2YYZA

Crystal structure of sugar abc transporter, atp-binding protein
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
358
structure length
358
Chain Sequence
PSIRVVNLKKYFGKVKAVDGVSFEVKDGEFVALLGPSGCGKTTTLLMLAGIYKPTSGEIYFDDVLVNDIPPKYREVGMVFQNYALYPHMTVFENIAFPLRARRISKDEVEKRVVEIARKLLIDNLLDRKPTQLSGGQQQRVALARALVKQPKVLLFDEPLSNLDANLRMIMRAEIKHLQQELGITSVYVTHDQAEAMTMASRIAVFNQGKLVQYGTPDEVYDSPKNMFVASFIGNPPTNFLRDFSVSVENKQTILKRDDVIIKLPEPVDVKLKEVVVGIRPEHCRISRERVENSIPGVVYVVEPLGRDIIVNVKTEKGEIIKVFGDTGKAPQPGENVFLVPDLRKIHLFNPETEETIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sugar ABC transporter, ATP-binding protein
publication title Crystal structure of Sugar ABC transporter, ATP-binding protein
rcsb
source organism Thermotoga maritima
molecule tags Transport protein
total genus 88
structure length 358
sequence length 358
ec nomenclature
pdb deposition date 2007-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF08402 TOBE_2 TOBE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2yyzA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2yyzA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2yyzA01
4C2TA 4F4JA 1GZSA 1DVRA 3NH6A 2ZJAA 3QVVA 1MRSA 2C03A 3I73A 1OTCA 1E2PA 4LFCQ 1H9SA 2GAOA 4DR6Q 2V54A 4PHHA 1XJQA 1LW7A 4BFYA 1P2VA 1WQ1R 3TE6A 1G5TA 1AZTA 4LUVA 4P4TA 5FI0B 2QTVB 4IOKA 3KDSE 2VPPA 3CRQA 4YMTA 3U61B 1B9MA 2A5FA 2DY1A 4L15A 2G1KA 4IOLA 1GFIA 3GJ4A 1FMJA 5IT5A 1IJFA 5TDHA 3RRYA 4A0HA 4A3KG 1VG0B 4NXNL 3A1WA 1OB2A 1YITA 4AQYL 3ETLA 2CFMA 3VR2A 2UUCL 2W6ID 1G6PA 3ULJA 1HCZA 2QSZA 1GJXA 1UBFA 2WSSA 3LQQA 2VHCA 2BCJQ 5AUNB 3WP0A 1E0SA 3CCUA 2KHIA 3IILA 1F60A 3W5JA 5CIQA 1KDTA 1XTRA 1RPZA 2F9LA 5L3QB 2FZ4A 2QEXA 2VY3A 3B82A 2I5LX 4PC7A 3TRFA 4BFXA 3FHCB 3FMCA 1FMLA 2GJAA 3IO3A 1A0IA 3I7FA 3OEHA 4DSNA 3HOWH 3DO6A 5LMUL 2ZSDA 1S72A 1IHUA 1OSNA 1SLJA 2B21A 1N32Q 5BWMA 2GCOA 1W0KD 2H92A 4PZYA 5JRZA 5BR8Q 1EFRD 1JXMA 3AVUA 1CRQA 3I4LA 1TPZA 1PH7A 2GF0A 4RZUA 2XTIA 2RGDA 5H8WA 3HOZG 1CU1A 3EZ2A 4PZ8A 1XCMA 3PV0A 1HNWQ 4GLAC 1XTQA 1BYUA 3CRKC 5LBIA 3KJEA 4IXMA 1YZGA 2QQEA 2O8CA 2B8WA 2ZJRA 3K1JA 3RWMB 2WMOB 4PC3A 2FG5A 3T1VA 3VQTA 1Q44A 2ZJ2A 4FXPA 1X3FA 1YR6A 2F9MA 2ANBA 2QBYB 2R62A 3TAUA 3IQXA 1JBKA 3QIAA 1KK1A 2IK8A 1GVPA 4ALPA 4R4IA 2O0KA 3H3VI 2CWPA 2WWYA 4JI1L 1X54A 4U02A 4TKOB 1OFHA 2NO0A 3R9XA 4ZIRB 1IN8A 2FPMA 1XTIA 2BMDA 3L0IB 3W5OA 1Z47A 1GM5A 2P5TB 3WHLA 3ZS8A 3A1UA 2YTVA 4JI6Q 1M8PA 2C5LA 5D3MA 2OE2A 1E69A 3F8TA 4KLZA 3CIOA 1PH6A 4B3FX 1ZINA 3BH0A 4NU0A 3KF6B 2KWIA 4ZPXA 3CW2C 2H7VA 3WBJA 1OFUX 5JWHA 1S3GA 4RD6A 1MABA 1R0YA 3TIFA 2PZEA 1TUIA 2QM8A 1VQMA 3NTUA 4C9BA 2IEYA 5TARA 1PMRA 4LBVA 4DV0L 4Q9JA 1Y1WG 2BEJA 1GG2A 5HKKA 1IBRA 3EX7C 1LS6A 3BH6A 4BBRH 3ZH9B 1BIFA 1GILA 2PL3A 4IJMA 4NKRA 3DOFA 4OQFA 4ZCLA 2WWFA 2PJZA 521PA 5A5GA 3T1TA 5EE3A 2QPAA 3RNUA 1CJVC 4EJSB 2KBNA 4BLRA 3U2QA 4BA1I 1RRFA 4LYJA 1EIFA 4B3XA 3SJAA 1IYUA 3QENA 4DDVA 2V1UA 2OXCA 1FR3A 1Q3HA 1RJ9A 2D2EA 3VNVA 3AB3A 4JL6A 1JE5A 1GL9B 2WJIA 2ZRNA 5CK5A 5E7JA 2JXMB 4R1JA 1OXVA 2EFHB 2GCNA 2AN9A 1Q8KA 3C7KA 3DM5A 621PA 6Q21A 2EJFC 4PSAA 1MIUA 2AK3A 3WNBA 3A74A 3OZXA 2FPKA 1ZAKA 4LJ4A 3ZZUA 4B74A 2ZRKA 3Q5DA 1GUAA 4M4SA 4Z8YA 3U7GA 2IHYA 1PFSA 1JQLB 4RCYA 3U4QA 3NHBA 4Q7LA 2O8BB 1KO5A 4L5QA 1UADA 1DAGA 1KAGA 2QY9A 4XSHA 4YCWA 4JV5L 3VA7A 1II8A 4K46A 1IY2A 121PA 3TSWA 4EJSC 3PIPA 1N6PA 3W9YA 3QPWA 2PPBC 5H1SE 3A7AB 2DWPA 4DK3C 5B57C 1N5KA 1NMYA 3ZYCA 2REXB 3MJRA 4QGAA 2B29A 4YMWA 4QJ4A 3CF5A 3Q7PA 1EWRA 2Z83A 2OBMA 1UDXA 4HIKA 1D6JA 4BY1G 3IIKA 1DO2A 1JPJA 1HNZQ 4A3IG 2EFGA 2JLQA 2WWWA 3VTKA 4D82A 1N6RA 1YHNA 2VBCA 3O8CA 4IFBA 4TMXA 2DGYA 3UDXA 2H1LA 3IO5A 1N34L 4Q66C 5DHFA 3AF3A 4NONA 3SFZA 3IIMA 4TL8A 3JVVA 4PXAA 2A68C 3GTOH 1VQ4A 1I6HH 1T0HB 2OFOA 4NYJR 5CJ2A 5HGQA 4W5HA 2PX3A 1F2TB 4XWKA 2E74C 3ADDA 3IHWA 4X64Q 4B32A 1JJVA 1ZUNB 2MMCA 1VF7A 4O0MA 1FOEB 4MGYR 5JS8A 2D0PA 4KFRA 4US1R 2HEIA 2OTLA 2UUAL 4B3DA 2O5IC 1RIPA 4QC2A 1OKKD 1II9A 3JAMi 3KLRA 1TEXA 3SEAA 3QXJA 1GNRA 4PAQA 4G3XA 4OO1I 2C99A 3D8BA 2RHMA 5M5YH 4OBEA 4X6AH 2RHQB 1JJGA 3FMPB 3PO2H 4JSTA 4NTZA 1JAIA 2D7DA 4TL7A 2CE7A 2W58A 5LB4A 2F43A 4EDHA 2BJWA 5FUXA 2IYVA 3KFXA 2WB1E 1XJVA 2GBLC 3LRPA 3OF5A 2DWQA 3L8YA 4LF9L 4PHGA 1MO6A 2A7QA 3T12A 2MSEB 5C1BA 1UE1A 4DV7L 1EG7A 4LF7L 1OT3A 1OXSC 1P2TA 4QIWE 1VG1A 4PO8A 4UJ3A 1UKZA 1TF7A 4NPHA 3ASYA 3CCMA 1VQNA 5EXXA 1KSJA 4OWWB 1I6VC 1YU9A 5K8UA 1FTSA 3OIYA 4HUTA 2LXJA 2Y0SE 1Q86C 4OQMA 1S9HA 2P65A 4HIOA 3GTGH 1EFUA 1Q81C 4FIDA 3HU2A 5JEAJ 1KY3A 3VR6A 2HYDA 3MWJA 5FOSA 2CHGA 1IW7D 2QPTA 2O8FA 1GUNA 1TAGA 3CRLC 1A63A 2ZI9A 5C3EH 1P9WA 1IBMQ 4BLOA 4EQ6B 4Q9HA 3U7HB 2XXAA 4B6FA 3CRW1 4HZUA 4OI4A 2XITA 4QRHA 1C4OA 3M3YH 5FR1A 4QOSA 3QY0A 3AGPA 1XMQQ 4RMFA 1NSTA 4JVLA 4TMWA 2JA5H 2WAQE 4V02A 1K8MA 2Q0HA 1UFQA 4HATA 4OJQA 1XBTA 4Z1MA 1DOAA 4A2QA 1HTWA 2XNDA 3R8FA 2Q2HA 4Q1EA 3TW4A 3LBNA 1SXJC 1N5IA 1HTPA 1EOVA 4HEJA 4HB0A 3M7NA 2VF7A 1KOFA 2ZIAA 2CCKA 4NL4H 3LW8A 3TQFA 3E9HA 2BDTA 3GJ8A 5JEAH 3MJHA 5C4GB 1B23P 1G51A 1AS3A 4P33A 4LNQA 1ZD1A 2V1XA 1GUTA 4G5QA 2PZGA 4QKQA 5K8TA 5FPSA 4P74A 3U6KA 1JR3E 3OFNA 4DV6L 2R7ZH 1YKSA 2IXEA 2QAJA 2GZHA 2ZYUX 3PITA 1E22A 4LFCL 1XNQQ 1IOZA 5AR1A 4DR6L 1D9XA 2VP9A 1NRJB 3AUYA 3SJZA 4GOXA 5CJPA 2HUPA 2WAYA 1JECA 1KDRA 5B2ZA 4NB3A 4P71A 4OXPA 4HJAA 4A3DH 2Z4RA 1PH9A 4YDSA 2ZRCA 4QXAA 4Q7KA 2V8OA 2ANCA 4P4UA 1Z6GA 1S4QA 3DEFA 4JT2A 5FPTA 5HPYB 2WSSD 1BKDR 1AGRA 2ODBA 4UNSA 2C9OA 2KI5A 5DN6A 2OESA 2BE5C 2FGKA 2YTXA 4M8NE 1K9MC 1E1OA 3BK7A 1G16A 2AD5A 4RSGA 3RDPA 1EQRA 3SS8A 3ND9A 2ZYTX 1W4AA 4TSFA 1KSGA 1IN5A 2N78A 1II0A 1XD9A 4JC0A 2NVXH 4XVQA 1ONLA 2YTYA 1W4CA 5AJXA 1NN5A 4KKSA 1ETUA 4IRUB 3T35A 3THXB 3S1AB 4DUYQ 2H57A 4GP6A 5FUWA 3ND8A 4DT1A 3RC3A 1SXJA 3KDFB 3GEHA 3MWLA 4JMPA 1IQPA 1FUKA 2CCJA 2QT0A 1LVGA 4GRAA 1KI1A 2H5XA 2C2HA 4HAZA 1LF0A 2QAGB 4JI2Q 1N32L 4M2LA 5BR8L 2NVYH 1PLKA 2GZDA 4QJFA 3T1HQ 4BBSG 1VQPA 4RJLA 4QJ3A 3H94A 1HNWL 3EPLA 1DARA 1KHTA 2RGXA 4HI0E 1Q21A 1XEWX 4WJ3M 1YNJC 2JA9A 3NH9A 1NLYA 1XD8A 4GN5A 1EFWA 2RGEA 4M9XA 3VU9A 2BH8A 3K0XA 3VMFA 2NMVA 2GVAA 1VYVA 5DE3A 1U98A 5JFGA 1E9CA 3U4VA 2HQLA 4PHTA 5FOTA 1OV4A 5IF9A 2YC2C 2QZ4A 3EZFA 4ESVA 1U0LA 5G41A 4F7WA 4QHYA 4DVGA 1K8OA 1K8RA 3KOJA 2IS1A 2ERYA 1LF5A 2CLCX 5KDOA 1Y1VH 3W1BA 4JI6L 3G71A 4QQBX 1NIPA 2GDJA 2YOHA 1GITA 4QBFA 1NLFA 3Q85A 1ZJ6A 2ZROA 4BEJA 1L4YA 1NNEA 3M4OH 1YZNA 5HKKD 1ZRHA 4LV5B 2VNUD 2I4IA 1FNNA 4MQBA 2XNSA 4B3CA 2VL6A 2B8FA 3R9IA 1IN4A 1CR2A 1PH5A 1L2TA 1X8LA 2WKPA 3NBZC 2N42A 4ARZB 2UXDQ 1EXMA 2VP0A 3RC8A 4M53A 4WBSA 4Q5IA 4Q4AA 2PJRA 2REOA 3HR8A 2PEZA 3A8TA 4JLKA 5C18A 2PMDA 1X3SA 2ATWA 3SJCA 4C3JH 5M04A 4O0AA 5CM9C 1Y63A 3RVBA 1CF4A 1NVXQ 4LHWA 1MJEA 3J81j 2JE6I 1P60A 1GO3E 3RABA 1U5KA 3THWA 1NMZA 2IYTA 2OCAA 3BGWA 4A3FH 1ZM3A 1XTKA 1YE8A 2X1VA 3HOUG 1Z6TA 4W9MC 1QG4A 1I3QH 4PR0A 1KY2A 3THOA 2J45A 2R93H 2ZSEA 2V7QD 3FTQA 4LHZA 1EWHA 4BZXA 4JLNA 1J7KA 1L1OC 1MO5A 4LRWA 2AR7A 3UMFA 4JLPA 4PPNA 3LV8A 1KI7A 3TJZA 3CCEA 2C9YA 4AURA 3QSYA 2NZHA 1KO8A 2LSSA 1N6KA 1X1SA 3BS4A 4HIDA 3AVVA 2B8TA 3QPUA 2QI9C 4U00A 5L3RA 1OB5A 1G291 4JBWA 4V0NA 2ZAMA 5FFMA 1G6HA 4AIIA 2ZTDA 3K7UC 1NMFA 1XMSA 4DCSA 4LHYA 3EZ9A 4DLTA 5TVKA 3TUZC 1XNRQ 3I32A 5IYDG 3DMNA 2QMUA 3FMIA 2AMCB 4Q18A 1SROA 4A2PA 5JCZA 4D4KA 4IVPA 3ZZ0A 1XMIA 4Q48A 5CK4A 1HNZL 2AKAB 4LHVA 4JCVE 4O2LA 2ZEJA 3D4RA 1E0KA 3K9LA 2PZFA 2OBNA 4KVGA 4ZV4A 4QFMA 3WBKA 5FPHA 3C15C 4C0KA 1P16A 1OHHA 4Q9IA 5HTKA 3VKGA 4ACBA 2WVJA 3CX7A 5CITA 5JECA 3IPXA 1NY5A 2YWHA 4H02A 3CONA 3T06B 5GADC 2R92H 2UVQA 2KSQA 1H9RA 3K0SA 2RGNA 4IW3B 3NEJA 2V3CC 1W44A 3RS3A 2GRJA 2XAUA 1IY0A 4KN7C 4BFVA 4X64L 3NC0C 5ELXA 1HT2E 2IYSA 1Z6XA 1L1OA 1TWGH 3EIHA 5KO2A 4IFDG 3Q8DA 1R0XA 2FFHA 2PLFA 2O5VA 3EA0A 3QXCA 1UPTA 2VP4A 4APVA 1E2JA 1HQCA 2HJVA 2BBWA 3MG9A 1GVNB 1RRPA 1ZD8A 1GUSA 3P4XA 3P1JA 1E79A 4UKDA 2DUDA 3EBEA 4PG3A 4U5XA 4ABYA 4ASUD 1QHYA 3TAHA 4LC0A 3AVXA 1UBEA 4LK1C 2GJSA 1R0WA 5M5WH 1EGAA 4A8JB 1E2QA 2ZJ5A 1EWQA 3QUSA 3L7ZC 1ASZA 2B8GA 5EXTA 5H70A 1XF9A 3OAAD 1S0UA 2OEPA 3A37A 2QGNA 1Z22A 2C9CA 2R6CA 3UK6A 4IVQA 3U6BA 1E2ZA 5EQTA 4LJZC 3LX5A 1SXJE 1VF5C 1X3EA 4AKEA 3LBHA 3I8XA 4JI5Q 1AK2A 4K81B 4AD8A 1VQ7A 1ZIPA 1N5JA 1TU2B 4JL8A 2ZI3A 1KRSA 4URVR 1WYDA 2R6FA 2IUTA 5GJCA 1H8HA 1UM8A 2C98A 4D6PA 1P62B 2YNMA 1R5OA 1IBML 2RHDA 5M3MH 2AKYA 4KAXA 5F9HA 4XD7D 3IBYA 3B13B 3ICQB 1G41A 3X1WA 1XB2A 1XMQL 2XSZA 3AP2A 1G20E 2KA7A 1GP2A 1VQAA 1L8QA 3NBFA 4OWXB 1CJTC 1EFHA 1S1MA 4KFTA 4RFSA 3EIVA 4JZKA 4A8JC 4DWJA 2IT1A 1RKBA 1QHXA 1Q82C 3KB1A 2GZAA 4CEJA 2ECKA 3REFA 2AWNA 4GL2A 2WFWA 2DNEA 3RLNA 1PJRA 1T3HA 4UQOA 5FTMA 5CB6A 2PLRA 2X77A 4HUQA 4V0OA 2AFIE 4F38A 2O8DA 2OQ0A 4BXXH 1GAJA 4M1SA 4D81A 3FHOA 3BWDD 4B35A 2GJKA 3QF4B 3NXSA 4TZ0A 4NCKA 5J5CA 3WYGA 1W4RA 2F3TA 4EKDA 4KKTA 4PPGA 2Q2UA 3L43A 3FKSA 4A76A 4EPRA 2B7CA 1YJNA 2FSFA 1WA5A 2JCSA 5DN6D 2CVHA 1V8QA 2RGAA 2UZ3A 3M0EA 3F1ZA 5HZKA 2O8EA 4NYJQ 3IFTA 4A15A 3U5ZB 3E9IA 3L82B 4A3MG 3VR5A 4TSFD 4DR2Q 8OHMA 4C0SA 3BOSA 3LDAA 3QXHA 5EP2A 2F52A 5SZIA 4MYUA 5EZ5A 1S2MA 1COWD 4KLKA 4TLAA 1VQDA 3DKPA 4LJAA 2KENA 2ZJ8A 2FFBA 2ZRIA 2WJYA 3BB4A 1XU4A 2RB4A 3U58A 3J80c 3PEVA 4GN3B 4TYPA 1EQQA 4A82A 1PYBA 3CCVA 4DUYL 5L3SA 1TTTA 2OAQ1 1OXUA 1BH2A 2J41A 2CNWD 4D4LA 1DG1G 4PC2A 1E24A 3SGIA 2JA6H 2A30A 2R6AA 3H2YA 5KNDA 1W2HA 2AUKA 3DHWC 2IX3A 5J4YA 5A4JA 3DMDA 3KKMA 2IYUA 4GMDA 5GJVC 1FNMA 4PX9A 3C5CA 3PENA 5EP3A 2UZIR 5KNBA 1ZM4A 5IP7H 2G6BA 2RAPA 3E1SA 1XCPA 3LD9A 2C77A 1V1QA 4W5WA 1ZIOA 2ZJZA 2J3EA 2NPIA 4LPKA 3K70D 4U7DA 2YKGA 2MSDB 2E5LQ 4LUOA 1AH9A 3EZ7A 2ZM6Q 4JJKA 1QZXA 3PIRA 2QGZA 3TMKA 3KQUA 1WCMH 2XEXA 1QHGA 4MUBA 2ZI4A 3FMFA 3AVWA 4A3JG 2VLIA 4EPTA 1WMSA 2IF2A 4NXMQ 4P75A 4FCTA 3B1ZA 3BFXA 4GLVB 1HR0Q 1CI3M 1D2NA 3PJRA 1OYYA 1XTJA 4JVNA 2GAAA 2NN6H 2EQBA 3U60B 1P3JA 2AHOB 4GN4B 3I5XA 2LXKA 2OLJA 1YQTA 1NY6A 3JZMA 4OJKA 4A1FA 4DLXA 1W2BA 1DG3A 3B1YA 2XX3A 1E9RA 1TWCH 3EWSA 1PZNA 4BA2I 2BDOA 1QRAA 2ZU6A 3DDCA 1G3QA 4FMCB 2CL0X 4V0MA 3ZS9A 5C44H 3EA5A 4IPHA 1G19A 5E4FA 2HV8A 3CH4B 4PQFA 2VP2A 4OK6A 5H1YA 3BERA 5M3FH 2A69D 1ZNYA 4A3EG 4HLDA 4F91B 2JAQA 1N25A 1GTVA 3QNUA 4TMTA 1E2LA 2ZM5A 1SMXA 2UXDL 2NVQH 4YY3Q 4JS0A 1Y8PB 4LBZA 3S1RH 1VQ6A 4IDOA 4LBWA 2BIFA 4MUAA 1AE3A 4DV3Q 5BYJA 3CLVA 2G0NA 4KLNA 1F2UB 5IK2D 1W4BA 1J5EQ 2QUZA 4KITB 3GLIB 3HR7A 4QY7A 1ZKOA 2QP4A 5FOWA 5TY0A 3MWKA 2ZJPA 4UXIA 3AB9A 3WRYC 4M9QA 3K81C 2HF8A 5HCNA 1E94E 2Z6KC 2NZOA 4RZ3A 1QZGA 4KI0A 4QJ5A 1SVIA 3X1DA 1ELOA 1E9SA 4C3ZA 5JJIA 2JDID 4PO1A 1CFMA 4Q01A 3AQ4A 1ZBDA 4TLDA 2DPXA 3W8RA 1IL2A 1X55A 2Q6TA 1EK0A 4QGHA 2IL1A 2GNOA 3CNOA 1G7CA 3HKZE 4ACAA 2BBOA 4BECA 2CL6X 4LK2A 5EUMA 3KYHC 2KCTA 2G88A 1DAFA 3TREA 3RRNA 4BPBA 2JA5G 3RAPR 4DNRB 1WP9A 5BN4A 1WRBA 1BMFA 3KUDA 5LMNQ 4DR7Q 2FSGA 1QHIA 1Z29A 1XWIA 2G1JA 1G8GA 1KRTA 3P4YA 3GJ6A 2VP5A 4ZKEA 4MGKR 4LF8Q 5C4XG 4YDHB 4DR3Q 1W3SA 5JEAG 3GO5A 1D2EA 1XNRL 1NMXA 2QG6A 2X2FA 3AV0B 1OHHD 5E3HA 4JLDA 4WZ6A 5IYCG 5IYBH 2ASBA 2VSXA 2PQAB 1VQJA 2O52A 5HE8A 1CS4C 3CF6R 3KXLA 2PNHA 1HY3A 1YJWA 1FQKA 4L9WA 4AY2A 1P2UA 5KPDA 1R9TH 1RZ3A 2JJ1A 1E32A 2ZREA 1TL7C 1NTGA 4B3SL 2IYLD 1N0UA 5KSPA 1VQLA 2D06A 4OK5A 4PQYA 2CE2X 2Z6KA 4TT3A 5LDDC 1US8A 3KF8B 2REBA 3KFUA 3TS0A 2ODWA 3CRRA 4PMWA 4JI3L 3NENA 1NF3A 3DPUA 4DAMA 1IBKQ 1GNQA 3AFQA 2V55B 4B6EA 3AM1A 1NMGA 3S1QH 4OI2A 4OYHA 4TQAA 2PCFB 4CYMA 2ODEA 1E79D 3QBTA 2FN4A 4LJ8A 5JWOA 1GIAA 5IP9G 3PEWA 2FEOA 2ZXUA 1YRAA 2IC5A 3RNLA 2HDNB 4WXPA 2WZQA 5KSYA 2VHJA 3N2IA 3LBIA 3MD0A 3K0FB 4YHHQ 1OXXK 4GDFA 1VIAA 3J7A5 3HPRA 5JSZB 2KE5A 1HE1C 2J7KA 3MAAC 3BRWD 3BJUA 2EU8A 4Y0AA 4BFTA 2PNRC 4I1OA 4DV5L 1S8FA 3B78A 3DKVA 4TTRA 1QF9A 2GK6A 5SZHB 3WYFA 4MRPA 3ZQ6A 4DBLC 5J4VA 1CXZA 4B73A 3PO3G 3FMOB 3U44B 3UG6A 2O5JC 5BYKA 2W0SA 1DAKA 3OW7A 2VW9A 1H8HD 1KJYA 2BM0A 4FMBB 5DH9A 5KDDA 2ERXA 3GLHA 4D0LB 1VHLA 1YJ9A 3B7GA 4JI5L 1H9KA 2J0UA 3M6AA 3EASA 1QUQB 4H1VA 2D2FA 4MGZR 2B3GA 1E3MA 2XB4A 1KMHB 4KHZA 2ZYVX 2XSZD 4IVRA 5C2JB 2QENA 1T4GA 3I8SA 3CPFA 2QMEA 1EWIA 4HDQB 5TB5A 3SHFA 1RFLA 1Y8NB 4R4CA 2H5EA 3U50C 3KJHA 3VR4A 4MITA 1Z0FA 1BOFA 3T1YQ 1JR3A 2HLDD 4A3GH 4B33A 3PUYA 3PGZA 4P3YA 1UDWA 3SBEA 2GVDC 2EVBA 2EDGA 3NBHB 1CR4A 1QBKC 4GNXB 1TMKA 2FE4A 4MRSA 3GLFE 3L0SA 3OW2A 3FPPA 3A1VA 1PH4A 3PCRB 1I5FA 2FX3A 4Q47A 3FKSD 1IXZA 4F93B 3KLWA 3LWUA 1E4VA 5FL3A 1G3UA 2GXQA 3W90A 2ZJBA 1ZYUA 1GOTA 1N0VC 4FCWA 5CYOA 1TADA 4QBHA 5GAEC 3VHXA 3LXXA 1OPXA 5FR2A 1N6HA 2EYQA 2ZJQA 2VHTA 2ZRGA 1R6BX 1KAWA 1J70A 3A4NA 1FL0A 1VG8A 2CLDX 3B9PA 4ERNA 4AH6A 5GAHC 1NKSA 4YMUA 1R5BA 1T91A 2IYZA 1QVAA 3MXUA 1NN0A 2VL7A 4V0ME 3ZLJA 3TEHB 5JMTA 2B92A 2IWRA 1HURA 2OFWA 5DO9A 3EIEA 3KTAB 1Z83A 2I3BA 4JBMA 4G5GA 4DR2L 2A19A 2YYZA 1KZ7B 1PA6A 1TF2A 2BHRA 4URUR 4YCUA 4GNXC 1U8YA 4N3NA 2CL7X 4P4SB 2HHHQ 1NP6A 2CXXA 4G01B 4JLAA 4UJ5A 1UBGA 5L3QA 2GKSA 4DUZQ 2GA8A 5FJ8H 2QN6A 2ZI5A 1LNZA 4AWXA 4LV8B 4H0LC 1DEKA 3CBQA 4GOPB 2I0QA 1YZQA 4B47A 4UY8C 1YZ6A 2WMNB 5JEDA 4POFA 3NIBA 2AK2A 4WJ4A 1JEDA 2W0MA 3TW8B 4HAUA 1LFDB 1WE2A 3FWYA 4NH0A 3QE0A 1NBME 1YJ5A 3CW2A 4GKJQ 1Q7YC 5B58C 1SRUA 1WDTA 3ERSX 4ON9A 2OCBA 4DCTA 1N6IA 1NIJA 1AJEA 4DSUA 3BFVA 1PV4A 1NVUQ 3OPOA 1SVLA 4LYFA 4DK0A 4A3BG 2QBYA 4BZPA 3GTLH 1KAOA 2CK3A 1LM0A 1Y69U 1T3SA 1JT8A 4Q1DA 3HOXH 4A3LH 1IXSB 3NEMA 2E5LL 1HZAA 1MV5A 4AC9A 4D0GA 4OHWA 4WA7A 1F5NA 4BLTA 1NSFA 4A2WA 2ZM6L 4BY7G 1QHHB 3GJ0A 4K8OA 4ZIRA 4AKHA 4KCGA 2HCJB 3O47A 1ZYRC 5JI2E 4UNNA 2ZJYA 4A6XA 1V5WA 3BBPA 1DGSA 3BC1A 1PYSB 2H8KA 3KKPA 3O8BA 1N6LA 1R5NA 3FPAA 2VQFQ 1OLOA 1U2RA 3UWKA 3KF6A 1IYVA 2A5GA 2W6JA 4XWOA 4AYBE 4B3BA 1VQIA 1Q1EA 4OO1G 4NXML 1D9ZA 1W36B 3LNCA 4G1UC 2IX0A 1HR0L 2NVTH 2GVZC 2ZAOA 2ZRDA 3WXMA 2VZAA 1KDOA 1HT1E 221PA 2X19A 2P3SA 3TGPA 4DR4Q 1UAAA 2BMEA 3K8AA 1E99A 3NBXX 4LGMA 2IBMA 4OK3A 2K7VA 3K7AH 1O3YA 4X8HA 3H0GG 3HOYG 1QZHA 3U3MA 2DBYA 5EXSA 1IM2A 1G4AE 3ASZA 2RHSB 1UKVY 5BW8A 2MSCB 3K0AB 1IAQA 1P6XA 2J1LA 1NE3A 4EJSA 1M74A 1KL9A 2Q3FA 2VF8A 1E0JA 3ZDQA 3AQQA 1UE7A 1KI3A 1Z2CA 3NDPA 1VS0A 3F5FA 1JB7A 1FZQA 5DISB 3K09C 3V4FA 4YY3L 4O25A 5A0FA 4RFVA 1ESMA 2A6EC 5GJBA 4DV3L 3I4MH 2B6HA 2C78A 3UPUA 1JNYA 1YEZA 5EE0A 1J5EL 2XZPA 4A93G 3R8CA 4O2RA 3PQCA 1TQ6A 1GUOA 4IOCA 1AA9A 3LH5A 2R8RA 2PCJA 4P72A 2GF9A 3A1TA 3CF2A 4Q00A 1SVSA 2XB2A 3FKQA 5AK0A 3CF0A 3I4NG 2VUMG 1FX0B 1G3RA 5K8LA 4QM6A 4DLUA 4RCNA 4JKIA 4E07A 1KO4A 2QEQA 4QGUA 1XJCA 4NCNA 3I62A 4A0GA 1R0ZA 3KQNA 5JJKA 1I50H 1BMFD 2GHIA 1E2DA 1E7ZA 3M9BA 2EW1A 3TBKA 4HSEA 3E70C 4CF7A 2VQEQ 2ZE8A 2BKEA 1E2NA 5FLMH 3GLHE 1TWHH 4MGIR 4C2UA 4BE7B 4AG5A 5EJEA 3QI2A 4R71A 4DJTA 2WJHA 2R6GA 4DSTA 1HEIA 5LMNL 3ZJYC 4DR7L 1LB1B 1NL3A 2WP8J 3GTKH 1L7VC 2VTKA 5JCPA 4O3MA 5J3BA 3L8ZA 2OFXA 1GKYA 3U7EB 1AKEA 4A3CH 1AIPA 4ZO4A 4LF8L 2UUBQ 1G21E 4DR3L 3B6YA 3FP9A 1LV7A 1VKJA 3K09A 1VYTA 3ULPA 4PFSA 2JJ1D 4KVAA 2ORWA 4LF5Q 1E2FA 5DNYB 1XXHB 4R4QA 2GBLA 2G83A 2A5DA 2IS4A 4NYMR 3FHWA 1VCIA 1F2TA 2E2JH 5M5XH 1ZM9A 2A9KA 3S17H 1E9DA 1LYLA 2CCGA 3SZRA 5FBQB 2FMXA 2ORVA 2GESA 2V4DA 3TS2A 4A0FA 5FH9A 4KV9A 4C7OB 3SYLA 1KI6B 1G8PA 4ZKDA 1VDZA 1S3OA 2ATXA 1KSHA 1HUQA 2MNAA 3EN2A 4B43A 4CEJB 5GAGC 3HPQA 5KPJA 1IBKL 4QL5A 4ILEA 2IHEA 4CRWB 4EPWA 1A82A 3F3YA 5DI3B 1MOZA 3PSIA 4LI0A 2P6NA 4YXWA 3J81k 3OEHD 4Z51A 2IUUA 2CMKA 1P73A 2NZ8A 4OQNA 2KBFA 4C3HH 1DAEA 1A6XA 3KZ1E 3RSOA 1E96A 3Q8XB 4JBYA 3GLGB 4YHHL 2QP3A 4Q19A 4G5OA 3CPEA 4CEHB 5F9FA 4A3KH 3RRZA 1CULC 4Q4AB 4V0KA 3EPHA 2EFDB 1OH7A 1SVOA 1Z3IX 1W48A 2H17A 2MMGA 3U3OA 3EPJA 3RS4A 2J7PA 3QKRB 4I81A 3CCLA 4BWYA 4LF4Q 4EQ6A 4DB4A 1BO6A 4HJ8A 5J4KA 2Q2IA 5JHHB 1C1YA 5G53C 1QDEA 3KQHA 1J8YF 2YWEA 3KXIA 4UP9A 1GUGA 2ZSFA 1LABA 1AQYA 1E1RA 2J87A 1JALA 2EJMA 2IEZA 1EFCA 2KCCA 1KKLA 2JLRA 2NO9A 3AVPA 3A6PC 1JR3D 1XEXB 4OHYA 2G0TA 3LVRE 2R65A 1WCMG 4HJ9A 1SHKA 2BCGY 5AJWA 1X65A 1I4TD 4D4MA 5K36G 5HR5A 1MR3F 2XOKA 3QEJA 4EPYA 3HOZH 5J4HA 3TQCA 3D3QA 3T1YL 1B9NA 2QAGC 2PCLA 3P32A 4NP6A 3FKIG 1G7RA 3UE0A 2BMFA 3CCRA 4RKFA 3R7WB 2RCNA 4LCBA 1A1VA 2KCMA 3QJYA 5DLQE 2OQKA 3GJ7A 3W6OA 2BEKA 1K0RA 2GCPA 3FE2A 1NG1A 3KJOA 2YV5A 5J40A 5FBVB 2CJWB 3K0CC 3CD6A 1VQHA 1EIYB 3SR0A 5M3FG 2MO0A 4URYR 1H8EA 4WZAE 2FSIA 3UMSA 2WWIA 1YNXA 2N1BA 2VP6A 1Q1QA 3DL0A 2R2AA 3EARA 4IXNA 4M21A 4YQFA 2SHKA 2Q3HA 1LS1A 2NN6I 4OKSA 4EUNA 3LXRA 5IRCD 3UXMA 2WWGA 1ANKA 2QA4A 1R7RA 3SHWA 1E2GA 1FVIA 1ZCBA 2BA0A 1ZC4A 1ZNWA 1IJEA 2D7CA 4TYQA 1Z0AA 1XD2B 3S1AA 3THXA 1KI2A 4IPDA 3VHLB 3CQZH 3BZKA 3V9PA 2HHHL 3G0HA 1UEBA 3KDFA 3QKUA 2VS1A 2Z0SA 2JA7H 4DUZL 3B8HA 3W6NA 4BUJA 1N6NA 1HPCA 2BKUA 3IUYA 4CZ2A 4TMVA 1VCMA 1GL7A 4WW0A 3AVOA 4PAOA 1C9OA 4PTLA 4URXR 4PC1A 3TKLA 3TSZA 2QAGA 4CDGA 2ZRHA 1BDOA 2ASEA 1WCV1 4A4DA 1M7HA 4AG6A 2QL6A 3ER0A 4X65Q 1D8LA 4CVNA 2AKWB 4J15A 2J0SA 3KUCA 4XOIA 3SE0A 4GZYC 1KK2A 1W46A 4IEEA 1L2FA 1MRNA 1VHTA 2FJUA 3VDYA 2UXBQ 2GVBA 1FQJA 4GKJL 1VMAA 1SVKA 2RH5A 2RGCA 2CK3D 2PBRA 4Q4JB 3VFDA 4B44A 3WHKA 2QGQA 4R4OA 2PI2A 3RLOA 1M34E 4P0TA 4V03A 5E7MA 4HIMA 4D26A 1T8TA 4OQLA 5UKDA 4PZ7A 3CP0A 3L0OA 2WSMA 5C0XG 3CO5A 3A58B 3W1GA 1Q12A 3T1QA 4UXHA 3CAMA 3N2EA 1LTQA 4UXJA 4NHOA 3CR7A 3KQLA 1KK0A 2H16A 4E09A 2W6JD 4DR5Q 1P75A 2C04A 3WMGA 2CHVA 2F3RA 2KBEA 1X3GA 4DK6C 5FBLB 5KYKA 3ZQJA 1V9PA 5C46F 1Z07A 4CEIB 3OE7A 5FOVA 2PH1A 4HAWA 5FLXc 4YWLA 5H68A 4JVMA 1XZQA 2VQFL 2FA9A 2F4VQ 3E2IA 5HY6A 1E3PA 1LTLA 1XFAA 4FCVA 4PPFA 1KTVA 4B3TQ 2D3WA 2NQ2C 2JLYA 3OESA 2EWVA 2Z6VA 3ZD6A 3X1XA 4B3MQ 4BY1H 4DR4L 1CLUA 1CTQA 1S96A 2NIPA 4X8OA 4ARZA 1LACA 4R4TA 1T6NA 3CM0A 1KJWA 4URZR 4ZI3A 4LUCA 4AIMA 3M85A 2GETA 2YWGA 3QXSA 4BLQA 5KTYA 2F6RA 4IOMA 2ZRAA 1YHAA 3LX8A 1BVSA 3QKSB 1JQJC 1GHKA 2QRZA 4HLQB 3HYRA 5JS7A 4LYAA 4GT1A 1CIPA 1QHSA 5FTJA 1CR0A 1CKEA 3A8IE 4W5JA 1GRRA 1A4RA 3PFIA 4KKUA 1UE6A 4KFUA 2WKRA 1YI2A 1KIXA 5KU1A 3IQWA 1H9MA 3HOWG 4JLJA 1HZCA 4RG1A 3KX2A 4AQYQ 1OE0A 3FVQA 1J8MF 1SVWA 4QGGA 1MT0A 4MYCA 2LKCA 4C0HA 2NOAA 3F2CA 2WJGA 1M6NA 4NMMA 1OW3B 3RS7A 2A68D 4BFWA 3TVTA 3PEUA 4POAA 1U9IC 3LAWA 1KK3A 2FDCA 2VHUA 2VEDA 4LJ9A 3FOZA 1YR9A 2ZRLA 4LF6Q 4FN5A 4IDQA 4L5BA 3SQXA 4IDPA 4Z54A 4OI1A 1ZCAA 1HE8B 2VH5R 5E7NA 3QVUA 1EYGA 1X8KA 2PT7A 4Z1MD 3W3AA 1WB9A 1YNNC 2XNDD 1RYFA 3MLEA 4PZLA 1CJUC 4E03A 3DVLA 4GMXA 1KIMA 3ECCA 1K83H 4LC1A 2VHQA 4RKEA 4FWTA 2JLVA 4IFDI 1OH8A 2EFCB 3X1YA 5IE8A 3CX8A 4A3GG 1OFTA 4NE2A 1MO3A 1JJ7A 3NELA 1E9FA 5LB2A 4TTQA 3V00A 4GFDA 5LD2B 3HP1A 4M1TA 1GDDA 2DCUA 3OFND 2N49A 3HWSA 2D74A 3WDNA 1G17A 4BFZA 4RD0A 2PEYA 4JOIC 2NTYC 1G3MA 1PUIA 2QM7A 4US0R 2A3RA 2UUBL 3IHLA 4TLEA 2OCPA 1Z08A 3ZVMA 3RN5A 1G18A 4C3IH 2IYRA 4R7ZA 2OBLA 1SKQA 4LF5L 2IHFA 3T51B 4KMUC 1VQOA 1VQ8A 3ADKA 1JR6A 1RL2A 1XNQL 3PXGA 1W5SA 1TX4B 1XEFA 3LGJA 1XXHE 2WJVA 3BU2A 4BBRG 4II7A 4L4UA 4AI6A 4M1WA 4H9GA 1KSFX 2GJ9A 2L5TA 1XMVA 3CNNA 4YCVA 1VCOA 4IO9A 2DWOA 4IEIA 5J4LA 1SGWA 1WOCA 4BGDA 1NI3A 5KSZA 5ANRB 1GWNA 4PPQA 1T8UA 1PLLA 1W0JA 2ZUDA 4CGZA 1U99A 2JLSA 3QXXA 4YXWD 4L5TA 1XP8A 2VSOA 4TLCA 5CM8B 4AKGA 2ZR9A 4FMCF 5EE1A 3THYB 4OHVA 1SXJD 1WXQA 4E5UA 2MQHA 5IDVA 3GTPH 1CKNB 2TMKA 4YWKA 4I7ZC 4A8JA 1X1RA 1KO1A 3TNFA 4TYWA 1ZP6A 5EP4A 1N33Q 1S3SA 4DV2Q 5D3QA 4NYIR 3L2OB 2ZYWX 4IFEA 5HCIA 1WBBA 2BA1A 2JASA 4MDFA 1B7YB 4B3RQ 3GLGE 2V6IA 2ZUCA 4HJ7A 3AKEA 4QNMA 1D7QA 3OTOQ 3DZDA 4JI2L 3C41J 3PG5A 4JJZA 1PH2A 3I61A 4Q1CA 3FFBA 1XZPA 2ZTSA 1CKOA 4G5SA 4X8LA 1OH5A 1B70B 4LF4L 2QROA 3T1HL 4MKHA 4RD2A 1M7GA 4E22A 2IYQA 5GVRA 2EIFA 1TUEA 3LNNA 1MO4A 1Z0JA 2VIIA 3OIVA 2BE5D 1B0UA 1DPFA 4DHEA 5B30A 1KDPA 1AQUA 3HOXG 1K8AC 1Z0DA 2OTJA 4QBGB 3GLFA 1I94Q 2XOKD 1UKEA 2ORIA 2RF4A 5JJLA 3U3RA 2V1CC 3PUZA 3WNDA 5C4MA 2F7SA 2BOVA 4CT5A 2PI2E 2ZPTX 4AYBG 1Q1BA 2HXSA 2H18A 1M1YE 2N3SA 2CW0C 2QA5A 1HQYE 4C0BA 2GXSA 3U3JA 2OG2A 4BBSH 4BLPA 4JK1C 4GPTA 1R2QA 1SR3A 4DKXA 4RD4A 2XGJA 4B2PA 1JMCA 4TYYA 3QF4A 3GQBA 1UWVA 3G4SA 3BG3A 1G64A 3CPHA 3K53A 1DD2A 2GEUA 4JYAQ 4ITRC 4TN1A 4ESHA 3M1IA 3NHAA 4PHFA 4S35A 3M4QA 4C2MH 2D5DA 4XSGA 3RSLA 2WKQA 2ATVA 5JZVA 1E2IA 3QBVA 4ASUA 1SN8A 4OX9Q 4M9SA 1IYJB 5G40A 3A5UA 1P72A 821PA 5JBQA 3EW9A 5GQOA 1EX7A 3GEIA 3IKJA 1XCGB 1VPLA 4C0AC 5A35A 3DM9B 3HU3A 4KYUA 4LWZA 2WB1G 4R98A 4AYWA 4D2IA 3PO2G 1Z63A 1GRNA 1H9SB 1TNDA 3RANA 1U8AA 3KFVA 1G3IA 2HIVA 1H9JA 1E1QA 4IOAA 3SFVA 1JJ2A 4L9SA 3Q9LA 4IHQA 3CKLA 2QE7A 2DNCA 1NVVR 2E1RA 1A62A 1O7IA 1FJGQ 4ZDIA 4DV1Q 3P27A 4GP7A 2Y0SG 2RMKA 3MCAA 4MH0R 4Q4LA 4LX0A 1I4LD 3CCQA 3W5IA 2QSYA 2JATA 3TUIC 1H65A 2Y8EA 3CZPA 3H4MA 3UG7A 4DZZA 4DDWA 4N0DA 1NBMA 3GMTA 3NE5B 421PA 3QG1A 3KJIA 4TL9A 4M9ZA 1PH3A 1X86B 3IBGA 1PVOA 2ONJA 5C3EG 2WAQG 4LW1A 3CCJA 2IW3A 3SN6A 1K3RA 2L15A 1AN0A 2Z0MA 5JLJA 1K5GA 1E6CA 4X65L 3UDFA 3FB4A 4Q7MB 2WAXA 1VG9B 4WOPA 2FGJA 3G6EA 5FLMG 1PH8A 2UXBL 3EAQA 3X2SA 2FV8A 3HOUH 4WZBE 1NVWQ 5JWRA 2I5MX 2ES2A 2KHJA 1W5TA 2GCOB 2IF0A 5FL7A 3T61A 2JLWA 1ESNA 1XTSA 3GJXC 3CC7A 3A4LA 3LO5A 3S1NH 1S9DA 1IN6A 1GL6A 3IDQA 4Q4HA 1YHQA 4GBMA 2R7ZG 1HNXQ 2K14A 4OONA 1DBSA 1NN1A 5KSOA 4DR5L 4Y0VA 3JAMc 4DNTB 3PIOA 3E5HA 3U4ZA 2AHOA 2EYUA 1VCNA 5FUVA 2WIAA 4Q1FA 4W7SA 2WBLC 2FWRA 1ZVQA 4A3DG 1W2GA 3Q72A 2QTFA 4A6PA 2ZE7A 4DIDA 2JLXA 3BD9A 3CB4A 3O8DA 5IYDH 1RYHA 4B3TL 1TF5A 5CDFA 3QG5A 2IYWA 4JYCA 1N5LA 1WJJA 4N0EA 1KD1C 4JI7Q 4B3ML 2BH2A 4Y52H 1DAMA 4DV6Q 4IFDJ 2JJ2A 2RGGA 3EC1A 4FMDB 4J0QA 5D3MB 5DHAA 3I72A 2ALYB 4P31A 4Q03A 1E98A 2ZRJA 1I2DA 2IS6A 5ELNA 1F2UA 4LJ6A 4JT4A 4DV4Q 3C16C 1TWFH 3GLIA 1P7CA 3PF4A 1NJIC 1MABB 1Q3TA 3HDTA 2GTPA 2ZVPX 3AKCA 3CWQA 4YLGA 5FBWB 3UMRA 4DB2A 1TWAH 2DFNA 2FFQA 2GEVA 4LHXA 4UNQA 3RHFA 3TR5A 4JKYA 1UEIA 3TK1A 4AYXA 1BBUA 3UE1A 2ZI6A 2QT1A 2JGNA 3BXZA 2JA8H 4EQ5A 2A8VA 1L0WA 4IFDH 4LFAQ 2FU5C 3CXCA 3SC3A 2P6UA 1XPUA 1DADA 1WBDA 1FP6A 3EIQA 1OF1A 3ZD7A 1ZUHA 4GOJA 2O0JA 2YHSA 2AFHE 3GFOA 3G48A 3CWZA 5DYGA 3U7FB 1RJ9B 2OV2A 5IHPA 4DLSA 3T56B 4ZDKA 4LF6L 4P73A 4MA4A 3N70A 3WMFA 5J47A 1UE5A 1G8HA 4DEYA 4JI0Q 4DK1A 2AXNA 2P5SA 4BZQA 1HJPA 2C35B 1P2SA 4TMZA 3LFUA 1A2KC 4O2DA 2RGBA 3L0PA 4FWIB 3Q7QA 3RS0A 3B9QA 4EIWA 2E76C 3H15A 1GNPA 3U4QB 1KKMA 1Z0KA 1SQ5A 1WI5A 3KXKA 5AUOB 1NJFA 1G5PA 2PQAA 1II8B 3FFAA 2P6RA 1Y1VG 1YZKA 3MXNB 3J80i 3GTJH 4LJYA 4LPSA 4DR1Q 4DLZA 3T34A 4IPGA 4KHPQ 1H95A 1FP7A 1FYCA 5EAYA 5EUQB 2WIBA 1CBUA 3A4MA 4LDJA 2OUKA 2YU9H 2IXGA 1M1KC 2W2VA 4GZLA 2A1AA 3UIEA 2E75C 1R8SA 2MO1A 3DM3A 3S16H 1G8FA 2NO7A 3EXAA 3SNHA 3CPJB 4TYNA 1HH2P 1HA3A 4HB2A 1D2MA 3X1ZA 5EE9A 2XZOA 1NY4A 3CC2A 1W0JD 3BDOA 4R2IA 1ODFA 4N1AA 3HOVH 3NG1A 2OSBA 4LOAA 1AGPA 4B2LA 1DXMA 4DAYB 3RN2A 3S14H 4PAMA 5EZ6B 2Z5FA 4WIAA 4M1MA 3IRBA 4L5RC 1KZGB 5DLQC 1TEVA 4CW7A 2ZS7A 2AWOA 1RE0A 2B7BA 2ZE6A 4M1YA 3PUXA 3ZIAA 2IS2A 4A3FG 1A2BA 3K0FA 1CSQA 3MUFA 3CRVA 5JSZA 3WWVA 2JA7G 4PZ6A 3CR8A 5FOXA 1S40A 4I99A 2CWAA 4X62Q 2R93G 4I1UA 1QVCA 2J59A 3U44A 2N46A 1IZ6A 1N33L 4DV2L 4KODA 4A3MH 1BS1A 3T53B 1U0HC 3TVDA 4IPCA 1YRBA 4RVCA 2B63H 2OZEA 2ZANA 2O0HA 1M7BA 2O8CB 1XRJA 3A7LA 4Z8XA 2WTUA 4B3RL 1TKWB 3MMPA 1QUQA 2F43B 2IXFA 3OTOL 4KN4C 4Q9LA 1KO7A 1KMHA 2FXQA 2YVUA 2G3YA 3J81c 2R6DA 1Y8OB 4DDUA 3BB1A 2MFIA 2A78A 3TLXA 1J99A 4PV1C 3VAAA 1VQBA 1SFOH 3GJ5A 2N8NA 4RZXA 2FOLA 3A8KE 4DLRA 4UNRA 1BKBA 2W2TA 4GOPC 3IGFA 4A9AA 1CR1A 1I94L 5EXPA 1HR0W 3C14C 3P26A 2V7QA 4FW9A 3F2BA 3CRMA 1AM4D 2P2LA 2QNRA 4QHTA 2O8FB 4GNXA 1DS6A 1UBCA 2BVNA 2R44A 3AVQA 4NZYA 2XXAB 4GKKQ 1FUUA 1R10A 3VR3A 1VTKA 4HZUB 1YVDA 2R92G 1Q1ZA 4TQUS 1G4UR 1DCZA 4XVRA 3GD7A 3DZ8A 4TQ9A 4AYTA 4IQZA 1QVFA 3PUWA 2YJTD 3UKDA 3EQLC 3AEZA 3GFPA 1W49A 3T5GA 1T3LA 3TSOA 3H86A 1Z7TA 4JYAL 4G7ZC 4MKFA 2K5VA 4I1SA 2OILA 4HAYA 4DRZA 1U0JA 1VECA 2HIXA 5E95A 4LJ7A 4OX9L 5KNCA 3STBC 3ICEA 1C9KA 2IYXA 1NG9A 4KBFA 1E1QD 2JJQA 4A3JH 5IY0A 1G1MA 1TU4A 1CTMA 1IY1A 3KTAA 1P4SA 2QE7D 4TMKA 5CDFE 4B75A 1T0JB 3A8JE 2EFEB 1CUKA 2WOJA 3I92A 4IOJA 1EX6A 1TQ2A 4IKEA 1E4YA 4P4SA 3AGQA 3P20A 1IBLQ 3BZCA 1MKYA 2DFTA 4DCUA 4LFBQ 4QGFA 2D62A 5AUPB 2YWFA 1Z6YA 2VA8A 1W36C 1NBMD 3G82C 3I4OA 4GOPA 1JPNA 3GP8A 1FJGL 2WWXA 4DV1L 1N36Q 4HAXA 2JA1A 4RZ2A 4Q21A 721PA 2ZRBA 3GLIE 3LQRA 3NDBB 2XZLA 2JLUA 3ZVLA 4CT4B 4A3EH 4PQRA 5EE5B 5GVSA 4JLOA 1CJMA 1OXTA 1G6OA 1HH4A 1XJ0A 3W34A 2EJGC 2E2IH 1JEEA 5IWAQ 2OCYC 4KSBA 2ZTCA 1KC8C 4NYIQ 2F1MA 1JI0A 5FI1B 3NVAA 1Q46A 5CLQA 5LMNW 2JLZA 1ZM7A 5M3MG 1E9EA 1ONBA 4A36A 1YIJA 1K73C 1L4UA 4DT1B 3F0TA 1G7TA 5FL7D 1B8AA 1SXJB 4B3GA 2IA5A 1YZLA 4L16A 2JJ8A 1XPRA 4LJ5A 3AP3A 3EC2A 3WP1B 2F1JA 4F92B 2OXRA 3AEVA 2FFAA 5LPNA 2FEMA 3BH7A 1N8RC 2UXCQ 1QHHA 3RRMA 3OAAA 4XH9B 4HDOB 3KJGA 4X66Q 3VR1A 5F3WB 1VIYA 5KOYA 4Q1AA 1FGUA 4IDNA 2QORA 4RCZA 1XX6A 4B76A 1P61B 1S1CA 4BXXG 4KYIB 4B71A 1Z06A 3ZZTA 3KL4A 3C8UA 3REGA 3JC66 2Q2TA 3AF4A 3N5CA 1KNXA 4M1OA 4Q9KA 1DTSA 1P8LA 4TT3D 1NJGA 1HNXL 3VU9B 4B48A 3HJNA 1X6VA 4NBSA 2BMJA 3AVYA 2DFLA 3RZOH 2WWHA 3NEYA 4HLCA 2UU9Q 1Z6HA 2XJ9A 4KFSA 5TMPA 5HZHA 3K70B 1RW4A 2XTNA 4K0KQ 1M90C 4XD7A 2CKZB 1NN3A 1OIXA 2JJ2D 4MRVA 2ZT9C 2OHFA 5GROA 1A5TA 4LWCA 5C4XH 1CP2A 3B60A 4JL5A 2JIZA 3K0AA 4BASA 4QM7A 3KKOA 3KB2A 1G8YA 2DR3A 2K5UA 2K52A 1YBYA 5IYCH 3I56A 2GK7A 3BIFA 4JI7L 2XTZA 4NCIA 2CBZA 3CNLA 4HAVA 4JI8Q 2ZE5A 1YR8A 3KJPA 1GHJA 5CYPA 2C96A 2WICA 2DN8A 2YINC 5ELOA 4BQSA 4DV4L 1J90A 3A0JA 1XNJA 3FGNA 3ZJYA 3I3SR 3WRXC 4BFUA 4DC9A 1HV8A 2QRNA 4OWTB 1AE2A 2K50A 5BN3A 3K70C 1NVVQ 2CDNA 2JA6G 1PLJA 4C30A 2V9PA 4HDCA 1JAHA 4X8MA 3H1TA 3W3ZB 1NLZA 1ZU4A 1E9BA 3SDZA 5AJ3Q 4LSGA 4BLSA 1FX0A 2D4HA 4HJ5A 2OAP1 5JEEA 4DNIA 4LFAL 1DE0A 5IP9H 2KJQA 5IP7G 3FYHA 2WPDA 1C7YA 3GEEA 3UDIA 2ZQ5A 1J2JA 3K0EA 1XMOQ 4MTNA 3SYKA 3THWB 4UPAA 3CPWA 2QP9X 4NCHA 1COWA 1N9WA 3BE4A 4TL6A 2F3IA 4A4IA 1P9NA 1SKYB 4BFSA 1CRPA 2Z43A 3SBDA 2E2HH 4UP7A 1JB1A 2GILA 1T5LA 4UP8A 4JI0L 4MRNA 5CLLA 5KDLA 1MJCA 1PHJA 1N3BA 4R2HA 5L3VA 3B6EA 2W00A 3M4PA 3PO3H 4MKIA 4TTPA 1R4AA 3H84A 2CNWA 3C4JA 3OHMA 5DIFA 3H3VH 2E8GA 2VQSA 3B2EA 3LWNA 4EX5A 2A69C 5IT9c 4FD2A 2NN6G 1EUJA 4BRUA 1XXHA 4NDZA 4GLXA 4QG7A 2CHQA 4DR1L 2QPOA 3D31A 3AKYA 3ADCA 1RIFA 1SZPA 4KHPL 2Q3MA 2I1VB 3EPKA 1E2VA 3ZVNA 3SJBA 1EESA 4B34A 5C44G 5KUTA 1KI9A 3B5JA 3GDEA 3I2ZA 4PZZA 5TXGA 2BV3A 4M0LA 4C7OA 5BN5A 1KI4A 1KI6A 2OT3B 3U3KA 2VYFA 4EFNA 3VX3A 2AL7A 1DO0A 3CX6A 1JXOA 5DGXA 3A1SA 3W6PA 1RRGA 3J81i 4POGA 3BJIC 5DI9A 2R7DA 2BBSA 1XPOA 1GKUB 2DHRA 3CUEF 4HZIA 4IJHA 4G0NA 1SHZA 3ZIAD 3LA6A 1Q90A 4D25A 1GKHA 2ODNA 3V4RA 4YC7A 5DI3A 1F6BA 3LLUA 4US2R 4L8GA 2JEBI 2LWIA 2A6HC 1F48A 1SVMA 5CIWA 2HYIC 4GS3A 2K5HA 1BBWA 2LKDA 2NO6A 2RKOA 2J46A 2ZS8A 3CMAA 1Q57A 2ZUBA 2QQ0A 1K5DA 1CKMA 3R20A 1ASYA 2AX4A 3K8YA 3U9SA 4JLVA 4MDEA 2ID0A 4QBIA 3OOCA 3WNCA 3GLGA 2I5HA 2A2ZA 3FDIA 3AF0A 1Y1WH 1X9NA 1ZW6A 3AKDA 3IEUA 1L1OB 4CEHA 3HKZG 4YWMA 4X62L 1DAHA 2BJVA 4A92A 3S24A 4L5SA 2J0QA 4JI4Q 1W47A 1TQDA 3CH5A 4JBJA 1W7AA 2AD1A 3OIWA 2XGTA 1ZM2A 1QG2A 2W2XA 3QKRA 4F4IA 1CEEA 3NKVA 3ONWA 2NGRA 2D0OA 2LCFA 2W83A 4MZ9A 2C95A 2I1QA 2ZS9A 1VQGA 4DUGA 2K4KA 2PMZE 1OJLA 3R9WA 1YR7A 2ZITA 2JQOA 3VNUA 3KKNA 5IK2A 3K0CA 2A5JA 4NCJA 1D8TA 3ULLA 1X8JA 2AUJD 2RGNC 3OEEA 1Y3AA 1XEXA 2DB3A 2FNAA 2GEDA 1XTDA 3T5DA 4OL0A 4XJXA 3RS5A 5JRJA 3GPLA 4C0LA 2JK8A 3RR5A 2EWWA 2F1HA 3TQYA 2FSHA 4HB4A 5JI3E 4XTRA 2ZI7A 5IYBG 4HLUC 4B2IA 4DLVA 5FTLA 3N6RA 3FHTA 1Z9FA 1Q20A 2NZJA 5E7IA 3MRSA 1E1TA 3UANA 5B64A 2JDIA 4KJZA 3QQ5A 5GJWC 4YONB 2G9NA 1A7JA 3R7WA 3RWOA 4YMVA 1U81A 4RD3A 1E2MA 3E0EA 4QHSA 2OWOA 4Q02A 4GKKL 5L8VA 1U8ZA 3HFZB 1Y14B 3BB3A 5BXQC 4KO8A 4URWR 2ONKA 1WF3A 4A3BH 2HXYA 1ZNXA 3D7MA 2CJWA 4A75A 1ZU5A 4YMSA 4EPVA 2QMHA 2DFKB 4I4LA 1VQCA 1YZTA 3TH5A 4RFSB 1U94A 1ZD9A 4WXRA 4ZCIA 1ZNZA 2IUSA 3GFTA 1MKHA 4A3IH 3WYAA 4D4JA 4EFMA 1G5RA 4IDHA 2F55A 1X56A 4BY7H 5K8IA 3I5YA 2ZVQX 4OHZA 3K9GA 5F98A 3DOEA 3H0KA 3OYYA 2ZTEA 2E9SA 4DEXA 5TV2A 1YHBA 2X2EA 3QOFA 4HUQB 2O8DB 1VQFA 4JBKA 2HJGA 2E87A 4B3SQ 2CQOA 1KXLA 2FPLA 4PSKA 3TR0A 3DLLA 3EG5A 1Q22A 5FBRB 4OO1H 1Z5ZA 4OGQC 1FFHA 2WM9B 4QL3A 1ZC3A 5C0XI 1XD2A 5SZJA 1GKIA 1J6QA 1E2KA 2WV9A 4XTCS 1IBLL 4JI3Q 2O8BA 4NXNQ 4RY2A 4LFBL 3CCSA 4DXAA 4BRWA 1N2CE 2P67A 3H0GH 2UUCQ 3HOYH 1RVDA 2Q21A 2O8EB 1E0AA 2IYYA 1UEJA 1YZUA 4JSYA 2JA8G 1N6OA 1SULA 1OFIA 1W1WA 1Z6AA 4HLUA 3LY5A 1OIVA 1I2MA 1N36L 2PMKA 4C0JA 4BEBA 3MEFA 3W8NA 2YOGA 2K5NA 3AFPA 1VQEA 1JJCB 1CJKC 4JIMA 1BYIA 4M22A 2NPFA 3SYNA 4NPSA 3PEYA 3SU8A 4LUZA 2F1RA 2IHBA 2W6IA 2IY5B 1TQ4A 4A0RA 5EP1A 2XJ4A 4PANA 3TZUA 5IWAL 1Z28A 2JEOA 4GZMA 2EVWX 2WOOA 4Q4JA 3HU1A 2XTMA 3K9HA 5LMUQ 4DV5Q 1PUJA 3MFYA 1F3OA 4RD1A 2C8VA 3BORA 2IWHA 4P32A 4GSYA 1C0AA 3IEVA 3STBD 1XEWY 1HZ9A 3PR1A 3M4YA 4A93H 1O7LA 5AWFC 3SQWA 1O78A 4KXFB 5L3SB 3HKSA 2VQEL 2CEAA 2OLKA 2R7FA 3PF5A 2AXPA 3F2DA 4MYHA 2CVFA 4TLBA 1A8VA 2X8AA 3IIJA 3AF2A 1W0KA 3AF1A 2GN5A 1GSIA 4D80A 1EFRA 1KGDA 2A6ED 3I4NH 2VUMH 2UXCL 3AUXA 3B1VA 1TXYA 3K9NA 2D2CC 3RS2A 2PT5A 4X66L 1UJ2A 3BFKA 1W36D 4CEIA 2BM1A 3GTMH 4MNOA 4OQXA 3S1MH 3G5UA 1HYQA 1GD7A 3EWAA 4H1UA 1HZBA 1FL9A 2YOFA 3AVTA 4JI1Q 5FOUA 3NWJA 3RLFA 3QPVA 4OHXA 2F1IA 4C4PA 4IJLA 1D5CA 2JIZD 3SOPA 1T9HA 1DAIA 2L0XA 1LY1A 1OIWA 1IN7A 2UU9L 2NG1A 3GTQH 3AH8A 4GNKA 5DSZA 3HOVG 2HCBA 5G3ZA 4DSOA 2WJJA 4K0KL 2VO1A 3UDGA 1U9IA 3MGCA 5AUQA 3RZDH 1SE8A 5FPYA 2OO7A 1KQSA 2VSFA 1HQMC 2HLDA 5LD2C 3QKSA 2FH5B 2ZRFA 3WMEA 3I55A 2CLSA 1IONA 1VQ5A 1KMQA 4Q7JB 1TU3A 4LZZA 4MYTA 1VYUA 1FW6A 5FJ8G 4DV0Q 3D0FA 2ZR7A 1DELA 2QMOA 4EFLA 3HYTA 2BC9A 4AKIA 1Z2AA 4JI8L 5F2EA 2NO1A 4JLMA 3UWOA 4V0LA 4AK9A 1FTNA 1OYWA 5FTNA 4LV6A 4S2EA 4TVAB 5BQ5A 4DCVA 5FPKA 5FUYA 3A36A 4L8JA 1AKYA 2K32A 4C0QC 1PH1A 3LLMA 1IXRC 3GCGA 2LMCB 2J7PD 4XIGS 1U90A 1ZUIA 2HF9A 3GJ3A 1QVRA 1AZSC 4JOIA 1Z0IA 2B63G 1GRQA 2Q9AA 2WPDD 4FI3C 4KSCA 4R9UC 2J0VA 3S2HH 1MH1A 1WFQA 5FTKA 4ZI2A 2ZSBA 5GADl 5AJ3L 4EAQA 4FINA 3CZQA 4XWAA 1LUZA 3T15A 1E1RD 1UF9A 2ZSAA 3LW7A 4HYYA 5DYIA 3IPYA 3L2PA 1KYIA 4GI7A 4CIDA 1XMOL 1I4DD 4A3LG 3ZVRA 4XVUA 4DPGA 2ZJOA 5G3YA 1QHNA 2HT6A 1KI8A 3C5HA 1OH6A 4JV5Q 3VX4A 4TZ6A 4MKGA 5C4JH 1SKYE 4H13C 4Y7NH 2BBTA 2FZLA 2OM2A 4JLBA 4KBGA 2K75A 1K6MA 2QF7A 2HT1A 4LBYA 4LY6A 4FDBA 2A5YB 2UKDA 2ZR0A 3EZ6A 3GLFB 2K33A 2EXDA 2KB0A 3BAFA 3MWYW 4DLWA 2ZRMA 4Q1BA 1VQ9A 1KJZA 4JBXA 4ZDWA 3JVUA 1QVGA 4DLYA 1AS0A 2OCEA 1E9AA 4PSVA 1H8ED 4TWZA 3O8RA 3VKWA 1QJOA 1G7SA 1N0WA 1IXRA 4I1VA 1V43A 3NBYC 1KNQA 4ZDJA 4NYMQ 3PCOB 2DYKA 4D0NA 3MSXA 1XMJA 1N34Q 3S2DH 1XDBA 2ZRPA 1E2HA 3I1FA 3K80C 5K36H 3CC4A 3OIUA 3Q5EA 4DDTA 2J9RA 2V6JA 4G7HC 4Q4HB 2Q8IB 4LYHA 3FKIH 1AS2A 3DXJC 1RC8A 1E2EA 1FPMA 3QF7A 4GOKA 2PX0A 4DKAC 4KU4A 3TRZA 5KHOC 3THYA 3I4MG 1IW7C 3KKQA 1CKNA 2V4ZA 3ZGXA 1K8GA 2UUAQ 1G9XA 2FF7A 4PO9A 1SMYC 4HR7B 4FMDF 4WVFA 1O87A 3WY9A 3B85A 4WAUA 1US8B 4DCNA 5HE9A 2P0EA 1R8QA 4PC6A 1P5ZB 1X6OA 2YC4C 3KQKA 4G7OC 3HGBA 5AJYA 1E2WA 4DUGD 1UKYA 3AP1A 2Z4SA 3TUJC 2GXAA 1OKKA 3PUVA 2QU8A 4EPXA 1YVCA 4JI4L 4DIEA 4LF9Q 4JYBA 2WHXA 2GXUA 1Z8FA 2EQSA 3QKTA 4MRRA 2JEAI 4DV7Q 4LF7Q 2R9VA 1ZMXA 3OEED 2VRWA 3NC1C 2G77B 2ZETA 4M1KA 2Q9BA 2YZ2A 4G5RA 3A5ZB 5AJZA 1Q0UA 4ME3A 2Q9CA 1P9RA 3J7ZC 4OI0A 5C0XJ 2IX1A 3B1XA 3LVQE 1CSPA 3RYTC 4A3CG 2QTHA 4F4CA 1RRCA 2GWHA 2A6HD 5AJVB 3OE7D 4QNRA 3SI7A 3UATA 3B1WA 3GLHB 3VKHA 5P21A 2J5XA 3D6TB 2GJ8A 2J0UB 2BWJA 1KHIA 3JZAA 1T5IA 4JG2A 3CMEA 3AYHB 3QEOA 4UNPA 4HB3A 4ZCMA 3PVSA 2CCZA 5CB8A 3Q3JB 4H44C 5JHGB 3ADBA 4JVSB 3S15H 2F4VL 1NBWA 1NKTA 1M2OB 3T1OA 2ZU0C 1T5EA 1EFTA 5SZKB 5C0XH 1VQKA
chains in the Genus database with same CATH superfamily
5KOJA 1BGWA 3IJEB 1G66A 3O9VA 4NNOA 4DR6Q 4EI7A 4X20A 1C7ZA 4YMTA 3U61B 4H31A 2NU7A 2I65A 3REQA 1LT3D 3CJRA 1ISGA 3L41A 2ZT7A 2CFMA 1UBMS 3N39C 3ZDYB 4CMHA 3LE8A 2KHIA 1T5OA 1ENCA 4QJBA 4C05A 3LC7O 1PK8A 3I7FA 4JB2A 4C6TB 1SLJA 1N32Q 1PH7A 4RZUA 4JASB 2WMYA 2B8WA 1T36B 2WMOB 2FG5A 5A3QA 3IQXA 3I04M 2WWYA 1YUNA 5IXJA 4QUKA 3NQIA 1GM5A 2YTVA 5D3MA 4RC9A 1UOPA 5DFAA 4W8OA 3H3XA 1T4CA 5KTMA 3KLOA 3P9YA 1L8AA 3SXUA 5TARA 1NV8A 1GG2A 3FNIA 1ODLA 2VDWB 3P2YA 1ZD4A 4RXTA 2H5LA 3KYIB 3QENA 4DLNA 4JL6A 1S7GA 3OFJA 4C7JA 2JGLA 4IIGA 3ZCQA 2ZRKA 2R93B 3E27A 4X7BA 1OLSB 4NESA 1KO5A 3KLPX 4OA8A 4O4LA 4B3TB 4GZ5A 2RHJA 5H1SE 4XB1A 3A7AB 3VM6A 4DK3C 1N5KA 4RZSA 2AF4C 3NX4A 1EIHA 4JWTA 1AGXA 1A3TA 2JLQA 1EVQA 4ZUIA 1HDYA 3Q41A 4C6RA 5C53B 1CQVA 4XWKA 1LZLA 4KIUA 1VF7A 4F3CA 4B9AA 3R3WA 1TS5A 4QC2A 3QHAA 1TW2A 2FUKA 2XUHA 2RHQB 1IG3A 1XV5A 2QDKA 1RHPA 3GZJA 1C3XA 5C1PA 2OAGA 2CJYA 1XJVA 4M54A 1PGJA 5KYTA 4UJ3A 4INZA 4ZMBA 4NPHA 3CCMA 3GA7A 1JIUA 1SXHA 2IU0A 5SY4A 1MW8X 3ILHA 3QY0A 2PFGA 4R54A 4TMWA 1UWCA 3LBYA 5ALVA 3DV2A 3R8FA 1FDRA 3TW4A 1F4PA 1SXJC 3LY9A 4HB0A 2ZIAA 3PXBA 2XY4A 3UJCA 1G51A 4IDEA 1UANA 4RCVA 1JR3E 1M8AA 2GZHA 3UH0A 5BV7A 2B1IA 4GOXA 5B2ZA 2LIPA 2V8OA 1Z6GA 5HPYB 2WE8A 1Y42X 4AECA 2AD5A 4LVUA 5HK8A 1Z35A 5EI5A 1LPOA 4KKSA 3PDIA 2ALJA 3THXB 3CO0S 2P3LA 1SXJA 3OZFA 4CKBB 2CCJA 4RY0A 3HZZA 3JSAA 3AW9A 1ZN2A 3FSGA 1J97A 1I2CA 4QJFA 4WJ3M 2AEMA 1P0MA 3U3ZA 1F9SA 4CLDA 1YFJA 3HN2A 4PHTA 4IUYA 4GRIA 4ESVA 3FSEA 3TMEA 4F2PA 4URFA 4YJ2F 3B6MA 1YAHA 2ZDGA 4B3CA 3EVGA 3TTSA 4PICA 1X8LA 2N42A 3RC8A 1P4RA 5L6LB 1CZRA 1M67A 3TOSA 4LHWA 1GO3E 3OZRA 3EVAA 2XWQA 2OCAA 1XTKA 1TZJA 1V5GA 2AG8A 4PR0A 1I3QH 1TEZA 5LZ7A 4S1PA 4IMRA 1VLHA 3OOHA 2ISSD 3VR3D 4KXNA 4YREA 1MSGA 1TM2A 2CFTA 1XMSA 4LHYA 1EIWA 8ABPA 3PKIA 3O82A 4C5AA 3AU9A 2UVQA 5MFZA 1YS2X 3OMWA 2CGEA 5CVJA 3RS3A 3WL7A 2GRJA 4BC0A 2QZSA 1NQVA 2WAOA 5KTNA 4HTFB 2ZR8A 3TP8A 4JQOA 3WLTA 3P7JA 3P1JA 3QWIA 3BXXA 5ALHA 2V3WA 3PRKE 3RSQA 4RZQA 4A8JB 2YN0A 4IVQA 1NI4A 4C04A 3I8XA 3BWXA 4WKGA 2EHDA 1N5JA 2XH8A 5ADWA 1UM8A 4V0SA 2AUTA 4KAXA 3RIHA 4L74A 3IBYA 4YPFA 3KZKA 1PRTB 1KDVA 4DWJA 4P34A 4S24A 4GL2A 4PWYA 5CB6A 4X62B 4HUQA 4BV9A 5DGHA 3IQFA 3VH1A 4B35A 2MGSA 4K9KA 4AJ4A 3L43A 2RDFA 1V8QA 2IEDA 2B82A 3JQ6A 5A02A 3NAMA 4A15A 5HMLA 1DL5A 3S14B 3COJA 1T29A 4UW9A 3M6FA 2QLJA 3UAXA 2PMFA 2ZRIA 4N18A 2NP6A 4DUYL 3M9WA 5KNDA 3Q3HA 5JAZA 1FNMA 3C5CA 1IRIA 3E1SA 2VT6A 4LPKA 2V6FA 2Y3IA 1FRVA 2G9QA 3KQUA 4DC1A 4MUBA 2ZI4A 4NZZA 1USWA 5EUBA 5F3RA 2AHOB 1XR3A 4PNEA 3B1YA 1EQVA 2XX3A 1FP1D 3ZS9A 4PQFA 2VP2A 2C4MA 5M3FH 4KE6A 4UBOA 4F91B 2ZM5A 3SD7A 5CFQA 4J75A 3AY7A 2BI8A 1JBQA 4QJ5A 1GG8A 4G8CA 3O1IC 3TKAA 1X55A 3E48A 2M6KA 1DAFA 2XQJA 4MW1A 1I0IA 5LMNQ 2KYRA 4LNHA 1KRTA 4MGEA 4MGKR 1WZNA 5JANA 3TMYA 3K72B 2ILTA 2O52A 1J23A 1HY3A 1R9TH 3VJRA 5MF6A 4UOEA 1Z37A 2CE2X 1JVSA 4L27A 2WWRA 4HQ0A 3OKCA 2IC5A 3ZDZB 4C06A 1RFGE 4CLOB 3J7A5 5JSZB 1SEPA 3G3EA 4EY6A 3NNSA 3ZQ6A 1CXZA 4B73A 3S5UA 2C5HA 2FCRA 1H2FA 4KY5A 2BFBB 1FQWA 4JI5L 2XMPA 1U0FA 4V2UA 2BFOA 4KXXA 1RWKA 1A5BB 2HCTA 2MINA 1PQUA 3DMFA 4MITA 3EY4A 1T8RA 3PUYA 3EDRA 1UT6A 3SBEA 1QBKC 1PH4A 4DLAA 2J9GA 2GFHA 5GAEC 4FUQA 2ZRGA 3CINA 1NKSA 3GROA 5AK4A 1RYDA 1NN0A 2BDNA 1L4KA 3EIEA 1NBIA 3SWWA 5E2BA 4G0OA 2NT4A 1WQ3A 3WYDA 1SKAA 3FUWA 3JAML 5JZMA 4LV8B 4GOPB 3DMPA 3CUUA 3QMWA 3R5JA 1UBSB 1X3QA 3TW8B 4NMZA 1ECGA 1B73A 5IHXA 2XQGA 2P2CA 1GGKA 2X6QA 2IXBA 2HIMA 4H4DA 2Q50A 1U0EA 1LM0A 4MVJH 3NEMA 1C1DA 5CDTA 2HCJB 4MVJE 4XASA 2VQFQ 3DLBA 3GAZA 1W36B 1UT5A 3OCCA 1K2VN 4WQMA 2QXUA 4LGMA 3K7AH 1AY0A 2ZT8A 4G63A 3IUEA 4U9UA 1NE3A 2Q3FA 1E0JA 3UOWA 1Z6QA 3T7AA 1U7ZA 2BP7A 3R6DA 1GZ7A 1JNYA 3HJHA 4M8SA 4B6RA 4QOEA 2A5HA 2G5DA 1Y1QA 2VJOA 3BF7A 2YZKA 1Z8HA 5K9ZA 2VDMB 2W4IA 4QQKA 1PJ4A 3QI2A 4GLFA 3BMQA 4A3CH 2VUMB 2F0MA 1QH8A 2JJ1D 4GC5A 2WHPA 4R4QA 5JC8A 1M6EX 2I7XA 4PLHA 4WLEA 5FBQB 3W4IA 3JWEA 2D9UA 2UZAA 5GAGC 2WQZA 2J32A 4PQXA 3J81k 4YXWA 1T15A 2KBFA 4KXQA 5LP6C 3L6DA 3FCSB 1TVCA 3EUEA 1OAKA 3V33A 2HKIA 1X7WA 5KYIA 4FKZA 3L9AX 2ZVDA 3KNZA 2HZ7A 5AJWA 5K36G 2RGYA 3QOYA 2NWGA 1F4LA 4WNIA 4LCBA 4Y18A 2BT4A 4J0IA 2ZIUB 2A1TS 5JDIC 3CD6A 1EIYB 2N1BA 1E59A 2IPAB 4CTOA 5FADA 4YQFA 2I33A 4BY9E 3OSZA 2PE5A 5DK4A 5EOVA 4I8IA 4KUGA 3UHAA 5AT1A 3S1AA 3DW3X 2QCPX 5IULC 2QLNA 2PZBA 3E58A 3ZE9A 3ROZA 4CCYA 3SK8A 4JN6B 4YCNA 3CGWA 1CHQD 1SVKA 5JDIA 3WHKA 1DWQA 4HIMA 4TLLB 4DGQA 1ETHA 2PH5A 1N1MA 4XYGA 5C46F 3NFRA 2JAOA 1NRWA 3G5TA 4POOA 4MB6A 5DJ5A 1YHAA 3LX8A 4D74A 4ARSA 3IQWA 2ABWA 1F8FA 4KIWA 1RLTA 1B3RA 2HNBA 4FHGA 4K9OA 2PSDA 2AFHB 1BS2A 1QMPA 4B7ZA 5F1OA 1YR9A 2EBFX 3OWHA 1I0LA 1U0OC 4E03A 2IH5A 1U8XX 3V1LA 5AXCA 3E6ZX 1PJ3A 1EBUA 1DCFA 2FW0A 3OMGA 3T9AA 2DWUA 3F98A 4EBBA 3ZH2A 4ALNA 2PFSA 5TQJA 2OBLA 3U1TA 1VQOA 4YJGA 3GUCA 1OLUA 1XXHE 4N9WA 2VDQB 4HDMB 2HXGA 1I13A 4W1PA 1HRJA 3HVRA 2FUNB 3ROEA 4QXOA 4H4CA 3GTPH 1KO1A 3BG5A 2VEOA 4IFEA 3G9UA 4E32A 5KOIA 1FDOA 4J0CA 4I4TF 3C41J 4IFIA 1DQYA 4KVFA 3F6PA 2QROA 3T1HL 1T5SA 5B30A 2BE5D 1AQUA 4YRJA 4RVOA 5T4EA 3WV5A 4TKZA 4DSAA 4AICA 3ZWPA 3U3JA 2V97A 3KAKA 4NFYA 4MS4A 4TYYA 1LDBA 3M1IA 4YNBA 1E2IA 3QBVA 5KYXA 1ZIXA 2VK4A 4EJ2A 5LQNA 4QPPA 2RAVA 1A76A 4D2IA 1PWZA 3GPDG 1AKWA 4FTWA 5GV7A 3MT9A 2ZJ1A 4Z0NA 2JFZA 4DV1Q 3P27A 1BG6A 2HW8A 1C3EA 4N0DA 1N2GA 1XMQB 4KLRA 4O59O 2O6LA 1H93A 1PKXA 3NU1A 3DD1A 2G6TA 4Q7MB 2BR4A 1I36A 3IT1A 3FD8A 2L19A 3HOUH 4WZBE 3PTAA 5F1YA 1IN6A 1GL6A 3TFOA 4Q4HA 1BE8A 2X9VA 1VJRA 2K14A 2JA5B 2LBPA 4H6PA 2FWRA 3MQFA 2XVXA 1L5HA 5IYDH 1N1EA 2DH6A 1A2TA 5C4XB 1NC1A 5IGCA 4ERNA 2R8EA 4EMSA 1FTWA 3D6JA 4J2HA 3NC4A 5B58T 1DC7A 5FBWB 2FFQA 5HF6A 1U9JA 4Z7QB 2C7VA 2JGNA 3BXZA 3T4UA 2R6JA 4P5EA 3SC3A 4BB6A 3EIQA 1OF1A 1Z74A 2ID8A 5D51S 2Q5EA 4DLSA 2XYPA 1I3CA 2C35B 1SBNE 1OR8A 3L0PA 4W82A 3Q7QA 4RNDB 4RV5A 2JYOA 4E46A 4M0PA 1ATZA 3DEIA 5H9WA 1QHFA 2PRSA 3ELUA 3F5DA 4P38A 3KF8A 1HH2P 4XB2A 1NY4A 1EVIA 2JFHA 5GIPE 3B6JA 4LECA 3GUUA 2IHUA 4PGAA 1XJ5A 1PP4A 2GHRA 1Y4DE 1B16A 3MUFA 3VDMA 4AWBA 3KIPA 4K8IA 2R93G 3IQHX 2I91A 4XCXA 1N33L 2WVGA 4WNYA 4ZQGA 4D98A 4TSSA 3J81c 4C6SA 3VAAA 5E8RA 4DLLA 1H66A 1BKBA 4FZ3A 2G9RA 2GD6A 4JI3B 4FYXA 5KKNB 1DS6A 1UBCA 1SC9A 4QO8A 2Z5VA 1DCZA 2VN8A 4HNHA 3PUWA 2YJTD 2WABA 4DPKA 3S8EA 3I90A 5FT9A 4IH9A 2TMGA 2YV4A 3STBC 3ICEA 5JFTA 4A3JH 3VHQA 1CTMA 3M89A 1GKKA 1TQ2A 1IBLQ 4QGFA 4WINA 721PA 3ZBTA 3ZVLA 1R1DA 1WDWB 1G6OA 1C3OA 4E4TA 3KPVA 2OCYC 4GC9A 2ZTCA 3GHHA 2F1MA 4NYIQ 2DY0A 4Y1RA 3F74A 1L4UA 2YJGA 2JJ8A 3ZCUA 2FFAA 5EZQA 1FGUA 4E70A 1W5BA 1S1CA 4RCOA 3C8UA 3VNQA 2NLOA 5AVSA 3HS3A 3IHKA 3LZCA 4L75A 4ND3A 3G0OA 4PIVA 2NZWA 1V26A 5CMDA 2RIRA 1M90C 2A73B 3H04A 5DN9A 4LQCA 1G1AA 2BSQA 3D6AA 2XRZA 2ZE5A 2QZJA 2WICA 4BQSA 3ZJYA 3I3SR 3Q9UA 3T7RA 5BN3A 1PEAA 2BZ1A 3COSA 3GRYA 4BLSA 5IFKA 4KKXB 5LYJA 2GM9A 4X3TA 1XMOQ 3M6LA 1NVTA 3SBDA 3FVTA 2GILA 1MJCA 1ZDMA 3GUYA 3OPXA 4LOKA 2VPXA 4F9EA 1IU9A 2CNWA 1R4NB 2VQSA 4WECA 4EX5A 4C21A 3NTHA 1EUJA 3AFOA 3QLUC 3I83A 4DV3B 5KX5A 5IVHA 1KI4A 3AZPA 2OT3B 2IH2A 3D6VA 2CXRA 1RS0A 2DHRA 1GKUB 4AY6A 3ZIAD 1O9HA 1F6BA 4QUAA 3U09A 3OOCA 1WPRA 2A2ZA 4I5DA 3BJRA 4CCSA 5FAKA 1W7AA 3FPJA 3D5EA 3NKVA 3QLUA 2Z6BA 2NGRA 1CP3A 2C9BA 4FR5A 2G7MC 5IK2A 1J9ZA 4FFRA 4BQPA 4C76A 3RR5A 3IKVA 2F67A 5G4LA 3KZCA 2OTCA 1Q20A 4EHAA 2DZDA 1DQSA 2GGSA 4DPMA 1LXCA 1Y14B 4A3BH 3V8QA 4ER0A 3K2BA 4I4LA 3ZTYA 4RFSB 4R3WA 3N3BC 1JA0A 4QTXA 5HQ3A 2X2EA 3ENNA 1C8VB 4DF7A 3OE1A 3VO1A 4PONA 1E2KA 4XTCS 3N58A 1ZYRD 2I34A 3E53A 4DLPA 2C92A 2ZYSA 5DKFA 2F1RA 5EP1A 1MXFA 1GFZA 2COEA 3WWDA 4P32A 1HZ9A 2R7FA 1PK9A 3CVYA 1BE0A 5AM3A 1WXWA 2GN5A 4U8HA 1TXYA 1IM8A 3RPEA 3C1EA 2FEPA 2JL1A 3G0GA 4YS6A 1LVUA 3IUJA 2XNCA 4EELA 2UU9L 4A3GB 5FPYA 2OO7A 4FQ8A 3IEPA 2NVWA 1ITZA 5CA1A 3HA2A 4DV0Q 1TIKA 1T2EA 2NO1A 3OX3A 4DCVA 2ZYGA 4ZU6X 2AXEA 3DYIA 4E1AA 5GADl 1EZ6A 3T15A 3F9CA 2E5FA 4NJEA 2IY8A 2N55A 5IFLA 4C08A 1BA2A 5HWSA 2B3DA 1OH6A 2E4ZA 2WM2A 3LWZA 4KJXA 3LTNC 2K33A 3Q2KA 3MWYW 2OD7A 1KJZA 4ZDWA 2BGNA 1QJOA 1QZUA 2BFEB 1U3VA 3K57A 3P9QA 3I1FA 3CC4A 4DDTA 3PNSA 2OP0A 4G7HC 4YRQA 3SEQA 3D3WA 4LYHA 1L5LA 5JNVA 4DW8A 4O1IA 1XNHA 4HR7B 2M6LA 4G7OC 5FF9A 2EGGA 3OZBA 3LPNA 4JI4L 1U6KA 4OUDB 2OO3A 2C3OA 1I7DA 4DV7Q 1IAVA 5JVH3 1MV8A 2VFAA 3A28A 3VZSA 2PA3A 3GTGB 3S70A 3OQHA 1SYGA 3Q7EA 3HY4A 4OXXA 4IINA 4ZCMA 4GDMA 3D4DA 2XLBA 3BSSA 4D9GA 2ZU0C 1EFTA 1V1JA 5MN4A 3FPCA 3LUKA 4ROSA 1FTGA 1HGXA 3HBAA 4N03A 2EKLA 4LQ4A 1H2XA 4YAEA 3TE6A 2X4DA 3AUKA 2E2JB 3PDWA 1DEXA 2PUDA 1HDEA 3LCVB 1FY2A 1H0HA 1VG0B 4MAFA 3ULJA 3IILA 3I9V1 4LCJA 1W96A 3TE7A 4RANA 1WHTB 2FZ4A 3QWAA 1QH1B 2VK1A 2VY3A 1FX1A 2H63A 5B7GA 2P8JA 4D99A 1S72A 4G81A 4IUUA 1L1EA 2CJXA 2X0EA 3EZ2A 3K2QA 4WOKA 5J63A 2RHCA 3NVKI 2XECA 3ENZA 5SY6A 1EE2A 2H4HA 2WF5A 3UYKA 2JAXA 4ZIRB 2OF1A 1YNND 1XO1A 3H3VC 2KWIA 3VYUA 4ZPXA 4EA6A 2QL5A 1H6BA 1RQ2A 1I4RA 1TUIA 3NTUA 4TM7A 1LS6A 1JZSA 2UXBB 1BIFA 4O3FA 3T0GA 1DKOA 2Q41A 3T1TA 3HG9A 4YI3A 1JDUA 5LIRA 2WJIA 2V0CA 2ZK7A 2GCNA 4LYYA 2OC9A 1OAAA 3OZXA 2FPKA 1DZ3A 2NACA 1A9XA 3TTWA 1EY4A 1U8EA 1BHQ1 4BNUA 4JV5L 4LWQA 4K46A 2DVMA 3E7XA 3KVRA 3ZWNA 1RQLA 2AYXA 2Q9UA 3EBPA 3LKZA 1SG0A 1D2GA 4RGNA 1N6RA 4JHLA 2V58A 3D0RA 1CZUA 4IV5A 1C0EA 2YYAA 2MMCA 1YVEI 2ESRA 1U7WA 4KI7A 2AFRA 4B3DA 1PHPA 4Z49A 1RIPA 1ZSYA 4Y6OA 2A1UB 2BFCB 3QVTA 3LM8A 2O8CA 2WYVA 3K9WA 3BD6A 3HR4A 1XVTA 3V7WA 1ET6A 1VG1A 1P2TA 3V2GA 3EEIA 3GEGA 4RTNA 3DEOA 1TF7A 2X6GA 1TK9A 5G4KB 3L46A 1RE1A 2YZNA 1EFUA 1LSJA 3CRLC 3GCZA 2VAPA 2DUWA 1K83B 4V02A 3DTTA 4F6LA 4IUDS 3MJHA 1C48A 5C7YA 4LNQA 4DV2B 2ET6A 1NR7A 3P71T 4DV6L 4D9KA 4DJEC 1E22A 1MTOA 5AR1A 4DR6L 4X41A 4X45A 1K9MC 1G16A 2QTTA 1EQRA 1I94B 1TCBA 4FX2A 2H57A 5FUWA 1ZA1A 5BYBA 1L7DA 5FI5A 3MWLA 2FPPA 4GRAA 4IIDA 1N32L 3WGGA 1EZ8A 3T1HQ 3WL4A 1XQVA 1PL8A 4FFWA 4PLTA 2JA9A 1MAWA 2RGEA 3WRXA 3KUKA 1QP0A 3OKAA 1A9OA 2C00A 4F84A 5JFGA 5IF9A 1OV4A 2QZ4A 4F7WA 2EJUA 2IEBA 1K8OA 1LSSA 2RHTA 4UCXA 1OLXA 5E6RA 2VBGA 3AIOA 1UDRA 1QTRA 3AHJA 3MZ5A 5JNWA 1CERA 4ZVNA 2P35A 2UXDQ 4WBSA 4Q4AA 3HR8A 3AU8A 2KQUA 4QLBA 4ZCRA 5CLJA 1EU3A 3LUGA 3L01A 5FXMA