2YYZA

Crystal structure of sugar abc transporter, atp-binding protein
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
358
structure length
358
Chain Sequence
PSIRVVNLKKYFGKVKAVDGVSFEVKDGEFVALLGPSGCGKTTTLLMLAGIYKPTSGEIYFDDVLVNDIPPKYREVGMVFQNYALYPHMTVFENIAFPLRARRISKDEVEKRVVEIARKLLIDNLLDRKPTQLSGGQQQRVALARALVKQPKVLLFDEPLSNLDANLRMIMRAEIKHLQQELGITSVYVTHDQAEAMTMASRIAVFNQGKLVQYGTPDEVYDSPKNMFVASFIGNPPTNFLRDFSVSVENKQTILKRDDVIIKLPEPVDVKLKEVVVGIRPEHCRISRERVENSIPGVVYVVEPLGRDIIVNVKTEKGEIIKVFGDTGKAPQPGENVFLVPDLRKIHLFNPETEETIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sugar ABC transporter, ATP-binding protein
publication title Crystal structure of Sugar ABC transporter, ATP-binding protein
rcsb
source organism Thermotoga maritima
molecule tags Transport protein
total genus 88
structure length 358
sequence length 358
ec nomenclature
pdb deposition date 2007-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF08402 TOBE_2 TOBE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2yyzA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2yyzA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2yyzA01
2KA7A 1KDRA 5IF9A 4YXWD 4DEXA 5JEAJ 5TXGA 4OK5A 4KKSA 2JDID 3T15A 2RHSB 4QHYA 5FR1A 1X54A 4JI6L 5ELXA 1E2IA 1R10A 4Y52H 2UXDL 2PI2A 2XTNA 5ELOA 1UBEA 3AH8A 4IVPA 4TYNA 5HR5A 2ZQ5A 3K80C 4A3EH 4A3IH 4TTPA 1XMIA 3PXGA 1KJZA 3DPUA 3GPLA 5JZVA 3MCAA 4RD2A 5D3MB 3ZD7A 3ICEA 1QG4A 3HWSA 1Z7TA 4WA7A 4C0QC 3U3KA 5E7JA 4IW3B 1VQBA 2B8FA 1G21E 1PZNA 4D4JA 1VTKA 4LFBQ 2VHCA 4M1KA 4CEIA 1FYCA 3J81k 4ACAA 2WIBA 4A3JH 4R7ZA 1K5GA 2PJRA 3MGCA 3PCOB 2AMCB 1SXJE 2GJAA 1Q57A 4LF6Q 3CLVA 3KKNA 1H8EA 4QOSA 3DL0A 4Q01A 5H68A 3IO5A 1J90A 1X1RA 1HE1C 1XTRA 3L82B 2YWFA 1IYUA 3HYRA 2G88A 4NXNL 1L7VC 3U9SA 2KENA 1XMVA 4H13C 1AKYA 3GLGA 4PTLA 5C44G 4R4TA 3K0CC 2XZOA 3W6NA 1Q0UA 1D9XA 1OE0A 4IFEA 2C04A 3H3VH 4DV7Q 3PO3H 3CQZH 1NSTA 3W8NA 3PIRA 5DN6D 3IEVA 2OLKA 4DLVA 3GJ0A 3G5UA 4A8JC 4IRUB 4K46A 1VF5C 4OO1G 2PLFA 3A36A 3BH0A 1B8AA 1RFLA 3KQHA 4NDZA 2B8GA 2FJUA 4R9UC 2IUUA 2Z6KA 2FWRA 2VL6A 4HSEA 1HNXQ 2J0QA 4X8MA 3DO6A 4MYHA 3TAHA 1D7QA 1NBWA 2MMCA 5GADl 4C3JH 1NLZA 2C9CA 1KDPA 4G7HC 3CRVA 1G7TA 2DWQA 1TWGH 3Q7QA 5GAGC 2E87A 2I5MX 3I32A 5HCNA 5HCIA 2RGBA 2DNEA 3B1XA 4OI4A 4LF8Q 1PJRA 4IEEA 5KHOC 1U0LA 1V9PA 4NKRA 2OAP1 3AV0B 1P4SA 3LBIA 4PX9A 2HXYA 4Q48A 2GN5A 3QXSA 4YHHQ 3W6PA 2ONKA 2AD1A 3L0SA 3CH4B 1VQOA 1VG8A 4OK6A 1UBFA 4H44C 4IPHA 3GJ5A 1EQQA 1VG0B 4YDHB 1EWQA 1JJGA 2C96A 4ASUD 3SNHA 4M9XA 4QBFA 1W49A 2D4HA 2BA0A 2RGGA 3E5HA 4TSFD 4AKIA 3QKSB 3MWJA 3H1TA 4KSCA 3KQKA 2E74C 3L43A 3PENA 1HT1E 3X1XA 4XSGA 4M2LA 3JAMc 1KY3A 4DB2A 3CC2A 1KSGA 3QVVA 3R9XA 2K5NA 4QBHA 1HZBA 1KMQA 2NO6A 4NYIQ 4QGFA 4TLBA 4TT3D 1TWAH 121PA 4TMVA 3OIYA 3KKOA 3N5CA 2F4VQ 5KUTA 4IPGA 2B29A 1HNZL 2GEUA 3GFOA 2R92G 1ZMXA 3IUYA 2AK2A 5C3EH 4B75A 1RYHA 3LWUA 2WWFA 1S3SA 4POFA 1U9IA 3P27A 4DLXA 1ZD9A 4GBMA 4NL4H 3KYHC 2WM9B 1WCV1 2KE5A 4DJTA 2ES2A 1I2MA 1LV7A 5BR8L 3TS0A 4QBGB 4URZR 4DSOA 3GEEA 4G5GA 1CI3M 4LI0A 4GT1A 2BDOA 1TU3A 2ZIAA 1NMGA 3J80c 1FL0A 1GFIA 1RIFA 3FFAA 3KKQA 4TQAA 1DOAA 4FN5A 2E2IH 2ZITA 5FOTA 1IXRC 2ZRHA 2A5DA 2PNHA 4HDOB 3B78A 1G1MA 1NN5A 3CR7A 4MZ9A 2CJWB 4LF4L 4LNQA 1WMSA 2EVWX 3FOZA 2GKSA 1W5SA 3AVQA 4IQZA 3HOUG 2AX4A 5TB5A 4TZ6A 2HCBA 2X2EA 3R7WB 4UNRA 1QHGA 4QHSA 2AFIE 4NHOA 4TKOB 2HXSA 4MGZR 2JA5G 1IZ6A 4LBYA 1W2GA 3PF5A 4DXAA 2EQSA 1N2CE 3VQTA 5EZ5A 2GVBA 1NMZA 3ZQJA 4Q4JA 4JI5L 4G5SA 3BDOA 4FMBB 4NTZA 2WAXA 1Q1QA 3AF1A 3ZIAA 1UE5A 4ESHA 2JA6G 3TUJC 2QA4A 1HEIA 4Q7KA 3VAAA 1PMRA 2R65A 2XB4A 3HKSA 1KZGB 1RVDA 2OCBA 4FCTA 4KJZA 4QXAA 3T1OA 4R1JA 2MSDB 1CKOA 3TRZA 3UDFA 1VECA 4LUCA 1EYGA 2IS1A 5C46F 1ZNZA 4US0R 3QUSA 1TXYA 4JZKA 1GUSA 4JC0A 3IBGA 3C5CA 1W3SA 1YEZA 5IE8A 1IN4A 1WP9A 1QUQA 1S72A 1A2KC 3I4NH 3P32A 3BS4A 2YJTD 5LMNW 2GDJA 1VYVA 5FPSA 3U2QA 4A1FA 5CDFE 2NN6H 3VR2A 4GOPB 1KI6B 3FVQA 3P1JA 1FMJA 4IJMA 2OV2A 5FBQB 3EZ2A 4RKFA 2PCFB 2AWOA 1U94A 4RD4A 2NZJA 4BA2I 2FEMA 5E7MA 3T12A 4JI0Q 5G3ZA 1JECA 4I99A 4HZIA 4L9WA 2JLUA 1VS0A 5L3QA 5IDVA 2VSOA 1R9TH 1FX0B 2JLRA 3NBYC 2GEVA 2J5XA 3DMNA 3L0IB 4WVFA 3QE0A 3NDBB 2HHHL 4B3RL 1P61B 1G7RA 2YVUA 4DEYA 1O7IA 2I5LX 3O47A 1Y1VH 2AUKA 1D2NA 2W6ID 1XWIA 4XSHA 4L15A 1L0WA 1YZGA 1Z07A 4H02A 1Z2CA 3DKPA 1E2MA 1KY2A 2C95A 1NIJA 2WJYA 1IW7C 1P16A 3GTPH 1R8SA 4DCUA 2HIXA 4EFNA 3IDQA 2R6CA 3T61A 4DLRA 1OKKD 2W6JA 2NVTH 1CTQA 1G3QA 2VP2A 1CKEA 2L0XA 4A3DH 1GRQA 1Z22A 3QNUA 5AWFC 3KOJA 5G41A 4IDOA 1RIPA 3PUWA 1E0AA 2D5DA 2LKCA 2P6UA 3MWLA 2BIFA 4QJ4A 1I6VC 1VQIA 3BAFA 4NZYA 2QMUA 4A3MG 4JT4A 2GF0A 3FGNA 1Z0DA 5A4JA 1N3BA 1B0UA 2FNAA 2ASEA 5F2EA 4DC9A 1K83H 4ALPA 2KJQA 4JI7Q 1UE1A 2CDNA 2FU5C 1N0UA 3B1YA 1J6QA 4X65Q 2JAQA 1F2TA 3GJ6A 4UXIA 3ZVMA 2QA5A 4DR3L 1NL3A 1MKHA 1AE3A 1JJVA 2A5FA 2WMOB 3FTQA 5KO2A 1I50H 4JVMA 4BRWA 1W47A 2O8FB 1YRAA 4HZUA 5KOYA 5KYKA 5DLQC 2GAAA 2R6DA 4KHPQ 1GITA 1Q46A 5C0XJ 1RRPA 2NPFA 5EZ6B 1DBSA 2F1RA 2XTZA 1H9SB 3BORA 3UKDA 4M4SA 2FG5A 4EQ6B 3CC4A 3EN2A 1A5TA 1O3YA 3W6OA 1E4VA 1ELOA 5JJKA 2OXRA 4IXMA 1EWHA 3T1HQ 4IDNA 5IYCG 2QEQA 3VMFA 2WB1E 1A6XA 3TQYA 2WV9A 3LXRA 1YNJC 4BEJA 1G8FA 1QVGA 3ZDQA 1IY2A 4C0LA 4DAMA 3M4OH 2ZTEA 4DUZQ 3LVQE 4JBJA 1VQ5A 5DISB 4GSYA 4LHZA 4G5RA 1T3SA 4D6PA 4E07A 3OW2A 5TDHA 4YMVA 1NIPA 3I5XA 3U44A 1DARA 3CZPA 2KCTA 2IYRA 4QGUA 2XJ9A 1J5EL 1GKYA 3CPJB 3HPQA 3OIVA 1V8QA 1ZM7A 3EPJA 1HE8B 4AH6A 3CPWA 2YNMA 4B33A 3PUYA 2W83A 2EFCB 3U4QA 3QKUA 4G1UC 3QKRB 2V54A 2O8CA 2QI9C 3FFBA 2A6HD 1L8QA 4Q66C 3NC0C 3U44B 2IYLD 4RKEA 3SI7A 1NMXA 4PPGA 1MO4A 5FBVB 1GZSA 2ZYVX 3NWJA 4N0EA 1ASZA 4NCIA 4LYJA 4OO1H 1T9HA 3UIEA 3VKGA 4D4KA 5JRZA 1PYBA 4DV6L 4ERNA 5EP3A 3G6EA 1B23P 3CF6R 3OAAD 5P21A 5KNBA 2UUAL 1EX7A 4LF9L 1IYVA 5BN4A 3GDEA 1RC8A 3EPHA 3BZCA 3N6RA 2QBYB 2Z83A 2ZR9A 2ZVQX 2NOAA 4C0KA 3L0OA 5M5YH 2XNDA 2ZYWX 1LFDB 4ARZB 4EDHA 4C2TA 2BBTA 3SYKA 1CBUA 3FKIG 3JAMi 3LNCA 4BA1I 2IS2A 3HOYG 4RVCA 3X1DA 2WWHA 2HIVA 5JCPA 4I4LA 2ZJAA 3I62A 3KX2A 3M6AA 2O8DA 4Q1CA 1E1QD 1FL9A 2GJKA 3BB4A 1G3MA 1UKVY 4E5UA 3K8YA 3PEYA 2VQEL 2QGZA 4APVA 1UKEA 3D31A 2IBMA 2PJZA 4JYBA 1SVIA 1XEXA 1DEKA 2F43B 4KLZA 2KB0A 2RF4A 3P4XA 4IO9A 3UDGA 4L5QA 1NVVR 2PZFA 3CIOA 1W4RA 2D2CC 1YZNA 3C7KA 1YHBA 4M0LA 3CX6A 3FMPB 4IOKA 3K0SA 5KPJA 3KXKA 4WW0A 3J80i 1OXUA 1IXSB 1DAFA 1UDWA 2KSQA 3BK7A 4I1OA 4NONA 3IRBA 4Q47A 2E2HH 3GJXC 4A6PA 3LLMA 2JLYA 1SULA 1OPXA 2AKAB 2IK8A 2EU8A 2OZEA 4TMKA 1KXLA 2H1LA 1UF9A 3LV8A 4JI2L 1DAIA 2NIPA 4C3IH 1VG1A 5GJVC 3ULJA 3PEWA 5JFGA 3T1QA 2WVJA 5JSZA 2V1CC 4DPGA 1XNQL 4C3HH 3EBEA 1D9ZA 4OI0A 1KD1C 1X55A 2R6FA 5GVRA 1IBKL 2R92H 3S2HH 1ZU5A 4O0MA 3SBEA 1HA3A 1RE0A 2EYUA 4FDBA 2VP0A 3C15C 4C0BA 3KQNA 1N8RC 3NDPA 4HJ5A 1IN5A 1GILA 4DZZA 3AM1A 4LFAL 4XVQA 3S14H 3KDSE 4P31A 1L1OC 2XXAA 2BBSA 4HIOA 4LW1A 3EWAA 2VS1A 1U99A 2C78A 1W0KD 3MXUA 3IQWA 4JS0A 4YWLA 3THWB 3RS5A 3K0AA 1AK2A 2YINC 2WIAA 3EA5A 1PV4A 1KSFX 4TMXA 3CX7A 1ESNA 2K4KA 1F60A 2QRNA 2OEPA 1T0HB 1W0JA 4F91B 1JJCB 3WYGA 1V5WA 2ZJQA 4JI4Q 3HOUH 3FMFA 3EIVA 4DLTA 1RPZA 3WWVA 4NCKA 4HJ7A 1GHKA 3EZ6A 3GTKH 4DVGA 4GNXC 3MAAC 5TY0A 2QTFA 4ON9A 2JA5H 3M3YH 3OFND 4OWXB 5TARA 1JEEA 1EWIA 1XMOQ 1K9MC 1E96A 2GZAA 4X8HA 2VRWA 3RR5A 2VQFQ 2PL3A 4A3IG 2O5VA 2VEDA 4Q9JA 1C1YA 4M21A 4AIIA 4AURA 2ZRBA 1CKNA 3GP8A 2EWVA 1K0RA 5ELNA 3S1RH 4LHWA 4PO9A 3PVSA 1YVCA 2UU9L 4URVR 3H4MA 5AJ3L 2R9VA 4DB4A 4JI3Q 1C9OA 2N8NA 2P67A 1E1OA 4UNNA 4V0LA 4Z8XA 1D8LA 1Z9FA 4BEBA 5LMUL 4BGDA 3GLIB 4X6AH 3SJZA 1DAHA 1I5FA 3FKSA 1Z28A 3FHCB 2W00A 2CNWA 1CS4C 5EUQB 1VHLA 4LJ9A 1VQ8A 4JI8Q 4JG2A 2HCJB 5LDDC 4MKHA 1H8ED 1GP2A 1NJFA 3RS3A 4JLOA 1XXHB 1N36L 3CM0A 2HJVA 2WWIA 1E9FA 3NBHB 2ZM5A 1EFRD 1ZW6A 3RLNA 2A5GA 1E0SA 4YLGA 3I4OA 5CB6A 5JWRA 1F5NA 2EFEB 5M5XH 4KBFA 3K8AA 1EGAA 1FP7A 3KTAB 2IL1A 3N2IA 4DR1L 2MO1A 1T6NA 1NVUQ 2FF7A 5CJPA 3ZH9B 2CL0X 1YHNA 2QUZA 5BW8A 4GP7A 3G4SA 4G5OA 1KAOA 2A9KA 4NCHA 4M1MA 4PHHA 5CK4A 3CMAA 3K09C 1SR3A 5M04A 1JB7A 1SKYE 5IWAQ 4Q4LA 3DZDA 3ER0A 4ACBA 5AUPB 1HNWL 2F9MA 3BGWA 2WKRA 3TW8B 2VP4A 5CJ2A 1E9BA 1P2SA 2VF7A 3PEUA 5FBRB 3GLFB 4X66Q 3P4YA 1Q22A 1AIPA 4OL0A 4PXAA 3TSWA 1Z6TA 4LF9Q 4EFMA 5BXQC 1T4GA 1OHHA 1XCPA 2ZI9A 2NZOA 1QRAA 2OFXA 4ZKEA 1G291 1HR0L 2O0JA 1VCMA 4HB0A 2RGNA 1CEEA 4A6XA 4A3MH 4KAXA 2ZSAA 5EXSA 4G5QA 2JE6I 5IY0A 3M7NA 2CEAA 3M85A 5CIWA 1Z47A 4A4IA 1OTCA 1KGDA 4H1UA 2MNAA 4HUQA 2J7KA 1FQKA 2I3BA 4MRSA 3AEVA 3BIFA 3DLLA 4LV5B 4WIAA 1N34Q 3FMOB 1H9JA 4MYTA 1E2JA 5DHFA 1S3OA 2BKEA 4YC7A 2JLSA 4HIMA 3ETLA 1ZNWA 2VIIA 4YDSA 2AXPA 1Z6GA 4XOIA 4KXFB 1HPCA 2J59A 1KI7A 3TUZC 1E0JA 4A3BG 4IFDJ 3I1FA 2CL7X 2C9YA 3SU8A 4FWTA 2FV8A 2EJGC 4GPTA 4HYYA 2BHRA 4R4OA 3ULPA 4Q00A 4E22A 3DXJC 4MRPA 1R7RA 3HOVG 5D3MA 2V7QA 2NZHA 1ASYA 1TL7C 1UEIA 5EQTA 1LW7A 1E24A 3PG5A 4LYHA 2RB4A 1VG9B 2F3TA 4LFBL 5C0XI 2B6HA 1R6BX 5IYCH 4JI2Q 1VQGA 1OW3B 2F9LA 2ZS7A 1QVFA 3AGPA 1KOFA 2IWRA 3ZGXA 1VQLA 3LQQA 1WYDA 4IPDA 4LF6L 2A6ED 1KHIA 1RYFA 1XF9A 3QEOA 1FTSA 1II8B 1CJKC 1E2DA 1EUJA 3AQ4A 4W5WA 2ALYB 3GJ8A 5AUOB 1Q12A 2BM0A 4I1VA 2Q9CA 4LX0A 1EOVA 1W44A 1C7YA 2BCJQ 2DCUA 1Z0IA 1WJJA 5BWMA 2V6JA 3MEFA 3AGQA 1SVLA 1XJVA 2FGJA 2O0KA 1IN6A 1SHKA 1P73A 1UEBA 4JYAL 4A93G 4FCVA 2A68C 3H0KA 2D74A 4IFBA 4DV7L 5HTKA 4M9QA 5FTLA 2V55B 4NH0A 2VPPA 3TK1A 3JVVA 5H70A 1OIVA 4C30A 1E1RD 3QF4B 5KTYA 2JA8G 3OEHA 3NH6A 3CCQA 2NO1A 1SROA 4CW7A 1ESMA 3AUXA 3SFVA 2DFNA 1PFSA 3LQRA 1H8HA 4LBZA 2PI2E 3KXIA 2QF7A 3AP1A 3RSOA 1Z08A 2Q2TA 3K0EA 2G9NA 2IYZA 3MRSA 4MUAA 4DDVA 1JMCA 1G8PA 3KUDA 4LF5Q 4RD3A 1HNXL 2ORVA 2VTKA 3CR8A 1XMQQ 4KVGA 2A69D 4P4SB 2VLIA 4MGKR 1NVXQ 2OAQ1 4IVQA 4OHZA 4Q1EA 5TMPA 5H1YA 3KFUA 3A7LA 3CZQA 2B7BA 1NE3A 5HGQA 1S96A 1KI3A 2E9SA 1FVIA 2CWPA 4PSAA 3F3YA 4LJ5A 1AGPA 3ZIAD 1NRJB 3T34A 4LF8L 5JECA 3E0EA 3FKIH 2W2XA 2EFGA 3HOYH 1FUKA 3KB1A 4B3TQ 1NG9A 1N5IA 2FOLA 4XWOA 2IYQA 3AF0A 2KCMA 5DI3A 2JXMB 3REGA 4O3MA 4YHHL 4PPQA 3CC7A 2A19A 4PFSA 1ZD8A 2BC9A 3EIEA 3N70A 1E9AA 4KFRA 3TBKA 4B73A 2Z5FA 2BH2A 2YHSA 3MG9A 3SC3A 2GTPA 4B3FX 2Q2UA 3SOPA 1QJOA 4JVSB 3WHLA 3WMEA 3GLGE 1EESA 3U50C 4R4CA 3AP3A 1T8UA 2VHQA 5FTKA 2ZM6Q 1Q3HA 2GESA 2PZEA 3E9IA 3GCGA 3KJEA 3KKMA 4GZLA 1XD9A 4A36A 2VZAA 3H3VI 2CE7A 4N1AA 1IN7A 3TAUA 1KK3A 1E32A 3B7GA 1W2HA 3QKSA 1QZGA 3H0GG 2QE7A 3G0HA 3IHLA 1CF4A 3C4JA 1K8RA 2CVFA 3NBFA 1PH8A 2CWAA 4DLUA 3ZVRA 3ZJYC 1DXMA 5D3QA 4ZDWA 2WAQE 3C5HA 4HEJA 1VQCA 2IX1A 2BWJA 3B60A 2EFDB 4KYIB 1HCZA 2AKWB 4HIDA 4IDQA 1TWCH 2O5IC 5JCZA 1CKMA 2F4VL 4LUZA 1SVSA 3BBPA 1WFQA 3CCVA 4HAZA 5BQ5A 5C2JB 1Z83A 2IUSA 1Z29A 1X6OA 1OFIA 3KB2A 3W3AA 2OTJA 2R7DA 1KTVA 3A4MA 4L9SA 3S15H 1Z2AA 3OEEA 1N9WA 2QMOA 1IONA 4NYJQ 4TL7A 1ZM3A 4V0NA 4JLJA 5EXPA 1RL2A 1KJWA 3I72A 2B8TA 3S1AB 4A15A 1L1OB 3ZVLA 4XWAA 1CJVC 3OIUA 2BM1A 1KJYA 2A5JA 4LK2A 3TEHB 4QRHA 2HJGA 4HDQB 2QP3A 4PPNA 3VU9A 4LJ6A 2BBOA 3T1YQ 1ONBA 2W6JD 4LJ7A 4YMWA 2YZ2A 4ZV4A 1IBMQ 5FLMG 1JR3E 3UG7A 3AQQA 1KMHB 4PQFA 1VQHA 4OBEA 2WB1G 1NF3A 2UKDA 4OX9Q 4IPCA 2NO0A 3V9PA 2ATVA 5B58C 2CJWA 3X1WA 2PX3A 4O2DA 2B63G 1A63A 3VR3A 1EIYB 5LMNQ 4LCBA 3MMPA 4QBIA 5DH9A 3U7EB 5KSZA 2Q3FA 5L3RA 2IHBA 2ZYTX 1OT3A 2DUDA 3R7WA 4KU4A 1JAHA 1YJWA 1E94E 1LS1A 3KQLA 2CVHA 1OF1A 1O78A 3HJNA 1FFHA 2Q8IB 1ZAKA 2WKPA 4H1VA 4L4UA 3NBZC 4DLSA 3UPUA 1FOEB 2C99A 1M90C 4TYPA 3D3QA 4G3XA 1VKJA 4AD8A 1FNNA 1NVWQ 2BMEA 3DZ8A 1P9WA 2NVQH 5KDOA 5DYIA 4JLDA 3RS0A 4EPXA 4JVLA 3S2DH 3X2SA 3BJIC 4B2LA 1G18A 3D6TB 4C0SA 1UE6A 4W5HA 1N25A 2EWWA 2FH5B 1VCOA 4XWKA 4CEIB 5E7NA 3BU2A 2ZI3A 4XD7A 4WXPA 3K53A 2A30A 2DFTA 4B32A 4QM7A 1NLFA 1JXOA 3A8TA 2DWOA 2IYYA 2IS4A 4BFTA 4PR0A 2ZSBA 4B3MQ 4GOPA 1KI6A 2O52A 3B6EA 3B13B 4HLQB 4B71A 1E9SA 2VBCA 3IIJA 1XPRA 1UEJA 4PSKA 4Q7LA 1Q3TA 3MJRA 4JI0L 4JI1Q 1NY6A 1NBME 1OXVA 3DOFA 4AYBG 4V0KA 5CYOA 3A5ZB 5K8IA 1N5JA 1I4DD 2DN8A 2ZE7A 2P5TB 3MLEA 1N6IA 2WOJA 3LW7A 2R93G 4U5XA 2WJVA 1UBCA 1EFWA 3J7A5 5JBQA 5FR2A 5H1SE 5IP7G 1AN0A 1FX0A 4JYAQ 1EFTA 4QG7A 2O8EB 4LJAA 4RY2A 1G51A 3GLHE 2NMVA 3MWKA 1R5OA 3TRFA 2V1UA 4RD0A 3AVWA 1XEWX 2X1VA 1JPJA 2I1VB 3C41J 2BV3A 1CR0A 4POGA 2HF9A 4Q9IA 4U02A 4EQ5A 1TPZA 4FMCF 3CF0A 1P6XA 5DE3A 2PMZE 1MR3F 3I4LA 1WQ1R 4G01B 4M8NE 4AG5A 2V6IA 3HKZE 2HYIC 2G6BA 4GKJQ 3U4VA 3QSYA 4A3GG 3F2CA 1F48A 3U5ZB 5SZHB 3TNFA 4BE7B 4TQUS 1K5DA 2UXBQ 4P4TA 5HY6A 3WXMA 2QEXA 3LA6A 3HYTA 4TQ9A 3THOA 1SXJC 2XNDD 3Q5DA 2IX0A 4LBWA 3X1YA 1KRTA 3LGJA 1QZXA 2BE5C 4BLOA 4JI7L 2SHKA 3A0JA 2XNSA 3EWSA 4PC6A 2NN6I 4X65L 2WJJA 2CMKA 3NC1C 1PH1A 4ITRC 1U90A 1KO8A 4FCWA 1VQ4A 2W0SA 2N46A 3A1UA 1B9NA 2R2AA 1G8YA 4PZLA 3GO5A 3K1JA 4BFVA 4CEJB 1JR3A 3WYFA 3K70D 3KLRA 2ZRCA 2XTIA 3DKVA 4FIDA 4US2R 2O8FA 1JQLB 1A2BA 2Z4RA 4FMDB 2XZLA 2BJVA 1VQDA 4NCNA 2AN9A 5AUNB 4KHPL 4A3BH 2Q0HA 1U8ZA 3B82A 1NY4A 1E22A 1YITA 4URUR 3RLOA 1YHAA 1H9SA 4YWMA 3CWZA 2EYQA 3T53B 2G1JA 2WSMA 4EQ6A 4PC3A 1NMYA 3HOVH 4Q1AA 5DI9A 4LWZA 3NBXX 3FKQA 3UK6A 2XB2A 5GROA 2J3EA 2QGNA 4IFDI 1Z0JA 2ZRFA 3T1HL 4L5BA 1DELA 2ZRAA 3MUFA 1HQMC 2QTVB 1KIXA 1ODFA 3BRWD 1G3RA 2N78A 1X9NA 1VQNA 1BMFA 4OONA 1IY1A 1I2DA 2PH1A 4V02A 4PZYA 4DLYA 3O8RA 4DUZL 3Q7PA 2J46A 1B7YB 3CNOA 4NCJA 1SMYC 1MABB 2V1XA 1QVAA 5E95A 1VPLA 1GRNA 1A4RA 1ZD1A 3SN6A 4KFTA 2OXCA 4HJ9A 4BBRG 4DK3C 3PIPA 4L5RC 2ZI4A 3K0CA 4BPBA 3K0XA 3HOZH 1VDZA 4A93H 4LV6A 4NXMQ 3S16H 2YTVA 2BMFA 1KAGA 5J4YA 2XGTA 3KF6A 3ADKA 4YCWA 5C4XG 4WOPA 2QU8A 1S4QA 1J99A 2IEYA 2LWIA 3QKRA 3W3ZB 2JA8H 3HOWG 4WJ4A 1YU9A 1NBMA 1PH7A 1E79A 4BFWA 2XTMA 3THXB 1UWVA 4QNRA 4UPAA 4RG1A 5IT5A 2BVNA 3A4NA 4LRWA 3QXJA 5AJYA 4OHWA 2ZAOA 4A92A 4D2IA 3PQCA 3THYB 1CRPA 2DY1A 4RMFA 4RZ2A 4IDHA 3IPXA 3GLHA 3SGIA 1W36C 1G19A 2ORIA 4RFVA 4LJYA 4GI7A 1FMLA 4L5SA 4IJLA 4JLVA 4ARZA 2DHRA 2JJQA 1K73C 4HAYA 2VHJA 1QDEA 2WJGA 2X19A 4HB4A 4GMDA 4DCNA 4URXR 1KL9A 4KKUA 2WOOA 1PH4A 4JBYA 4B34A 4C7OB 3HDTA 2RAPA 1JXMA 1XEFA 2WTUA 2EXDA 3IILA 5SZIA 4MKGA 1E99A 3AVXA 1H65A 2QAJA 1N0WA 3JZAA 1FQJA 2RHDA 3VR1A 1OXXK 2MSEB 2YV5A 1NG1A 4A75A 2JCSA 4CIDA 1F6BA 3FKSD 3IIKA 4JLMA 5AUQA 2WPDD 2ZSFA 3B9PA 3ZLJA 2CNWD 2BOVA 1RRFA 2GBLC 4JBMA 3NHBA 1K8AC 1SFOH 1QHHA 3H0GH 1GJXA 5KNCA 2IYWA 5BYJA 3ZZUA 2K14A 3STBD 2GWHA 3CO5A 2D3WA 3LBHA 3MSXA 4KCGA 4TZ0A 1X3FA 1GL6A 2ODNA 4JBXA 3QG1A 2JJ2A 4OO1I 4Z8YA 2F55A 4YCUA 1E7ZA 4DNIA 2PCLA 5L3VA 1W4AA 2OBMA 2WWYA 4MKFA 3LX5A 5KPDA 3TQCA 3IIMA 2ERXA 1M34E 1IXZA 1E6CA 5LB4A 4A76A 1UKYA 3V00A 1FR3A 1LM0A 2VYFA 1TF5A 1ONLA 2MMGA 4PV1C 5FPHA 4AYTA 5JHHB 4HB2A 3K7UC 3K7AH 4D82A 1YZ6A 1GKUB 3H86A 1WA5A 1XD8A 4P72A 1R2QA 3EZ7A 3UANA 2P3SA 3NENA 4DUGA 2B3GA 2PEZA 2Q9AA 2ZRNA 2VP9A 1E9DA 1IXRA 1XX6A 4ME3A 4L16A 3UE1A 1GTVA 3THWA 4G7ZC 5FLMH 4O0AA 1OHHD 2K33A 5HKKD 3QKTA 3RRNA 1KIMA 2VQSA 3K9NA 4IOLA 2YC2C 3CRKC 3SFZA 2R6GA 1CRQA 1XU4A 2B63H 4TTQA 4HLUC 3R8CA 4BZPA 4JI4L 4V0MA 3S1MH 3AFPA 1K6MA 3QENA 4MITA 2ZRGA 1YZUA 2ZRIA 1S2MA 4KV9A 4OJQA 1VQEA 1Z0FA 1W5TA 2HYDA 4ZPXA 4G7OC 2GXQA 4B2PA 1XMOL 3LH5A 1AGRA 1W1WA 2PX0A 2BCGY 3ADBA 4Q1FA 4PHTA 1N6OA 3TSZA 4PHGA 4I7ZC 4HJAA 1BKDR 1YI2A 2ZRJA 3EIHA 5M5WH 2VQFL 1R0ZA 1WCMH 2IXGA 1E2WA 3LFUA 3OHMA 2EJFC 3AVTA 5EAYA 2MQHA 4TMWA 4YY3Q 3J81c 3DM9B 2VNUD 1HQCA 1N6KA 4FWIB 3UDIA 1E4YA 2BDTA 1QG2A 1WF3A 3LDAA 1ZYUA 1GAJA 2V7QD 4JI3L 2F1HA 3SHFA 1PHJA 4JT2A 4AQYL 2YOGA 1P72A 2K7VA 4DV5Q 2H57A 2GCNA 1XCGB 3U6BA 1HZ9A 3GLIA 4B3CA 3JZMA 3PUZA 4C2MH 4DAYB 6Q21A 1BO6A 4NE2A 1GUAA 4B74A 3SE0A 3Q85A 1Z0KA 3CKLA 4JI8L 1KSHA 4TTRA 2JASA 1DO0A 1G3UA 1X8KA 2Y0SE 1KNXA 2JJ1A 2RGXA 3WNBA 4EFLA 1XXHA 2B8WA 3TGPA 1A8VA 1YHQA 5EP1A 1B9MA 1G6OA 1KI2A 3J81j 1GUOA 2R93H 1DAEA 1SZPA 1XBTA 3HR7A 3TKLA 2ERYA 3DM5A 3GEHA 5IP7H 2PNRC 4KFUA 2XGJA 3V4RA 4OXPA 2EIFA 3KTAA 3I7FA 4TN1A 1Q1EA 2VSFA 4Q4AB 1KK2A 4K0KQ 4B2IA 4DT1A 2LMCB 1SGWA 4UQOA 1S40A 4IDPA 4J0QA 2GJSA 2CHGA 5DHAA 5FI1B 5KSPA 2WWXA 5JI2E 3RLFA 4AK9A 1I6HH 5IWAL 4R4QA 3QQ5A 1G5TA 1G6HA 1XJ0A 2R7ZH 2IYVA 1H8HD 2QP9X 4M1YA 2H5EA 4KITB 3D0FA 1GG2A 4ZCMA 4DIDA 3FPPA 4QJ3A 1LF5A 1OIXA 1P3JA 4X66L 2WJIA 4DHEA 3GLFA 2J41A 1G9XA 4A3GH 1P8LA 5JS8A 3Q3JB 4LHXA 3S24A 4GLAC 4UXJA 1LS6A 2VHUA 5FL7A 3RNUA 1SXJB 4JIMA 4N3NA 4Q9LA 2OCAA 5IK2A 1SVKA 4YMTA 1BS1A 5CITA 2D2FA 1OXTA 2EVBA 1D8TA 2H18A 1NI3A 2MO0A 1US8B 3BOSA 1IBLQ 3F5FA 3ERSX 4Q7MB 5J4LA 2XOKD 3WRXC 5EE1A 1K8MA 3ULLA 1MJEA 1Z3IX 3AF4A 1AQYA 3KKPA 1CP2A 4LPSA 1N34L 4F4IA 1J2JA 4II7A 4IHQA 3QJYA 4A8JA 5B30A 2YKGA 2CK3A 2HEIA 2PT5A 1N6RA 4WZBE 5B2ZA 4MRRA 4EJSC 1H9RA 1CU1A 3FE2A 4UKDA 4QKQA 4XJXA 1E69A 3OESA 4DR7Q 4GDFA 3SQWA 4KYUA 2QM8A 1O7LA 1ZUHA 2BA1A 3W5OA 2FPMA 4Q5IA 1P9NA 3W5IA 2ZE6A 1ZJ6A 3QIAA 2ZUCA 1G7SA 4DV2Q 2A5YB 2FSHA 2KWIA 2WHXA 5FFMA 4U7DA 3ND9A 1DG3A 2QE7D 4IOCA 4Q19A 4BASA 4PO8A 1TF2A 3IO3A 2OM2A 4LSGA 2UZ3A 3WMGA 2J1LA 3L0PA 5IHPA 2DWPA 5FPKA 2OSBA 2R62A 2E8GA 4ASUA 3IGFA 4JLKA 1TQDA 2CLDX 1CULC 1DVRA 4KFSA 2QGQA 1S0UA 1II8A 1X3SA 4M1OA 1DCZA 4NYIR 4OK3A 4F38A 5IYDG 1XFAA 5JHGB 3VR4A 4DR4Q 5FOUA 4JLAA 4F93B 2FN4A 3CD6A 2JLZA 1EWRA 2ZJRA 3MWYW 2FFHA 3OEED 4BY7H 4Q18A 2IEZA 1M7GA 4BBRH 2ZJ8A 3KUCA 4GN3B 4A3FG 2ZRKA 3RN2A 4GOKA 4V03A 1BKBA 3VA7A 4JSYA 4LV8B 5L3QB 1KC8C 5EE0A 1N33Q 3NKVA 2GCPA 2W58A 1MV5A 1NN0A 4RJLA 5C4XH 1I4LD 3QXCA 5FUVA 2CW0C 3CCRA 5GJWC 3QF4A 4AG6A 2UUCQ 1Y8PB 4JOIC 2P5SA 4EAQA 1A1VA 3HOWH 4GLVB 1Q44A 4B6EA 3H84A 4P71A 3WRYC 2F7SA 3NELA 3F2DA 4DV1L 1L4UA 4BFSA 3CRMA 1AJEA 1XTJA 3L2OB 4LF5L 1Z0AA 1VQFA 1ZM4A 3L8ZA 3GJ3A 3CW2C 1XMQL 1OFUX 1OJLA 1VYTA 3RRYA 4EUNA 4P4SA 2VL7A 4GS3A 3VX4A 1W36B 2O8BB 5AJVB 5AJWA 1JI0A 1I3QH 5G3YA 2K32A 1KRSA 3PV0A 2EW1A 3AVYA 1QHIA 1VCNA 3CCMA 5GJCA 4D26A 2L15A 1R8QA 4LPKA 5M3MH 4LZZA 5DYGA 5UKDA 4DSTA 1G6PA 3TR0A 4FD2A 4DNTB 4TYWA 4B3TL 1E2LA 3VTKA 4QM6A 1Y69U 4TL6A 1H9MA 3PUXA 1E2EA 4LJZC 4F4JA 1Z5ZA 2V4ZA 3C14C 521PA 1M8PA 1J70A 2RH5A 4PAMA 3PJRA 1XTIA 3NVAA 4Q03A 3TW4A 5K36G 5FOVA 1Y14B 4AQYQ 1P7CA 1UFQA 4XD7D 1ZU4A 3U3RA 2IYXA 2JIZA 4DR5Q 4DK0A 2ZM6L 4DDWA 4QIWE 2FSIA 1RW4A 4B3SQ 1EK0A 2CLSA 4AKEA 4OWTB 4IOMA 2P6NA 3BXZA 3GTOH 2KHIA 4DR6Q 1S8FA 1RZ3A 2REXB 1M1YE 3RC3A 1E1TA 2G77B 3B9QA 4CF7A 4GKKQ 1YZTA 4MYCA 5FPTA 1TF7A 4BLPA 2UZIR 4URWR 1BYIA 1DG1G 2WSSA 2RGDA 4OWWB 1KKLA 3SBDA 4WAUA 2FEOA 1HZCA 4DWJA 4ZDKA 3SHWA 1XZPA 1G41A 1I94Q 2UXCQ 3SEAA 2JEBI 2JQOA 4DV4Q 3EC1A 2REOA 4BWYA 1QHXA 2JEOA 4M9SA 3KFXA 3W5JA 1VIYA 4JYCA 4XTRA 1TEVA 3T1VA 1DAMA 4BLTA 4ZI2A 1GHJA 3KQUA 4JL6A 1JEDA 4XIGS 1XD2B 4ZO4A 3S1AA 2Q9BA 2XZPA 1L1OA 2OBLA 2OHFA 3QXHA 4PC7A 2PMKA 1YE8A 3G71A 1UE7A 1NJGA 4Q21A 2UUBL 2P6RA 4QGHA 1RJ9B 3T1YL 3RVBA 4NBSA 3ZS8A 3HR8A 1LTLA 2ZYUX 2YU9H 1IBML 1XMJA 2TMKA 5FI0B 1ZUNB 2BKUA 4X8OA 1HJPA 3J81i 2BMJA 2CXXA 5FTJA 3A7AB 1WDTA 3PITA 5DIFA 2C2HA 4OX9L 5EP2A 3U4QB 1PA6A 4HJ8A 1TAGA 3ZZTA 2ID0A 3UXMA 1KKMA 1OB5A 3CPHA 2A6HC 3DM3A 4KKTA 2GZHA 5LMNL 2IT1A 1R4AA 3SJAA 1CXZA 1VQKA 3WMFA 3CP0A 4GNXA 2CL6X 2A7QA 3BFXA 2HLDA 3U6KA 4A3KG 1CFMA 1OKKA 1ZINA 4DSUA 4JLNA 1NP6A 4MGYR 1JR3D 4FINA 3UMSA 4J15A 1BIFA 5JLJA 1U8AA 2JJ8A 4D80A 4HAVA 4RZXA 2ZTDA 2YC4C 1CSPA 2KBEA 2ATXA 2ANBA 2DBYA 4YQFA 4GFDA 2J0VA 3GJ7A 3RHFA 3TLXA 3C8UA 2NZ8A 5L3SB 4PPFA 4F4CA 3B1VA 4AC9A 3BFKA 2ZJZA 3L2PA 1G16A 2GJ9A 3B8HA 3HP1A 1OH6A 1XNRQ 2NPIA 3EW9A 4G0NA 4UNPA 4C3ZA 4D0LB 1MO5A 3K70B 3D4RA 4B3ML 1KQSA 1R0XA 2RGCA 3QXXA 1E2PA 1M6NA 3F2BA 1XEXB 1XP8A 5F3WB 1XDBA 1GNRA 2CFMA 1TWFH 1W46A 2CQOA 2QAGC 2C8VA 2J0SA 3SQXA 2YOFA 4JI1L 1IY0A 4PZ7A 3AUYA 3QY0A 5K8TA 3U7GA 2ZVPX 2ZE5A 1PH9A 4JBKA 2R7FA 3HOZG 1HT2E 2V8OA 5E4FA 2P65A 4W5JA 2ZTSA 4XTCS 1AM4D 4PAQA 2O8EA 2K5HA 3L7ZC 4Z1MA 4QL5A 1DO2A 1OSNA 4L5TA 1PH6A 4LFCQ 4Y7NH 2DPXA 2P0EA 3AKDA 5JSZB 5C18A 2IX3A 3K09A 2XJ4A 5FJ8G 2JA7G 1C9KA 2ZSDA 2OWOA 1NBMD 2GEDA 4MYUA 1E79D 3GTQH 1TQ6A 4OQNA 2ASBA 2REBA 4FI3C 4DBLC 3A1TA 1ZNYA 1IAQA 4DV1Q 2CHQA 1OH7A 2IF2A 2DB3A 2QSZA 2N3SA 4RZ3A 1GKHA 4GKJL 4QL3A 4OGQC 4X64Q 1Q82C 1XZQA 5KDLA 2GK6A 4LY6A 2AUJD 1J7KA 3U3MA 3OTOQ 2UXBL 3CXCA 2I0QA 4EPVA 3OIWA 1XRJA 1TNDA 5JJIA 4LJ8A 2QMHA 3K0AB 3H15A 2ZI5A 4IOJA 4WXRA 2BBWA 4OI1A 4JJZA 2VSXA 3D7MA 1P60A 4RFSB 5F9HA 1LUZA 2QQEA 1II0A 3HU2A 3MJHA 2OCPA 4V0OA 1P75A 3VKWA 3AEZA 3EG5A 1GO3E 4P32A 3NTUA 2NO7A 4LYAA 2C35B 4EJSB 3OAAA 4I1UA 4CEJA 3A1VA 1VIAA 2W0MA 4QC2A 3CRQA 3RDPA 2DNCA 3SZRA 3FYHA 4KI0A 4QNMA 4YMUA 2LXKA 1RRGA 4OJKA 3W8RA 4TLDA 3H2YA 4OKSA 1FJGQ 2F6RA 3BG3A 2QT1A 2NO9A 4BFZA 4Q4HB 5AJXA 5TV2A 2VY3A 4D81A 4URYR 3QBTA 1MRSA 3I8SA 3SS8A 5H8WA 1D5CA 1YNNC 1E1QA 2H7VA 1J8YF 2ZT9C 3TUIC 3TQFA 4ILEA 1T3LA 5JS7A 1KO4A 3ONWA 2JJ2D 3BD9A 2PZGA 3F0TA 3ZYCA 2XAUA 4M22A 1TU2B 1AA9A 1U5KA 5GQOA 4MRVA 4F92B 2E1RA 3GMTA 1MABA 1YIJA 4AKGA 4RD1A 5IYDH 3NE5B 2WICA 4A82A 1T5IA 2QQ0A 2RHQB 3WP1B 5A5GA 4QQBX 4CZ2A 2VW9A 2R8RA 3G82C 5LB2A 4LUOA 2R6AA 5FH9A 1P62B 4MTNA 1LTQA 2VF8A 2CCJA 3EZ9A 4ZIRB 3IKJA 1JBKA 4HAUA 4D4LA 4A3FH 5C1BA 4NXML 1KHTA 1K8GA 3M0EA 2UUBQ 3WYAA 2ODWA 4DUGD 1IJFA 1KSJA 4GZYC 4Q1BA 2GNOA 1N32Q 3EC2A 2YTXA 3LLUA 3KJHA 4DNRB 2ZJPA 4TLCA 1GVPA 2GCOB 1OIWA 3V4FA 4IFDG 3VHXA 3MXNB 3PCRB 1BOFA 3W90A 3EIQA 4K81B 2FDCA 2E2JH 5C0XH 2G3YA 1M7HA 3THYA 1FGUA 3EA0A 3CCJA 5SZKB 1CSQA 4N0DA 2R44A 3KJGA 2AD5A 4DV0Q 2RKOA 2PQAB 2Z6KC 2ZJ5A 3T5DA 3BERA 3HU1A 1GUTA 4TYYA 4JV5Q 621PA 4LJ4A 1X56A 1WCMG 4DCTA 5LD2C 3M4QA 1M74A 1HTWA 2QORA 3AVVA 4AYXA 4B48A 2HT1A 5FTNA 1LYLA 3ZQ6A 4UXHA 3UWOA 2ZUBA 4GLXA 3KXLA 1PLJA 1X8JA 3TE6A 4O2LA 2J45A 2GAOA 4EPTA 3BJUA 3UE0A 1WBDA 4KLNA 5K36H 1N6HA 4DCVA 3OFNA 4BRUA 4D4MA 1KK0A 4B3XA 1SN8A 1X3EA 2JLXA 3GJ4A 4IEIA 4U00A 5C4JH 1IOZA 4UP9A 5E3HA 5HE9A 1COWA 4P75A 2FFQA 2QROA 4TWZA 3I5YA 2OLJA 2F52A 2ZI6A 2ZE8A 3CRLC 1HH2P 2JJ1D 2DYKA 3WHKA 1E2GA 5J47A 2AHOB 2K5UA 1U98A 4JK1C 3ZJYA 4UP7A 1D6JA 4C2UA 3OW7A 4JMPA 1ZNXA 2FGKA 3SDZA 2CCKA 1Z63A 1YBYA 2Z0SA 3CPFA 1PH2A 2QENA 4GMXA 1S3GA 3ZS9A 5EE3A 3FPAA 3B1WA 3LY5A 3E9HA 4DR2Q 1EIFA 2F1MA 2J7PA 4NP6A 1E2ZA 1CIPA 4QGGA 2A6EC 4NPSA 1AQUA 2HDNB 4OQLA 4DV3Q 2R7ZG 1SVMA 1YKSA 4O2RA 1X3GA 1IW7D 5GAEC 2ZROA 1O87A 1OYWA 3LXXA 4F7WA 1JR6A 1Q86C 1EFRA 1XNJA 1S1CA 2W2TA 2YOHA 2P2LA 4LC0A 1U9IC 3SR0A 3EX7C 3ICQB 3RS4A 1U8YA 2D0PA 3BZKA 4JJKA 2ZJ2A 1IBRA 4BZQA 2I1QA 2ZR0A 2NG1A 4US1R 1AS0A 3T35A 3JC66 4GNKA 1CJMA 1L2FA 2QP4A 4RCYA 1NJIC 1Y8OB 3S1NH 1N0VC 1FP6A 1QHSA 4NB3A 2EJMA 4DKAC 2FX3A 1RKBA 3K0FB 5FL7D 5K8LA 5IK2D 3ADCA 1ZCAA 1TTTA 4PMWA 1TADA 2OBNA 1AKEA 2WKQA 2AL7A 3PO2G 2IC5A 3R9WA 3CCLA 2BEKA 5EXTA 1LB1B 2Z6VA 3Q72A 1K3RA 1R0YA 3RAPR 1X65A 5BYKA 3Q8XB 3UMRA 2GXSA 2JEAI 4A3KH 2J0UB 3OE7A 4NYMR 4HB3A 4ZDIA 4M53A 2A69C 2CK3D 1AE2A 1XPOA 1M2OB 4D25A 3I55A 3B85A 2G83A 2NTYC 5KSYA 3KF8B 1RRCA 4ZDJA 3LX8A 1QHYA 2C77A 2X8AA 4S2EA 4W7SA 3RSLA 1MH1A 4YY3L 2ZREA 1WBBA 4AY2A 1SKYB 1A62A 1Q90A 2KBNA 3AB3A 4C0JA 2A1AA 1DPFA 2OFOA 2ZR7A 2ZTCA 4Y0VA 3RNLA 1G4UR 3TMKA 4C4PA 3LWNA 2Q3MA 2WJHA 4WZAE 1E2HA 1N5KA 5DI3B 1DS6A 1VQAA 2EDGA 3IFTA 3FHWA 3Q8DA 4DV5L 2PT7A 3AVOA 3BH6A 4BXXG 5J4HA 3I61A 1NVVQ 1BDOA 2F3IA 5IT9c 3HFZB 4PQYA 1Q81C 1DADA 4A2PA 3ZVNA 4KN7C 1V43A 1S9DA 2QAGB 3HPRA 1EX6A 4B3DA 5LPNA 3KZ1E 5GJBA 1PLLA 1SHZA 4QY7A 4MQBA 1QHNA 4TL8A 3S1QH 4HUTA 1DE0A 4LF7L 4BY7G 1M1KC 2AFHE 3E70C 4E03A 1UM8A 1HZAA 4DUYQ 1R5BA 4PQRA 5JWHA 1C0AA 1AS2A 2HUPA 2ZI7A 2OE2A 1FUUA 1F2UB 2J9RA 3Q5EA 3R8FA 4CEHB 3I56A 2ZEJA 4V0ME 1GL7A 1TMKA 1YZQA 4XH9B 3I4MG 3U61B 3GFPA 3W1GA 1WRBA 3IHWA 2LSSA 2L5TA 3E1SA 4K0KL 4C9BA 2ZJBA 5KU1A 4Q4AA 3BE4A 4BBSG 1NY5A 5JEAG 4MGIR 2H92A 4LWCA 4UNSA 5FUYA 2JLVA 4C7OA 3KDFB 5FJ8H 2JA7H 2MFIA 3CCUA 1LABA 1N6PA 1ZP6A 2Q2HA 2A78A 2LCFA 2VHTA 3T5GA 4BQSA 4BUJA 3CCSA 2CBZA 3FDIA 3R20A 5DSZA 4A4DA 1IM2A 1G3IA 1VMAA 1AS3A 1W0JD 2K52A 2E5LQ 1JAIA 1GL9B 3D8BA 4GP6A 4OI2A 1Z06A 1CJUC 1GDDA 1TQ4A 3EAQA 3FHOA 3U3OA 3QPWA 1G8GA 2QTHA 3REFA 3T06B 1A0IA 3B2EA 5JMTA 3P26A 3U60B 2QBYA 1SXJA 3SYNA 1E1RA 2F1JA 1E3MA 2D62A 3GLIE 5M3MG 3GTMH 2AR7A 1IBLL 1I4TD 2HV8A 4ESVA 3HOXG 1US8A 1UAAA 2C03A 3AKCA 1H95A 1U0JA 2QT0A 5IP9H 1E9CA 4JLPA 3AP2A 4EIWA 4HR7B 1CLUA 1XXHE 2H8KA 3H94A 2VA8A 1TWHH 3AF3A 4IKEA 2IF0A 2F43A 4A3LG 5A0FA 3ASZA 1VF7A 3A74A 4DR7L 2YYZA 3O8CA 3FWYA 4TLAA 2JIZD 4JLBA 2KHJA 4P33A 4RD6A 2H5XA 2IW3A 3IEUA 4JI6Q 1G4AE 2UXDQ 1OYYA 4W9MC 1XJQA 3LO5A 3DHWC 4HATA 3U7HB 1PUIA 4DV2L 1ZC4A 5JWOA 3AVPA 3GFTA 4KSBA 2G0TA 1XMSA 3LVRE 5JEEA 2QL6A 3FB4A 3GEIA 1HR0W 1PVOA 1JQJC 3CF5A 5B57C 2V4DA 1CUKA 4JVNA 1G64A 4P73A 3JVUA 1UBGA 2WSSD 2YWGA 3GLFE 3ADDA 1QF9A 1TX4B 1VHTA 2XX3A 3B5JA 2WP8J 3CWQA 4PSVA 4QFMA 4Y0AA 5CLQA 4Q7JB 4QHTA 3VNUA 2J87A 1UJ2A 4QJ5A 4DR4L 2WZQA 2OQKA 2XSZA 4GN5A 5CK5A 2Z43A 2KI5A 4DLZA 1YJ9A 4NYJR 4OYHA 1P2UA 2ZANA 4PG3A 1T5LA 4NXNQ 1N33L 3GLGB 3RRMA 4PHFA 1VQ9A 3M4PA 1II9A 2X2FA 1ZIPA 4JL5A 3AKYA 3CMEA 4FW9A 4JSTA 2NVYH 1G17A 4L8JA 2UUCL 4DIEA 4R71A 1DAKA 4LK1C 2OILA 4GN4B 4ZCLA 5DLQE 2QG6A 1BBWA 4PO1A 3WY9A 2GZDA 2GRJA 4IFDH 1Y8NB 2JLQA 2Q2IA 2RGAA 1SQ5A 4A0HA 4DSNA 4I81A 2Z0MA 3PF4A 1YR6A 5FOXA 4KN4C 4B44A 2K50A 3B6YA 1EG7A 2HLDD 2ZS9A 2O8BA 3UDXA 4Z51A 4DK6C 4R2HA 3RYTC 5LD2B 4O25A 1C4OA 5BN3A 1JE5A 4R2IA 1ETUA 2Z4SA 5FLXc 3BC1A 1YR9A 2AWNA 2IXFA 2CE2X 3A4LA 3QEJA 2B92A 2FZ4A 5C4GB 1NN3A 1ZKOA 3PSIA 1MOZA 3DOEA 4AYWA 4AI6A 1LVGA 4ABYA 3VR5A 3QBVA 1ZUIA 4P74A 1JT8A 1VYUA 3ECCA 3QPUA 3U3JA 3TIFA 1OXSC 1EFHA 2KBFA 3NG1A 4YXWA 4BY1G 4HLDA 4DR5L 3CNLA 1JJ2A 2JDIA 5EE5B 5L8VA 4B3SL 3K70C 3NEMA 5DNYB 4TVAB 1E9EA 1HURA 2GBLA 1YZKA 3WDNA 4DR6L 2IHYA 2ZUDA 3OOCA 2ODEA 1NNEA 2GXAA 1OH5A 3J7ZC 2VUMG 2OO7A 4LF7Q 4GKKL 4H0LC 4A0RA 2PLRA 4D0GA 4BLQA 2O0HA 1Z6AA 5IYBG 1F3OA 2VO1A 4CDGA 2RHMA 3CF2A 1I94L 2UXCL 4DRZA 4Z1MD 4JKIA 4OHYA 1E2VA 4DV4L 4K8OA 4HAXA 1ZM2A 1QVCA 3OEHD 2OCEA 1HNZQ 4X62L 1BH2A 3CUEF 2GK7A 2DFKB 1JB1A 1HUQA 3A1SA 1XD2A 1GD7A 1VQMA 1CJTC 3O8BA 1W4CA 3VU9B 2O5JC 1LY1A 1BYUA 2QPAA 2QPOA 1IHUA 2K5VA 3BWDD 2QSYA 1RJ9A 1EQRA 5BR8Q 4A8JB 1E3PA 3PGZA 5C44H 4GZMA 3AFQA 5CDFA 5SZJA 3LNNA 4C0HA 3KF6B 4YCVA 1W2BA 2WAQG 1KDOA 4OQXA 5DN6A 3ZZ0A 4LGMA 2V3CC 4HI0E 2A8VA 1YRBA 4OQMA 4WJ3M 2ZXUA 4B35A 2EQBA 4HLUA 2FFAA 2N1BA 1FNMA 1GNQA 3RN5A 3PO2H 3RRZA 5EJEA 1Z6HA 4LOAA 1UADA 1EXMA 4M1WA 4LF4Q 1Q21A 4DDTA 3M9BA 4EPYA 1CR4A 1XJCA 1KDTA 1J8MF 5EUMA 3KJPA 4FMDF 2D06A 3GLHB 4BECA 3SJBA 3VKHA 5KNDA 1S1MA 2PEYA 2QM7A 4P0TA 1U81A 1M7BA 4AIMA 5JJLA 4KBGA 4I1SA 4Q4JB 3CB4A 3NXSA 4JI5Q 3U7FB 2OUKA 4AYBE 3A37A 4R98A 3A8JE 3DEFA 1ZC3A 1SLJA 2YTYA 1JALA 2AKYA 2GVZC 3ASYA 5L3SA 2IHFA 1G8HA 2QRZA 4Q9KA 1XNRL 2ZSEA 2GVDC 4Z54A 5F9FA 5M3FG 3DVLA 3UG6A 4UP8A 1E98A 2QNRA 4M1TA 4AWXA 5IRCD 1KO5A 2GXUA 1V1QA 3GQBA 1QUQB 3VDYA 4BXXH 1Q1ZA 4KHZA 4M1SA 1IQPA 4LHVA 1JPNA 1NKTA 1CR2A 3CCEA 3KLWA 3CRRA 2YWHA 3E2IA 1S9HA 4LUVA 4TSFA 1KAWA 2YWEA 1GKIA 3A1WA 5G40A 1N6LA 1CTMA 1GVNB 2A2ZA 2H17A 4MUBA 1MT0A 1QHHB 1N5LA 1TUEA 4KO8A 2OT3B 4KODA 3RC8A 4TMZA 1AZTA 1ANKA 4YONB 3STBC 3BH7A 2A68D 3EXAA 4RZUA 3I4MH 3RWOA 1ZYRC 4IOAA 4HDCA 4LFCL 5C4MA 5A35A 4TT3A 2ZRDA 3K9LA 2WWGA 3RANA 2JGNA 4ZKDA 4BBSH 2C9OA 2KCCA 5JEAH 2DGYA 2HHHQ 4B3RQ 1IL2A 3CNNA 3QF7A 4LHYA 2ECKA 4TL9A 4BZXA 4EPWA 5JEDA 2CCGA 1ZVQA 1VQJA 2AK3A 1YZLA 3P20A 1OV4A 2GF9A 5J40A 4NMMA 5BN5A 1A7JA 4OQFA 5KDDA 5C0XG 2QY9A 2D0OA 1XEWY 4A3CG 1SVOA 1K8OA 4HIKA 1GOTA 1Z6XA 4X64L 2FPLA 4UY8C 1KI1A 2ZJYA 3LAWA 5GADC 3RABA 3OTOL 4LC1A 2CKZB 1P2TA 5FBLB 1KNQA 3UWKA 1MRNA 3W34A 3I2ZA 2A3RA 4DKXA 3TH5A 4M9ZA 3HGBA 4EX5A 2ZRPA 2Q21A 3EARA 4LYFA 3AF2A 1VQPA 1CR1A 1X86B 2PMDA 2XEXA 3IQXA 3HOXH 5J4KA 2GILA 5AK0A 4YMSA 1WOCA 1Y1WG 4RFSA 3AKEA 3VFDA 2RGNC 1DTSA 1OFHA 1PLKA 1U2RA 5E7IA 4UJ5A 3EZFA 1F2TB 3IPYA 5EE9A 3TJZA 4A2WA 2H16A 4EJSA 4EPRA 4MDFA 3N2EA 5DGXA 2V9PA 1W4BA 4DR3Q 3FMCA 821PA 5FOWA 4A3LH 1XTDA 2IA5A 3HKZG 2WWWA 3WBKA 1TQ2A 5CM9C 2JLWA 1GNPA 1FJGL 1L2TA 4HZUB 4CVNA 1KO7A 3NIBA 4Q4HA 3QI2A 4C0AC 4KLKA 1COWD 4GOJA 4NU0A 5FTMA 4A3EG 2JA6H 1WXQA 2CHVA 2F3RA 3CBQA 4PC2A 2WFWA 1VQ6A 1Q7YC 2ZU0C 2JA1A 2B7CA 5G53C 4PANA 3TR5A 4CRWB 2ANCA 3MFYA 2BJWA 2NGRA 3CRW1 1QVRA 5FL3A 2FXQA 5K8UA 1U0HC 5LBIA 3I73A 1SRUA 1SVWA 2FSFA 2IY5B 3A8KE 1JNYA 5AJZA 4A3JG 3EPKA 3OF5A 1GSIA 2ZETA 3MD0A 5JI3E 2HQLA 2WPDA 4B76A 3TS2A 2GA8A 3FMIA 2J7PD 4GRAA 5TVKA 1W7AA 3A6PC 1WE2A 2ATWA 5FBWB 3KFVA 4X62Q 1Q1BA 1MKYA 2IYTA 1E0KA 2OCYC 4POAA 3TVDA 4ZIRA 3WBJA 4JKYA 1YNXA 1WI5A 3S17H 2D7DA 3RS7A 4A0FA 2Y8EA 1DGSA 2OQ0A 2HT6A 1WB9A 1HQYE 1R5NA 3EQLC 1J5EQ 1Y3AA 4YWKA 5FOSA 1E2QA 3GTLH 3QOFA 5CM8B 4JOIA 1N32L 3RWMB 2FZLA 5KSOA 2WMNB 3PO3G 1KMHA 2F1IA 2NQ2C 2RGEA 1D2EA 4DT1B 4P4UA 3I3SR 1DD2A 2O8CB 2FPKA 3ND8A 2W6IA 4NPHA 4PZZA 2GCOA 4KMUC 2IYUA 1ZCBA 3KJIA 1BBUA 1G7CA 2OG2A 5J5CA 3CW2A 4A0GA 4XVRA 2GHIA 1XTQA 3RS2A 1AH9A 3GD7A 1FPMA 4A9AA 4DV0L 3CH5A 4DLWA 4E09A 1TEXA 1SMXA 4DV6Q 1T3HA 4FMCB 3X1ZA 5F98A 1NMFA 2RCNA 3OE7D 2PQAA 4Q9HA 1HV8A 4JL8A 2UUAQ 4UNQA 3OPOA 3TZUA 4JV5L 3RZDH 1GIAA 3Q9LA 3WNDA 8OHMA 5HKKA 5DO9A 1JJ7A 2IUTA 2DFLA 1ZM9A 3GTJH 1T0JB 3B1ZA 3AVUA 1TU4A 1GUGA 1Q8KA 2W2VA 2E75C 4X8LA 4L8GA 2CCZA 4Q02A 3M4YA 2FSGA 1PH3A 3ZD6A 3BB3A 2QN6A 1GUNA 1XTKA 2QMEA 1LF0A 3O8DA 3QPVA 2C98A 4NYMQ 4TYQA 4ZCIA 2O8DB 4HAWA 3U4ZA 4KVAA 2RMKA 1E2KA 3LBNA 3VX3A 5B64A 4BY1H 4IJHA 1NN1A 4DK1A 1XTSA 2VQEQ 2E76C 2FFBA 2GETA 1UKZA 1UDXA 4QGAA 1D2MA 4S35A 2IWHA 1BMFD 1KI4A 4RCNA 1G20E 5J4VA 1P2VA 2ZRLA 3IBYA 1KI9A 3VHLB 5ANRB 1L4YA 4IVRA 1TKWB 3RZOH 2VH5R 2VUMH 3W1BA 1PH5A 1YR7A 2AHOA 2IYSA 1ZRHA 2FE4A 2LKDA 3NH9A 4MDEA 1Z8FA 5IYBH 4BFXA 1A82A 1EFUA 1W48A 4JBWA 1XPUA 3I92A 4Q1DA 3R9IA 3K9GA 3UATA 4D0NA 5HZKA 3A8IE 1R0WA 2GJ8A 3PR1A 1VQ7A 1OH8A 2I5HA 4DR2L 1X8LA 1KZ7B 1MIUA 5J3BA 1XNQQ 2D2EA 5HZHA 3K81C 4DV3L 1G5RA 1SKQA 4PAOA 4WBSA 3AB9A 4QJFA 5AR1A 2CLCX 5C3EG 2JK8A 1NKSA 1GWNA 4JCVE 1IBKQ 3SJCA 3PFIA 2FMXA 1T91A 2D7CA 4MNOA 1P5ZB 4CT5A 1OB2A 4BLRA 1Z6YA 3FHTA 2PPBC 2ODBA 4LFAQ 2UVQA 2ZS8A 3UMFA 4DCSA 4B3GA 4MKIA 2XXAB 1HH4A 3CONA 3LW8A 1HY3A 2VP6A 421PA 1XCMA 3K0FA 1E2NA 1SXJD 221PA 4PC1A 2B21A 3F1ZA 1T8TA 4OHXA 2BE5D 4TLEA 2ZJOA 4PZ8A 4TMTA 5IP9G 4PZ6A 4BFYA 2BMDA 2JATA 1KI8A 2DR3A 3M1IA 4RSGA 3T51B 3KJOA 4BLSA 1YQTA 3LRPA 2J0UA 4DDUA 4RCZA 3KL4A 1YJNA 5FUXA 2I4IA 2Q6TA 2ZU6A 3C16C 1HYQA 5CLLA 3OZXA 2EFHB 5EP4A 1NTGA 1DAGA 1FZQA 1Q20A 4WZ6A 3SYLA 4B47A 4EKDA 2IS6A 1PUJA 3OYYA 1YR8A 2XITA 1ZBDA 4A2QA 2WBLC 2MSCB 1LACA 3FP9A 2NVXH 2K75A 1P9RA 2XOKA 1X1SA 3W9YA 1KK1A 1X6VA 4CT4B 3L8YA 1FTNA 2OFWA 1QZHA 1CKNB 1KO1A 3TVTA 3T1TA 3G48A 5M3FH 3EPLA 3WP0A 4B43A 3A5UA 2OTLA 2UU9Q 5AJ3Q 4GL2A 3I4NG 5CIQA 1UPTA 1XB2A 3NHAA 2GVAA 3A58B 4B6FA 4MH0R 5GAHC 1ZIOA 1GM5A 2G1KA 5LMUQ 1E2FA 2QAGA 1SE8A 2ORWA 3BFVA 2ZRMA 3I8XA 2NN6G 5EXXA 4UJ3A 1LNZA 2Q3HA 3LD9A 3QG5A 4GOPC 1H9KA 3GTGH 1MO3A 2N49A 4DUYL 2AXNA 2FA9A 2XSZD 4LDJA 5GVSA 4AKHA 2QPTA 1N36Q 1F2UA 3VNVA 4CEHA 1AZSC 1MJCA 2BEJA 3K9HA 1NSFA 3BB1A 4R4IA 1YVDA 3CAMA 4FXPA 1VCIA 1BVSA 3PIOA 4P3YA 2ZPTX 4B3BA 1Y63A 4CYMA 2ZAMA 4DR1Q 3PUVA 1NLYA 4H9GA 3KDFA 1YJ5A 3HU3A 1IJEA 3TSOA 1Y1VG 5JRJA 2C5LA 3THXA 1FW6A 1G5PA 1GRRA 3QVUA 2IHEA 2VP5A 3CPEA 3NEJA 5CYPA 3WNCA 3CX8A 3F8TA 1HTPA 1IYJB 2E5LL 4CGZA 4GOXA 2Y0SG 4LBVA 3T56B 3TREA 4A3CH 2WAYA 3EASA 2IXEA 4BFUA 2QZ4A 1HNWQ 3AYHB 4IXNA 1W36D 3NEYA 1EFCA 2PCJA 2X77A 4MRNA 1IN8A 1TUIA 4XVUA 1KYIA 4A3DG 1W0KA 5HPYB 1MO6A 1E9RA 3PEVA 3DDCA 2ONJA 3U58A 1QBKC 2N42A 2JA9A 1OLOA 4MA4A 5HE8A 1B70B 1HR0Q 1Y1WH 3DMDA 1T5EA 2G0NA 2OESA 4OHVA 5FUWA 1N6NA 2PBRA 4HLCA 1OFTA 4HUQB 2LXJA 5FPYA 721PA 4GNXB 4ZI3A 2BH8A 3VR6A 1PYSB 2HF8A 5CB8A
chains in the Genus database with same CATH superfamily
3VZSA 5JSYA 2XMGA 5IH7A 1P4GA 3GZ4A 3JQAA 3MGBA 1ORTA 4WVLA 4TV9B 1KJZA 3V4ZA 1HDOA 3ICEA 4R3UC 2HSGA 4BO9A 2E4AA 1VTKA 1M9NA 5ADVA 3D4PA 5THKA 2TSSA 4FNAA 5T3UA 1F12A 4C3IB 1IYUA 5DTQA 2KENA 3N0WA 3WO1A 3GLGA 5I4DA 1EQ2A 1KEPA 3VYTA 3UA4A 4K8IA 1EDBA 3DEKA 5F12A 1JJBA 3DEIA 2QB5A 3CQ9A 4QYIA 5HUHA 1BXGB 2QRHA 4BMVA 2WP0A 1LI5A 1D1PA 4XQ0A 4Y2UA 4RY8A 4LF8Q 4OELB 1U0LA 1P4SA 4OU5A 1ADJA 2HXYA 1AZLA 4LSZA 1VQOA 5G0UA 1FDRA 4YDHB 3AFGA 4BQPA 3SNHA 1IEWA 3BGSA 4JEMA 2RGGA 5DEHA 5HFAA 4HDKB 2MHVA 5LNK1 2K5NA 4G9EA 1HZBA 4TLBA 5FF9A 1U0SY 3FYDA 3D1JA 4B75A 3KR0A 1KAHA 3MXTA 3RAJA 4I7AA 1MCZA 1T0IA 1XL0A 4RZIA 4B8YA 1LV7A 3Q1KA 4GT1A 4K5VA 1H66A 1G1MA 2FQQA 3JQGB 3HJCA 2HKIA 2FSVA 3VHXB 4F8MA 2CWWA 4LBYA 1W6KA 4ESHA 4KBYA 4LUCA 5I6YA 1BHSA 1WP9A 1Z5NA 1VYVA 5CVCA 3U2QA 4WFIA 5CDFE 3LT1A 5BMVA 3BTVA 1GQ2A 2F17A 5CHYA 1ZISA 1R9TH 4ZP1A 3N2KB 3RU7A 4AZ3A 5A3JA 2JPDA 3MHBA 1NF8A 2A1TR 5A2GA 5IGGA 2D5DA 2CZGA 2P6UA 1XYGA 5IH3A 3L49A 5LOVB 3B1YA 2RHCA 5IN4A 1JJVA 1REQB 2A5FA 4OATA 2O8FB 3HXQA 1JCKB 3OCJA 1GITA 1QCCA 4WE3A 3EVEA 3UHPA 1DMRA 3W6OA 3ZU6A 1I4HA 5E8RA 4NNOA 3SX4A 1H2XA 2WV9A 3BMNB 1YNJC 1F2LA 1QVGA 3CCFA 4DUZQ 4JBJA 2ID4A 2IUEA 3PLRA 3OW2A 3B2NA 2A33A 1C41A 3HNOA 1HGXA 3DTYA 3Q12A 2PMCA 3GZNA 1NQ5A 1OU4A 4YCBA 3U4QA 3NC0C 2DH6A 3ZC3A 1NMXA 1YOVA 1F4LA 1EFDN 3U1BA 3MS4A 5KTNA 3ZNNA 1L7OA 4UOEA 2EYPA 5DPMA 2Q45A 4AULA 4NAVA 4J1MA 3SYKA 2W43A 3ZVKA 2IS2A 2HIVA 1Y9EA 1DM0B 1PZID 4CV1A 1FL9A 3PEYA 1DQYA 5CDSA 2PX8A 4AN4A 3W7BA 5I2XA 1F4VA 4YRDA 1NI5A 1V8FA 5FOBB 3F4KA 4I1OA 4R1UA 4GBGA 2J4DA 5AKHA 4BO6A 5E7QA 4O4LB 3WGTA 3R2JA 3HR4A 2X5XA 1QF6A 1GILA 3FSEA 2A58A 5EPLA 4QVKA 3O75A 3IAFA 4FJ1A 2AFHB 3B6MA 2OEPA 2H0QA 5ULLA 1RPZA 3GTKH 4ZI7F 3I30X 3I5MA 1Q7TA 4A3IG 5IXSA 4OXKA 2YS7A 2B39A 4RKYA 1VHLA 3PE6A 1O7JA 2HCJB 3V1NA 3DR5A 1EFRD 1U7WA 3JTMA 3MJSA 4G0XA 1F5NA 1PK8A 3QM1A 4KBFA 2JP1A 3K4PA 3KLNA 1AY0A 3D3EA 1KAOA 1TGVA 4NCHA 3GCDA 3K1YA 1JB7A 2HMWA 1CW2B 4EG3A 5LQAA 4YIJA 3Q9UA 1E9BA 4MIUA 2ZI9A 4CI9A 1KPIA 2Q27A 1EOTA 1QRRA 5HIIA 4ZOBA 3OQ1A 4PWZA 5BVGB 5BURA 3USCS 1H9JA 1QHFA 5DHFA 1I9CA 4R2MA 4XOIA 5IASA 1K0SA 1ASYA 2RB4A 1KF0A 5GOTA 4MIOA 4WLNA 3LHFA 1SNDA 4E4RA 5LUAA 4JUAA 1SUDA 1ILPA 1C3XA 1SVLA 1A5AB 2IKQA 2A68C 1EGHA 3DYBA 4DV7L 1FVFA 1OZAA 2V55B 2PGXA 5DM2A 5KWJA 2W42A 4CW7A 3AUXA 5IANA 3FF1A 2QF7A 3GYGA 3W4JA 4TKVB 4UREA 5TMPA 3A7LA 5HGQA 2NM0A 2CWPA 2SICE 4B09A 1EY0A 3V7YA 2W2XA 1XHFA 3REGA 1VBNA 4PFSA 5CCDA 1JWAB 4JJIA 3D8UA 2Q2UA 3U50C 3K1TA 2VHQA 1ZOOA 1GR1A 1BD3A 3ZE1B 2VJBA 4EO7A 3QKSA 1PH8A 1K7EB 1KE1A 5K0JA 2CLMB 2AKWB 2O5IC 4MVJA 3VVBA 4EGSA 1X6OA 1OFIA 3EJWA 1IONA 1DT5A 5K0EA 4JLJA 4DQVA 3I72A 3PNOA 4JX9A 3V33A 1D4ZA 2QP3A 4NBKA 1IBMQ 1K92A 1VQHA 3VZBA 2NO0A 2ORED 3JD4A 3MTJA 2CJWA 3MCZA 3P0FA 4QBIA 1MXHA 2SKCA 3AERA 3DAYA 1TRHA 3O92A 2WZCA 2Q5QA 2NVQH 1LK7A 5EIHA 1N25A 1YIDA 3TRDA 4WESA 2ZT7A 2O54A 4GECA 4I46A 4BTLA 2FZGA 2O52A 3EZYA 3B13B 1XPRA 4OU4A 3LF2A 2HCFA 3DF9A 3LW7A 1MI2A 1RWQA 4G1FA 4LCJA 4R9NA 2NMVA 4L02A 1QWOA 4G4GA 6REQB 2UYCA 1JPJA 5ESDA 5FYDA 1TO2E 2PMZE 5C4XB 2XQGA 5IYZF 3DLTA 1U6JA 4MUJA 2QEXA 2IX0A 1UBMS 3TE7A 5D85A 5HBGA 4JI7L 3KJFA 4X65L 2JA5B 3T7SA 4LWOA 1U2DA 1B9NA 5IJ9B 2UZ0A 3CLUC 3DKVA 2XTIA 3CR3C 3WGNA 5JNLA 3JD3A 1KJNA 3CW8X 1M75A 1HQMC 4PICA 5IT4A 3BRWD 2VAWA 2H0AA 4LRYA 5DHSA 4L6AA 1GPDG 4BKMA 4NXMQ 1V1OA 2RK6A 1PP4A 3L9XA 1QVVA 1S4QA 2IEYA 3R5KA 3QU2A 5EGNA 4FFNA 3NRJA 4IDHA 4ODIA 5CX4A 1Y3HA 5J43A 1Z39A 2PS0A 3DL2A 3GGGA 4LXIA 4ZVQA 5JU6A 3B8EA 3NTRA 1P7WA 2RBGA 4L7VA 1D0IA 3OU6A 2BR5A 3QEAZ 2RHDA 1I1OA 2CVRA 2FKNA 3HKCA 2ZSFA 5CCXA 1IG3A 1B1ZA 3GBSA 5KNCA 2R7AA 4NFYA 4A7PA 1ZYRD 2ODNA 4V1CA 2C59A 5J5AA 1XRSB 2YCBA 1TVMA 5C37A 1VJDA 3D7NA 1LA2A 1TJ3A 1LM0A 1LPSA 1ONLA 4WZAA 4KIJA 4RCOA 2XMPA 1PR3A 4R69A 2P7HA 1L0BA 2EEZA 4DG9A 1LDYA 1JWMD 2NTTA 3VJMA 2BELA 2ZRGA 5IHXA 5KOHB 1Y1LA 2QVBA 2HYDA 1C8CA 1MFPA 3A6HA 4S1TA 5HF8A 3ENVA 3DM9B 2VNUD 3QWIA 1DC3A 5K03A 1DWOA 2FZKA 5EZSA 4AFNA 3VTFA 3EGDA 2YOGA 4TXHA 3PUZA 1BO6A 3OOEA 1TRKA 1ULHA 5AT1A 3HO1A 4DJDC 3FUTA 1G6OA 4R1MA 3LM8A 1J0BA 3AJAA 1EXNA 4C7OB 4UQOA 5AKZA 1DRVA 2WWXA 2PTGA 4R4QA 4A3FB 2FR8A 2H5EA 3L8EA 3RTDA 5HQ3A 1YI0A 4OUDA 1F9RA 4DHEA 3S5UA 1NW5A 1TYEB 2BFWA 2TS1A 2JD0A 1F7VA 3UENA 1YFKA 4G25A 2D2FA 1D8TA 1QFJA 1IBLQ 4HXYA 2ZSHA 5ESWA 2XOKD 4OAPA 3ULLA 4NAUA 4NOLA 3FE2A 1G2QA 5EJFA 3LZDA 5CD9A 3SQWA 3MIZA 3CF4G 4QBKA 3VYRB 3W5OA 2IYAA 4CQMA 3W5IA 1ZJ6A 4KZPA 3KG2A 2HBZA 3RW9A 1NUHA 3AK4A 3UJHA 2WKSA 3L0PA 4GGPA 1P6QA 1Y9ZA 1U9JA 4MVJD 1CULC 3AEQA 4NBRA 1CR6A 2V98A 4GN3B 1EAYA 5KJ6A 1N33Q 2CSXA 3BE6A 2F8TA 1KEKA 3DJYA 2UUCQ 1Y8PB 1A9ZA 4EAQA 2WQ7A 5C8ZA 3F2DA 4DC0A 5IX8A 1ST2A 2O8BB 3HXPA 1V71A 3PQ5A 1E89A 8LDHA 3A4VA 5DYGA 5UKDA 3KETA 4B3TL 4GNRA 1MORA 4TL6A 1M8PA 4K5WA 4H7BA 1ZL2A 4CCAA 4DDWA 4AKEA 3GPDG 3CZCA 4NBLA 1P39A 4WBNA 4GKKQ 2AFIB 5BOSB 1HZCA 1JIJA 3SS9X 5FFNA 4AMYA 3EC1A 1W5FA 4JVZA 5MGNA 3M6MD 3NASA 3COVA 2OBLA 3OJFA 2JFZA 1VBMA 1ZN2A 2JGRA 5FTJA 1QGED 3P2MA 1OZ0A 2GZHA 3IFDA 3H05A 4B3RB 5GONF 1JDNA 4HAVA 4MR7A 4V0QA 4XWWA 2OKCA 2QX6A 3TLXA 4PG4A 1R0SA 5FK9C 4E32A 2YZNA 2VH1A 3HC7A 3CSUA 1WPXA 2GN8A 1XSEA 4D42A 1FNCA 4PZEA 3WGVA 4DR3B 1U5BB 1WEHA 1PH9A 3FGPA 1HDGO 2AQ3B 1JH9A 4XA8A 1XI2A 3O1HB 1E58A 4UNIA 2AOTB 1WLYA 4M0CA 1JG2A 4KNYA 1W581 2DG2A 1AG9A 3SLKA 4XJTA 5AVWA 2QQEA 4I8XA 3K30A 4P32A 3EEFA 2NO7A 1T1SA 3NQ41 5HKLA 3A1VA 2HDLA 4EHHA 2DNCA 4TWAA 3EF3A 3C4QA 2UUAB 1JNXX 1C7IA 3ZWQA 3ZGLA 4LOIA 5KNCD 3ZYCA 4M7OA 2RHWA 5GQOA 2P9YA 3GFQA 3K5OA 4IWNA 3SQNA 4LTNA 1SYGA 5MHTA 1JBKA 4EEZA 4GG1A 4GZYC 2LW7A 4Q1BA 4NE7A 1JKJA 1CUGA 2AG1A 2YTXA 3LLUA 3KJHA 3R6LA 2L69A 1KVRA 3V4FA 3EA0A 3FYUC 2ZUTA 1EP3B 4V3BA 1ZK2A 5BR4A 2VYQA 3R41A 3VH1A 3CH6A 4UXHA 3UE0A 2ONZA 2R3ZA 1TECE 3GP3A 4IEIA 4TWZA 3I5YA 3ISJA 3WHKA 1KERA 1Y4ZA 2ADFA 2GA4B 5JROA 1GGKA 1Z0UA 3EQ6A 5C8YF 5ER6A 4R31A 4UUOA 2C1EA 1GG8A 5AK5A 3NHSA 4NPSA 2HDNB 1CK4A 3WA7A 4PGHA 4W9NC 1PNTA 3U3DA 4U6SA 1AS0A 5CITA 4GNKA 2WU8A 5EE1A 1TTTA 1CUDA 4ZODA 1KTIA 5KZMB 3R9WA 1N5MA 3U26A 3UMRA 4NYMR 2EBWA 4BBPA 1V2HE 3PLAE 3B85A 2NTYC 3KF8B 1E3QA 4G8CA 4I1IA 1SKYB 2A1AA 4CQMD 2W6ZA 2Q5FA 5M9OA 5JVDB 4X97A 4XVCA 1WXDA 2P4SA 1GTZA 3HFZB 3SYTA 3HFJA 1LT4D 1ZJJA 2H2AA 3D7RA 4E03A 5A9SA 4DUYQ 4K8JA 3BMCA 1YQDA 1YVEI 3SHVA 1YZQA 1TMKA 2HJ9A 1M2VA 5I51A 3D3JA 3E1SA 2D5AA 4I19A 2JJMA 1P2GA 1NY5A 1ZP6A 3I0MA 3U44A 1LABA 1DFIA 3T5GA 2G7MC 1KQGA 2O9JA 1DC8A 4PFKA 1E1RA 2F1JA 5M3MG 4L5JA 4N49A 1UAGA 1EY8A 4MV9A 3AF3A 3VPDA 7YASA 3ASZA 3UGTA 1ZMRA 2H5XA 4K1LA 2UXDQ 4W9MC 1XF1A 3P9QA 3WWEA 3U7HB 3AHHA 1HR0W 4LHEA 4CEIB 9LDBA 2WP8J 1S3FA 1GUZA 2CJXA 3SJ7A 1M66A 1BF4A 1SA0A 3JZDA 4UPEA 4ND2A 3ANTA 1TUGA 5GAJA 4CKXA 3TG8A 2B4YA 4OLAA 3OLVA 1FP4B 2HIMA 2J6BA 4KN4C 4YJFA 4R2HA 3VV3A 4YRFA 5TQVA 1NFRA 1GEEA 5A3SA 3Q8MA 2X8WA 1VCHA 4YXWA 1OV6A 4NFSA 5CNKA 2EBFX 3JQ9C 5DNYB 5B1EA 4E5PA 3ZI7A 3T41A 1FFDA 3PJGA 2NZXA 5SYNA 3HL4A 5FLXE 4RHCA 4DV4L 1QVCA 1IMOA 3TGWA 1H9BA 4MROA 2P6MA 1JB1A 1VQMA 1CDOA 4A5OA 3PGZA 4C4XA 5SZJA 3G8DA 4GI1A 2FFAA 3VHQA 3PIDA 3BQNB 1CR4A 4YCNA 1KDTA 4U7JA 5KNDA 1W5EA 5A5DA 3P19A 3U40A 1JDVA 3BRQA 1X32A 1USKA 1RMYA 2QNRA 3QX9A 2D00A 2R1ZA 3TFWA 1JHRA 3GU3A 3B3JA 2OT3B 3F5DA 2JAXA 3LL4A 5ALMA 4A3JB 2Q1XA 4HDCA 3SR3A 1SDFA 5DP1A 5M29A 3KYDB 5EKLA 2C54A 2D0OA 4HC4A 1SVOA 1GOTA 1N2IA 3PO3B 2Z8LA 5GADC 1A8PA 1E8NA 3ERCA 5D86A 5JAHA 1TQOA 3V4SA 2EZUA 2FW7A 2EJVA 2FRDC 4O4JA 5EUCA 1VFNA 5AVOA 3L7IA 1O9HA 1SEBD 3WLJA 1BZYA 1TOAA 2G63A 5FTMA 5JAZA 2ZU0C 2JA1A 4L22A 4CDFC 2OHJA 5K8UA 1U0HC 2QUIA 1VL1A 3OF5A 1NF2A 1ET9A 4Z86A 1YBAA 3PC8C 2IYTA 4MVJH 4DGSA 1WB9A 5EJWA 4RLQA 4PZZA 4C07A 1JV2B 1AQLA 1D1TA 1RKQA 1YMVA 3ICOA 2OC4A 4DV6Q 2ZWVA 4R0NA 5F98A 5CFPA 4Q9HA 4UNQA 3URMA 4FX2A 4JA2A 1T0JB 4BJ6A 1LCIA 1RAFA 5ALUA 3CEHA 1R4ZA 1LF0A 4ZCIA 3MMSA 4MX8A 4F8JA 3NUZA 4YP7A 3AYXB 4W1SA 3MBKA 4LCEA 4KIWA 1TKWB 2CNBA 2Z3VA 1SCUB 1DV2A 1K63A 4LDZA 3SZ3A 4ZHQB 5LQNA 3D4LA 1LBTA 1G5RA 4PAOA 5DGHA 5K0FA 4UPDA 4FZVA 3KB8A 5LR6A 1PDQA 4JI8B 1XCMA 3IL2A 4G37A 4N4AA 4QGSA 2IZOA 4C04A 3BJRA 4BLSA 3B6KA 2J0UA 5FUXA 2ZU6A 3MRTA 1QZHA 5F3RA 2VHYA 4D9GA 5AJ3Q 1GFWA 1YC5A 4AJPA 2C2KA 3QNMA 1QE6A 3N8DA 1H22A 1L5QA 6YASA 4V2UA 1E3TA 3EEQA 4D56A 3K9HA 4ZN6A 1UT5A 4MZDA 1Y1VG 4ARCA 2R8EA 3EASA 2N75A 2PCJA 2I6FA 4EUEA 4O8CA 4FK8A 4J29A 3OQJA 3ZCUA 5DLPA 3AOEC 4L9AA 2OESA 2OORC 1N6NA 2XKAA 1OFTA 1CP3A 1ZXXA 4GMGA 2BH8A 1PYSB 1VE1A 4YXWD 5JEAJ 1N2XA 3KZMA 1E2IA 2WHRA 1UBEA 3OZSA 3PXGA 3O0DA 1UWLA 5FO8B 1BRTA 1RHKA 2NN3C 1PYGA 4CJXA 2I71A 5KNCH 2RCYA 3ORFA 3G9TA 3MGCA 4K6MA 1SRRA 2AC2A 5DSXA 3VVMA 3BK1A 2X4IA 4PTLA 3M49A 2CMFA 1SMKA 4YUAA 2WM8A 3O82A 3R3VA 1HDEA 2Y1OA 1PJQA 1RFLA 2B8GA 4R9UC 2LP4Y 5IEJA 1VSVA 4X8MA 2R00A 4HT3B 2YVKA 3I32A 2QD5A 3C5WP 4NKRA 3WG9A 2QD4A 4PX9A 5AXBA 1QH8B 2VDLB 3CH4B 1VG8A 1MVNA 3GOQA 2JARA 3GDOA 3LQYA 2IYPA 2AOWA 3JCZA 1PZJD 5TPZA 4E88A 3TMAA 3R9XA 5FA6A 1W0CA 2Q8TA 1T4CA 1ODCA 3ESZA 6PFKA 3IBFA 2WM2A 3DW3X 3QPCA 3N2ZB 3BZWA 3ABRB 4MZ9A 5FIUA 1KY5A 4CLRB 4HYTA 3KVRA 2AX4A 3WYDA 1N2EA 3R7WB 3B1FA 3L7BA 5K99A 5A7FA 2ZJ6A 2XB9A 2QA4A 4Q7KA 4F5EA 1JXAA 3P52A 5COBA 1KIAA 5FBZA 3EQ9A 3T9BA 1H0KA 3HKBA 4GOPB 3IRVA 4JI0Q 3IOEA 5IULC 1LSUA 1FXWF 5GMOA 3NDBB 1P61B 2JAPA 4L15A 2B2YA 2WFAA 3P9CA 2CDRA 4TKUB 2PO5A 1NM5A 1O5TA 4FKBA 1HHVA 1F6WA 4IDOA 3EIXA 2BIFA 3WLIA 1E59A 4JZYA 3NANA 1UE1A 2X0DA 1D2HA 5LM3A 1F2TA 1VJ0A 5FNVB 3PNKA 3KSRA 5K2OA 3EXEB 3ZGVA 3BAZA 4XIIA 4UE2A 1O0SA 1G42A 1AMNA 2BGGA 1DBVO 5I7HA 1FQWA 2WB1E 1BQEA 2EYHA 4RA8A 2P9FA 2N3ZA 1O0BA 5CXUA 3I5XA 1PQWA 2D1FA 3ZLBA 3JXEA 3PFHA 2GH1A 4FDUA 1H2WA 4B33A 4A91A 1NNSA 4G1UC 2MYTA 1HMYA 4GE0A 1BXRA 4FNMA 2HA4A 1UNSA 3OAAD 2NTNA 3N6RA 5TQ2A 2BL4A 2ZR9A 1LFDB 4IIJB 4B80A 3IJEB 3L4BC 1CA5A 2NU6A 1YCGA 1Z6PA 1XVUA 3BB4A 4K8RB 2KB0A 1DRJA 4O3FA 4RTKA 4LZWA 3NM5A 1X1CA 4A6PA 4B4KA 3UUGA 2JLYA 2EU8A 2UDPA 1SNYA 1VG1A 2XA1A 5E8JA 4DPGA 4GKBA 1JRLA 2OD7A 3E0JA 2INGX 2CMGA 4FDBA 1KBOA 1GXDC 1N8RC 5JS1A 1PFQA 3KDSE 2GMWA 4ZCTA 3V46A 5H3HA 2N88A 3NXKA 5D3KA 2F9FA 3CE9A 4EB6A 4GNXC