2YYZA

Crystal structure of sugar abc transporter, atp-binding protein
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
358
structure length
358
Chain Sequence
PSIRVVNLKKYFGKVKAVDGVSFEVKDGEFVALLGPSGCGKTTTLLMLAGIYKPTSGEIYFDDVLVNDIPPKYREVGMVFQNYALYPHMTVFENIAFPLRARRISKDEVEKRVVEIARKLLIDNLLDRKPTQLSGGQQQRVALARALVKQPKVLLFDEPLSNLDANLRMIMRAEIKHLQQELGITSVYVTHDQAEAMTMASRIAVFNQGKLVQYGTPDEVYDSPKNMFVASFIGNPPTNFLRDFSVSVENKQTILKRDDVIIKLPEPVDVKLKEVVVGIRPEHCRISRERVENSIPGVVYVVEPLGRDIIVNVKTEKGEIIKVFGDTGKAPQPGENVFLVPDLRKIHLFNPETEETIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Sugar ABC transporter, ATP-binding protein
rcsb
source organism Thermotoga maritima
molecule tags Transport protein
molecule keywords Sugar ABC transporter, ATP-binding protein
total genus 88
structure length 358
sequence length 358
ec nomenclature
pdb deposition date 2007-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF08402 TOBE_2 TOBE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2yyzA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2yyzA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2yyzA01
2RGGA 4RD1A 1KI2A 4O2RA 1JJ7A 2XNDA 4WBSA 1DAIA 2GETA 4B3DA 3FOZA 3K0CA 1SN8A 3AUYA 1FP7A 4LJ7A 3TIFA 3TQFA 4BY1G 4P32A 3TUJC 3TUZC 3AKCA 1YR6A 3CCRA 3AEZA 4QGUA 2WVJA 5JZVA 2Z6KC 1FUKA 2PZEA 2WJHA 1E24A 2GJKA 2F9MA 3P32A 2EDGA 4A3BG 4QGAA 2A7QA 4Q21A 5FOSA 3SFZA 2QBYB 4YCWA 3CF6R 1AZSC 5JECA 1R0XA 2CBZA 1HJPA 2VA8A 3SS8A 1IN8A 2IEYA 2RGNA 2UXDQ 4PSKA 1GWNA 1U8YA 3KXLA 2IYWA 2KCMA 4JLDA 1FUUA 2C98A 3A1VA 4OI4A 4HDOB 5AK0A 1WP9A 3QEOA 1CR4A 1I5FA 3C41J 1VQ7A 3GPLA 1IW7D 1AKEA 4Q4AA 1EGAA 3BERA 2ZAMA 4D4LA 4MYTA 5C0XI 3K53A 3A8IE 3IFTA 2G88A 4IQZA 1EX6A 3QUSA 1W2GA 2ZI7A 1VQCA 1NN3A 1OF1A 5EE9A 1QDEA 3E1SA 4P4SB 4B3RQ 2QTFA 1J99A 1UJ2A 1YJNA 4E22A 1UE5A 1VTKA 3FKSA 4JV5L 3N2IA 5KNBA 3S17H 3FGNA 3GLFB 1JT8A 4LF4Q 1XTKA 1M2OB 2EFEB 3N5CA 4NHOA 4QBFA 3RNLA 1OKKA 3AP1A 1NI3A 5TXGA 2ZE8A 2FWRA 4ZDJA 1SLJA 2K14A 3EBEA 1KD1C 3SQWA 3RWOA 2N78A 2WKRA 1W2BA 4A15A 2O8DA 4RCZA 5C0XG 1II9A 4OWXB 2EFCB 2QL6A 3PEUA 4W5HA 3GJ5A 4C0SA 1E3PA 1NTGA 2DYKA 2OG2A 3Q3JB 2WV9A 1AQYA 3JVUA 2AN9A 2FE4A 1Q1ZA 4A36A 4QBIA 2IF2A 4UKDA 3FMOB 4OHVA 4A3MG 5CM8B 2RF4A 2EFHB 3HR8A 4MH0R 4DT1B 3E0EA 4DVGA 5IYCH 1RJ9B 3I55A 2QUZA 4LJ4A 4NCJA 2BH8A 3CXCA 5IP9H 1XMVA 2IUTA 5GAEC 2OBMA 3P27A 4QM7A 4HZUB 1XMOL 1GNPA 3CRRA 1HZBA 1Q7YC 2ES2A 2GXQA 1EQRA 1KJWA 4R4TA 5GJVC 4LF7Q 1WI5A 1U9IC 3BRWD 5C2JB 2JA5G 1XTJA 2ZIAA 4DV2Q 4MGIR 1LVGA 5EZ6B 2VL7A 1L7VC 1EK0A 4P0TA 5FBWB 1TF2A 1QZGA 5C0XJ 3UG6A 1P61B 5DI9A 3U60B 1ZNZA 3F0TA 1KNXA 1F2TA 4P33A 3BB3A 4EKDA 2N49A 4X64Q 1VHTA 2RMKA 2ZYUX 4OK5A 2FSFA 4YLGA 4ZCIA 3K09A 3VAAA 3GLGE 2DB3A 1KK3A 3ND8A 4G5RA 2WOOA 1CULC 4A93G 1NN1A 3QF4A 5DSZA 821PA 2C77A 4JLJA 3VR3A 3F2CA 2ZJ8A 3HKZG 1P2UA 5JS7A 3I4NH 4DK0A 4ZV4A 1KKLA 2G77B 2VHJA 3I5YA 1UADA 1VS0A 5LB2A 4C3JH 4M1SA 4B44A 4Q9JA 1N6OA 5A0FA 4X62L 1CJMA 4DV5L 4A75A 4BLTA 3LW8A 3PQCA 4B3SL 1Q0UA 2D06A 4GMDA 4L8GA 1OXUA 3ADCA 2XTMA 5IF9A 3RRYA 2R92G 3GLHB 2V9PA 2OHFA 2OLJA 1GUAA 4IRUB 2A6HD 4Q19A 4YMWA 2HDNB 2FPLA 1Q46A 2ZI6A 3V9PA 4D0NA 3K70D 1AQUA 3CAMA 3AF3A 4UNSA 3NBZC 1UE6A 2BJVA 2GBLC 4WW0A 4GI7A 4B48A 4DSUA 1ZP6A 1PA6A 1M7HA 2BBWA 5CYPA 2ZYWX 1K8MA 4DR6L 3SC3A 1GO3E 4CEJB 3N70A 1LACA 1Z9FA 3QPUA 5FTMA 4C0HA 4HJ7A 4TZ0A 4A3FH 2F7SA 1E1RD 1FP6A 5FOVA 4TSFA 1HTPA 3ER0A 1NJGA 3FMIA 5J3BA 1DBSA 1G41A 4BBSH 2KWIA 5JRJA 1XPRA 5J4YA 2NO7A 5EXTA 1H9MA 1TQ2A 2LKDA 3HOVG 2ZYTX 3PUYA 1LM0A 4RZXA 1DGSA 4B6EA 1JXMA 5CYOA 3IRBA 4IKEA 3ETLA 4EPRA 2DFKB 2NQ2C 2YZ2A 2ONJA 4PTLA 1TEVA 3AF0A 5IP7G 4KN4C 2JIZA 4AIIA 4DV6L 1E0AA 4EQ6A 3IEVA 1SROA 2NPFA 3E5HA 3QNUA 2W6JA 4P31A 3U4QB 4G7ZC 1YKSA 2L15A 4LBVA 3CCUA 1R0ZA 1ZM2A 1VQBA 3RN2A 2ZJ2A 1RFLA 3BBPA 3HR7A 3NE5B 1ZBDA 3EC2A 1IY1A 2BKEA 2QE7A 2XZPA 2VF8A 3CBQA 4JBMA 1VQHA 4XVQA 1HNZQ 1QHIA 1NVVQ 1O78A 1A8VA 4O2DA 1S2MA 1JE5A 2D74A 2FZ4A 1L8QA 4L15A 5B58C 1KL9A 1M74A 5M3FH 4KJZA 4AD8A 1QHSA 4DLRA 2ZRFA 4JI8L 3SJBA 2CJWB 4HJ5A 1KC8C 3LWUA 1N8RC 3I8XA 4TYNA 3VKGA 3CZPA 1CFMA 2PL3A 1W4AA 1YI2A 4YXWA 3KXIA 1YZUA 4DHEA 2HIVA 3FKIG 4HB0A 4JK1C 2BOVA 3U6KA 5LMNQ 4EQ6B 2K4KA 4HIKA 1I4DD 2ZUDA 4WXRA 1HH2P 3PR1A 3GJ3A 1W36D 1EFTA 1XZQA 4DV4Q 1OJLA 3GTQH 1VG9B 3T5GA 4LK1C 4X65L 4OJQA 2LSSA 3RR5A 3G6EA 1JALA 2J87A 5H1SE 4C0KA 4JJKA 1FVIA 2WB1E 1PLLA 2EFDB 4PPFA 3TVTA 1QHGA 2ZXUA 2RHDA 5FTLA 5L3SA 3DHWC 3ZDQA 4K0KQ 1Q20A 4ERNA 4MNOA 4FMCB 4BLRA 2WTUA 3GFTA 2QP3A 1E2NA 2PI2E 2MMCA 2CLSA 3CO5A 2R93H 1G3RA 4H0LC 4A92A 4BLPA 3KQNA 2JJQA 1OYWA 1XMSA 1VQAA 1JJGA 1JR3E 2DFLA 3RDPA 2C95A 2AK2A 3MAAC 1PH5A 4E03A 1S9DA 2AUJD 3FMPB 1DPFA 1FW6A 3FHCB 5AJWA 4NBSA 2MSDB 3SU8A 2X19A 5KPJA 3QPVA 1M8PA 3C4JA 4H1UA 1R2QA 2A8VA 2WWIA 4NTZA 4URYR 1NVUQ 2ATXA 4RD3A 2HIXA 3C7KA 1II0A 2HT6A 2DWPA 4HJAA 1Z7TA 3BFKA 3SR0A 3T34A 4BFXA 1T0JB 1I6VC 2JATA 2F3RA 2V1CC 1PH1A 3IQXA 2WBLC 5JEAG 4DCVA 2AR7A 2P67A 4UP7A 2G6BA 4DLVA 1SQ5A 1PH6A 3Q5EA 1YZKA 1Z6YA 2BCGY 4JLBA 4DEYA 3Q8DA 1OFTA 3B8HA 2GEUA 3H84A 1A2KC 4I99A 4V0LA 2BBTA 2ZEJA 3Q5DA 3KF6A 1HV8A 1Q57A 3IEUA 3TVDA 5JWRA 4OO1G 2NO6A 2PPBC 1XJ0A 1X3SA 3B9QA 2IXGA 3CRVA 3KB1A 2W2TA 2Q6TA 4JLKA 5C44H 2HJGA 4JC0A 4JOIA 2BKUA 3AKYA 4QXAA 2JLZA 2H92A 2K5HA 1KXLA 3J81k 1XTQA 5FTKA 3T1VA 1RIFA 2WKQA 2F43A 3KZ1E 4FCTA 5FTNA 2R6GA 1HZAA 2JA7H 1X86B 4M22A 3PV0A 3BB1A 5E7JA 1FNMA 5IK2D 4GOKA 1GHKA 2CQOA 2UZ3A 3P20A 3OEEA 1GUGA 4PO1A 2F1JA 4A9AA 2CJWA 3AF1A 4P73A 1XTIA 1U90A 1S3GA 2R6FA 4QJ5A 2JLQA 4IFEA 1P2VA 2NN6G 4OI1A 1GVNB 2QMUA 5IDVA 3WYFA 1YHQA 3OF5A 3OIWA 1IBRA 3OYYA 4DIEA 2O8EA 2AX4A 2EYUA 4Q47A 221PA 3I4MH 2W6IA 2O52A 3BORA 4KHZA 3CCEA 3X1ZA 1V1QA 2YTYA 4KO8A 4LUCA 2AKWB 4C2TA 2GILA 3ZVNA 3NWJA 2ZTEA 1ZYRC 2GK7A 2JIZD 1JMCA 4TTQA 1G5RA 4YY3L 4Q7LA 4XOIA 1K5GA 2CW0C 1SHKA 2WWGA 4PV1C 2P65A 1WBBA 4B75A 2ZRNA 3GTGH 4GPTA 3CCJA 4QHYA 2OXCA 1DG1G 3HU2A 2VL6A 1N36L 4OO1I 1ESNA 1G5PA 2ZAOA 4M0LA 3CRQA 1XD2B 1B9MA 1IXRA 2FNAA 1RPZA 3GJ7A 1D8TA 1YJ5A 4R4QA 1HZ9A 1VQ5A 3H3VI 1PFSA 2PQAB 4LYJA 4DR1Q 2XTZA 1K3RA 1MJEA 4ZO4A 1DCZA 3CKLA 4TMWA 1IBKL 4UY8C 3CR8A 3K0SA 2F1HA 4L9SA 1ZYUA 4DR4Q 2C03A 2OCYC 4Q4HB 2ZM5A 2ERYA 5KHOC 2PCJA 3BXZA 3IGFA 1HTWA 2UUBL 4PQRA 1T5EA 4RMFA 3LBHA 1N5JA 3OIYA 4QBGB 2D7CA 1CS4C 3ZH9B 2PZGA 4GL2A 1XMOQ 2GJAA 2QEQA 1CBUA 1Q1EA 4H13C 2BDTA 4BFZA 1BBWA 2DNEA 1XXHE 3T61A 4CVNA 2VO1A 3A37A 2DPXA 1MRSA 4ZCLA 1P3JA 1K8AC 2K50A 4WZ6A 4DLYA 4A3BH 4C2MH 3QJYA 2J45A 5EE5B 4Q4AB 1E2HA 4HIMA 1RW4A 2QT1A 2ZITA 2EQBA 4PHGA 5B2ZA 3K81C 3B13B 1OH8A 2W2VA 4QOSA 2YWFA 5BXQC 2Q9BA 4GMXA 3HKZE 3KKOA 3TR5A 2O5VA 5JWOA 2CHQA 2IL1A 2LXJA 5DN6D 1ZNYA 4OI0A 5BW8A 2YC4C 1JB1A 3L8YA 3WNCA 3BJIC 4JVMA 2FSGA 1Z0FA 4X62Q 1VYUA 3EZ6A 2QAGC 5FTJA 4BGDA 3GLIB 4EDHA 4Q4JB 4OQXA 1EWQA 4DUYQ 4DAMA 4DLUA 2E74C 2HLDA 4KLKA 4DV2L 1J2JA 4I1VA 2VP4A 3NDBB 1W5TA 4A3KH 1W49A 1ZNWA 5L3VA 4EJSA 3WNBA 2JGNA 4MRNA 4DR5Q 1P75A 4XD7D 2FA9A 2A1AA 1Z08A 3VDYA 3MD0A 2FFBA 2VTKA 2OAP1 4XSGA 4D4MA 2KJQA 3K8AA 2V7QA 1L2TA 4BZQA 2E9SA 1HPCA 1FTSA 1Z28A 2J41A 3AGPA 2PCFB 2B8TA 3I3SR 2BH2A 4FCVA 3MG9A 2KHJA 4N3NA 1DAFA 4Q03A 4OBEA 2Q2TA 1A6XA 5CLLA 4RFSA 1SR3A 4LZZA 2Y0SE 1C1YA 3QE0A 3RABA 2X77A 1IJFA 4D81A 3M7NA 4LF6L 1JJ2A 4ZI2A 2FZLA 4D82A 2ZSAA 2VQSA 4NB3A 1S4QA 4TQUS 1QF9A 2D2CC 5E7NA 2JEAI 4IFDG 5JJKA 1AA9A 1NMZA 1UEIA 2WKPA 2ZRAA 4O0MA 3RLOA 1VG0B 1SRUA 4E07A 4G0NA 4D2IA 2VBCA 3NIBA 5A4JA 3QQ5A 4L9WA 2YNMA 4DZZA 5IP9G 3I1FA 4PO9A 5FUXA 2PCLA 2V1UA 3CWZA 3THYA 1X6VA 3D31A 1QVGA 2QTVB 3QOFA 3QG5A 3TW8B 2WSMA 3KKNA 1BO6A 5DE3A 1QVFA 2XGTA 2O5IC 3EIEA 1EFCA 1PUIA 4UXIA 5LMUQ 4OJKA 4LV6A 3U7EB 1G4AE 3VR4A 1MRNA 2X2FA 4L5BA 4JI6L 3IPXA 1JEDA 2Q3FA 1XJCA 1G7TA 2HCBA 2ZRHA 1Z0JA 3L7ZC 3LY5A 4GP6A 4GLAC 1HNZL 4KBFA 5H8WA 3REGA 4TQAA 2W0MA 2EJFC 2WOJA 2GHIA 4M1KA 3TJZA 2A6ED 2WWFA 4UNRA 4PZ7A 2D2EA 4LJAA 4BY1H 3A8KE 4K8OA 4IOMA 2J7KA 4UJ3A 4EJSB 1OH7A 2EWVA 2QQ0A 3QG1A 3NEYA 3U7FB 4Q4LA 1NMFA 2JJ2A 5F3WB 2KI5A 3BWDD 3U3RA 2KENA 5B30A 4A2WA 2UKDA 4B3RL 3LVRE 4C3ZA 3LFUA 1GZSA 2VSOA 3SHFA 2NMVA 2VHTA 4LUZA 2O0JA 2O0HA 2HYDA 5J40A 2HHHL 4AYWA 4LF7L 2Z0MA 4S35A 1LY1A 4JI1Q 1KKMA 3QI2A 1OB5A 1CR0A 3CPHA 4KKUA 2MFIA 2KBNA 3DLLA 1X8LA 3EC1A 4BLOA 2GVDC 4JI2Q 3CB4A 2QA5A 2DBYA 5AJVB 2F43B 1E9SA 1E2FA 4CT4B 4DRZA 3L8ZA 2VQFQ 3AFQA 1G6HA 3O47A 3B5JA 4JT4A 2QGZA 4QNMA 3KFUA 4FWTA 1QJOA 2A6EC 1PYSB 2OLKA 4DPGA 4A3MH 1UM8A 2O5JC 2BCJQ 3OE7D 1PH4A 3AVUA 5KOYA 1YNXA 2R65A 2E75C 2DUDA 1U99A 5IYCG 1K8OA 1E6CA 2G0TA 2ZI5A 2VIIA 4PXAA 1P9WA 4LHZA 4LJ9A 5EE1A 3CRLC 3RC3A 3PCOB 2BE5C 3K0FA 1GOTA 3KQLA 1OE0A 2J5XA 4PQFA 4GZYC 4MRVA 2C2HA 1LABA 1J5EL 2CE7A 4BBSG 2FPMA 2ZRIA 5FOUA 4PC2A 4MKFA 3QIAA 4LF4L 2JA5H 1CKOA 4NPSA 1KI7A 1W0KD 1R6BX 2KCTA 4A3IG 1P60A 1VCOA 2EU8A 3EW9A 4OHWA 3I73A 3VKHA 4UPAA 4IOCA 2LXKA 4L5TA 1KI1A 1LW7A 2FX3A 4JVNA 3S24A 3AF4A 4F91B 4JSYA 1E0KA 4LFAL 3X1WA 1TWCH 4D0GA 2NIPA 2CCKA 4KV9A 4NPHA 5JCPA 3THYB 1SVIA 1E1TA 4E5UA 5K8TA 3SQXA 2VQFL 2FSHA 2OESA 1NMGA 2FEOA 1W1WA 4ARZB 2A5JA 4NXNQ 1P2SA 4PC3A 5CJPA 4B47A 4Q00A 4G7OC 2ODEA 4LFBL 5IT5A 1ZKOA 2ODWA 3Q72A 4YXWD 2GNOA 5EP3A 1CSPA 2VQEQ 4I4LA 721PA 2WMNB 3CR7A 4M1TA 2R7ZG 4QBHA 3F2DA 5JS8A 4C3HH 2UXCQ 1RVDA 2R7FA 1MO6A 2I3BA 2JASA 4JT2A 1O3YA 3WP1B 3HOYH 1DTSA 4DCUA 1U9IA 3FKIH 5BR8Q 2MSCB 2A2ZA 4HLQB 2NVYH 1P62B 1Z22A 3CF5A 2OZEA 3PIRA 3GLFE 1VG1A 1YHNA 4EFLA 1FMJA 1Q82C 3D0FA 2NVXH 4A3CH 2BV3A 2YHSA 1CJKC 3BH0A 4LWZA 4DNTB 1X55A 2D0PA 4DCNA 3GJ4A 4V0KA 4CGZA 4NCIA 3M0EA 4GT1A 2O8EB 4IOJA 5DO9A 1XMQQ 5HZKA 2REOA 1TF5A 3VX3A 3VNVA 2JA8G 1ODFA 2OEPA 1FMLA 3LLUA 3E70C 4P4UA 5TV2A 2IWHA 2QGQA 2HUPA 4GSYA 3W90A 3A5UA 3S1MH 1QHHB 4U5XA 4CRWB 5AJ3L 2PZFA 4X64L 3CNLA 1I3QH 4FIDA 4DLXA 1LTLA 2CL0X 4DUGD 3SEAA 2GVBA 1JR6A 3C14C 1ZD9A 1GUOA 4TLCA 1ZVQA 3KFVA 3H0GH 2KSQA 3K9LA 1GHJA 3S15H 3K09C 3PVSA 2FOLA 1DAHA 1EFUA 2P3SA 4DT1A 2IX0A 2MQHA 5EXPA 3NG1A 1FX0A 4MQBA 4QJFA 4DV4L 4RCYA 2BMJA 1XTRA 4JI0Q 2GCOA 2NG1A 3UDGA 1OIXA 1VECA 1TL7C 3C5CA 4KFTA 2ZROA 4O3MA 3QVVA 1YRAA 4KSCA 4C30A 4B3GA 3HOVH 3RYTC 3VTKA 3UWKA 3AQ4A 4PSVA 3B60A 4DR3L 2QRZA 4IHQA 4V0OA 5J4KA 2UUAL 2F9LA 2JLXA 4JI0L 2VHQA 1N36Q 3M4OH 1CF4A 2OO7A 2W0SA 3OE7A 5C4XH 3WXMA 1RE0A 4Q66C 2ZPTX 3J7ZC 2Q3MA 4IEEA 3I4LA 2EVBA 2C35B 2MO1A 5C44G 2ZRKA 4GNKA 4JBXA 1IXRC 2AKYA 3K70B 4RJLA 2WAQG 4DV1L 2QE7D 4GLVB 3IBYA 4B2PA 4F92B 3EIQA 4TLAA 4N1AA 1BVSA 1XEWX 4KFRA 2YKGA 2ZJRA 3B1WA 2JDID 4NL4H 1X3EA 4IJHA 4EPXA 1XU4A 3V4FA 1KAGA 1SXJD 3KJGA 5H70A 5FPYA 4FINA 4MRRA 2OQ0A 1XTDA 3TEHB 4A3LG 1Z29A 3KUCA 2ZM6L 2VP0A 1XNQQ 3DZDA 1Z63A 3BH6A 4YCVA 2VSXA 4O2LA 4AWXA 1XTSA 4ZDIA 2P6UA 4CYMA 2PLFA 1ONBA 2YOFA 1PLKA 1D7QA 1XD2A 4LJ8A 3BC1A 2GJ9A 1DVRA 4IFBA 1E2GA 2J0UB 1IBML 2KHIA 4IPHA 1IL2A 2OV2A 3HYTA 4JZKA 4WA7A 1HH4A 3EIHA 3ZJYA 3ZZ0A 3M1IA 1K5DA 3B85A 4GKKL 1UFQA 3LGJA 5JJIA 2J7PA 4QJ3A 3H15A 2WSSD 1E2VA 3ZQ6A 3QF7A 2GXUA 2GJSA 3MGCA 5L3RA 3NENA 1S9HA 1JPJA 2CNWA 2WWXA 2R93G 3J7A5 3DO6A 1OKKD 2CK3D 4B73A 3KQUA 3EPHA 4BUJA 1ZM9A 5JEAH 5IYDG 4DUYL 1L4YA 3U3OA 1KY3A 5LD2B 4A3DH 1E9CA 1Z6XA 4M8NE 2UZIR 3ICQB 4CEHB 4EQ5A 1ASYA 1X1SA 3E2IA 2C9YA 3AVXA 3ADKA 3OEED 2IEZA 5KO2A 1H8EA 2O8CA 5JEAJ 1UBEA 3GMTA 3QXXA 3U2QA 2X2EA 4P3YA 3CC4A 5FOXA 2FSIA 3GTOH 2D4HA 1U5KA 4RKEA 4IFDI 2EQSA 2C96A 1MV5A 2BMDA 4JVSB 1GKHA 4OHYA 4YY3Q 4R4IA 3BFVA 3C16C 1IZ6A 3BE4A 4DK1A 1IHUA 2ZREA 2X1VA 1Q1BA 2FFAA 4HJ8A 1KO5A 3IO3A 2QRNA 4UNPA 1HCZA 1E2JA 3X1DA 1Z2CA 4QY7A 4PHFA 4LI0A 2IXEA 4OHXA 4LOAA 3SBEA 2Z4SA 1E2EA 3NXSA 3F2BA 1VCNA 4JVLA 4TYPA 2IT1A 4FMCF 5BR8L 1N33L 2ZI3A 1I94L 1IM2A 3U50C 1OT3A 4E09A 5HCIA 1YZLA 1W36B 2PX3A 3T12A 2BHRA 3TLXA 2HLDD 3TRFA 1LB1B 2Q2UA 4JI5L 1S8FA 3W34A 2JA9A 3K0FB 3WYAA 4Z51A 3I4MG 2REBA 2QU8A 4RCNA 4LF8Q 3GD7A 1CR2A 4B3FX 2UUCQ 3HWSA 4XH9B 5F9HA 1WMSA 1AH9A 3U61B 2JA1A 1Q12A 2FU5C 1PH7A 3U9SA 2I1VB 1LTQA 5SZIA 2WJVA 4O0AA 4OX9Q 1JJVA 1JNYA 2JEBI 5B57C 5C3EG 3L0OA 1VYTA 5FL3A 3HOXH 2JA6G 3GEHA 1A82A 1TKWB 1J6QA 1J8MF 2IY5B 1P9NA 3L0SA 3D7MA 1Q3HA 2A19A 1YRBA 4DK3C 1XB2A 1G6PA 2G3YA 5IE8A 4EPVA 2ZJ5A 5HKKD 4RD2A 1TPZA 1FGUA 1KAWA 2YV5A 5CK5A 4OKSA 4DR4L 2MNAA 4ARZA 3CQZH 4DV0Q 1HE1C 1WE2A 1Z6AA 1ZINA 4Q9LA 1QRAA 3QXJA 3HYRA 3U44A 4IFDH 4YWMA 2FGJA 3SYLA 2JJ2D 1OH5A 3KTAB 5DI3B 4BZPA 3RAPR 1BS1A 3ZVMA 1H8HD 2PT7A 1QUQA 2AWNA 2KBEA 1KO8A 4QHTA 3R7WB 3SYKA 3KJIA 4JI1L 5FUYA 3I5XA 1EQQA 5EE0A 1QUQB 1GIAA 4RFVA 1S40A 1YZ6A 3A36A 3KKMA 4BXXH 2ZTCA 1YJ9A 2V4ZA 3FWYA 4JYCA 5JI3E 1E32A 2YTVA 2OCAA 1NIJA 1DAGA 4D4KA 4MDEA 3ULPA 4GLXA 1G21E 1CJTC 1E9FA 5G3ZA 1W4RA 4CZ2A 1LF0A 1XBTA 4MYHA 1OB2A 1Z5ZA 2IYQA 3UDXA 4JLNA 2Z83A 1BH2A 2OUKA 4NCKA 5H1YA 2CWPA 4LJZC 2V6JA 2VY3A 1XXHB 2VP5A 2PNRC 3D8BA 3M6AA 2JLYA 2GDJA 1KIXA 3UKDA 1UEJA 5JCZA 3KTAA 1VF7A 2VZAA 2QAGA 3B1YA 5DI3A 3T1OA 1FL9A 3EA5A 3TSOA 2A6HC 4JL6A 2CHVA 4Q02A 4TMXA 3RLFA 3S2HH 3OZXA 4LDJA 3K70C 3FE2A 5IWAL 3ZZTA 3BIFA 4NE2A 5L3QA 1GJXA 1GAJA 5EAYA 1PLJA 3R20A 1CKMA 2P5TB 3CX7A 4GNXA 4LBWA 1R5NA 2IBMA 1EWRA 1K73C 1KJYA 4DR7Q 4LHYA 5M5XH 3I8SA 4Q5IA 4B35A 1TEXA 1FTNA 1XP8A 2ZTDA 4LF5L 4YONB 4ZKEA 4HAYA 4AG6A 2IS2A 2OCPA 2O8DB 4EPYA 1VQMA 3FVQA 1XEXA 3KJHA 2IS1A 5FUWA 1R5BA 4QHSA 1QBKC 1HURA 1E79A 4URZR 2P6NA 3A6PC 3Q8XB 3LAWA 1Y1VH 4C0QC 1X56A 3EPLA 1NNEA 1HR0Q 1NIPA 2GA8A 1ZIPA 2C99A 4OWWB 4QRHA 2J0UA 4ASUD 5C46F 2AXNA 4AYXA 3BS4A 5K8LA 3STBD 4PANA 2P5SA 1XD8A 1KSJA 3T1YQ 4Y52H 3H2YA 4D26A 1M7GA 1ASZA 4H1VA 3KDFA 1UWVA 2D3WA 5FBVB 2XOKD 3OPOA 1NE3A 1Z06A 2V8OA 2C9CA 2WAQE 1MO5A 3G0HA 3OTOL 2GWHA 4M9SA 1A5TA 1OXVA 2G83A 3M4PA 2QN6A 2ZUCA 4HLCA 1Z8FA 3QEJA 3CCVA 2WFWA 3F1ZA 4R2IA 1E3MA 4Q1AA 2P0EA 2WJYA 3W6PA 4CIDA 3QY0A 4NYIR 1UAAA 4LF6Q 2QMEA 2FN4A 4HDQB 4BRWA 5LDDC 1RYHA 2IYUA 3J80i 4O25A 4APVA 4QC2A 4A6XA 1KRSA 2IYRA 2ZRJA 1RRGA 3B1VA 4OQNA 2B63H 2MMGA 3AGQA 4JI4L 3T1HQ 2R6AA 3FPAA 3R9IA 3UMRA 3UDIA 1E2QA 1S3SA 4GN5A 2JJ1A 5E7MA 4B71A 5CDFE 3HOWG 1V9PA 2AKAB 4ABYA 4HIDA 1TU3A 2XSZD 2B8FA 3R7WA 2GZAA 3JAMc 4TT3D 3SFVA 1D2MA 4Q48A 3UG7A 2JLWA 1HY3A 3V00A 4BY7G 4ALPA 1VIYA 1KO4A 5UKDA 1Y8NB 4HR7B 4B6FA 4D6PA 3T1TA 1D8LA 1F2UB 1II8B 4WJ3M 2CEAA 3OAAA 3OFNA 4IVPA 2WZQA 3NC0C 4IVRA 2UXBQ 5FR2A 3BD9A 4MKGA 1N0UA 3NHAA 3K7AH 4Z8YA 1F2UA 2ZUBA 3A1UA 3JZAA 4NXML 2N1BA 4IDPA 2KCCA 1KK1A 2ZYVX 4AQYL 2NZ8A 2F52A 3TRZA 3DDCA 4BFVA 2ZJBA 4TYQA 3PUWA 1JECA 3CMEA 4C3IH 4JLMA 5D3MB 5E3HA 3GTPH 3DOEA 1TWHH 1H8HA 3QKTA 2OBLA 5TDHA 4NDZA 4II7A 4DSTA 4A3GG 1XPOA 1WA5A 1L2FA 5KSOA 4HI0E 4TMZA 4Y0VA 5FOTA 2HCJB 3PCRB 2EJMA 1W7AA 2Q8IB 1QVCA 3EARA 3P1JA 3WNDA 1C0AA 1G16A 4LYHA 2G9NA 1QVRA 4PPQA 2Q2IA 1G64A 2G1KA 2RHQB 1C9OA 1NVXQ 2R9VA 1RIPA 2WAXA 4KVGA 4Q7KA 4XWAA 2OCEA 5AJZA 4W5JA 3VHLB 3CLVA 2ZE7A 2ATVA 1IBMQ 4G5OA 4DR7L 1WJJA 1CR1A 3RRNA 4AKEA 4I1SA 4ZPXA 3NTUA 4LF8L 3IIJA 4M53A 4KITB 1YZGA 4JLOA 3TS2A 3D3QA 4IDHA 2CNWD 3ERSX 1X1RA 3NHBA 1QZXA 2RAPA 2QY9A 4KMUC 2WSSA 4X8OA 2IS6A 4A3IH 4POGA 5ELOA 3MCAA 2NN6I 3MXUA 1EWIA 2ZJQA 3KL4A 3FKSD 4W7SA 1N34Q 2AUKA 4BWYA 1X8JA 1OSNA 1BMFD 2E5LQ 2DFTA 4A0FA 4JYBA 1SFOH 3AKEA 4BQSA 1CIPA 3CCMA 2VPPA 4KVAA 4MRPA 1CJVC 2PNHA 5DISB 4U7DA 3VHXA 3GLGA 1C7YA 3THWA 1P4SA 1SHZA 1W3SA 1N32L 1TAGA 3QXSA 4D80A 3ULLA 3VQTA 1R10A 2ZU6A 5EP2A 2J0QA 2RGEA 2OCBA 4W9MC 3CH4B 3KF8B 1M1YE 5BWMA 4WAUA 5KNDA 1JJCB 3HP1A 1L1OA 2E8GA 3OAAD 4I1UA 4Y0AA 2PJRA 4Z8XA 4EIWA 2RB4A 4KFUA 1RL2A 2ORWA 4IDNA 1H9SA 3EIVA 4JKIA 1IYUA 4JV5Q 3Q85A 3T1HL 5IHPA 5KSZA 4POFA 4G5QA 1OYYA 4HZUA 1ZMXA 4BA1I 4M1MA 5FH9A 4DV3Q 2K33A 3CD6A 5CDFA 5EUMA 4MKIA 2A69D 1MIUA 4DK6C 4LFCL 3J80c 2UU9Q 1ZIOA 2IYYA 4W5WA 3OIVA 2H16A 4Q1DA 5LB4A 4JI5Q 1QHHA 1YR8A 3CF2A 3GFOA 5TARA 2CCJA 2HF9A 2OM2A 1GKIA 3LXXA 4GRAA 1XDBA 4WZAE 2DWOA 3SDZA 1FZQA 4R71A 1F6BA 1DS6A 1MR3F 4TMTA 2R7ZH 1K8RA 1E69A 1NLYA 4G5SA 1IBKQ 1KI4A 1HQMC 4NZYA 4ITRC 2UXDL 3RN5A 2WM9B 4FWIB 2J7PD 3HOYG 1E9EA 5KDLA 5AJYA 1VQLA 5TMPA 2FH5B 4HDCA 4R2HA 3CPEA 5C4GB 5F9FA 1NY5A 4HLDA 2D5DA 3T06B 1AKYA 3SNHA 4PAQA 2WWYA 4A3CG 1Q1QA 5IP7H 4Q7JB 2BM1A 1CU1A 2AFHE 3ASZA 1PH3A 4MYUA 3W3ZB 3KDFB 4DDUA 5EUQB 3A8TA 5JBQA 4XTRA 1SKYE 3V4RA 4U00A 3A4NA 1WF3A 3BAFA 2PX0A 4NONA 4GN4B 4YMVA 2L0XA 5D3QA 2GF9A 3EQLC 5FJ8G 4B34A 4PHHA 1VF5C 1G1MA 2MO0A 1Y69U 2ZSBA 2ZSFA 4QG7A 5DIFA 1LYLA 5L8VA 3W1GA 2BEKA 3H4MA 1ZAKA 1E7ZA 4YMTA 4M21A 1T3LA 1VQFA 3S2DH 2OE2A 5D3MA 2AFIE 3TZUA 4QNRA 5M3MH 1Q21A 2N8NA 1XCGB 3CF0A 1A4RA 3R8CA 3PIOA 1E1QA 2N46A 2XEXA 5CK4A 4XWOA 2A5GA 4JL5A 3UATA 4Z1MA 3GLFA 1Y63A 4HB4A 4B33A 2P2LA 1DOAA 1IXZA 1IONA 1JBKA 3FMFA 4LF9L 5EJEA 2RGAA 4CEJA 1WOCA 2JJ1D 3F8TA 4KODA 2BMEA 4BECA 4NYMR 3LQQA 2QPOA 3TR0A 3ZIAA 1C9KA 4HLUA 4TWZA 1KI3A 3ZYCA 4XD7A 1R0WA 2V1XA 4M2LA 3WMFA 4OQLA 4WIAA 1N9WA 4ESHA 1IY2A 1H9JA 1KI8A 2NO0A 4H44C 2AMCB 2ASBA 4OQMA 1E9RA 2QF7A 2F1IA 3IBGA 8OHMA 1VQIA 4PZZA 1J90A 3RNUA 2RHMA 1L1OC 2K5VA 1J7KA 1K83H 1D9XA 2NVQH 4DEXA 2F4VQ 3RRMA 3QXCA 3SJZA 3DM3A 4TSFD 4QKQA 2E2JH 5J47A 3VR5A 2HYIC 2JLVA 5TY0A 3LD9A 1G291 4EFNA 1XMJA 4QGHA 2CLCX 1DO0A 2ZVPX 3DM9B 3SYNA 2PMKA 2CE2X 3QF4B 3GQBA 1ZD1A 5FPSA 1NY6A 2VP6A 1E2IA 1CSQA 2VF7A 3ASYA 4Q9KA 1CUKA 4JI8Q 3MWLA 2H18A 1ANKA 1TU4A 1O7LA 1S96A 2GRJA 1NLZA 4OK3A 4UNQA 5EP1A 2J3EA 3RS0A 421PA 4NCNA 3LRPA 2BA0A 4EX5A 1N0WA 4P4TA 4PFSA 2IHBA 3FHWA 1L0WA 2EXDA 1KI6A 2NOAA 4YQFA 2ZETA 5DNYB 4OWTB 2VYFA 1YQTA 1ESMA 4NYJQ 4WVFA 1SMYC 1B8AA 5LMUL 5GAGC 4BEJA 2BDOA 3IQWA 3TW4A 4PO8A 2CHGA 1KDTA 2EFGA 4DV5Q 2PLRA 5AWFC 1JR3D 4UJ5A 2OT3B 4PHTA 1KO7A 1SXJA 3S1QH 1Q44A 5K36G 2ZI4A 4BFSA 5JFGA 5KTYA 4X66Q 3RZOH 3PEYA 1E4YA 1L4UA 1NP6A 2ZRBA 4LUOA 3KJPA 4LPSA 4GZLA 5IRCD 2YWGA 1OHHA 1E2LA 1QG4A 2YWEA 1TWFH 4MUAA 3U58A 4CEIA 2C8VA 2NGRA 3EX7C 1AE2A 1N5LA 2QMHA 3GLIA 4KN7C 2LWIA 1NMXA 3T56B 3AFPA 2NO9A 2RKOA 2PMZE 1FJGL 4TMVA 2REXB 5LMNL 4A4IA 1U0JA 3IIKA 3BZKA 4JBYA 1IN4A 2NZOA 4PZ8A 4IJMA 4AYBE 3B82A 3QKRA 2VUMH 4IW3B 1T5IA 4GOXA 1MKYA 3KX2A 3SHWA 2PEYA 4LC0A 4DV7Q 2BVNA 2V55B 3W5IA 4LV8B 1PV4A 1KDRA 5AUPB 1HUQA 3MUFA 4TTPA 1E9AA 5HE8A 1GL6A 4P74A 1KNQA 1OTCA 1G8HA 4IPCA 1G3UA 1G7RA 1YVCA 2AXPA 3ZS8A 4A1FA 3EA0A 4GDFA 4M9XA 1P16A 3LV8A 1LV7A 2QP9X 2IX1A 4AKHA 4AQYQ 1GKUB 4B3ML 1VQNA 4LHXA 4Q1EA 1EUJA 1GUTA 2E5LL 3GTMH 5BN4A 2VLIA 4IDOA 3LW7A 3VX4A 3WWVA 2YTXA 1Y3AA 3NEJA 5EXXA 3VFDA 3W6OA 1G19A 2IHEA 2LCFA 4F38A 4DDTA 3VR2A 1XWIA 1RZ3A 1Z6HA 2XB2A 2ASEA 4RZ3A 3X2SA 1PH8A 4BASA 1ZC4A 4IOAA 2DNCA 4KLNA 3CUEF 1W0JD 5C3EH 4DC9A 3A5ZB 3CNOA 1N33Q 3RS7A 2QBYA 3HOXG 2JA6H 1OIWA 3PITA 4Q1FA 2XXAA 3HOZG 1GNQA 4MGYR 2I5LX 2I0QA 3HJNA 4FMBB 1NVWQ 3PF5A 1W44A 5IT9c 1U0LA 1ZU4A 1J8YF 4G01B 3RS5A 1ZUIA 2I5HA 1B9NA 1W48A 2B92A 2QTHA 4YDSA 3A1TA 4B76A 3IUYA 1OH6A 1FPMA 2PBRA 3AF2A 3O8DA 3PSIA 3AKDA 1CP2A 1BYUA 1HQCA 4A0HA 3PEVA 5GADl 4BBRH 1HR0L 3MWJA 2VP2A 2WB1G 3W5JA 5J4HA 1WFQA 4M9ZA 2PMDA 1DAEA 1KSGA 1ZM7A 3ZD7A 4F4JA 4TN1A 2NTYC 3REFA 2GESA 1AM4D 2QPAA 3F5FA 1GVPA 4BXXG 1Q90A 1EFRA 1R9TH 1I4TD 2A30A 2ORVA 4TL8A 4A2PA 3ZD6A 1NVVR 1N3BA 1AIPA 1ZUHA 1Q86C 2IA5A 3UDFA 3H3VH 1N6IA 2E2IH 1VQDA 1VQ4A 2K5NA 3ONWA 1R0YA 3FB4A 5LD2C 3CWQA 1EIYB 3QXHA 3OW7A 3PUXA 1TXYA 1OFIA 2O8BA 2R7DA 2QP4A 5E7IA 3RVBA 1I50H 1KI6B 5LPNA 5IY0A 2ZRGA 1JB7A 2GN5A 4QL5A 2FFHA 1FX0B 2IUSA 3PF4A 4DUZQ 3RSOA 4CT5A 2KBFA 2B8GA 1DAMA 3WRXC 3N2EA 3Q7QA 3Q7PA 4PSAA 3CCQA 1F60A 4JBKA 4LWCA 2IHFA 3B7GA 1Z6GA 2JAQA 5EZ5A 3MSXA 4JJZA 2JLUA 4LBYA 1E2WA 2DFNA 1CKNB 1TUEA 3BJUA 1UKZA 2YWHA 5TVKA 3GDEA 3OHMA 1Q81C 3OEHD 1KSFX 3K0CC 1XCPA 1XJQA 1XJVA 2VH5R 4IJLA 3NH6A 3FTQA 1NJIC 2CLDX 2W2XA 1GUSA 3NH9A 1US8A 3CZQA 4PC1A 3WHLA 4LW1A 4B3SQ 1IYJB 1D6JA 3VU9A 3HOUH 1EIFA 1EX7A 5C1BA 4JI7Q 1GKYA 4HUQA 4Y7NH 5AJ3Q 121PA 2GK6A 4HLUC 4N0EA 3T1YL 5FBLB 3ECCA 3WHKA 2ANCA 4B3XA 2JK8A 4A76A 2FJUA 3A1WA 1TUIA 4TMKA 1XRJA 3NKVA 4XWKA 4K81B 1W5SA 3G71A 3FDIA 5JEEA 2BWJA 2WWWA 3I72A 4MDFA 4PPGA 5JWHA 5DYGA 3U3JA 2VW9A 4QL3A 5BQ5A 4IPDA 4BFTA 3OFND 1HYQA 2B29A 1U81A 1U2RA 5HZHA 4X66L 2ZANA 1Y1VG 3BZCA 1KQSA 3A7AB 2CVHA 1VQKA 1V5WA 2QGNA 5KYKA 3VKWA 4L5SA 1Q3TA 4US2R 2QG6A 4LHWA 1GFIA 2QMOA 3QBTA 3P4YA 1OFUX 1ZU5A 3QKSB 2L5TA 4ILEA 4R98A 1FR3A 3LNCA 1S3OA 4D25A 3QPWA 4BRUA 1JAIA 4B3BA 2JE6I 5M5WH 2B63G 3B1ZA 3NELA 4LYFA 4CW7A 2VNUD 1E1RA 2JLSA 4F4CA 1KRTA 2ZSDA 4LBZA 1XXHA 3FMCA 2H57A 1OXSC 3WBJA 3W6NA 3DXJC 3MXNB 2V4DA 3CONA 5FBRB 3M4YA 1AZTA 4OI2A 3NBYC 2WHXA 4K0KL 1OLOA 3K9HA 3PO2G 1IOZA 1P7CA 4A3EH 1SKQA 1XD9A 2ZTSA 3MJHA 3SOPA 3DVLA 4QGGA 2CK3A 1BKBA 1C4OA 1E0SA 1E96A 2CL7X 3LBIA 4OL0A 4LNQA 4X8LA 4DSOA 1HT2E 4ZDKA 5KU1A 5L3SB 1N25A 4UXHA 4BFWA 4DNRB 1ETUA 3CNNA 4HB2A 3GLGB 4B3TL 1MABB 3KXKA 4IXNA 4N0DA 4JLVA 4DSNA 3HOWH 2ZR0A 1W36C 1T4GA 4DB2A 3CX6A 2NZJA 3T15A 1XCMA 2J1LA 1K8GA 2ZS8A 1DD2A 3MLEA 2GZHA 1ZM4A 3GJ6A 4IFDJ 1YNJC 3PUVA 1IAQA 1IW7C 4DWJA 1OV4A 2EIFA 1DAKA 1M1KC 3NBHB 1IN6A 2GJ8A 2QAGB 4AKGA 1GM5A 4KHPQ 1TMKA 4KLZA 1WRBA 1CRPA 1E0JA 5TB5A 2G0NA 2ZJZA 4DBLC 1YZNA 1Z2AA 2IK8A 3DPUA 4HUTA 1TWAH 1E22A 2I5MX 5CB8A 4DKAC 1Y1WG 3KKPA 2YVUA 1Z47A 1E1QD 4DXAA 4GZMA 2XXAB 1BOFA 4IOLA 3S1AA 1H95A 3WY9A 1I6HH 5KPDA 4TQ9A 1PH9A 3I92A 2GXAA 4MZ9A 1E2ZA 4A3GH 3TKLA 1P73A 1VQGA 2IC5A 3TAUA 3O8CA 5SZHB 4DR3Q 3I7FA 3IPYA 4TLBA 3IDQA 2ZT9C 4TL6A 3TSZA 2CL6X 1VKJA 2GVAA 2YOGA 3B78A 4M1WA 2IX3A 1Y8OB 2PJZA 3A1SA 4A4DA 4C0JA 2F4VL 2KB0A 5AR1A 4MGZR 2PI2A 3FHOA 1CLUA 1SKYB 4ZDWA 4RG1A 4OHZA 2OSBA 1P8LA 4AI6A 1F48A 1PUJA 2NO1A 4A3FG 2QQEA 2ZM6Q 4D0LB 3RWMB 2CCZA 5SZKB 5GQOA 2QM8A 1H9SB 3GEEA 4JYAL 4NKRA 2OFOA 3H94A 3AV0B 1Z0DA 3LLMA 2XTIA 4A8JB 1XEFA 5HGQA 3EWAA 4JG2A 4B32A 3I61A 3UK6A 4MRSA 1GD7A 4OXPA 2GEVA 1RRFA 2GAAA 4V0ME 3K0AB 3UIEA 3X1XA 1LS1A 4TYWA 1LS6A 1UPTA 1DEKA 2R62A 3TMKA 4RD0A 2ERXA 3QENA 4WZBE 3A58B 1T9HA 4LV5B 4A0GA 1TNDA 1HNXL 4QQBX 1G3QA 1RJ9A 4JCVE 4RD6A 4A8JC 2DR3A 3EASA 2XITA 5JI2E 1L1OB 2XJ9A 4UNNA 2BJWA 3W9YA 3J81i 2FFQA 4TZ6A 2FG5A 4DV7L 3KF6B 4YCUA 3X1YA 3LH5A 3ZZUA 1DO2A 4F93B 1E1OA 4CEIB 3QBVA 3ZQJA 1CKNA 2BA1A 2AHOA 2ZR7A 3D6TB 2VEDA 4ASUA 4XVRA 1LFDB 4YWLA 3MWKA 1SVOA 4DUGA 2JA8H 1Z0AA 3QKSA 4NMMA 3RZDH 1HZCA 3GLHE 1R8SA 1BKDR 2FMXA 1N6LA 1TTTA 3AVOA 4X65Q 4KBGA 3O8RA 1E79D 1B23P 3AVPA 3EWSA 4MA4A 4C0LA 1YITA 4B3TQ 1KMHA 2Q9CA 1X9NA 5CJ2A 1J70A 1CJUC 1WXQA 3PIPA 1XZPA 2QROA 4ZIRB 2YC2C 3FFBA 1OHHD 4P4SA 5GADC 2JJ8A 3RC8A 3NVAA 3CCSA 4KU4A 4LF5Q 4ACAA 1N0VC 3OESA 3TK1A 2J59A 3CPFA 2ZJAA 1E4VA 1T6NA 4A0RA 1XEXB 3JVVA 3ND9A 1JR3A 1AJEA 2CMKA 3BG3A 1VQ9A 1G9XA 4A8JA 3KKQA 2H5XA 1EOVA 2LMCB 4B74A 4UXJA 2BE5D 2H8KA 2C78A 4QFMA 2A69C 3ZVLA 2N42A 5C18A 2O8FA 4AH6A 4YMUA 3EPKA 4JI3L 2H5EA 3LQRA 4J15A 4MGKR 2D7DA 1MOZA 4DCSA 1PMRA 5J4VA 1GITA 1KI9A 3G48A 1OIVA 1DG3A 2IS4A 5GJCA 3W1BA 1WB9A 2IXFA 2ZQ5A 4HAUA 4NXMQ 4RD4A 5AJXA 5M5YH 4V03A 2RHSB 3I2ZA 5FJ8H 1KZ7B 1QHXA 1W47A 4L5RC 1M34E 3WMEA 2IYSA 4I81A 1E2KA 3KQKA 3STBC 2OAQ1 4NCHA 3WYGA 1B70B 2JEOA 4DJTA 3FYHA 1WCMG 3EZ7A 1A62A 4TYYA 4JI6Q 1E2DA 1NJFA 2XGJA 1M7BA 4IXMA 4M1YA 4L8JA 2ODNA 3FKQA 2VP9A 3NBFA 5DN6A 1WBDA 1YNNC 4PC6A 2VHCA 3ADDA 3EN2A 1XMIA 1VG8A 1VMAA 2ECKA 1N6PA 2FDCA 4KKTA 1SVLA 2HQLA 2OXRA 3EPJA 4LF9Q 3PO3G 3MWYW 4OO1H 1RKBA 1U8ZA 2E2HH 1S1CA 2WJIA 4IO9A 3DOFA 3A0JA 3TAHA 3TH5A 3FHTA 5F2EA 4DLWA 4AG5A 1NKSA 4RVCA 4Q9IA 1HNXQ 4TT3A 3RRZA 1NBME 5HR5A 2IW3A 5KDOA 2JA7G 3KQHA 3K0EA 1QG2A 3C5HA 3EG5A 4AURA 1SULA 1VCIA 5DGXA 4MITA 2OTLA 2ORIA 3JZMA 1JXOA 4HATA 4JSTA 4B3MQ 4JMPA 3AYHB 3U6BA 1PZNA 5FL7A 5B64A 2V6IA 3K8YA 3ZVRA 4JLAA 2EYQA 2NN6H 2GKSA 3AH8A 2QA4A 4NYMQ 4DR5L 1XF9A 5IYDH 3EZFA 1KK2A 3LO5A 3THWB 4A3DG 2F1MA 3MFYA 2ZRLA 4G5GA 1VQ8A 1TQ4A 5DHFA 3ADBA 3AM1A 2LKCA 2WJJA 3PG5A 3OW2A 4UP9A 2PT5A 4LGMA 4QJ4A 1NN0A 1G8YA 4LJ5A 1DELA 4BLSA 3L43A 2HF8A 4HZIA 4KFSA 1NBMD 1KY2A 2XSZA 4B2LA 2ODBA 1H9KA 5K8UA 1E2PA 1G3IA 1KMQA 3VNUA 2Q2HA 4BEBA 3J81c 1KJZA 2K75A 4LPKA 4C2UA 1BMFA 2XX3A 3QVUA 4TL7A 2H1LA 3ULJA 2ZJPA 3KJOA 5FLXc 3CC2A 4JYAQ 1KIMA 1U98A 1YZQA 2GF0A 5G41A 3HFZB 3UE0A 2QEXA 3WP0A 2EWWA 3CRKC 1AGPA 4BFUA 3TGPA 3GFPA 2X8AA 4PAMA 1DE0A 5JHGB 3U5ZB 4LK2A 1XMQL 3ICEA 4MKHA 5DYIA 2J0SA 1X8KA 3GO5A 1N5KA 2E87A 4K46A 4I1OA 1GG2A 4PQYA 4B2IA 3CW2A 4DR2Q 2IYLD 1KOFA 4GKKQ 1VCMA 3VA7A 1TU2B 5EP4A 5GVSA 2SHKA 2Z5FA 3ZLJA 3O8BA 2WP8J 1RRCA 3R9WA 2R6CA 3HU1A 2XOKA 4JBJA 2K52A 1Z0KA 1G7CA 2WWHA 1ZUNB 4NYJR 1YVDA 2V54A 3I32A 4KYUA 4LY6A 3U4QA 1QHNA 3A4LA 5IWAQ 3PGZA 3H1TA 3T53B 4KXFB 4PZ6A 1YU9A 1UDWA 1DARA 2QORA 1Q8KA 1GILA 1I4LD 1T91A 1ZW6A 3OIUA 1NG1A 4H02A 3B6YA 4EAQA 1XNRL 1IN5A 1U8AA 2YOHA 1HNWL 3CRMA 3GJ8A 3SGIA 1LNZA 2CDNA 3DMNA 1AE3A 5FLMG 3IHWA 2A68D 2A5YB 4YWKA 3LVQE 3DL0A 1ZJ6A 2QZ4A 1IY0A 1YIJA 1SZPA 2PEZA 1K0RA 2ZRPA 3GCGA 4HAXA 4P71A 2XB4A 1XNRQ 3HOZH 3CM0A 4KI0A 1HA3A 2DY1A 2XZOA 4DB4A 1FOEB 4LJ6A 3CW2C 2Z43A 3MEFA 1NMYA 1TF7A 3DEFA 2DHRA 5FFMA 4B43A 2JDIA 4URVR 4BA2I 3Q9LA 1HQYE 2HT1A 5IYBH 2F3IA 4GOPA 1EG7A 3KLWA 1A63A 2MSEB 4A3KG 5FI1B 1H8ED 2XNDD 3RLNA 2QI9C 1MKHA 6Q21A 5L3QB 4DLTA 4LUVA 4FCWA 1US8B 2GBLA 4BBRG 1G7SA 2V3CC 2RGDA 1P9RA 1AN0A 4TLDA 4A2QA 3A4MA 1N34L 1XPUA 1G4UR 3UMSA 4F4IA 1T0HB 4YHHL 5BN5A 4OK6A 2QM7A 4HEJA 5JMTA 1G8FA 4C7OA 3EXAA 1IYVA 2RGBA 1SE8A 2PQAA 4URUR 2OTJA 2IYZA 4AK9A 3R9XA 2WJGA 2BMFA 1UBFA 3QKRB 1VQPA 3OEHA 4HAVA 5HE9A 3UXMA 5LBIA 4BFYA 3IIMA 4BE7B 3PJRA 1Q22A 1XNJA 1GL7A 2KA7A 1NSFA 5CLQA 4A3JG 1JEEA 1E9BA 1CKEA 1YR7A 3LX8A 4FI3C 3B6EA 4UP8A 3TQCA 5FPKA 4XIGS 5GROA 2CFMA 1T8TA 2A3RA 3KYHC 1SVSA 4RSGA 4DCTA 4DV0L 1RYFA 2Q0HA 2AWOA 2YINC 3M3YH 5DHAA 3RS2A 4D4JA 5A5GA 5JSZB 3KB2A 5ELNA 3BB4A 4YDHB 3EAQA 2R8RA 5SZJA 5JHHB 1VHLA 3A8JE 1YZTA 4TVAB 1KK0A 4FN5A 5FPHA 3VMFA 3PO2H 5HKKA 3R8FA 4A3EG 1VQJA 1KO1A 3LNNA 3HPRA 1SVWA 4R4OA 4KKSA 1F3OA 3DMDA 1JQLB 4A6PA 2GXSA 3THOA 1Y14B 3IO5A 1JPNA 2ZRMA 4PR0A 3S1RH 1CXZA 1G8PA 2FPKA 2ALYB 2O0KA 1VQEA 4FXPA 4GOJA 2GCOB 1PH2A 4HAWA 4G3XA 3LWNA 3GLIE 5C0XH 2FXQA 2Q3HA 4R4CA 2H7VA 3NDPA 1KTVA 1ZC3A 4OGQC 1IN7A 4IDQA 4NP6A 3U7GA 1TX4B 4JIMA 3AUXA 1OPXA 1GL9B 2IUUA 2OILA 2UVQA 3DKPA 2UUBQ 3HOUG 4RKFA 5FI0B 3PXGA 3AVTA 3K7UC 1CEEA 3W3AA 1XEWY 1YHBA 1N5IA 1XX6A 3AB9A 2JQOA 4Q7MB 3AVVA 1KHIA 1VQ6A 2EVWX 1R8QA 3L2OB 5JLJA 3E9HA 1T3HA 3SJAA 3L0PA 3GEIA 2IHYA 3HDTA 1GRNA 3LXRA 4KHPL 2OWOA 4XSHA 4POAA 2OBNA 3HPQA 2WMOB 2Y8EA 2W83A 1EYGA 2J9RA 1ZCAA 2J0VA 3CX8A 2EJGC 4JBWA 1U0HC 2XTNA 2QNRA 2A5FA 3C8UA 3FFAA 1UKEA 3K1JA 2IWRA 4GFDA 4EUNA 2HHHQ 3AB3A 1FFHA 1NLFA 1E9DA 1R7RA 3TUIC 1AK2A 3I62A 4AKIA 1IBLQ 3G5UA 4PX9A 2BC9A 5KUTA 4GOPB 3CRW1 3LX5A 1OXTA 1E2MA 2Z6VA 2ZJYA 1SXJC 3SJCA 5IK2A 4JS0A 4LHVA 1EFHA 3GTJH 3U3KA 3G4SA 1BYIA 4A93H 4BY7H 4X6AH 2ZR9A 4DV6Q 1O87A 5A35A 4DR6Q 2F6RA 4DIDA 3MMPA 3MJRA 2NVTH 1G6OA 1MABA 4Q1CA 3G82C 4OYHA 4Q9HA 4CF7A 4EJSC 4JI3Q 3RS4A 3JC66 3I4NG 1F2TB 4DLSA 2XNSA 1U94A 2OFXA 1SXJB 1W0KA 1W46A 3A7LA 3TNFA 2WPDA 4YMSA 2Q21A 1NN5A 1H9RA 4RFSB 1EFWA 2HXSA 3PFIA 2DN8A 3N6RA 1PYBA 4V0NA 1TWGH 1W4BA 1S0UA 3RHFA 2C9OA 4GP7A 1SMXA 4C4PA 5CITA 5E95A 1N6KA 3UMFA 5LMNW 2QPTA 4WOPA 4KSBA 4NH0A 1CI3M 4GBMA 4Q4JA 4EPTA 3KOJA 1HNWQ 1NSTA 1ZCBA 5GAHC 1ZNXA 4Z1MD 5GJBA 4CEHA 1YBYA 4JOIC 2UUCL 1R4AA 3P26A 3BFXA 2V7QD 2DCUA 4HB3A 3I4OA 3H0KA 5J4LA 2RGCA 4Q1BA 4DNIA 5FBQB 1B0UA 5DLQE 2GZDA 3AVYA 2K32A 2DWQA 1X6OA 4DDWA 3OTOQ 3ZJYC 2W58A 1GRRA 2B7CA 1ELOA 4OONA 2GVZC 4TL9A 4C9BA 1QHYA 2XAUA 5HCNA 1COWD 4Z54A 2VS1A 4F7WA 4JKYA 2UXBL 1KDOA 4ZI3A 3CPWA 2ZRDA 1NL3A 2QENA 4Q01A 3GTKH 1IQPA 5EQTA 1A7JA 2H17A 1N6NA 5G40A 3RANA 3M85A 3S14H 2WICA 4UQOA 3BK7A 1AGRA 2ZSEA 4C0AC 2O8CB 4B3CA 4FW9A 3TE6A 3U44B 1Z07A 5AUQA 4R1JA 2O8FB 2R2AA 1Y1WH 4FMDF 3KLRA 2ZE6A 2K7VA 1OW3B 3T51B 1D5CA 3U4VA 4XTCS 1GP2A 4US1R 1CRQA 4ON9A 1Z3IX 4C7OB 3DZ8A 2B21A 3LA6A 2AK3A 2D0OA 1G17A 4DUZL 1UDXA 4HAZA 4ME3A 1NKTA 1KDPA 4NYIQ 4V0MA 1GDDA 2ATWA 3S1NH 1D2EA 1W4CA 1TADA 2BEJA 1FQJA 3SI7A 1MJCA 2Y0SG 1CTMA 5KDDA 4GN3B 1GSIA 2XZLA 3WMGA 5BYKA 1N32Q 1KZGB 1II8A 2A5DA 3H0GG 5C4JH 4X8MA 2A78A 4AY2A 2O8BB 3K80C 2E1RA 3HKSA 3U4ZA 4LSGA 1ZRHA 1PJRA 5M04A 1M90C 3K0AA 2GTPA 5JEDA 1BIFA 3ZIAD 5FUVA 4XVUA 4LJYA 1WDTA 4ZKDA 4P72A 4HJ9A 3J81j 1KAOA 3AQQA 5K8IA 4QGFA 2QAJA 1QVAA 3H86A 3K9GA 3RS3A 3T5DA 2IYVA 3W8NA 4KCGA 3CMAA 1SXJE 2BBSA 2CKZB 5KSPA 3BU2A 2HV8A 2QSZA 3B2EA 4M4SA 1G5TA 2ZU0C 2OQKA 4Q18A 3PUZA 2R92H 1WQ1R 3UWOA 2B7BA 3PO3H 3FPPA 5C4MA 4QIWE 3CCLA 5C4XG 2EW1A 2ZJOA 4TTRA 5P21A 4BLQA 2ANBA 4TKOB 3IHLA 3UE1A 2B8WA 1A1VA 5GVRA 1IXSB 2RGXA 3PENA 1M6NA 3ZGXA 1EWHA 4DR2L 1UF9A 1NG9A 1IBLL 2NPIA 2I1QA 2BM0A 2VSFA 1O7IA 5DH9A 1CTQA 5AUNB 1VPLA 3SE0A 4A82A 1KYIA 1X3FA 3M9BA 4PPNA 3QKUA 4AYBG 1X3GA 4S2EA 5KNCA 2VQEL 4DKXA 4ZCMA 2QT0A 2RGNC 2JXMB 4A3LH 1DXMA 3TREA 3AEVA 3TSWA 1UE1A 5HY6A 2F55A 5M3MG 4LFBQ 2YYZA 2J46A 1TQ6A 1P2TA 4QM6A 4PG3A 2D2FA 1LUZA 1D9ZA 3L82B 3S1AB 1P6XA 2IYTA 1WCV1 4X8HA 4JI2L 5CB6A 1ONLA 2OFWA 3HGBA 2ZS7A 3L2PA 5DLQC 3FP9A 3JAMi 2UXCL 1XNQL 1AS2A 1Z0IA 2CCGA 4R7ZA 4V02A 4DLZA 1KGDA 3TBKA 1S1MA 1UEBA 4GOPC 2FEMA 5CIWA 1AS0A 2WIBA 4RZ2A 4YC7A 4ZIRA 5FOWA 3BDOA 1I94Q 3GJXC 3LBNA 1BBUA 4DV3L 3WRYC 3ZS9A 2HXYA 4DDVA 3SBDA 1UKVY 1X65A 1FL0A 1P5ZB 1E99A 1COWA 4M9QA 4TLEA 1X54A 3GTLH 5M3FG 1FNNA 2ZI9A 3GP8A 5FPTA 3VR6A 1G20E 4R9UC 1F5NA 5CIQA 3SZRA 5CM9C 2AHOB 3AP3A 4M1OA 3TQYA 4BZXA 1V43A 3IKJA 1A0IA 5H68A 2UU9L 4LFCQ 1EFRD 2QSYA 4L16A 4LC1A 5FL7D 1RC8A 3P4XA 5E4FA 1D2NA 2W00A 3CIOA 2E76C 4YHHQ 1N2CE 3B9PA 4LCBA 1TQDA 4HIOA 3AVQA 4XJXA 1WCMH 3UPUA 3KUDA 3NBXX 3TS0A 1WYDA 2RH5A 1JAHA 1EXMA 3THXB 1N6HA 3CC7A 4FD2A 1MO3A 2ONKA 4ACBA 2P6RA 4MYCA 4HYYA 1RRPA 5FLMH 2ZRCA 4I7ZC 4URWR 4IPGA 2W6ID 3E9IA 2ZVQX 2GEDA 5EE3A 1YE8A 2BBOA 2VHUA 1OFHA 2WPDD 4PZYA 5HTKA 1JI0A 2YU9H 1GTVA 4WXPA 3S16H 5AUOB 2UUAQ 4L5QA 2BIFA 4G1UC 1K6MA 4GS3A 3U3MA 5K36H 3CP0A 3M4QA 1Z6TA 2F3TA 4OX9L 1HEIA 3HU3A 4JI4Q 1MH1A 3AP2A 5F98A 2RCNA 3I56A 2GCPA 5ELXA 1BDOA 1NY4A 1A2BA 4HUQB 1HR0W 1UKYA 4ESVA 5IYBG 4BPBA 4WJ4A 2R44A 1S72A 3T35A 1EESA 1VYVA 3MRSA 2HJVA 4DAYB 2F1RA 4H9GA 4IEIA 2B3GA 2G1JA 3THXA 2WAYA 1FYCA 3GLHA 3IILA 1YHAA 1MO4A 4LYAA 1E94E 5EXSA 3KFXA 2AL7A 1IJEA 2GCNA 3BH7A 2VUMG 4GKJQ 1NBMA 2Q9AA 1NF3A 3BOSA 3EZ9A 3L0IB 4FMDB 4HSEA 1HE8B 5FR1A 3W8RA 1I2MA 4G7HC 4P75A 1Z83A 2FF7A 4KAXA 4L4UA 5BN3A 2C5LA 1YJWA 1UE7A 2C04A 4NXNL 4PC7A 1P72A 1GNRA 2AD1A 2CXXA 2WIAA 5J5CA 3WBKA 3K0XA 4AYTA 4FDBA 4PMWA 1B7YB 2AD5A 1VQOA 2K5UA 2W6JD 1SVMA 4PAOA 1UBGA 521PA 1T8UA 3OOCA 4GKJL 1ZM3A 4DV1Q 3SN6A 5JSZA 4A3JH 2JCSA 4JLPA 2ID0A 1YR9A 1HT1E 1VIAA 2Z4RA 4RY2A 3VU9B 3DM5A 4KYIB 4JL8A 4LRWA 1LF5A 3T1QA 4AC9A 1PVOA 1KMHB 4US0R 5ANRB 2D62A 2VRWA 1GUNA 4NU0A 4AIMA 2Z0SA 1R5OA 2IYXA 1Y8PB 4MTNA 1YEZA 2N3SA 4RZUA 1K9MC 1ZD8A 1KHTA 1W2HA 2PH1A 1N6RA 3KJEA 5JJLA 2DGYA 4OQFA 4IOKA 3KDSE 1FJGQ 1W0JA 2R6DA 2CWAA 4LFAQ 4CDGA 2ZS9A 4EPWA 1G3MA 4GNXB 3B1XA 2YJTD 3AVWA 3A74A 2ZE5A 5KSYA 4U02A 1KSHA 1UBCA 1SVKA 2FV8A 1E98A 3EZ2A 1G51A 2Z6KA 3F3YA 4C0BA 4JI7L 2I4IA 3PEWA 2A68C 5G53C 4MUBA 4DR1L 3CPJB 1PHJA 1GRQA 1NRJB 4GNXC 2A9KA 3QSYA 2NZHA 3CH5A 1G8GA 1T3SA 4PZLA 3RSLA 4Q4HA 621PA 2CVFA 3NC1C 1MT0A 5BYJA 3W5OA 1T5LA 1FQKA 1SGWA 3NEMA 2TMKA 5G3YA 1VDZA 3DKVA 1QZHA 1DADA 2GAOA 4IVQA 3VR1A 5JRZA 2JLRA 5HPYB 4J0QA 1JQJC 3D4RA 1OXXK 1V8QA 3LDAA 2HEIA 3U7HB 1I2DA 3C15C 3GJ0A 4URXR 3UANA 2IF0A 1XFAA 2KE5A 3K9NA 3WDNA 1H65A 2FGKA 5GJWC 4LX0A 2XJ4A 1AS3A 1G18A 4EFMA 3BGWA 2B6HA 1J5EQ 1NBWA
chains in the Genus database with same CATH superfamily
2RGGA 4UBKA 2GN1A 3F9IA 1CQZA 4ND3A 1JJ7A 1XX8A 4HXYA 4WBSA 5LDHA 4ZVNA 4JEUA 3OFKA 5E6UA 4B3DA 4NP5A 1WCMB 1P33A 3TQFA 4MPPA 4BNYA 4P32A 4X3CA 5ITSA 1PJZA 2OP1A 3FDXA 3H18A 3H99A 5C1IA 1R9NA 1V1OA 1L7EA 1GT6A 1CY8A 4LN1A 4ODIA 1E24A 2H4FA 4QGAA 3ULKA 4A2QA 3CZ9A 5FOSA 3VYSB 3GLQA 4MEBA 4YCWA 4QFBA 5JECA 3ENKA 3NFYA 4FF1A 1GSOA 2VA8A 3SS8A 1A7UA 3IBFA 3VU8A 4LXYA 4YMLA 3ABOB 2UXDQ 4JDUA 3PP8A 1GWNA 5GONF 2HW8A 1AXRA 1G8JA 1NT2A 2KCMA 3ONFA 1T24A 4J8PA 1KJIA 4OU4A 3LOPA 3RHZA 3KWFA 1EVKA 3C41J 3H4VA 3E23A 3I6YA 5AVRA 3BERA 5LA6B 1ORRA 2EFJA 3K2BA 3WADA 3A8IE 3IFTA 2ZGVA 4I4TB 2HCCA 3UWPA 1LRKA 3VR5H 3O9VA 3VPGA 1NN3A 3BWBA 4V2UA 4ZVOA 4WEQA 5EESA 5F4ZA 2K04A 4TROA 4MMYB 4P4SB 3LXUX 4RQTA 3FYCA 3HYNA 4OQDA 2PFSA 1UE5A 1D4AA 1VTKA 4PQGA 2FQQA 5KNBA 2ZUFA 3FGNA 4L5YA 1AA6A 3IB6A 3K5IA 2ZBDA 2VK2A 4LF4Q 3AV3A 2EFEB 3LHSA 4HPJB 4MVJE 4O29A 5CU7A 3TRHA 4DJDC 2AE2A 1OKKA 3H9EO 3GT3A 1X94A 3HJHA 5HF8A 5A4DA 1U1DA 2AEEA 3NHJA 2WK1A 4MKXA 1JF8A 2K14A 3HA2A 3GJQA 2C0PA 1YZHA 1TS4A 5ITWA 4WFKA 3ZWQA 3GFSA 1C1DB 1LTBD 3DE4X 4QOIA 1W2BA 1B4DA 1I5OA 1QIFA 3D3WB 5C0XG 1IHXA 4OWXB 1II9A 2QL6A 3CLSD 3KDAA 1GHTA 1E3PA 1FXUA 5LMZA 4FYHA 3MTIA 1AQYA 2E82A 2FE4A 3NHZA 1OZGA 5K4AA 1Q1ZA 1M2EA 1USWA 3E22B 1PJ8A 2O7SA 4MTLA 5JDCC 3FMOB 4OHVA 1H2WA 2NWQA 4A3MG 5AHRA 5EIHA 3J7AF 1VE5A 2DT8A 3BYZA 2CHEA 3HBAA 4MH0R 4P58A 4ZXPA 4DT1B 3IE1A 2OYSA 2YICA 2P5UA 5IYCH 1Q7GA 3I55A 4X93A 3B70A 2QW1A 1O2DA 4UEQA 1SCNE 1A9YA 3CXCA 2W6QA 1XMVA 2C4KA 2WJ3A 3K6RA 1WZEA 4HZUB 4DQDA 1XMOL 4GHWA 2HMUA 3OKAA 2GXQA 1HTBA 4HO1X 2B5VA 2PL5A 1MHTA 3P2OA 1A9QA 3I9OA 3NKFA 5C7YA 4JU8A 5GJVC 1WI5A 5C2JB 2IPNA 3J7TA 3GMIA 1M2VB 4A36A 2JA5G 4Q3OA 3JCZA 1WLYA 4YUWA 4MQUA 4RH1A 2BGLA 5EZ6B 2VL7A 3JR3A 1EK0A 1XL0A 1Q91A 3SD7A 4G0ZA 5C0XJ 5CRIA 5H80A 2SEBD 1MCZA 1P61B 1NC1A 2X9LA 1XWEA 5ARCA 4D4IA 3I1YA 1JDUA 3AR3A 4MR8A 2UVDA 5JH7B 1F2TA 1Y8CA 4DAOA 3AEUB 4KXMA 1QONA 2RMKA 3LP6A 2FSFA 2POCA 2DB3A 3K09A 3VAAA 4DBVO 1KK3A 5DLYA 4D9MA 3K9BA 4HGQA 2WOOA 3NIWA 4A93G 2FDXA 821PA 3D7NA 1NATA 2PJUA 2AHRA 3SHTA 2DF8A 4CG3A 4ZJZA 3F1LA 3E3AA 3KZMA 1DEOA 3MD9A 3MSCA 1GDTA 1HO3A 1P2UA 2XD4A 4Y67A 2VHJA 3BWEA 4BKQA 1UADA 1VS0A 4C3JH 5CP8A 2NB0A 1SUSA 2XWSA 1N6OA 4WFQA 3OQIB 3LW8A 3PQCA 4L8GA 1O9HA 1RXSA 1ITZA 3FWPA 3TXYA 2BGRA 5ALVA 5HFAA 4NZ9A 2FZEA 4Y3UA 2R6JA 2OHFA 2P2ZA 4K9SA 4YMWA 1P8JA 2H2GA 1L3CA 2HDNB 4PZAA 4JOQA 5EKTA 5A9SB 1L5VA 3AHDA 1DC7A 4ID6A 2ZIFA 1G63A 2PH3A 1BE8A 4UNSA 1UE6A 4Q16A 4WW0A 5JD6A 4GI7A 5EZYB 3N87A 2GD6A 2PD4A 2C94A 3I9V1 1K8MA 1V11B 1HUMA 1PT7A 3CZ5A 3OP1A 4JB3A 3N70A 5CVCA 3SQOA 4AMGA 1Q0TA 4C0HA 4RHSA 4HBGA 4TZ0A 4A3FH 4BP3A 1E1RD 2R1TB 4CJXA 1JIJA 1O89A 1XDWA 4M86A 5FF9A 1QQAA 1HTPA 3DE1X 3ER0A 2RHCA 5JRJA 1DBSA 4YAUA 2KWIA 4RF3A 4R40A 1XPRA 2CLLB 4GKBA 2YIMA 2VPQA 4V0SA 4QPZA 4F5WA 1HG1A 2P79A 3E5RA 4BQNA 4KLAA 4AG5A 2ZYTX 3PUYA 2BRUA 2HOQA 3LL7A 5EVJA 5CYOA 5A6SB 4ZYVA 4NRDA 4XFKA 1Y1VB 2NQ2C 2WTMA 3V8NA 5IP7G 2PKRA 3I2IA 3ESAA 3ICCA 3IEVA 5COQA 5ENZA 1EFVA 1V16A 5I01A 5JDIC 2DGDA 2V6GA 4P31A 1JHVA 2D2VA 3P4UA 1N4DA 3GNSA 3WL3A 1MFZA 4HVTA 4MW9A 2VAVA 1O94D 3C0KA 1C9JA 1VQHA 4QUDA 1NVVQ 1O78A 1A8VA 4EMSA 2VPZA 1L8QA 1YQWA 2GYUA 4RIFA 5L4LA 4KX5A 2MSNA 4AD8A 4E5SA 5D5HA 3NORA 2BMVA 3LWUA 1N8RC 3I8XA 4XYBA 2IEBA 3CZPA 4KEAA 1W4AA 3TD9A 1YI2A 4GXTA 4BO8A 1NFRA 2HIVA 2DTEA 1HA6A 4HB0A 3U6KA 2JG3A 1D7AA 2WV6D 4E08A 1P7ZA 4HIKA 4TSSA 3E5SA 1I4DD 2W7TA 2ZUDA 1HH2P 2PRSA 4J1TC 4WLEA 5G1PA 1JG7A 4AWAA 1CF9A 1OJLA 5C5DA 2ZXEA 3F46A 2BZ0A 5EJ6A 4FYPA 3UXEA 2V6FA 2B2VC 4I4NA 2A94A 2V7XA 4OFZA 4OJQA 4O1HA 5E1MA 4C0KA 5AW4A 1DZ3A 2Y1DA 1CEXA 4FUQA 5DHSA 2FPPB 3JZFA 5ADWA 3A9RA 2D7JA 1QHGA 4Q4CA 3DZKA 5FTLA 3E7DA 3PIO3 5DCWA 3B38A 1LK0A 2J07A 2XUPA 2EHJA 5H83A 5IF3A 4MNOA 3IPAA 4WUVA 3RFUA 4BLRA 2JFUA 4R84A 2QP3A 3H11A 2PI2E 2CLSA 4DNFA 1G3RA 4H0LC 4XIJA 4A92A 4DMFA 3CINA 3E82A 1VQAA 1JJGA 1JR3E 2VYCA 3G9QA 2C95A 3GFBA 1EVLA 4FVTA 3MAAC 1A9ZA 1JIVA 4E03A 3QA9A 4YUVA 2I80A 3FMPB 1C4WA 2A14A 2PGAA 2EYHA 3FHCB 4MR7A 3IDSA 4O4LF 4JJ8A 2MSDB 4MDYA 4NBSA 3SU8A 4CLRB 1BD3A 3MT7A 2JCVA 3AIKA 1M8PA 3C4JA 4I0WB 4LZNA 1R2QA 2IPOA 1G2PA 4ND4A 3WGTA 3QPBA 4LF6B 3OBBA 2NT3A 1W2WB 4RD3A 4OFXA 1O7JA 3FDTA 3C7KA 1SE2A 4KSYA 1XYVA 2HT6A 3ERCA 4F7XA 3SR0A 1EG2A 2ECFA 4GUAA 1PS0A 5FPQA 2BKLA 1W5BA 2F3RA 4FILA 1UODA 2XDQA 3E8SA 5IEBA 4WOCA 3IKTA 1HDRA 3PNMA 3PFFA 5B4TA 1QNUA 4EUKA 4K8IA 5JEAG 1QK3A 4NEQA 2A1TS 3TI7A 3HFRA 1EQUA 4QFDA 3I6MA 1RWOA 2QU7A 4ZTBA 4UP7A 4WORA 1XAJA 2VYVD 1VSUA 4XCVA 4XYMA 5E9AA 2VOJA 2I6QA 1YZKA 3SF8B 1VA4A 3B8HA 5JDIA 4OL7A 2HHCA 4YROA 1A2KC 2XB6A 4I99A 3GLTA 2BBTA 4GMHA 3EYAA 3KF6A 1HV8A 4V0LA 4XUEA 5EL0A 1EFDN 1ZJWA 1T8SA 3TVDA 4OO1G 1T4DA 1KLGD 2PPBC 1XQ9A 1Z26A 2EOTA 2NO6A 3E5MA 3KB1A 2Q6TA 3QELA 3EOZA 3NOQA 4JLKA 4M6WA 4LRTB 2EKQA 2BGWA 2J6HA 3JWGA 3J81k 3SKYA 1XTQA 3T1VA 2X8JB 2WKQA 3E27A 3V2TA 3F5QA 1X86B 3AG6A 5C8YA 3T3NA 1KZ1A 1FNMA 1XHFA 1NNLA 2RQXA 1HNNA 1EK5A 1A1SA 9GPBA 1N77A 3HOWB 4ZHQB 2UZ3A 3HKBA 5CFMA 2VHYA 4OMFG 3UJBA 2ZJ6A 4ZVMA 2F1JA 4A9AA 2IFTA 4CN9A 3AF1A 4FFPA 1U90A 1FXSA 4WQMA 2HU7A 2QLJA 4QJ5A 1IXKA 1P2VA 3WYFA 1DHRA 4UOQA 2FZ5A 2FZWA 3L6UA 4ULLA 1G0NA 3A6KA 3OF5A 2NZUG 3PGA1 3WFIA 2O8EA 5CB4F 2GTIA 2EYUA 4LF5B 3O8OA 4PNHA 221PA 5FWYA 4KOEC 3CCEA 4AU1A 3OPYB 4D4HA 1QDUA 4CF3A 2GILA 3NWJA 4HKTA 4IRMA 1JI3A 2JIZD 3FM9A 3HEBA 4E4YA 1G5RA 3K6JA 4HS4A 1THZA 3QE9Y 1ID8A 2CW0C 3O3OB 3TRDA 2YYSA 3AR4A 3KB6A 4RTOA 3GTGH 4ZQBA 5K0EA 1WULS 2JIOA 3P9NA 1DG1G 1RAHA 3HU2A 4G8BA 1G5PA 1GD1O 2AJBA 1E5DA 2Q8QA 4JR0A 3CRQA 1NXWA 2QLMA 1XD2B 4X41A 5KRUA 4XE5A 1U0OC 3GJ7A 3SK8A 1U0BB 1YJ5A 1BKSB 4MIUA 3FCOA 3MWEB 3MB5A 3GIWA 3G9UA 2P5ZX 1G21B 1E6EA 4OXXA 3V2GA 4ZO4A 2HO5A 1DCZA 1IRIA 3ZV7A 3H8VA 4HH0A 4V1CA 1CHQD 4IIVA 3K0SA 4MTKA 3AESB 4L9SA 4DR4Q 3KALA 3LOQA 4RPJA 3F7NA 1EEFD 1QG6A 3TSCA 4PWYA 3HI4A 3T4PA 1QIDA 2Y1EA 1ZJZA 3AESA 3BXZA 3ZGLA 2UUBL 2Z2JA 2AG8A 4L28A 1E7WA 3LBHA 4KIUA 3PDWA 1CS4C 4LTDA 4OJNA 3RUZA 1R9MA 5FLYA 4KKVA 3EQ9A 4FFMA 3A10A 5CV4A 4KQMA 4Q3EA 4H13C 3W1WA 1EAMA 5IIFA 2WI8A 2VJYA 3KYIB 4CVNA 3A37A 2DPXA 4ZCLA 2VZEA 2BLNA 1K8AC 3C3JA 4BV9A 4A3BH 2GHRA 4U3JB 5CGZA 4OXIA 3KJXA 5REQB 1K86A 3W8FA 4Q4AB 1V25A 4HIMA 2QT1A 4X1IA 2VKQA 4DMKA 4YUYA 5CD9A 3QVTA 1P6QA 2L18A 1UC9A 4AT1A 4K2KA 1CD5A 2SNSA 3HKZE 1I6KA 1LI4A 3KKOA 4W8OA 5IJ0B 2CHQA 1TVKA 4I8DA 4QG3A 4OI0A 1E6WA 3A3KA 1H5NA 1RWVA 2LKVA 4I9FA 3VR4D 2VNSA 4JVMA 3ZWMA 3S2YA 3FVRA 3LCCA 2C5FA 3ILVA 3BZDB 3EZ6A 3E0QA 2J32A 4BX0A 4BXOA 2E48A 2ZWOA 2NYRA 2BONA 5FTJA 1R6XA 5KNCD 5DKFA 3SKXA 4EDHA 3GLIB 4Q4JB 1VHQA 4HN7A 4PLTA 3IP1A 1EWQA 4DAMA 5AW1A 1I6HB 2HLDA 4KLKA 3UA4A 5KX5A 2GX6A 3TLMA 1KFEB 1W49A 2CH4A 2FRXA 4GE3A 4EGJA 1PK9A 1W93A 3WIVA 1XQ1A 3KOUA 3ZWKA 3A11A 2OD2A 3UCFA 3OLYA 1ZZGA 3C7DB 2A1AA 5FKJA 1Z08A 3FOBA 3UAGA 3OSOA 1KVTA 1T0UA 2NSLA 2VTKA 2YV3A 4XSGA 5AD1A 4HQ6A 5B1SA 2KJQA 3UZUA 5IG2A 4YAEA 3K5PA 1L2TA 3GG2A 5EHNA 4NBKA 4BZQA 4CN8A 4E2XA 2J41A 1Z28A 1LJ8A 6GPBA 2PCFB 2LE0A 3Q9NA 3MG9A 3NHMA 1YB2A 4OBEA 2PT6A 2YR0A 3H83A 3RSZA 4OSEA 1SR3A 4U2KA 2Y0SE 1N0HA 1E1CA 5IODA 3ZK9A 4D81A 1OX6A 2FZLA 3MJTA 1KERA 4RK1A 4E6EA 3W4JA 4YRPA 1SUFA 4EGVA 4TQUS 1XEXA 2G28A 5E7NA 1XTBA 2ZE8A 3N53A 3T5CA 4JYAB 3DCYA 5KC9A 1LSOA 1WD5A 3HDGA 3MPUA 4G8DA 1CZGA 4G0NA 4E07A 4C6TA 3PX7A 2QMZA 4DZZA 5IP9G 3EVCA 1WO8A 3VH3A 1J49A 4DR3B 2V1UA 1JLHA 2GEFA 4MB6A 1X6VA 1DWUA 2QTVB 3QOFA 2P9BA 1IB6A 4KOAA 3SE7A 1MOSA 4GC5A 1NF8A 2IHKA 3MWFA 3TW8B 3P0RA 3QE3A 4AJEA 5HDBB 3I4MB 2O5IC 1EFCA 3C1TA 2E1PA 3L1HA 4ZVUA 1H0SA 3S40A 4AXBA 4RK6A 1X74A 1Y7PA 1G4AE 3VR4A 1J9GA 1MRNA 3AUFA 4L5BA 5ER9A 3IPXA 1JEDA 5F64A 1KXZA 1JQYD 2LZ0A 2ON6A 2Q3FA 1KYYA 2HCBA 3G6KA 4WINA 2B34A 5JSYA 2Z2IA 4GLAC 4Y6PA 4DNQA 1YVUA 5AW0A 5H8WA 3GY0A 1Y6ZA 2I7TA 1RI1A 2W0MA 2WOJA 4M1KA 4YA6A 4UNRA 1I94B 3TSYA 2P4HX 3VR2D 3GL9A 2ZQZA 4K87A 3IQFA 2QLBA 5EHQA 2CB9A 2EDCA 4LJAA 5IKXA 4UJ3A 1PTJA 2QQ0A 5AW6A 3SBXA 3U7FB 1DJMA 3ELYA 1Z17A 5F3WB 3BWDD 1GZ4A 2AJTA 3FYTA 3KLMX 4MV7A 5IAAA 3LVRE 3GI1A 4C3ZA 1YR1A 1PZJD 1ZONA 3K16A 3TIXB 3RYCB 1GCIA 5I6WA 2BT4A 1LDNA 3FWHA 4XYOA 3KU1A 4K1XA 5FOQA 4DM3A 4LUZA 2QRGA 2RIPA 2O0HA 4KD4A 2FPGA 2HYDA 2H8GA 3LWBA 4ZRDA 5LSAA 4BNDA 4OLFA 4MUGA 2VJMA 4GOND 2DHCA 5E3JA 2WZCA 2DETA 4JI1Q 1KKMA 3LC0A 3W3AD 4KKUA 2AOXA 2KBNA 2BHLA 1GAXA 1X8LA 5JLAA 2PZTA 1FYFA 3H9JA 5EIFA 3H2GA 2EQAA 2QA5A 4ARAA 2F43B 5F21A 4FJ1A 1OBOA 3L8ZA 4YJHB 3WLJA 1CW2B 3B5JA 1RWBA 1QJOA 3DUWA 3MTDA 5BSEA 5BVGA 2O0MA 2K6AA 3GRRA 3AI1A 3H2IA 4MJ7A 2O5JC 1NURA 1R4PB 3UUFA 4HGPA 3WE7A 1N8TA 2XLBA 1C3JA 1RHUA 4LMRA 4B3TB 4EGAA 1KMNA 1NX6A 2IY7A 1H2HA 1NR7A 2J08A 3LT5A 4LHZA 3SIRA 2VEOA 3K0FA 2HMVA 1GOTA 4UC0A 1OE0A 3DL7A 4GZ5A 4GZYC 2Y2VA 4G1BA 2CE7A 3INGA 3QIAA 4YIJA 4LF4L 1I5RA 3T0FA 4BV8A 4JBHA 4C04A 4A3IG 3C1AA 3T5PA 4MLDA 3TJRA 2EWMA 2EU8A 3EW9A 4X1YA 3VKHA 1MAHA 3ZCTA 3UK7A 2Q8RE 4OHJA 4IOCA 3DW3X 2GF2A 5LA6F 2HPAA 1O7YA 2ONZA 4G97A 1E0KA 4F91B 3NNSA 5LBTA 4D02A 4G41A 1TWCH 5K3OA 3THYB 5FWXA 3SQXA 1SMKA 4OMDA 4E5UA 1Y37A 3NTLA 5ADHA 1ZO8A 3PL5A 2ZBFA 1D6SA 2VDKB 1P2SA 4PC3A 1K98A 1UBMS 5JALA 2FR0A 1C3EA 1K3FA 2ODWA 1R27A 3QYAA 2GNOA 3RIMA 3OPQA 1M0TA 3HBJA 4WJKB 4A10A 721PA 1K7CA 1OFGA 3FTPA 3J7AC 3ROMA 1Y33E 1PX2A 1BCPD 4BMZA 4E7PA 4R7TA 3GDHA 2DTXA 4C3HH 1RVDA 3H5VA 2R7FA 4Y2HA 4JI6B 4DNXA 2VDWA 3ITNA 2GAIA 1DBIA 3PVZA 5BQ3A 3NW9A 3HOYH 1S2DA 1DTSA 2EKDA 1CY6A 2Q4DA 3QBEA 3FKIH 2FSVA 2VSNA 4KL8S 3PU6A 4TRJA 3WR5A 1SBHA 2O1WA 4J75A 2OZEA 1QTRA 3DL4A 1HZZA 1I3LA 1MA0A 1EQTA 2C58A 3GO4A 4HDAA 4UVHA 1FMJA 1AV6A 3FWNA 1Q82C 5TIIA 4JC4A 2YHSA 4GSLA 3BH0A 3K73O 1XHLA 2C83A 4PYJA 4KRXA 5CGQB 3V05A 3DHEA 4J16A 2PS3A 4J0CA 3GJ4A 4DCNA 2XMRA 2RG7A 4V0KA 5C32A 3Q23A 1DOHA 1GZDA 4X0EA 7AT1A 3K5MA 1WZIA 5ECGC 3VNVA 3H2SA 4IJ6A 4CQNA 3V1NA 3LLUA 3E70C 1EFKA 1EP9A 3F9RA 3FYSA 4P4UA 4GX5A 5DVZA 4ZT6A 2HK6A 2SBTA 3RUAA 3TDNA 3A5UA 3S1MH 1XYYA 2H3HA 2F0OA 3E9CA 1KVSA 1NMEA 2PZFA 3G5TA 4V3CA 4XQCA 2J4DA 4DXHA 1I3QH 4FIDA 3S0JA 2B2WC 3DV2A 4EKNB 4J1SA 1U3FA 5KTPA 4HDKA 4N9PA 1JR6A 1ZD9A 3TB4A 4RAUC 5K3EA 1YQ9A </