN8A 1SBHA 2W22A 3BGVA 3PFHA 5AHXA 1PTKA 5M2QA 4DKJA 5CB6A 4C3IB 4BFUA 4X5OA 4EVIA 4IIYA 2K52A 4XIJA 3RT7A 1SYGA 2NSLA 4G8CA 3CC2A 4UFPA 2QM0A 2VOEA 1GOZA 3OTIA 1T6XA 2LCFA 4KCGA 4B40A 2WF6A 3SMVA 2VDKB 2BC9A 2NV6A 4GP6A 4RO0A 3B5IA 2I67A 2Z8XA 5AKHA 5FOQA 3TB6A 2X2EA 4TT3A 2WP8J 1VQFA 1MORA 1XZMA 4GG1A 1U4LA 2HIHA 3GVHA 1CK4A 4TZ6A 3A9WA 2I4NA 1X8LA 1K97A 1I3NA 2ZIXB 1GAWA 2PYIA 3I72A 4QVKA 1JC7A 5AICA 1IJEA 2D1TA 4FQ5A 4LXYA 2H4ZA 1PGJA 5BN5A 2Q9UA 1IY9A 2JDIA 2YR0A 4YALA 1Q21A 3VV2A 3EZXA 3HYLA 4FUTA 1YVPA 1GCAA 3P8ZA 5KU1A 3MBOA 1E2GA 2SKDA 1MAVA 1QHHA 2NZJA 4H4DA 3A6KA 4BRUA 3DHYA 5FFMA 4DA9A 2TMYA 3BD6A 3NIBA 3UMRA 1E9VA 5A2GA 3OZCA 2VJMA 3C5CA 4MNOA 5DXAA 4B7CA 2F8TA 2A0UA 1P0FA 5JS1A 4WFJA 3VPHA 2WMNB 4B9XA 3FNEA 1RTOA 2NMVA 2PIAA 2PZFA 4DADA 4F1JA 3QELA 3FVWA 1FFXB 3IIJA 2Q6KA 3S2HB 1CY0A 3OZGA 2GVNA 1WPXA 4GDFA 3G0HA 2BISA 4TTIA 3E5NA 1EG2A 3TZEA 1Z4OA 4D2IA 3HDYA 4NZOA 1Y6QA 3ZHRA 2H07A 2QR2A 2PH1A 1EIFA 1CB7A 2HK7A 4V2UA 4YJHB 5MHTA 2BFCB 5TB5A 1CUSA 4GZYC 5AT1A 4JGBA 1X1DA 3QVLA 3IDZA 1XXHE 5JCOA 4LPKA 2NAPA 2DUDA 5FOXA 3UK6A 1EGVB 3QYPA 1UM9A 3CUWA 5L7YA 3S2IA 2ID7A 4DA8A 3TOSA 1RYHA 2FSSA 1K5DA 1ZYRC 2FXIA 1L5OA 1TAQA 1U1IA 3WK8A 1TVKA 4Q3NA 2ZZKA 2ZTSA 2W4QA 1JTFA 2H00A 2OFPA 3TH5A 5JZMA 3JZAA 1A1VA 1ZW1A 3VH1A 4HLQB 4X66L 4Q1CA 4YFVA 1JR2A 3M34A 4NEGA 1LQ2A 3I4OA 1SBNE 4RWEA 1R0ZA 1Z34A 1G7SA 4L9WA 3K0KA 5HM8A 2GCIA 3OW2A 4HH4A 3ZCXA 3ELBA 2YYAA 5AHWA 2WJ6A 5AIAA 4TGLA 3DE6X 5F2EA 2F9LA 2BTOA 5CDHA 2HTEA 1UMBA 3BL6A 2KE5A 2PSJA 4AKHA 3CZQA 1QDEA 2XUHA 4I9NA 4Z3OA 2J45A 3N2ZB 3OG9A 5KRUA 3W7BA 4HNHA 4LDNA 3CEHA 4HX5A 3USES 4M1TA 2Q27A 3IKVA 3BA1A 2WU3A 4GMKA 4MRRA 3J7ZC 1PWEA 2PZAA 1ISHA 3TZBA 3K6JA 4EHKA 1ZYRD 1U9IA 1YJXA 2HU8A 5FKJA 5IK2A 1T24A 5KOYA 5T6BA 5BR1A 1TK2A 3OCWA 1SCUA 2EKDA 1ASYA 4AP5A 4QU9A 4O1NA 1QRSA 2JP1A 1PBTA 1ESCA 3EQLC 1PNQA 2IC5A 2B61A 5C5MA 3KSDO 4BGEA 4F2DA 4KXQA 1UBLS 2MJLA 3RIYA 3K20A 2RDHA 2ALJA 1FD7D 2LV8A 1YRBA 4ZRDA 4F5DA 2ZFUA 3KTOA 2CJPA 1THMA 4GQBA 3HZRA 3I8ZA 5E7IA 3FF1A 1WXFA 3PUZA 2TRSB 1JKFA 3NBZC 4JBJA 4CQMB 1F77A 1IQPA 4MVJA 2YOFA 1AK9A 5FL3A 1RRGA 2VRCA 4CV0A 4KQ6A 4RVUA 2OKCA 3D2LA 5AKYA 2GZRA 3R44A 2IHJA 2CHBD 5H68A 4HQNA 3T7AA 2FPRA 3U3JA 3RE1A 3RSCA 3H4MA 2EYMA 3KJIA 3CINA 5K99A 2V4ZA 3JWPA 1GIAA 3QPVA 3KHTA 1FFAA 2RKSA 4A3LH 3FDXA 3SBXA 4FILA 5KYNA 1QBKC 4XCVA 2HXSA 4ZOLA 4XR9A 3EGEA 3E4DA 1KYWA 3AKEA 4DLTA 1EUJA 5FORA 4F87A 2JI4A 4BFVA 3C74A 3OLWA 5K5EA 4MV0A 5E7MA 2WG2A 2ZYWX 3IAM6 2H0RA 2HV8A 1QXSA 1NL3A 1NULA 1CERA 5F5NA 4JLMA 1K88A 4YNBA 1XRRA 2GBCA 3S2YA 4MPPA 1FUKA 3GGGA 1UC4B 5KCMA 4CETA 1VCIA 2GILA 3QTBA 3S5UA 1KXZA 4XQ0A 2OQ2A 5CYOA 4LF6Q 2L9HA 5IAEA 2RH5A 5EJEA 5J22A 2PNRC 4ZOAA 2LW7A 4LMRA 4OXYA 3PSHA 5KSPA 4H60A