2YYZA

Crystal structure of sugar abc transporter, atp-binding protein
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
358
structure length
358
Chain Sequence
PSIRVVNLKKYFGKVKAVDGVSFEVKDGEFVALLGPSGCGKTTTLLMLAGIYKPTSGEIYFDDVLVNDIPPKYREVGMVFQNYALYPHMTVFENIAFPLRARRISKDEVEKRVVEIARKLLIDNLLDRKPTQLSGGQQQRVALARALVKQPKVLLFDEPLSNLDANLRMIMRAEIKHLQQELGITSVYVTHDQAEAMTMASRIAVFNQGKLVQYGTPDEVYDSPKNMFVASFIGNPPTNFLRDFSVSVENKQTILKRDDVIIKLPEPVDVKLKEVVVGIRPEHCRISRERVENSIPGVVYVVEPLGRDIIVNVKTEKGEIIKVFGDTGKAPQPGENVFLVPDLRKIHLFNPETEETIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Sugar ABC transporter, ATP-binding protein
rcsb
source organism Thermotoga maritima
molecule tags Transport protein
molecule keywords Sugar ABC transporter, ATP-binding protein
total genus 88
structure length 358
sequence length 358
ec nomenclature
pdb deposition date 2007-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF08402 TOBE_2 TOBE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2yyzA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2yyzA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2yyzA01
1VQEA 4PC2A 2CWAA 4PX9A 3FMPB 3CF5A 1LNZA 1VTKA 1YHNA 4Z51A 3U2QA 3B60A 2QP3A 3DM9B 1GRQA 1GKUB 3IUYA 1F60A 1TX4B 4GP6A 1ZKOA 5FJ8H 3E2IA 2PQAB 3CXCA 3U50C 4HAWA 4ACAA 1Q86C 1U98A 3JAMc 5BN3A 1CR1A 1XEFA 4L5QA 2MSDB 2SHKA 4PQYA 5IE8A 1S1CA 2A2ZA 1Z83A 1KL9A 3QBVA 4CIDA 2O8DA 5JJKA 5JSZB 1D9XA 4LHZA 4TMXA 3UMSA 2OTLA 1SKQA 4D4KA 4XVUA 1MH1A 4O3MA 2UXCL 2QUZA 1Q7YC 4OKSA 1MJEA 4DUGD 1CR2A 4X8OA 3RWMB 3CX6A 1LS6A 1NRJB 2BMEA 2ZSBA 3W3AA 1E9AA 1ZUNB 2GESA 3OIUA 5J4LA 3SQXA 1AGRA 4DR3L 5EAYA 1R8QA 1XD2A 3U3KA 2XZOA 1KI7A 2J59A 2QGNA 1KGDA 3TSOA 5FUWA 4O2RA 2A30A 2GCOB 4X65Q 2JIZD 3AV0B 4G01B 1EOVA 2VL6A 4M53A 1KI3A 4QJFA 4AKHA 4PC7A 5IY0A 2ID0A 4PFSA 5LB4A 1WYDA 1SVOA 3CRKC 1V9PA 4GDFA 4LK1C 1YHQA 4Y7NH 1JT8A 1DO0A 4PAMA 4Q03A 1RJ9B 4Y0AA 3GLIE 4C2MH 2JA8G 4DHEA 1Q12A 3LXRA 3OAAA 2FDCA 3IFTA 2WHXA 4PR0A 4A92A 3RN2A 2CFMA 2J5XA 1DADA 1QHHA 2AD1A 4Z54A 3AQQA 3A5UA 2OBNA 3NG1A 1TAGA 4EUNA 2JA5G 1PVOA 2EU8A 1TPZA 3NEJA 2LCFA 4URVR 1K3RA 4NYIQ 2ATXA 2AWOA 4HIMA 1N6OA 2KWIA 4FMCF 1HTWA 1U81A 3OFNA 1CJTC 4KSCA 2ZJOA 2ZQ5A 1VQIA 4A3MH 2MMGA 1UDXA 2GKSA 1R4AA 1A63A 1TMKA 2V6IA 2OQKA 3L82B 1XEXB 2VQFQ 2AFHE 4PTLA 3CW2A 4F7WA 5GJCA 2VQEQ 1ZUHA 2UXCQ 1G5TA 1P2TA 4C0QC 3U4QA 3S1NH 1FP7A 2WPDD 2PI2E 3FFAA 3HP1A 4JI8Q 2V7QA 3M0EA 1NY5A 1HT1E 4Q7KA 2MO1A 3MXNB 1CR4A 1T0HB 4C0SA 4CEHA 1Z9FA 4HLCA 2N49A 3THOA 3LVRE 4AYTA 3H4MA 3HYTA 1DGSA 2HXYA 4FD2A 2QBYB 2IYQA 2Z6VA 4KLNA 3NBYC 4QJ4A 2VP0A 2KHIA 4IOAA 1PZNA 2QG6A 2ATWA 4JLMA 2ZU6A 1X6OA 3S24A 1RIFA 1M7GA 1K8OA 5JEAH 2AL7A 3N2EA 3QI2A 3KXLA 1YR8A 1G5PA 5SZJA 1D9ZA 2D0OA 2Z4SA 4U00A 3PEWA 3H86A 1VQ8A 2GJ9A 3CONA 2I4IA 3DVLA 3LW8A 4D25A 4IFDI 1U8AA 3KKMA 4ESHA 3QSYA 4BWYA 2BM1A 3FYHA 3IO3A 3B1XA 1YVDA 4MKIA 4GKKQ 2QP4A 1BS1A 1QJOA 4GZLA 5J40A 4M9ZA 1DAFA 4DR7Q 2V1XA 3CNNA 4N0EA 1RYHA 3U9SA 2P5SA 3J80i 4V0LA 4Q9JA 4PZZA 3EPJA 1XRJA 4DV0L 3A8JE 3EZ7A 4BFTA 1KI2A 1GUGA 3J81c 2XJ9A 5FTJA 4JKIA 2QM7A 1NL3A 4YWKA 5J4KA 3W3ZB 4W9MC 4WVFA 2WM9B 1D8TA 3I8SA 3PF5A 1K8AC 1G41A 1HCZA 2JGNA 3GTQH 3DZ8A 4HLQB 3ZJYC 4A3JG 1NG1A 1RVDA 2XEXA 4GZYC 4JYAQ 2ZIAA 1VF7A 1E4YA 2IHYA 1X9NA 4JBWA 3F2DA 2R6FA 3RSOA 5J5CA 3W6OA 1V8QA 3AP1A 2UZIR 4NXNL 5AUOB 3OW7A 2VQEL 2GDJA 1DCZA 5C3EG 2JLWA 1N25A 4H9GA 3OFND 1UE7A 3KB2A 4WZBE 3A37A 5FH9A 2Z6KC 4V0ME 4DRZA 2JA7H 4YMWA 1LABA 2R65A 3KL4A 1J8MF 3K09C 5AR1A 4A75A 2IYSA 3PEVA 3NDPA 5KUTA 3DMDA 1W46A 1HNXL 2J0UA 4QL3A 3OESA 4DUZQ 1G3QA 1M1KC 3K1JA 4MRVA 4TMZA 4B32A 3T06B 4CVNA 3U6BA 5IYCG 3K0CA 2YC4C 1UE6A 2J3EA 1HA3A 3DKPA 3OF5A 4R7ZA 4TSFD 4DLRA 4IXMA 3WWVA 3IBYA 3PJRA 1VS0A 3FMFA 1KRSA 5E7JA 1KK1A 3VU9A 1HQCA 1Z28A 1KK2A 1NF3A 1PHJA 1K8GA 2H92A 2IYWA 3FTQA 3SBDA 2IXFA 4NL4H 3FMCA 1F2TB 3RDPA 5CYPA 5IP9H 4X66Q 4B6FA 4QBIA 3I56A 2O0KA 1R5BA 4GKKL 1Z6TA 4DIDA 1FTNA 1T5EA 3MJRA 3B85A 1FW6A 1XCPA 4AYBE 3KXKA 5H1SE 4LV5B 1MABA 2Q2IA 4BLPA 4BA1I 3GEHA 4B3BA 1XPOA 4DB2A 4GOXA 4PV1C 2YU9H 2IXGA 3U7HB 3Q3JB 3VFDA 5FPKA 3AFPA 2GEUA 2J41A 4O0MA 5BN4A 3ADDA 4OK3A 5EP2A 1NMZA 4J0QA 5JLJA 2CHGA 2WJVA 4MYTA 1XTDA 4PHGA 2CEAA 3C7KA 3CF2A 2ZVQX 4QGHA 4BE7B 5JI2E 2X19A 2P3SA 2YOFA 3U58A 2LSSA 4Q4JA 2VP4A 2XX3A 2V54A 3AB9A 2WWXA 4ZDWA 4GS3A 1LS1A 5EE1A 4IDQA 2CLDX 3UG6A 1VKJA 5JWRA 3L2PA 1J99A 2ZRLA 3TAUA 4C7OB 2CK3D 3BAFA 1R2QA 1R0WA 1A2KC 2IYUA 2W6IA 4JLKA 4LHXA 4Q1EA 3OW2A 4S2EA 2JA7G 4YHHQ 4P4TA 2HXSA 3TGPA 2HCJB 2GILA 1XTSA 5KSYA 3K70B 3IPYA 4B6EA 1MKHA 3GJ0A 4TL8A 5SZHB 2EDGA 2YWFA 4M22A 1S1MA 4UXJA 2H5EA 3M4QA 2OUKA 3VR6A 3PIOA 4XJXA 1KJYA 3W8RA 5EXSA 2QSZA 2RHDA 1SVWA 2BKEA 5F9HA 1KHIA 3ADKA 1ZP6A 2Z0MA 4TYPA 2BJVA 3ZD6A 2QT0A 3TSWA 1CRQA 2ZRPA 3IHWA 2QGQA 1QHGA 2IXEA 1W47A 3KJIA 4HAUA 4RKFA 3LBNA 4O2DA 2Q2UA 1Y3AA 1IY1A 1V43A 4DK6C 1LTQA 4B3GA 3K9GA 1SFOH 3CPHA 3AFQA 4MUBA 3VR5A 3EIEA 4GOKA 1NG9A 2A5YB 4B71A 1RZ3A 3MWJA 2LKDA 1FZQA 4QXAA 1S72A 1IBKL 1BVSA 4PZ8A 4LBZA 1GG2A 3X1YA 2GCPA 1VQJA 3TQYA 1XMOL 4LFBL 1NIJA 1I94L 2H16A 4IDOA 3TIFA 3VKHA 2Q3FA 4LJ9A 2WMNB 1VQAA 3IEVA 1L1OA 1JR3E 1PH9A 1LF0A 4HJ9A 3CCVA 5JSZA 4YWMA 4Q01A 3PUWA 3PV0A 2F7SA 4HYYA 4NYMR 4TL7A 4US1R 1E9FA 4NBSA 2IYTA 1I5FA 1GRRA 3M4PA 1I94Q 3CPFA 3PO3G 1YBYA 3S1AA 4NCNA 1IN4A 1GHKA 1J5EQ 4FWIB 1HQMC 3TS2A 4MDEA 1HZAA 3L0OA 4NE2A 2KBFA 5CITA 4A3DH 1P72A 4I4LA 3UWOA 2MNAA 4I1OA 4X8MA 3RWOA 3BFXA 4UXHA 2IW3A 3PFIA 3U5ZB 1ZU4A 4OO1I 4DDTA 3HOVH 421PA 1GKIA 2AUJD 4H13C 1I4TD 1M8PA 3PO2G 2WOOA 4W5JA 5CJPA 2ZREA 5FPSA 2XNSA 3CRW1 4E5UA 1MOZA 1UKZA 5IYDH 4G0NA 2BJWA 3FHWA 3TQCA 1IBMQ 2W2VA 1NSFA 5FI1B 4Q1AA 1E2PA 4JLBA 3THXA 1O78A 5DLQE 4JI2Q 1E1RD 1PLJA 3K0EA 5CM9C 5FUVA 2ZVPX 1IBLL 2NVTH 1IONA 3NWJA 4JLDA 2I0QA 2C9CA 2KBNA 4P33A 3HOZH 1I6VC 5AJYA 2WTUA 3VDYA 1L4UA 1B9NA 4CEJB 3F3YA 3NKVA 4AH6A 3QOFA 1P73A 2HJGA 4AY2A 2PCJA 2UU9L 3TQFA 2I1QA 2QPTA 4Z1MA 5H1YA 1P4SA 1N6NA 2L0XA 2R9VA 1Q82C 3LRPA 1E22A 2FSGA 2WWWA 4RCZA 4XVQA 3T34A 3A1TA 2QL6A 4XD7D 2J0QA 2N42A 2PCFB 3GFPA 4OQLA 2CBZA 5JEAJ 4U5XA 2QTFA 3EPKA 2N3SA 1VQNA 1EFHA 3DL0A 2AN9A 4MTNA 1LFDB 2ZU0C 2BVNA 2F43A 4TYQA 4DIEA 1U90A 2OSBA 4R98A 3TR0A 2B29A 3FB4A 2VSOA 1BYUA 3V4FA 1JPNA 1XEXA 2OCPA 1ZIPA 2GZHA 1Y8OB 3SE0A 2I5MX 3G48A 1P75A 1TUEA 2LXKA 2QAGA 2JEAI 4GN3B 2DNCA 4DAMA 3GTOH 5H8WA 4ME3A 1QRAA 2WAXA 2R93H 1PH6A 3AF2A 5CDFE 1TADA 1H95A 4LOAA 1NN0A 4KKSA 1TQ2A 1E0AA 5E7NA 5FLMG 2L15A 1E0JA 5B2ZA 3SHFA 3DOEA 3WNBA 5LD2B 2A69D 1YHAA 3KXIA 2V7QD 1P2SA 5EZ5A 1KO4A 4KKTA 3UKDA 3VHXA 3GLIB 3QPVA 3EPHA 3SDZA 3K80C 5GVRA 3LX8A 4A3CG 1N6HA 1P9WA 2F1HA 1G1MA 4IDNA 2V4DA 1EX6A 3E9HA 3U3RA 2GXUA 1KDOA 1P2VA 2FPMA 3X1ZA 1XMVA 1TQ4A 2FWRA 4JI4Q 1PUJA 1NVXQ 1XEWY 3ASYA 1XMQL 2J7PD 2VTKA 3M6AA 5FOWA 3WMEA 4DLYA 1VQMA 8OHMA 1CU1A 4TL9A 3OPOA 3AVUA 1H8ED 2DCUA 1EWRA 1II9A 1O3YA 1TL7C 2WJGA 4O25A 1AS0A 4ZDJA 2H17A 2NVQH 1UKEA 4XH9B 3PCRB 2ZANA 1E2GA 4QJ5A 3RNLA 2JLQA 3R20A 4P73A 3K0SA 4ASUD 3AUXA 4LPSA 3CB4A 1OF1A 3F2CA 1T5IA 4TLBA 3REFA 4EJSB 1GO3E 4B3TQ 1EIYB 2FFHA 1GD7A 3WYFA 1V1QA 1DPFA 3SC3A 1ZNZA 2Y8EA 1YRAA 3P4YA 1YI2A 4C3IH 5GAEC 1HH4A 3SGIA 1N34L 3IIMA 2D3WA 2D2CC 2BA1A 1VIAA 3KFXA 4PMWA 4EIWA 1TTTA 1GFIA 2HQLA 2HF8A 2ZSDA 1U0HC 3GPLA 1BBUA 1QZGA 5BYJA 2YNMA 3MSXA 2UUAQ 4D81A 5DO9A 2O8DB 4QHTA 1UDWA 2N46A 2XTMA 4XD7A 2WV9A 1XNRL 4YCUA 3LX5A 4A3GH 1E6CA 1VYVA 4FMCB 1F2UA 4JBYA 3A1SA 5C0XI 3HJNA 3PSIA 1GOTA 1TXYA 4WOPA 5KPDA 1FX0B 4NU0A 2QA4A 2IYLD 4GBMA 4YMSA 3PF4A 3R9XA 1LVGA 2DFLA 1Z0FA 3E1SA 4IEEA 3FMIA 2C04A 4IJLA 1L2FA 2GXQA 2MMCA 1XMQQ 2HT1A 5FUXA 1VG9B 2PZEA 4Q18A 4LHWA 1DOAA 5DI9A 1HYQA 1XNQQ 2ZE8A 1TWAH 3H15A 4RD3A 1OW3B 4NP6A 5DGXA 5EZ6B 1HTPA 1FX0A 4DSTA 1NVUQ 4HSEA 4RZ3A 1AKYA 2GZDA 2V1UA 5GADC 1FVIA 5DLQC 1XB2A 2JA8H 1KY2A 1S8FA 1ZM7A 3I32A 4US0R 1DE0A 5FL7A 5DN6D 4BXXH 4UPAA 2DNEA 4B3CA 1NY6A 4JV5L 2X8AA 1G8HA 4Q1DA 1RE0A 5CJ2A 3RHFA 2ZJ5A 2X1VA 1VQHA 4R4QA 4LFCQ 1L8QA 3SBEA 3I7FA 2UXDL 1A62A 3G71A 1IAQA 2J0VA 4H1VA 3ZDQA 1U8YA 1EQRA 3KKQA 5AJZA 1HY3A 4JV5Q 2JJQA 1Y8NB 1VPLA 4XIGS 1H8EA 4D4LA 4F92B 1E1OA 3LNCA 4DVGA 3I73A 4BBRH 2F1RA 3KDFB 3PUXA 4PZ7A 3GTGH 1GL6A 1XJCA 4RZXA 4AG6A 2GVBA 1M74A 1Z6GA 3AH8A 3SJBA 4OONA 4DCNA 4E03A 4GKJQ 2A3RA 4JBJA 2WJJA 3THYA 1NBMA 2BHRA 3PIRA 3I4NG 2AUKA 1OKKD 2HLDD 1QBKC 1UKYA 5EP4A 2RGXA 4A8JA 4IVRA 2KI5A 4HB3A 2AR7A 4HUQB 4RZUA 2IS2A 3RC3A 1IN5A 4Q4HB 2OCBA 3NEYA 3FOZA 1GNRA 1Z47A 3IDQA 1VHLA 1BDOA 3TS0A 1DXMA 4HJ5A 4ZPXA 4KAXA 3HOWG 3A4LA 2ODWA 2YVUA 3IQWA 5DI3A 2XTIA 1VQBA 1YVCA 1MABB 4IPHA 1YZLA 2C9YA 1EYGA 3BDOA 2VP9A 3D8BA 3LBHA 4EPTA 4HJ8A 3BIFA 2H5XA 3E0EA 4X65L 2WSMA 2ERXA 5FPHA 5IK2A 1VCOA 3GLHE 4X64Q 3IBGA 2YWGA 2ZR7A 2A6EC 3ADCA 4FI3C 1C7YA 2D4HA 3IO5A 5K8IA 3NDBB 5KTYA 1AK2A 5LMUL 1QVFA 4EJSA 3BB1A 1OYYA 3A0JA 1M1YE 3QKRB 1C9OA 2PMKA 1Q44A 4X8HA 3I5XA 3AVQA 2A5GA 3FGNA 4JYBA 3TUJC 4JT2A 2RGNC 4KFUA 4A0HA 4AYWA 1Q81C 3KLRA 1HJPA 5BQ5A 3LFUA 4GOPC 1WMSA 5IT5A 2FNAA 3EAQA 3KF6B 3W6PA 4IPGA 4B3SQ 2IX0A 3L0IB 4A36A 4JLPA 1A1VA 2G0NA 2D62A 1P7CA 5AJXA 4MRNA 1KOFA 2R6AA 1EUJA 3LDAA 3O8DA 4A93H 2WWGA 4DK1A 1QUQA 4C0JA 1CRPA 1GNPA 4MITA 1XMSA 3NH6A 1R7RA 4HR7B 1YR7A 1E1QA 1W7AA 1H8HA 4RVCA 4KVAA 1NKSA 4DV6L 1OYWA 4H0LC 2FX3A 2VQFL 1W0JD 2CL0X 3ETLA 4JJKA 2WBLC 4BLQA 2R8RA 2NZHA 3KUCA 4F4JA 2KENA 3AF3A 4AURA 4FCTA 2NIPA 4EQ6B 2IX3A 1DELA 1K0RA 3RSLA 3SR0A 5EQTA 3MWKA 1RKBA 2E5LL 1Z06A 1G7RA 3B5JA 4XWOA 3N2IA 1E2EA 2V6JA 1JJ2A 2OEPA 2WJYA 3ZVLA 4TQAA 4P3YA 1YNJC 3CC2A 4I1VA 1GKHA 1DO2A 5J4YA 1EFCA 5HKKA 1KI9A 1G4AE 5IYCH 2IYXA 3CH5A 2BWJA 1EFRA 1N6PA 3T1HL 3QKUA 2K5HA 2IX1A 1AN0A 4Q1FA 5M3FG 1F5NA 1N6LA 2P0EA 4PXAA 4A1FA 2OWOA 2ZYTX 4OQNA 1E2MA 3AF4A 1FOEB 4OX9L 1CJUC 1W4CA 4M1WA 3WBKA 2IT1A 1HT2E 3CF6R 3GTPH 2QM8A 5HE9A 2HHHL 3JC66 2NO1A 1U0LA 1FFHA 2GBLA 2J87A 3VR1A 4D4MA 4F38A 4LF6L 1W1WA 5LD2C 2F55A 4LC1A 4ALPA 2F1IA 3W5IA 3H0GH 2B7BA 2GJSA 3S14H 4NCHA 3S1AB 5FPTA 1UADA 2ZRFA 4BY7H 5C0XH 4DZZA 1IN6A 3F1ZA 3NC0C 3SS8A 2O5VA 1ESNA 4ITRC 2VPPA 2FF7A 2UUCQ 4DEYA 1N5JA 1HURA 1ZC3A 2GWHA 5DE3A 5KPJA 4I99A 2D2EA 2ECKA 2FOLA 5IP9G 4FCWA 3CRMA 4W7SA 2IWRA 1NNEA 2JLRA 1KQSA 2ZJZA 2IL1A 4QRHA 4Q4JB 2OFWA 5L3RA 1OHHD 2QMEA 1AM4D 3KQHA 2O8CB 2GVDC 3KTAB 3CR7A 3K0FB 1H9JA 3KJPA 2X2EA 1E2VA 4GFDA 4IOMA 1YJ9A 1ZNYA 2W6JA 4QKQA 2K32A 4XWAA 4JS0A 2CDNA 2YWHA 3NC1C 4LUZA 821PA 4OQFA 2DUDA 3I72A 1QHHB 3QQ5A 1U0JA 2ZJAA 4EPRA 3N5CA 2JJ1A 3QIAA 4L5TA 1RJ9A 2WPDA 1KO1A 2OAP1 2QRZA 1AA9A 4DLSA 2E8GA 3H1TA 4DXAA 1X86B 3CPJB 3EWSA 1Q3TA 2ZSFA 4XTRA 2Q9BA 3W5JA 4C0HA 4NMMA 2E87A 4OXPA 2UUBQ 1AS3A 3O8CA 3HKZG 4R4CA 4LWCA 4DSOA 2ZXUA 2KCCA 1G7SA 1G17A 1M2OB 4JSYA 5JJIA 4Q21A 2UVQA 3IGFA 2NZ8A 4E09A 5EJEA 1Z2AA 2FE4A 2ZETA 2MSEB 3QKSA 2V55B 5KOYA 3CRQA 4JBKA 3AYHB 3UG7A 1WBBA 1KMHA 2NO0A 3EN2A 1II0A 1FP6A 1SXJB 5GAHC 2LXJA 2F4VQ 3PO3H 2RHSB 1DBSA 1T4GA 4ZIRB 5A35A 4TYNA 4BY7G 1ZM3A 4M4SA 1WI5A 4ZKDA 3QF7A 1AGPA 4DR7L 3VR4A 4IQZA 2ZI9A 3ZJYA 4A3DG 2YYZA 1XD9A 1YZGA 3PR1A 1NMYA 1OXVA 3LXXA 5CB8A 2F3TA 4UNPA 3VNVA 1D2NA 2ZE6A 4LZZA 4QBGB 3T12A 1PYSB 3B1YA 3FMOB 4MGKR 3CCLA 4N1AA 4PC1A 1JALA 3ULLA 2DWQA 1CJVC 2CNWD 5FFMA 1CEEA 621PA 4A82A 2MO0A 3ZVRA 5JHHB 5G3ZA 3GLHB 2YV5A 1T3LA 3R9WA 3T56B 4DSNA 3MFYA 3AKYA 2O8FA 2OCAA 1SRUA 3S2DH 3M4OH 5J3BA 2REOA 4BRWA 4DAYB 1P3JA 3QKSB 1NTGA 2ZRMA 4Q9KA 4HIDA 1YJNA 1X3FA 1J6QA 1IZ6A 2N8NA 1G6HA 1W0KD 3MUFA 3QUSA 4LDJA 2BM0A 1WBDA 4D4JA 5B64A 4KI0A 5C46F 3HOUG 3SFVA 1HNXQ 4MNOA 1XTIA 2EJGC 4A4DA 4DUZL 2PMZE 1W3SA 3TVDA 2O5JC 5DHFA 5TB5A 4F4IA 1S2MA 1ZMXA 4LI0A 1KSGA 4NKRA 1QDEA 1PH2A 3CRRA 4NYMQ 1AE3A 3HOYH 2GXAA 2EXDA 2WWIA 1VECA 1ZC4A 4LNQA 2JA6G 1HUQA 3BJUA 2FXQA 2QORA 3CNLA 1DEKA 3GEIA 1UFQA 3RS0A 4KHZA 1YKSA 1VQ4A 2FG5A 1E2NA 4LFBQ 1FGUA 5IYDG 2FSHA 2CQOA 3FKSA 4PHTA 1MIUA 4X62Q 4OJKA 2F4VL 1IQPA 3BB3A 3L2OB 3RRNA 3ND9A 4ZDIA 4G5OA 1JXMA 2VNUD 1ZU5A 4LV6A 1TWFH 2BE5C 1KI4A 1TUIA 5IWAL 1VCMA 3OEED 3U4QB 3X1WA 4GN4B 2EQBA 3HYRA 2PZFA 3B7GA 1ZAKA 2ZM6L 1P60A 2FEMA 2ZRBA 4FCVA 3TH5A 4CW7A 4WZ6A 1F6BA 2ZITA 5B30A 1W4BA 3ICQB 2QNRA 2VZAA 4KBFA 2K50A 4BPBA 4A3LH 4B3TL 3K9NA 3IRBA 3HU2A 3I55A 4FINA 3T1OA 4L16A 3TRZA 1N6IA 2D74A 2R7ZH 1E9RA 4P4SB 5KO2A 5M5WH 2W2TA 5L3QA 1E9EA 2VIIA 2JEBI 5M3MH 4HAYA 2QTHA 4YWLA 1PH4A 1EG7A 2G1KA 4BASA 3K9LA 4QGUA 5DH9A 2ZTDA 1SXJE 4DT1B 4H1UA 1LYLA 3GP8A 3K9HA 4EAQA 4JSTA 1N6KA 1MT0A 2R93G 5L3QB 3L43A 1AQUA 5FOUA 5GQOA 3EQLC 4LWZA 4UP8A 4WJ3M 5DNYB 4GOPB 4Z8YA 1B8AA 4PPNA 2R6CA 1H65A 1K5DA 4HLUC 4U7DA 3VX3A 4A2PA 3AEZA 1BO6A 3BS4A 1CJMA 1AH9A 4IOLA 1NBWA 4DLZA 1XD2B 1L4YA 5TVKA 3W6NA 2GBLC 2C95A 3A8KE 2G83A 3KQKA 3T5DA 1JBKA 2ZUDA 4EQ5A 3RABA 1E1QD 1BMFD 4I1SA 5JRJA 2X2FA 3O8BA 3BERA 3RS3A 3BZKA 1IJEA 1XXHA 1G21E 2ZYUX 3C14C 4KLZA 4LJAA 4M8NE 4ZI2A 3G82C 1H9SB 5JBQA 5IRCD 4HB2A 3TUIC 1IYUA 3U7EB 4DR2Q 3P26A 1P16A 5F9FA 1XWIA 1ELOA 4URUR 2EVBA 4Y0VA 4MKHA 4LFCL 4A3LG 1G19A 2BBOA 2VY3A 4GLAC 4R1JA 2GK6A 5FBRB 1YITA 2DHRA 4EFMA 3KYHC 1NY4A 4OK5A 2EJMA 1S3SA 4JI6Q 2O5IC 1X3GA 2BBTA 1J5EL 4HDCA 1XCMA 1O87A 5IP7G 3VQTA 1OSNA 1E3MA 4EFNA 2JXMB 2C96A 1I3QH 2FSIA 1DG1G 4J15A 1Y1VG 1Q20A 4IW3B 4IEIA 1Y63A 4JI4L 3SOPA 3RR5A 3LVQE 1SQ5A 5CDFA 3TEHB 1G20E 2BE5D 1G3MA 2PZGA 1MRSA 4OI2A 4A15A 2HCBA 3MCAA 5GAGC 2K14A 3KB1A 4DJTA 3SU8A 2DFTA 2WB1G 2VSFA 4Q4AB 1D6JA 5KYKA 2R7DA 5LMNW 2OBMA 4HAVA 1R10A 2WIBA 4D0GA 2JLXA 1YR6A 3RLFA 2F3RA 4OQMA 1Q0UA 3GTKH 1ZNWA 2C99A 4L4UA 1P62B 1XPUA 4L8JA 3BFKA 3EIHA 3HU3A 2GAOA 4LFAQ 6Q21A 3PEYA 3K8AA 4RD1A 2IK8A 4EDHA 4KMUC 3IHLA 1E9DA 1G4UR 4AK9A 2W6JD 1E1TA 4A3BH 3H84A 4MH0R 4R2IA 5GJVC 5HPYB 1N34Q 1N32Q 4PHFA 3BD9A 2BC9A 1KMHB 3B8HA 3U44A 4CT4B 1RRCA 3QENA 2FFBA 5HGQA 1FMLA 4MGIR 4B3FX 4B3RL 4BBRG 2OBLA 3D4RA 2NZJA 4A8JB 1W48A 3W9YA 4EKDA 4H44C 1NMGA 1CXZA 3Q5DA 5JS8A 2G6BA 1T8UA 2GA8A 2FFAA 5TY0A 3KKNA 4B3MQ 4F93B 3EW9A 4MDFA 1AIPA 1X65A 1IN8A 1KSJA 3T1YQ 2PQAA 4OO1H 4WAUA 3CCSA 2O8BB 3B6YA 2NPIA 4FMDF 4DBLC 2DGYA 4OGQC 2GVZC 3CX7A 3LY5A 4UJ5A 5FBVB 4Q9LA 3HOXH 1NKTA 4P75A 2GXSA 1X54A 4TMVA 1G6OA 5SZIA 1F2TA 3NH9A 3SZRA 1KK0A 4B47A 1KO8A 2EYUA 3AM1A 3BRWD 2F52A 1XNQL 4JYAL 2VP5A 4M0LA 5EP3A 2ALYB 2W00A 4JIMA 2ZR9A 3K7UC 4B74A 3NTUA 5C3EH 2GRJA 4QM7A 3U7GA 1OT3A 4PPGA 1SXJC 4C0BA 1QHNA 4HAZA 1Z7TA 2NN6I 5FTNA 5JMTA 4IPCA 4TLCA 3K8YA 4GT1A 3EBEA 2HJVA 5HCNA 4DV7Q 1HQYE 1SGWA 1Q90A 4E22A 3AVOA 1XCGB 2Z0SA 1KI6B 3BH0A 3BORA 4YLGA 5C18A 3GLGA 3E70C 2ZR0A 2LKCA 3MWLA 3CPWA 1CTMA 4GNXC 1G8FA 2GEDA 2B92A 2QGZA 4GPTA 4LGMA 1KXLA 4YDSA 5F98A 4BLRA 4ZCMA 4UY8C 1NJIC 1NJGA 4L8GA 1DS6A 5J47A 3NHAA 3F8TA 3A4MA 1JR6A 1WXQA 3GLFE 4B3RQ 2ZJQA 5AJWA 4A76A 1GUTA 2FPLA 2CKZB 4JYCA 1Y1WG 4ARZA 2PMDA 5BW8A 1FUKA 4LPKA 1G3RA 1TF2A 4ZCIA 1II8B 1JAIA 2O0HA 1Z6XA 3X2SA 4R4IA 3PXGA 4MRPA 4HZUB 4EPXA 2W0MA 3FHOA 4TN1A 2H7VA 4FN5A 2XNDA 2E2IH 1W2BA 3TZUA 2ORVA 4QBFA 3ZIAD 4PZYA 4DV4L 1E2KA 2EFHB 3B2EA 1S4QA 3PCOB 1W0JA 4NTZA 2A5DA 3L7ZC 4M21A 3I4MG 2UUCL 1EFTA 2TMKA 2JA5H 5IDVA 2Q9AA 1O7IA 1VQ9A 4YXWD 3Q9LA 2K7VA 2B21A 1KSFX 4B2IA 4LW1A 4DR6Q 4LJ6A 2UKDA 4A93G 1KZGB 3HR8A 1VCIA 2IYVA 1VMAA 1JJVA 1K8MA 2RF4A 1O7LA 1G3UA 4B3XA 2A68C 4GRAA 2YWEA 4O2LA 4A6PA 1E3PA 4B76A 1E2ZA 2VH5R 2C77A 5KSPA 1Z63A 4EX5A 2JA1A 3HDTA 3RS4A 1I2MA 2NN6H 2JJ2D 2N78A 4LYFA 2QE7A 1VG0B 5M3FH 1CKNA 5M5XH 4TL6A 1GM5A 4ARZB 1X56A 3Q72A 4G5QA 1W4RA 3BB4A 4JBXA 3NENA 2PT5A 2XNDD 3OEHD 1JR3A 3SJZA 2A19A 4LJ7A 1ONLA 1VYTA 3CIOA 2OE2A 3F0TA 4P0TA 3CC4A 3TLXA 2GJKA 3T35A 1KAWA 2ASEA 2C5LA 5AUQA 4ZV4A 5E4FA 1FJGQ 4H02A 1K5GA 1VQGA 2PLRA 1NP6A 5JEAG 3H0GG 1KMQA 3LA6A 5G40A 4EQ6A 3GLIA 3PENA 3AVYA 2V8OA 4NCIA 4RFSA 2G77B 1Z6HA 5C0XG 2ONJA 5LMNQ 4A3FH 1GITA 1YZNA 2QMOA 4XVRA 2QZ4A 2ZJ2A 4PHHA 1F48A 4BY1G 4K46A 4WBSA 4P31A 3GJ3A 1I4LD 2HV8A 3DO6A 3CKLA 1AS2A 2ZROA 3GD7A 1EK0A 1VHTA 3AF0A 2RCNA 4X66L 2PT7A 4KYIB 3FHTA 4O0AA 1VQCA 3STBD 5C44H 3F5FA 1ZD1A 3NHBA 4I7ZC 2VW9A 5LMNL 1BKDR 4WZAE 1T91A 3QNUA 5GJBA 1Q1QA 1S9HA 4JLOA 1XTQA 3B9PA 4B33A 4BZXA 3OE7D 4C0KA 1GUNA 4GNKA 1XPRA 4V0OA 5B58C 1EGAA 3I4OA 1X8LA 2K5UA 2VRWA 2GTPA 4D0LB 5JECA 3EZ6A 2ES2A 3TRFA 3LQQA 2XSZA 2PLFA 1C0AA 4TMTA 3RN5A 1R8SA 5C4JH 1Q1EA 1YJWA 1N3BA 2D06A 1E0KA 1VG1A 2B8TA 1KDTA 3AVXA 3R7WB 1G3IA 5M04A 4CEIB 3NELA 3TBKA 4F91B 1IHUA 2XGTA 2WIAA 5EXTA 3ZLJA 3PO2H 2P67A 1XJVA 2JA9A 2VHQA 4QHYA 2W0SA 2CNWA 2H57A 3I62A 3Q7PA 3SHWA 1VQ5A 1HE1C 5EUQB 2OAQ1 4FDBA 2HHHQ 5DN6A 5FL7D 4HAXA 1IXRA 4QC2A 4Y52H 3GJXC 1BOFA 1IXRC 1P9NA 2JJ8A 1JAHA 3CO5A 1HH2P 3GTLH 3A1VA 1G7TA 2KCMA 2GAAA 3G4SA 1OXXK 1TU3A 2JJ1D 3RRYA 2R92G 4QBHA 5TARA 4B2PA 3LWUA 4F4CA 3OAAD 4A3IH 4X8LA 3B9QA 3A36A 2A9KA 4G5SA 3AVTA 1US8A 1ZD9A 4LJ5A 4C3ZA 2NOAA 1G291 4JI1Q 5C44G 4DR4L 4UNNA 4ON9A 1A0IA 1FL0A 4AIIA 3NBFA 2J45A 4IVQA 2GJAA 4LBYA 1KHTA 1TNDA 1Z6AA 1SXJD 1I6HH 2CVFA 4BA2I 1BKBA 3M3YH 3CZQA 5TDHA 4A3KH 5ELOA 4A9AA 4DLVA 2PJRA 3PG5A 3W8NA 1U94A 4RSGA 4OHXA 4AQYL 3NE5B 3CC7A 4QY7A 3FVQA 3X1XA 3CQZH 2QEQA 1ZIOA 3BK7A 1W2HA 2HDNB 2XZLA 4MYCA 3IIKA 5AJ3Q 1DAMA 3S2HH 2QRNA 3B1ZA 4DR5Q 4M9QA 1D5CA 4NPHA 5UKDA 1ZCBA 1VQOA 2YJTD 3KKPA 3TVTA 4AD8A 4UNRA 2KSQA 1ODFA 3CLVA 3U6KA 2RGDA 5EE3A 1M7HA 4HB0A 1TWCH 1JQLB 3E5HA 5DHAA 2F1MA 3GJ4A 1NVWQ 1Z0KA 2W83A 3Q85A 4JC0A 2B63G 2NG1A 3K09A 2A1AA 1H9KA 1C1YA 3SN6A 3HKZE 3HOYG 4I1UA 2J7PA 4B73A 5FOXA 1XXHB 2R6DA 2O52A 4W5WA 3NBXX 3CZPA 1OLOA 4YQFA 1GRNA 4G7HC 2GHIA 2XOKA 1A2BA 2F1JA 2KB0A 2XXAA 1ZNXA 4GI7A 3RLOA 4RFSB 2H18A 3ZQJA 4JLVA 3UANA 1G7CA 4KFTA 5FI0B 4EPWA 2VUMH 3S1RH 2QROA 1B23P 4HZIA 5LB2A 1VIYA 3DEFA 1I2DA 1PUIA 2FA9A 4A3EG 1HR0L 2NO9A 3DXJC 2KHJA 1SVKA 3DHWC 4LHYA 4BZQA 2OXRA 3W1BA 4MKGA 3B1WA 3U60B 1OIWA 3SEAA 1XJQA 2ONKA 4JI1L 3GMTA 4AKEA 3M7NA 5K36H 1PH5A 4LF4Q 2C98A 4GZMA 2E2JH 5TXGA 5JCPA 4KN7C 1H9SA 4JOIA 1Z0IA 2RGNA 1E2WA 3UDFA 4IXNA 2WJIA 1C9KA 3RNUA 2A7QA 2BH8A 1H8HD 721PA 4C0LA 2YTYA 4GOPA 4A3KG 5GADl 1I4DD 2HYIC 1Z5ZA 4DLTA 1CULC 5M3MG 1DAKA 1EWHA 1IOZA 1QVAA 2CL6X 3DKVA 4KKUA 5FR1A 1MO5A 5FBLB 3GLFB 2IS1A 1HV8A 1YNNC 1XNRQ 2ZRKA 3P4XA 2UZ3A 2VHJA 4TTPA 2J0SA 3U3JA 1BBWA 4V0KA 4GNXB 1KKMA 3TMKA 1UBCA 2P2LA 4HIOA 4KCGA 1E2FA 3QVUA 4BFZA 4RD4A 1L7VC 1NMXA 1VQFA 1HNWL 2R7ZG 1NJFA 3BXZA 2V1CC 2HIXA 2B63H 2IF2A 3CPEA 4KSBA 4PPQA 1R9TH 3HOVG 4JI7L 1XZPA 4KFRA 2XTZA 3ER0A 1NE3A 3CCJA 4P74A 1KNXA 1UBFA 1XEWX 4B35A 3RZOH 1S3GA 2RH5A 3T51B 2XB4A 1TWHH 5JFGA 1MRNA 3GLGE 2YINC 1G16A 1GVPA 5HY6A 3MG9A 2Q3HA 4AKIA 1DAHA 1CLUA 4FMDB 5FOVA 3K70C 1IM2A 2P5TB 2RGBA 3UIEA 2D2FA 3D31A 3K53A 2QP9X 1XBTA 3J81i 3CBQA 3CCQA 1KKLA 2Z5FA 2J46A 1HR0Q 4P4SA 3H94A 1JB7A 1AQYA 2WFWA 121PA 2ZJ8A 5FR2A 3FKIH 4NB3A 3CP0A 2QE7D 3CD6A 4LC0A 4TWZA 2K75A 4LF9Q 4U02A 4UKDA 4BFSA 3I4NH 2E9SA 2VBCA 1GHJA 5CB6A 1GUOA 4DK3C 1EFUA 3KKOA 4JL5A 4PSKA 5E3HA 2IHEA 1XJ0A 1KK3A 3CWZA 5IHPA 5FOSA 3WNDA 1UJ2A 1NN3A 4LCBA 1Z07A 1Y1VH 3RS2A 2C8VA 1OFTA 1OFUX 4LF9L 3UDGA 4JVNA 5BR8L 2VYFA 4NHOA 4BZPA 4Z1MD 2GVAA 4DV3L 5C4XG 3QXJA 4JKYA 1JE5A 4GSYA 4KLKA 3G6EA 1HZ9A 3KLWA 3CRLC 1VQPA 4M1SA 4JI0Q 2ATVA 3ECCA 4LF5L 4POAA 2ODNA 1MO3A 3TJZA 4YY3L 2UUAL 5FLMH 2DWPA 2JDID 2N1BA 1G8YA 5JEDA 4RMFA 1YU9A 4C0AC 3UE0A 4YCVA 2ZS9A 1U9IA 4CEJA 2GCNA 1JJ7A 2GEVA 3I5YA 3U4ZA 1P6XA 4Q4LA 1PH1A 5BYKA 4A3CH 1KI8A 2REXB 4BECA 4YY3Q 2RHQB 1XMIA 3KUDA 3JZMA 4IDHA 1CKEA 2G9NA 2CE7A 1ANKA 1NIPA 3IPXA 2RGGA 1UAAA 3S1QH 1GILA 2IUSA 3ZGXA 3I8XA 2EFEB 3P20A 1N5KA 1F3OA 3T15A 1WA5A 5JRZA 4DKXA 2EFCB 3HU1A 2OG2A 4JK1C 2EVWX 3ASZA 4Q4HA 3TKLA 1YNXA 1K83H 3WBJA 1XTRA 2O8CA 3EZFA 2C9OA 4NH0A 4QNMA 3GCGA 4RD2A 1SVLA 1J2JA 2ZRAA 2BKUA 1SROA 3A8IE 4C30A 1OH8A 1KAOA 3GLHA 1XZQA 2ZTCA 1FYCA 2ZYWX 2XITA 4CF7A 4LF7L 1E2JA 2QA5A 4WJ4A 3RYTC 1W4AA 4TLDA 4KHPL 5DISB 4BLSA 3RZDH 1P9RA 2W6ID 3V4RA 4PPFA 1VF5C 1W0KA 2XXAB 3W5OA 3M1IA 1EWQA 4TTRA 4ACBA 5AUPB 5EE5B 1GUAA 4BEBA 4LUOA 5CK5A 4I81A 3SFZA 1KSHA 4LF8L 3OZXA 1M90C 1UBEA 2AXPA 4LHVA 3WDNA 3ZS9A 1R0ZA 2C78A 2L5TA 1FNNA 3ZZ0A 1WDTA 2JE6I 1OIXA 5G3YA 4URXR 1W36B 1PFSA 1KO5A 2ZRGA 4D2IA 1OH7A 4JLJA 3OHMA 2J9RA 5TMPA 1XXHE 2KBEA 4DV4Q 2IS6A 3A1UA 1UWVA 4Q48A 4JMPA 1NBME 1PMRA 2BBSA 2ZRNA 3HPRA 2QEXA 1GSIA 4XOIA 2EIFA 2Z6KA 1HNZQ 2IY5B 2JASA 4ASUA 2Q2HA 2DYKA 1SMXA 2CHVA 3S16H 4WA7A 3T5GA 2QAJA 4QGGA 3DLLA 5CLQA 1E24A 2BCJQ 1PH3A 5EE9A 1Z2CA 4UJ3A 3SJCA 2JDIA 3K0AA 1COWD 1E98A 1CKOA 2Q6TA 4KFSA 5KNCA 4DSUA 3W34A 4B48A 1IYVA 2QSYA 1NLZA 2Z83A 4LJ8A 4Q7JB 3RANA 2CE2X 2XB2A 2ZEJA 2FGKA 3JAMi 4QOSA 2ORIA 3TREA 2IUTA 3BC1A 4KJZA 1K6MA 2WB1E 3K0FA 2C35B 3BJIC 2OQ0A 2RKOA 3EC2A 1SR3A 5KNBA 1PJRA 1Z0AA 3G0HA 5FUYA 3QXHA 4A6XA 3I4LA 4Q47A 4URWR 2IBMA 2VA8A 4DB4A 3ZVMA 1AJEA 1Z08A 1Y1WH 2AKAB 4JT4A 1VCNA 4MYHA 2IYRA 3KF8B 1IXSB 4RFVA 4DCTA 1P2UA 1E96A 2I1VB 1DAIA 3TR5A 4DCSA 2GETA 2KA7A 4DR2L 1FTSA 4LF6Q 4PC3A 3PQCA 4BLTA 1W36D 5L3SA 1Q3HA 5KU1A 3UPUA 3A6PC 1FJGL 4C3JH 1BMFA 2B8WA 1J8YF 3AQ4A 4GKJL 2FV8A 3VX4A 4LUVA 4NYJQ 4M1MA 3T1VA 4BFWA 3EARA 3WYGA 1ZBDA 4N0DA 5FBQB 3DOFA 1TQDA 3J7ZC 3CCRA 3QY0A 4DNRB 3A74A 3WHKA 2AHOB 1OPXA 5K8TA 1GIAA 5ELNA 4Q00A 1YZTA 4PZLA 4K81B 2QBYA 1ZM4A 2ODBA 1NN1A 4RY2A 2I5HA 4D0NA 1ZM2A 1P8LA 4KBGA 3VU9B 4DV6Q 3KJHA 2FPKA 3WRXC 4C2TA 2D0PA 4NXNQ 3B6EA 1Z22A 1E2QA 3ZD7A 1WCV1 4L15A 4JCVE 4XWKA 4GLXA 1II8A 4M9XA 4OQXA 4RG1A 5FOTA 4JBMA 1QHIA 5IP7H 2VHUA 5FL3A 3T1QA 4RD0A 4LFAL 4BY1H 4M1OA 2BA0A 4KXFB 2MQHA 3A8TA 4AKGA 1X8KA 2ZI6A 3GTMH 1FL9A 5GVSA 3T1HQ 1TKWB 1V5WA 4C2UA 4EFLA 1D7QA 2WWFA 4NPSA 3EA0A 4DEXA 3EZ9A 4JOIC 5K8UA 4V03A 4TT3A 4BBSH 3CX8A 5LPNA 1OH6A 3NVAA 1YIJA 4HATA 1VQLA 2BEKA 4M1YA 3MEFA 1CTQA 3WNCA 2VSXA 4LUCA 2PX0A 1UEJA 3LGJA 2J7KA 1L1OC 4NXML 3VMFA 4FWTA 3ERSX 1N2CE 4G3XA 3KJEA 4WXRA 3WXMA 5IK2D 5KHOC 2PX3A 1KDRA 5AUNB 1CKNB 2MFIA 5HCIA 2FH5B 2R2AA 4IPDA 2V4ZA 5D3QA 2VO1A 5FTMA 3ICEA 3P27A 4DR4Q 1FR3A 1ZRHA 1LW7A 1X1RA 3SNHA 3UXMA 2RGCA 1OXTA 2R62A 4DCUA 1AKEA 4NYJR 4JLNA 4W5HA 3V00A 1QVRA 4A8JC 4LSGA 3W90A 4GN5A 2A78A 5HR5A 1J90A 1Y14B 1BYIA 1N0UA 2JA6H 1VG8A 1Z3IX 5EE0A 4OL0A 4QM6A 4P72A 4A2QA 3AVWA 2NTYC 2FZLA 4AYXA 4JI8L 2ERYA 2IF0A 3Q8XB 3QG5A 4NYIR 4QHSA 3R8FA 1ZUIA 1Q1BA 4DR5L 5HE8A 4CEHB 2A8VA 1A7JA 1N8RC 1G9XA 4TMWA 4GL2A 1E99A 3EC1A 4IKEA 2GN5A 2WKRA 5E7MA 5KSOA 4DNTB 4LYAA 4OWWB 5E7IA 2K5VA 1WCMH 1XU4A 4DC9A 1GL7A 3SYLA 3U3MA 1TF7A 1YQTA 4BEJA 4OBEA 4HLDA 1PA6A 1G64A 1L2TA 2ZRIA 3EXAA 5C0XJ 2Q2TA 3TSZA 2BV3A 1X1SA 3L0PA 3LH5A 1B70B 4TZ6A 1G5RA 1WFQA 1PYBA 4YDHB 1RIPA 2FGJA 3UATA 1KJWA 5AK0A 4G7OC 2WP8J 3Q8DA 3ULPA 2OLJA 2WVJA 2IA5A 3CM0A 1KRTA 5FLXc 3IILA 3R7WA 1IBKQ 1KY3A 3RRMA 3GLGB 2QPOA 1Q46A 2CVHA 5DYGA 4US2R 2QAGC 4MGZR 3HGBA 4R2HA 4JI3L 4BUJA 1T8TA 1ZYUA 1UBGA 1R0YA 3FKQA 1HE8B 3LW7A 4BQSA 5BXQC 3BGWA 1E79A 4OJQA 4YMVA 4MRSA 3CW2C 5FPYA 1K8RA 4KODA 1JEEA 4A2WA 4YHHL 4DDWA 4DUYL 2ZS7A 3PEUA 3BFVA 4MA4A 1W5TA 3A7AB 2WKQA 3AKEA 4CDGA 4L5BA 2NO7A 3C5CA 1GZSA 3D7MA 3HKSA 3S17H 3UK6A 3WYAA 1L0WA 4BFYA 4N3NA 3QKTA 4Q4AA 4URYR 4EPYA 1CIPA 5HTKA 5L8VA 2ZRJA 4GMXA 2HIVA 2JAQA 4DV2L 2WICA 2VUMG 1X6VA 2CMKA 2YZ2A 4OK6A 3TK1A 1WQ1R 4LJYA 1E4VA 4IRUB 4M1KA 3SQWA 2IC5A 3ZZUA 1PH7A 4A3JH 2UUBL 1MR3F 1OIVA 3SJAA 4CYMA 1GP2A 1IBML 1OB5A 2XGJA 1OHHA 1AE2A 4HIKA 3GQBA 2NVYH 2PNHA 3CNOA 4HEJA 1GTVA 1SLJA 2ZSAA 5KNDA 2A6ED 1X55A 3GJ8A 4JLAA 5IYBG 4ABYA 4K0KQ 1E79D 4Q9HA 5CM8B 1W36C 4OHYA 4ZCLA 1LV7A 1E69A 1NI3A 3BOSA 1AZSC 3M4YA 1ZJ6A 2FJUA 2XJ4A 3D0FA 5K36G 4KV9A 4DDUA 3QPUA 1UM8A 3JZAA 2ZE5A 2VF8A 4L9SA 3KQLA 2EJFC 2AMCB 2WMOB 3DDCA 3L0SA 2NMVA 1HZCA 1ETUA 4AG5A 4RCNA 3FWYA 3W1GA 5G41A 3QXXA 4TKOB 3WHLA 3WP1B 1A5TA 1QHYA 1RYFA 1YZQA 3ND8A 5H68A 1RC8A 2VQSA 1A82A 3CRVA 1U2RA 3H2YA 4BRUA 1MO4A 1JXOA 3RRZA 2JLUA 2WSSD 1OXSC 3OOCA 2REBA 5CIQA 3SYNA 1R0XA 3J81j 1NLFA 1K9MC 2ZJPA 1JJGA 3AP3A 4UP9A 1DD2A 3L8ZA 3TE6A 3ZS8A 2YHSA 2KE5A 2O0JA 3QF4A 3MXUA 3U61B 1R6BX 3P1JA 4JVMA 3RLNA 4RZ2A 2QQ0A 3TNFA 3RAPR 2E76C 3LBIA 4JI0L 5KDDA 2QTVB 2BH2A 1UPTA 3AKCA 4K8OA 4B43A 1IBLQ 4IOJA 1H9MA 1F2UB 2HT6A 3K0CC 4Q7LA 1UEIA 1ZVQA 2ANCA 2MSCB 1CI3M 2OHFA 4KO8A 2DB3A 1GJXA 3S15H 1DTSA 2ZT9C 2ZE7A 1FQJA 1E9BA 3M85A 2CLSA 3THWA 3EZ2A 3U3OA 2ZTEA 2EW1A 3NBHB 1KI1A 5BN5A 2QU8A 3T61A 1SHZA 5IYBH 2ZI5A 1ASZA 3AGPA 5TV2A 5E95A 1N6RA 1IN7A 1VDZA 2AD5A 2JQOA 2QMHA 3I1FA 4Q1CA 5BWMA 4LK2A 1JI0A 4JI5L 1H9RA 3STBC 2IEYA 4OO1G 1ASYA 3UDIA 1EESA 5DYIA 2JLYA 4LJZC 1U5KA 5IWAQ 1ZM9A 2CHQA 5FBWB 1S0UA 2IUUA 1T6NA 1UKVY 3NIBA 3CCEA 2ZYVX 2PNRC 3OYYA 2EWVA 2RB4A 3FKSD 2PBRA 3FPAA 1WP9A 4KU4A 1QVGA 1N5LA 1GL9B 1JB1A 2G1JA 2F43B 3MRSA 5A0FA 1VQKA 3R9IA 2CWPA 5GROA 3EA5A 4DLWA 2E75C 4YMUA 2CCKA 3DPUA 5C4XH 3CMEA 3BBPA 3EIQA 4S35A 1CF4A 1EIFA 1M6NA 2DY1A 1ZINA 4KHPQ 4DNIA 1HEIA 4B3ML 4A3GG 2WSSA 2O8FB 1YE8A 5F3WB 2ZSEA 4WIAA 1MJCA 3PIPA 1OV4A 1BH2A 4DV1Q 2Q0HA 4YC7A 4B34A 3VNUA 1T3SA 3HOXG 4BFXA 2ZRHA 1IBRA 2FEOA 3X1DA 3GTJH 2YOGA 3AP2A 4D82A 1A4RA 4DWJA 4HB4A 2NVXH 4JI6L 4FMBB 4M1TA 3NEMA 4JI7Q 2WJHA 3I3SR 4XSHA 4DKAC 1RRGA 3REGA 2AHOA 5A4JA 4OHWA 2RMKA 3UMRA 1LY1A 2IWHA 3THYB 1UE1A 1MV5A 1Q8KA 4FXPA 1YZKA 4MGYR 4D6PA 4C9BA 4DR1L 4DCVA 2A5FA 1FUUA 2AXNA 3MGCA 1Z6YA 4OI4A 4P32A 1OXUA 4ILEA 4AWXA 2YTXA 4UXIA 4PO8A 1RL2A 3KDFA 5CK4A 5EXPA 2OV2A 3R8CA 1L1OB 2RGEA 4BXXG 4ERNA 1UE5A 1NBMD 2PJZA 4V02A 3H0KA 2IYZA 4KITB 2ASBA 4DV7L 3G5UA 4HLUA 4ZI3A 4WW0A 5L3SB 2UXBL 4QGAA 3QE0A 4RKEA 5FTKA 3TW4A 5JI3E 2NGRA 2WZQA 2E2HH 3QEOA 2ZJBA 1SVIA 1OE0A 2QENA 1XF9A 3ZH9B 2G0TA 3EASA 4R71A 1KZ7B 4TLAA 1COWA 3ZQ6A 3I4MH 4OI0A 1MKYA 2UXBQ 4G5RA 2FN4A 3WP0A 4DV3Q 1KI6A 1K73C 4RCYA 5HZHA 3HOZG 5LBIA 3GDEA 1PV4A 2JCSA 3A1WA 1TU4A 4DK0A 3C8UA 4ZO4A 5KDOA 4TVAB 2XZPA 1NMFA 1KC8C 4LRWA 5EP1A 3MLEA 3UWKA 2ZUBA 2LMCB 1VYUA 1N36Q 4D80A 3RC8A 3M9BA 4MKFA 3PUVA 4A3EH 1P61B 1IY2A 1YZUA 4L5RC 1G51A 1ZW6A 4JL8A 4URZR 5H70A 3U44B 3ZVNA 1DARA 1N36L 1FMJA 3KZ1E 3QPWA 3K81C 3HOWH 1N0VC 3DM5A 4DR6L 5FJ8G 2RGAA 3KFVA 3MMPA 3N6RA 2XSZD 3GO5A 1N5IA 4POGA 1E32A 5ANRB 4FW9A 4TSFA 5SZKB 1IY0A 4KVGA 2NN6G 2CCZA 3H3VI 1OFIA 2AK2A 3RVBA 2JEOA 2Q3MA 3KQUA 3IKJA 3KDSE 3BG3A 1IYJB 1U99A 3FHCB 3B78A 2OFOA 4OHZA 2FZ4A 2J1LA 3MAAC 1Z8FA 1J70A 1XD8A 5JZVA 3QG1A 4GMDA 1WE2A 3B13B 4NZYA 4PZ6A 1WF3A 4Q7MB 4BGDA 4YONB 1KO7A 3T1TA 4APVA 3GJ6A 2QI9C 1IW7C 2A69C 5C4GB 1Z29A 5CIWA 3L8YA 2ZM5A 3PGZA 4A3BG 1E2LA 3C41J 4JJZA 4IOKA 3A4NA 3Q7QA 4RJLA 1RW4A 4LV8B 3VKWA 2FU5C 4PSVA 4B2LA 1TWGH 3T1YL 4X6AH 1IL2A 1RRPA 2F9MA 4B3SL 3OE7A 3ZYCA 2ZJYA 1JR3D 1E7ZA 2R7FA 4QGFA 2ZS8A 2J0UB 1SZPA 4LYHA 3TAHA 1E9CA 2ZI4A 3I61A 1XDBA 2YOHA 3E9IA 2XTNA 4NXMQ 3GLFA 1HNZL 1GVNB 4HUTA 5HKKD 1DAGA 5JS7A 3ADBA 4Q9IA 3GEEA 2O8EA 5JWOA 1OTCA 3J7A5 1W44A 1AZTA 1D2EA 1W2GA 4JVLA 3VTKA 1QF9A 2E74C 4C4PA 4IFDG 1SKYB 2NPFA 4C7OA 2R44A 4R4TA 2H1LA 2B7CA 2BBWA 4JZKA 4LX0A 4HI0E 3WMGA 5G53C 2G3YA 2E5LQ 1EFWA 2B6HA 4TT3D 5EXXA 3LNNA 4IOCA 4OWTB 3NXSA 1ZYRC 5CLLA 3UMFA 1QHSA 4QNRA 4DR3Q 3WRYC 2ZAOA 4DV5Q 4HJAA 1S96A 1D2MA 2D5DA 3CWQA 2AWNA 5FTLA 3DM3A 4YCWA 4A3MG 1S40A 4IFEA 2PL3A 4B44A 3ZIAA 2P6NA 1G8GA 2GJ8A 5DIFA 4MYUA 2HUPA 1GDDA 3OEEA 1DG3A 3CCMA 1XFAA 1YRBA 3OIYA 4PAOA 2IHBA 5C4MA 4NDZA 1D8LA 4IJMA 1Y69U 1CSQA 2ZI3A 4GNXA 4D26A 2BOVA 5ELXA 3T53B 4CGZA 4TQUS 1CBUA 1QUQB 1Q1ZA 1XMJA 1QG4A 2ODEA 4BFVA 1CP2A 2BMDA 4A3IG 3EG5A 3ZZTA 5M5YH 1QVCA 2FFQA 3UE1A 4LJ4A 4UNQA 2CL7X 1N33Q 3JVVA 1SE8A 2ZUCA 3LLMA 1GUSA 1OB2A 4AIMA 4PO1A 521PA 3CAMA 2VP6A 1HZBA 4IFDJ 1ONBA 2C03A 1B7YB 5AWFC 2YC2C 1VQDA 3GJ5A 4TYYA 4NONA 2PEZA 1LM0A 5F2EA 4BBSG 1M7BA 1SN8A 2W2XA 2K4KA 2X77A 5A5GA 1KTVA 2Y0SE 4C3HH 2F6RA 1T0JB 4HUQA 2FMXA 3S1MH 4PSAA 1SVSA 1EQQA 4OI1A 2ANBA 4JL6A 3KJOA 2CXXA 4IFDH 1Z0DA 4JI3Q 4IDPA 2K33A 2XAUA 3KJGA 4IFBA 1ESMA 1S3OA 2OILA 4Q19A 3OEHA 4MUAA 2OFXA 1G18A 2K52A 2KJQA 2O8EB 4G7ZC 2OT3B 2HF9A 1T9HA 4DV5L 3O8RA 4Q66C 2IS4A 2V9PA 2XOKD 5IT9c 4OX9Q 1OKKA 1SXJA 2HLDA 3AGQA 4QG7A 4B75A 2JK8A 3PUYA 1CR0A 4PG3A 2EQSA 3UDXA 3OTOL 2F9LA 4Q5IA 1SVMA 4TYWA 1WRBA 3EIVA 1JJCB 4DV2Q 1TQ6A 1TF5A 2AKYA 2EFDB 3H3VH 2KCTA 4AC9A 5IF9A 2HEIA 1JEDA 3QKRA 3AVVA 4PQRA 2A6HC 3B82A 4YXWA 1E1RA 3VR3A 4TTQA 2B3GA 2ZJRA 3J81k 5B57C 3QEJA 3AF1A 4IO9A 3BH6A 3D6TB 4LY6A 4AI6A 2JLVA 2ZTSA 3AB3A 1E9SA 1B9MA 1IJFA 3HFZB 1QHXA 3BH7A 1N33L 1CJKC 1GKYA 2OXCA 3C15C 5D3MB 3VHLB 3QJYA 4QJ3A 3FPPA 3LAWA 4B3DA 4EPVA 4DV0Q 5C2JB 1W5SA 1YZ6A 4Q1BA 1XTKA 2ZPTX 2PH1A 4AYBG 4A3FG 3QVVA 1Q21A 3FE2A 3O47A 3C16C 2CCGA 4JG2A 2H8KA 2VHCA 4M9SA 3RS5A 3I92A 2JIZA 1B0UA 1KJZA 1XMOQ 2VP2A 4DUGA 4A0RA 3MJHA 4A0GA 2GCOA 3K70D 2OTJA 1FPMA 3HPQA 4TZ0A 3U4VA 1J7KA 2AK3A 1TU2B 4MRRA 4UP7A 1PLLA 2Q9CA 2WKPA 1TEXA 2GF9A 2Y0SG 3TW8B 2YKGA 2WAQG 2A68D 2D7DA 4L5SA 1VQ6A 3OIWA 4Q02A 2DWOA 5JHGB 3QXCA 2GNOA 2DN8A 2PPBC 4JVSB 5L3VA 4OHVA 2CW0C 4QIWE 2WAQE 2CK3A 4HDOB 1I50H 4M2LA 4TLEA 3LV8A 3FKIG 5AJ3L 1HNWQ 1IXZA 1G8PA 2DFNA 2HYDA 2VHTA 3OTOQ 3D3QA 1E2DA 2A6HD 3LWNA 4EJSC 4QL5A 5JJLA 2ZAMA 2NO6A 2Q8IB 1T5LA 2GZAA 1ZCAA 4G1UC 4G5GA 1SULA 2PCLA 1U9IC 1X3SA 2JLSA 4R4OA 3KFUA 4MQBA 3RS7A 2P6UA 4UNSA 1JQJC 1R5OA 4V0MA 1LF5A 2OESA 4QQBX 1E0SA 3I2ZA 4OYHA 4ZIRA 2CLCX 4IJHA 2Z43A 1CUKA 2OZEA 4JI2L 1FNMA 2QQEA 2AKWB 3A58B 3VR2A 1XNJA 3FDIA 3CH4B 1W49A 1A8VA 1NVVQ 2WAYA 3LLUA 3N70A 4PO9A 1EXMA 2R92H 1Q57A 1QZXA 4L9WA 2CJWA 4JI5Q 2OCEA 2UU9Q 1YHBA 1R5NA 5DSZA 1HPCA 3A5ZB 3BZCA 2BCGY 2QN6A 1IW7D 2EWWA 3C4JA 3LO5A 2QF7A 1OFHA 4IVPA 5K8LA 1NN5A 2QMUA 5D3MA 4CT5A 4ESVA 5KSZA 4DUYQ 1GWNA 3BWDD 1E2IA 2I5LX 3J80c 1KNQA 5BR8Q 1LB1B 4AQYQ 1XX6A 2BMJA 1VQ7A 2FSFA 3V9PA 3EPLA 1OJLA 4LF4L 1E94E 1T3HA 1UF9A 1X8JA 4KN4C 3IQXA 3SYKA 2R6GA 4OWXB 2VF7A 3GFOA 1LUZA 1US8B 1EFRD 221PA 1EX7A 4ZDKA 4II7A 3LQRA 3BU2A 3AUYA 4LBVA 4NCKA 4GOJA 4YMTA 4PQFA 3THWB 5JWHA 3MWYW 4GLVB 3CUEF 4A4IA 1NLYA 2IEZA 4P4UA 3KTAA 1ZD8A 3GJ7A 1KD1C 1JMCA 3DZDA 3KF6A 3EWAA 3QXSA 3ULJA 1A6XA 4HJ7A 1XTJA 2I3BA 3ONWA 2AX4A 4FIDA 4ZKEA 4A0FA 1YJ5A 1Z0JA 3AEVA 1P5ZB 4POFA 5GJWC 1TEVA 3IEUA 4K0KL 1WOCA 1FQKA 1Q22A 2VEDA 5HZKA 2LWIA 4X62L 3CF0A 5LDDC 2ZI7A 3LD9A 3FP9A 4DR1Q 1LTLA 2OO7A 1Y8PB 5J4HA 2A5JA 1CKMA 5JEEA 2OM2A 2K5NA 1SKYE 1M34E 3KX2A 4CEIA 2EFGA 2NZOA 4WXPA 3SI7A 1HR0W 3PITA 4E07A 2VL7A 3FFBA 2PI2A 2ZM6Q 1SHKA 2BDTA 4R9UC 2JLZA 1YEZA 4P71A 3QBTA 2GF0A 4DLUA 4CRWB 1UEBA 1U8ZA 1JPJA 4CZ2A 2E1RA 5JCZA 3THXB 1CSPA 1E2HA 1JECA 2WOJA 2UXDQ 4LF7Q 3HWSA 3OIVA 1G6PA 3DMNA 2F3IA 2ORWA 4LYJA 1WJJA 3MD0A 1RRFA 1WCMG 3B1VA 1KDPA 1NVVR 2NQ2C 3GFTA 1QG2A 1EWIA 4DPGA 4HDQB 1DAEA 4PANA 5DI3B 2W58A 3TUZC 4DT1A 2OCYC 4LF8Q 1C4OA 4HZUA 3KOJA 1NSTA 2VS1A 2EYQA 3JVUA 1CFMA 4Z8XA 1N0WA 2IYYA 1CS4C 4BFUA 4TQ9A 4PAQA 3AKDA 2QY9A 3WY9A 4XTCS 1KAGA 3VKGA 1RFLA 3CMAA 1WB9A 2B8GA 3QF4B 2AFIE 3WMFA 2QPAA 1OH5A 2QAGB 1SMYC 2BDOA 1QZHA 2JJ2A 2Q21A 3VA7A 2DFKB 3HOUH 3C5HA 4TMKA 1KYIA 5EUMA 4DLXA 3NBZC 3CR8A 4NCJA 3K0XA 1XP8A 1PLKA 4V0NA 4BLOA 1BIFA 3F2BA 1MO6A 2GK7A 2P6RA 2CCJA 2ZRDA 1PH8A 3KQNA 5J4VA 4XSGA 4X64L 3VAAA 2BIFA 3U7FB 2RHMA 2PEYA 2CJWB 2WWHA 1DVRA 5LMUQ 1N9WA 3AVPA 4DDVA 2DPXA 2P65A 2ZRCA 3Q5EA 5C1BA 2BEJA 2O8BA 3EX7C 2BMFA 1X3EA 1GAJA 2Z4RA 1RPZA 2V3CC 2DR3A 2OLKA 4KYUA 2JATA 1N32L 3K0AB 1KIMA 1YR9A 1S9DA 2DBYA 4RD6A 4UQOA 2G88A 5AJVB 1JNYA 1GNQA 3PVSA 3CCUA 5KDLA 5P21A 4DV1L 5CYOA 2IHFA 1KIXA 2C2HA 2VLIA 4IHQA 2B8FA 3K7AH 2D7CA 4PC6A 1LACA 3P32A 3PUZA 4QFMA 2YTVA 2WWYA 3A7LA 4LBWA 3BE4A 4GP7A 3HR7A 3IIJA 4MZ9A 4LF5Q 2QT1A 2RAPA
chains in the Genus database with same CATH superfamily
1RM3A 1SKBA 2Q1UA 1P1KA 2NQ8A 3GA0A 2CWAA 4OFWA 4IZ8A 4Z51A 3EQ7A 3PHJA 1CT1D 2A9QA 1GRQA 2X5OA 3IUYA 3V8NA 3LFTA 1LTSD 4JGGA 3E2IA 5DNCA 2PQAB 3D0OA 1PW5A 1UWLA 5JMWA 1D7OA 5HIAA 2MSDB 1I5OA 1XEFA 2ATCA 4PQYA 4DLPA 2E4YA 1ABBA 5IE8A 1S1CA 1SQFA 1Y82A 4HOYA 1Z18A 2JVKA 3OTGA 3VR5D 3S6JA 2OYRA 3NHZA 3GTKB 2R86A 5JJKA 1HT3A 1UBSB 3KIPA 4ALNA 5JSZB 2O8DA 3T3IA 1SKQA 3LT1A 5DM70 1FU7A 2CGEA 3OTWA 2V3VA 1MH1A 3DAFA 3PLNA 3OQPA 5ESWA 4P3XA 1QGOA 4OKSA 1MJEA 3UJ7A 4BO1A 4DUGD 5BN1A 4D3FA 3HDVA 4JKOA 2AZDA 3DS8A 1LS6A 2BMEA 3OJFA 4LTDA 4MWDA 4HB0A 2C8LA 4QMGA 1E9AA 4XWGA 4RGVA 4V0QA 4YBZA 3QW4B 5LUBA 4PAWA 5ALTA 3UJDA 4G4IA 2XZOA 4BC0A 1KI7A 1YS2X 2J59A 1V2GA 3IDAA 3MUEA 1KGDA 2DJGC 2IH4A 4O2RA 1E58A 1E92A 4WFQA 2A30A 3CKIB 2JIZD 3AV0B 4G01B 1YC2A 1D1SA 2QUHA 1WMAA 2D59A 3GH3A 4AKHA 3VUFA 2L19A 4PXSA 3GDHA 4AULA 3A04A 4CLXA 4CM3A 4C1BA 4GDFA 4LK1C 4WZBB 5HZHA 3GLIE 3USCS 1BU5A 2JA8G 3SMQA 3N0TA 3OAAA 4LXHA 5EJGA 5GV8A 5HIJA 3SAJA 3VPSA 3EVFA 4EVIA 2CFMA 2EZ8A 1DADA 3UK0A 3ZTYA 1QHHA 4GM4A 4Z54A 1R1DA 3TJRA 4QUHA 2VHYA 3PTLA 1TAGA 4EUNA 2JA5G 2PV7A 1TCAA 1TPZA 4M8SA 2DCMA 2LCFA 4MV0A 3VM6A 4FQ7A 1JXQA 2IVZA 4R1QA 1OI4A 4HIMA 2OXFA 3NAZA 3QJGA 1N6OA 4DCJA 1KQGA 2ICIA 2VJAA 3FKIB 4K1LA 3AXTA 1ID1A 1HLFA 3JQ7A 3IAAA 3C3EA 1U4NA 1Z62A 2LRHA 2ZJOA 2ZQ5A 3MWFA 1YJQA 3O1HB 4L22A 2V6IA 1D07A 3KUKA 5HZMA 1A63A 4PTLA 1KEKA 3AFGA 3FDZA 5JNRA 4C0QC 1ZUHA 1G5TA 1AG9A 1P2TA 2JAWA 5DK4A 2L4NA 2PI2E 1PJ4A 2WPDD 3E22B 1GGFA 1JLLA 1GU1A 2V7QA 3EQ2A 3IVXA 2IU0A 3ZHOA 4BE4A 4HH4A 3MXNB 3CEJA 1WPRA 1MDFA 3PJEA 3SD7A 1N7GA 3CNEA 2N49A 4HLCA 5G02A 4XWTA 4AYTA 1JEQB 4EKGA 1D1QA 2Y0CA 1KU0A 2HXYA 1EJ0A 1J0DA 2AS0A 2IYQA 4YRMA 2IXDA 3NBYC 1YC5A 2DUMA 1LT4D 2ATWA 2ZU6A 1LEHA 5EWJA 5AHOA 4E33A 4CF4A 2AL7A 3QI2A 4MO9A 3OFVA 1XZDA 3KXLA 3PICA 3BVMA 1G2PA 3HCWA 4RHEA 3E7XA 2XQVA 3MJVA 4YJ3F 3RSFA 3RRBA 4BJ6A 5GZ3A 3LW8A 5J2UF 4LSMA 1QZUA 1SJ9A 1U8AA 3RCBA 3IAUA 3A3KA 5L7YA 1TYBE 4DAVA 2BEWA 5HUQA 4LTMA 5KX5B 2QP4A 1BS1A 1QJOA 3TSOA 4M9ZA 1M75A 2MYNA 4GX5A 3SVMA 3VAYA 2JZOA 4QQKA 4F4UA 2P5SA 3H0CA 5HJ2A 3EPJA 3TCXB 4H17A 4PHCA 3EZ7A 2I2AA 4ZVPA 2W5UA 2LKVA 3EVGA 1MDBA 4PGFA 4TROA 5FTJA 3WIOA 1I2AA 2XZDA 3W3ZB 4W9MC 1AD2A 2WM9B 3HU5A 1K8AC 4ECAA 3GTQH 1LBHA 1I8TA 1PEDA 3ZJYC 1NG1A 2ZIAA 5IBCA 4JYAQ 2IHYA 3E8XA 2IXTA 3VNBA 2PD3A 4BGIA 4EW1A 1FS5A 1LLRD 1V8QA 3T8YA 2VUUA 2UZIR 4NXNL 1GZHB 4DGSA 5LIPA 5L6LB 5FNVB 1HT0A 1N25A 2WABA 3EGIA 5COBA 3KB2A 2QTTA 3A37A 5F5NA 1JFLA 3ZOKA 4P7BA 4BNDA 1A5BB 4OLJA 2K5WA 2B69A 2GO1A 2X6RA 3SXHA 2IYSA 4K5QA 3GX1A 2JA7B 3BZBA 2C2KA 3ZV4A 1RWWA 4B32A 3BGDA 4MGHA 2UYGA 1XFDA 4CVNA 4MR8B 4ZRZA 2J3EA 3DKPA 2OYSA 1SU6A 3EQ9A 3OF5A 4K6KA 5CGZA 4DLRA 1JLKA 3IMCA 2J3QA 1C3EA 5CR3A 2B5WA 2JKZA 2NTVA 3FMFA 1JIKA 3NJ4A 1IB6A 5HA5A 4YCMA 1Q74A 3L7OA 3T7EA 1A3TA 1Z28A 2R25B 4KR3A 4KWEA 3QWNA 4RDCA 3FMCA 4JW0A 1RAFA 4INJA 4X66Q 1TS3A 2YRWA 3Q7SA 1XDDA 1W9MA 1G5FA 4DYVA 1R5BA 1IKLA 1XP5A 4JI0B 4P4LA 3B85A 3KQYA 3L6OO 4PRZA 3QU9A 3JPWA 2P90A 1E0BA 2ZBQA 5FA5A 5J2TA 2PYIA 3EG9B 4B3BA 4GOXA 4CHTB 3AG6A 3Q3JB 5JAHA 3AFPA 1F4LA 4UM7A 2Q8QA 5U4QA 1N2ZA 1B1CA 4EATA 5JLJA 4QICA 2CHGA 5K0EA 5HILA 4AQ7A 4MYTA 3QOWA 4NDAA 1F7VA 1HSOA 4KG7A 1XTDA 3CF2A 2BEUA 2IX9A 2YOFA 4Q4JA 2Q27A 2LSSA 3IMEA 3WWEA 4L2IB 4BNNA 5JNLA 2G70A 1RHUA 3WFIA 3M1LA 4Y7DA 5JADA 1LRLA 3SHLA 1ZVMA 4IDGA 2J9YB 4IDQA 4ZC8A 1T8SA 3C3XA 2ZJ3A 3UG6A 2QMYA 2QLNA 2ZRLA 3I5MA 3TAUA 4RL4A 5JWRA 3ORYA 2IDKA 1EP9A 3PUHA 1R2QA 2W6IA 4G5FA 3VHLB 4BNXA 3KU4A 4A3EB 4HQOA 4YASA 3NWTA 3WJ1A 9ABPA 1SCAA 3V7YA 1LTGD 4YHHQ 2HXSA 1GZUA 3BIWA 1BKYA 1NXTA 3ORHA 2XDAA 2NW6A 2OYCA 4F71A 5A3JA 5AKXA 5J58A 2YWFA 1GA4A 3DDUA 4WD3A 4MV8A 3D0RA 4FDTA 1N2EA 1JU4A 1N0IA 1O94D 3JAWA 5EAIA 4N39A 2QSZA 2DY7A 4C7KA 1CB7A 2IYAA 4DWOA 3B3FA 3A3YA 4ZYSA 2PLWA 2QU7A 5BNIA 2EGUA 3KLOA 2R8EA 3ZD6A 3R8BA 2PL9A 2IXEA 4IHJF 4M6WB 2F0MA 1EGHA 1V1JA 3KJIA 4KPUB 1Y3AA 4OA8A 2ZXPA 4OQQA 5E3IA 1LTQA 2HK7A 3CPHA 2PXXA 1ZVVA 3BTVA 3AFQA 4FT4A 4P86A 3VR5A 2PGIA 1A2QA 2VDWA 1B3AA 1SHUX 3EIEA 3T52A 4AJ4A 1H5QA 3MWJA 4P9NA 4EDFA 1FZQA 5JCXA 4QU0A 4RTPA 1IBKL 3ZE8A 4PZ8A 3Q10A 1GG2A 3MCUA 4IQFA 3ZQ4A 3GFVA 1VQJA 3HBLA 4DNPA 1PNTA 1K8ZB 3TIFA 2Q3FA 3VKHA 2X6QA 1V9CA 4O8CA 1VQAA 1Y7IA 1IOLA 3MTSA 1KTKA 1B0PA 5DU2A 3ZD8A 4RK7A 3WAGA 3M6UA 4HGZA 3NUCA 5C35A 5ECYA 2O14A 4CQMD 3MRXA 1I0ZA 1T2FA 2NVOA 2C84A 4C29A 1O4VA 2GBFA 1I5FA 1GRRA 2XWBF 5ALGA 3BREA 5ALFA 5EJAA 2I6UA 4GLBA 5FNVA 2YJ6A 5ERGB 3F3SA 4NCNA 1IN4A 1GHKA 4YAOA 1WD5A 3T9CA 3TI9A 5JS6A 3G1WA 1HQMC 4LMRA 1Z45A 1B53A 4NRDA 2RE8A 3DG9A 5IN4A 4KX5A 1HYBA 1MC1A 2OCLA 1P72A 2O7SA 4I4LA 4NBUA 4I1OA 1M4VA 3BFXA 4UXHA 2IW3A 3LYAA 4K88A 4OO1I 1TOAA 4ZOQI 2AUJD 4H13C 1M8PA 2FW6A 2PNFA 2V6BA 4E5UA 4DJAA 2XNSA 1H6BA 1UKZA 4UUOA 3GR6A 2ZBRA 4X71A 3X1KA 4NZMA 1PP4A 2UYYA 1AUXA 3L7YA 5CX4A 2JFZA 4JI2Q 2C31A 1WXWA 3F5DA 3K0EA 4LQ4A 3CZAA 4W8GA 5ALEA 4JLDA 1PHRA 1QH8B 1PEYA 1WIWA 1X80B 2WVHA 1LDGA 3HOZH 1GSAA 2X1LA 3N59A 1LLCA 5C5MA 5DEIA 4EW3A 1B9NA 2A8YA 3WIBA 5ISMA 4JV5B 3G88A 1B93A 2R7NA 3R09A 3PFCA 2HJGA 2V0CA 2PCJA 3I34X 3MT8A 4UBKA 4Z1MA 1TD1A 3MRTA 5ER9A 1SC9A 1P4SA 3W5CA 1C0KA 3LRPA 2FZCA 2ZJFA 1ONPA 3T34A 3A1TA 1SSOA 3MWDB 3BTUA 2N42A 1CJBA 4HRAA 4OQLA 3T5TA 2R5FA 3L7JA 4G25A 2N3SA 1P7YA 1EFHA 2IOYA 2JEZA 3C3YA 4NAUA 3PQEA 4TYQA 2G82A 3OQJA 4LIPD 5C4XB 2ODAA 2OSBA 2Z57A 1C1HA 3DEIA 4FMPA 2B29A 5CLGA 3WSWA 4OLAA 3V4FA 3N2GB 5JZSA 1M2JA 4L0DA 1HZJA 2AYZA 2PGNA 1Y8OB 3SE0A 4IX9A 4KO2S 3ZNQA 1EP2B 2LXKA 3E22A 3A6JA 4ZI7B 1RXVA 1A8IA 2DNCA 4OM7A 3TLJA 2BI7A 3UFXB 4F5DA 2N47A 5C4JB 5ICSA 3FNHA 2AF3C 4EVOA 1H95A 1C3JA 1SCQA 3AR7A 5JFTA 2Z6BA 3C45A 5E7NA 2W6CX 3KYIB 2L15A 2B0CA 1A8HA 3KZKA 5H7XA 2OO5C 3ZQUA 4G26A 1K0FA 4YRGA 4G23A 3K9QO 4Y2JA 3EGOA 1P2SA 3GLIB 1BXKA 3UKDA 1CCWA 4K0RA 3RSCA 4AKTA 3SDZA 3IEIA 2J3IA 2C42A 4RV5A 4I4TB 1Y9EA 2V4DA 1EX6A 5JOBA 2ID9A 3ANYB 2G06A 3O26A 4WLFA 2ONCA 5EKSA 3QTBA 4N47A 2P9EA 4HT3B 4YMIA 2VTKA 3ZHSA 2AXQA 4EYSA 5JBNA 3OCJA 1VQMA 8OHMA 3W4IA 1ZMBA 4TL9A 2BR4A 1F0YA 4MX8A 4KPYA 2BGKA 2PRIA 2YW9A 5ADVA 1A9SA 1ENPA 1C1DB 2R5NA 5T1GA 1EWRA 2I3GA 2YIMA 2QTVA 3DB2A 5ELCA 1YS4A 3MBIA 4YXFA 5B7PA 2ZANA 4P7FA 5KINB 1EDOA 4EG8A 3NU1A 3Q3GE 2ZVDA 2RBEA 1J0BA 2BFBB 2AI2A 3EEIA 4YCAA 3SQNA 2XQGA 1H94A 3G02A 3QA3E 2K05A 4G65A 4JUAA 4V38A 4WN9A 3QK7A 5LQKA 1GO3E 1QVVA 3WYFA 4CODB 1N8TA 4JOSA 4CG3A 2HA7A 1YI2A 2ZB8A 3K2QA 5EJMA 3K7AB 1XT6A 4EIWA 2ENUA 4ARBA 1JIUA 2HSGA 3LI2A 1U1EA 2XMDA 3FVWA 2Y0DA 1SE2A 2YNMA 2UUAQ 1K7YA 1YJBA 5EZSA 1BQEA 5I8WA 2O8DB 5IT9A 2K5DA 2N46A 3SDSA 4YPOA 3BXEA 1HFGA 2QS9A 2QV7A 4YCUA 3LX5A 3OQHA 1HL3A 5EBDA 2JCVA 2XUGA 1F2UA 3FOCA 3MC1A 4FGUA 5HF5A 3T5AA 5C0XI 2QQFA 3R74A 1FB5A 3R5FA 1WHTB 4ISBA 2CXRA 2B8EA 4HN4B 1GOTA 3WRXA 1TXYA 1E8NA 4N9WA 4QT0A 2P4UA 3N7TA 2R8ZA 4PIPA 4WOPA 4BP3A 1UMKA 3U5TA 2DT5A 3E35A 3ONDA 1DIBA 5LQAA 3E1SA 3F98A 3R9XA 4ODIA 5A1TA 2X7JA 2MMCA 2GXQA 3NEPX 4U2FA 1CV2A 1XMQQ 2HT1A 3N2KA 1VG9B 1H4TA 1VL6A 4LHWA 4OQDA 1C0EA 4UQPA 5HUJA 4UE3S 1SKUA 1OU4A 3QU2A 3O4GA 4L73A 2GS9A 3HFRA 4NP6A 3R40A 3WYEA 3DHEA 5IN5A 5CDSA 1HTPA 5JFGA 1G8JA 5IKXA 2VC2B 3DYBA 1NVUQ 1GTMA 2QTRA 4HSEA 1T9GS 4N49A 4RZ3A 4DSTA 1OTXA 2GZDA 1FVIA 1WV0A 2PLAA 1SFRA 2QTCA 3E9CA 1S8FA 3KLMX 4US0R 1W2WB 1DE0A 4TV9B 4LF5B 1NBHA 1QO0D 4JV5L 1N2SA 4L4SA 2NUTB 1ICEA 1RE0A 4X7MA 3OETA 5CJ2A 1EFVA 4MLCA 3TDQA 1TJNA 1TT7A 1ZX1A 3D2AA 4G63A 1STNA 4IBOA 3G71A 1DDOA 1OX6A 5F33A 4BNUA 3IP1A 5D2CA 1QF6A 1DXYA 1TS4A 4JV5Q 4GBJA 1FFWA 4JJFA 1Y8NB 3Q1LA 4XIGS 4EUKA 4BEBA 4BBRH 5AD1A 3FDTA 1JCKB 4PZ7A 2IL8A 1Q0TA 4EUSA 5AOVA 5LZ5A 1M74A 3MMNA 3ORRA 5JRDS 2ZJ6A 4R0NA 4OONA 2ODQA 4RADA 4JBJA 3OE4A 5IBQA 1EVKA 1NBMA 3LFHA 3KQOA 4GXNA 5CMLA 3NHPA 2UYCA 1A2OA 1FRZA 2W90A 1DMRA 2RGXA 1IK4A 3EXHC 2AR7A 3DE5X 3NWBA 4ZYWA 3RYIB 2IS2A 1QGED 1W76A 1PFNA 2FVXA 3F6EX 3OH8A 1IN5A 4Q4HB 4UBIA 5E4JA 5DNFA 1P44A 2H2FA 2F64A 4J43A 1NMQA 3RR2A 2A14A 1DXMA 5EPOA 4RIFA 4AX4A 4GBGA 3E1GA 2HNAA 3SP1A 2RCYA 3I58A 3I6QA 2NSHA 1STGA 1NJ5A 2ODWA 4B45A 3IQWA 2XTIA 1YVCA 3DD5A 4MW2A 4IPHA 2CZQA 4BFTA 4BX9A 1YL5A 2MJLA 3OT4A 4YCJA 2WIDA 4KPEC 2WSMA 3UV7A 1VFNA 1Z75A 3OE5A 5IK2A 4QUBA 4EJ2A 1SG9A 2A6EC 1UP7A 3VH1A 4FI3C 4QDZA 4RVNA 4E6IA 1L4KA 1L8XA 3EVZA 4AF7A 8AT1A 1QVFA 5K8IA 3GYGA 5IJ0B 3OMCA 2A4MA 3N9IA 4KDEA 4KMOA 4X8HA 3AVQA 2V4UA 3FGNA 2WTXA 1G6ZA 3HB1A 1H2WA 3QH4A 4I3HA 1TAHA 5C52B 5I45A 1FSPA 2GHRA 1ARZA 3NBUA 4KIJA 4A0HA 4P54A 1L5GB 5BQ5A 4TRJA 3C6BA 3LFUA 4GOPC 1U4OA 1WMSA 1RLOA 4BATA 3KF6B 4FYIA 3V9AA 3W6PA 3ODGA 3N2YA 4B3SQ 2IX0A 1CJSA 4A36A 4MS3A 1TWAB 3EEQA 3K15A 2R7LA 2YIVX 2R6AA 1YB6A 3LDAA 4H7BA 1NULA 3TNJA 4A10A 1CRPA 2B35A 5CG1A 5BMVB 4M1EA 1XHFA 3SICE 4K8RB 2OKCA 3EXG1 2I65A 2PHZA 4M7RA 2PUDA 2JHAA 1H8HA 2CFTA 2V9CA 2F2TA 3BDIA 4JJKA 2VQFL 1W0JD 4LY3A 1NW3A 1KVSA 3N2NA 4YJ2B 1D4AA 3KUCA 5BVGA 3AF3A 3ZY6A 1S5FD 1ISFA 4ALMA 5LKRA 1VL1A 2AVDA 2HH9A 4JJIA 1RKBA 1H2XA 4W7IA 3S44A 3B5JA 1WCMB 2Z56A 3WGOA 2PSJA 4OU5A 4BRSA 3BVZA 1AK9A 2V6JA 1JJ2A 1J2RA 1F0NA 1QDUA 2ZWMA 1ENZA 3AIIA 2AFHA 3EEYA 4UAGA 3I01A 2XRFA 2RG1A 1FSFA 2IZZA 3AZOA 1QC5B 3TLYA 1EFCA 4AF6A 1PBNA 3ELWA 3V7WA 2OK8A 3CH5A 4C87A 4DC1A 1PXUA 1B15A 1UXKA 5KIXA 3QKUA 2IX1A 2GB4A 2P5YA 3ITPA 4PXAA 1E5VA 2AEMA 1O96B 3EGXB 5CEEA 2F9FA 2ZYTX 3AF4A 1FOEB 4OX9L 3S2DB 1CJUC 3KEFA 3M6WA 4DOMA 4CMKA 3TFOA 1WM1A 2NO1A 3OP1A 4DREA 1LX7A 2B3TA 5F5LA 2YHIB 1IHZA 4Y6QA 3TTUA 4YR9A 1EY7A 1DWOA 2F55A 4HFMA 5D5PA 2JG3A 4NICA 3PX3A 1TTQB 2RHBA 4NCHA 4MW6A 5FPTA 1JG7A 4BMVA 1NMEA 3DBOB 4MR7A 1DBQA 5D1HA 1S2GA 1U7OA 2QDXA 3F1ZA 1G4HA 1MPXA 3SS8A 2O5VA 4J4HA 1YFJA 3OKPA 2FF7A 3EVEA 1MGSA 4I14A 4EZIA 4E2ZA 4GQIA 1Y8ZA 4ER0A 2D2EA 3DE4X 1V1OA 4KE7A 2IWRA 1NZDA 1KQSA 2IL1A 1P1BA 4X1IA 2OFWA 5BURA 4W4TA 5BQFA 3NGXA 2TYSB 4NQRA 3L7CA 3IUMA 4PX2A 3JD4A 2BZGA 1W88A 2J3HA 3JQEA 4GVXA 4XQCA 1QJ4A 3KJPA 3H9BA 2GD2A 2NAPA 4GFDA 3DP7A 2BEVA 1MHWC 4OYLA 3UUGA 1BCPC 4M8AA 3P9CA 4OXXA 4JYAB 2YWHA 3NC1C 3SQDA 3WQSB 3I72A 1EWVA 3L0CA 3QQ5A 5I7HA 3FPJA 4HEA6 4L07A 1F38A 2ZJAA 4EPRA 1Y98A 4UZFA 2JJ1A 2OF1A 2LR0A 5LYYA 4B81A </