2YYZA

Crystal structure of sugar abc transporter, atp-binding protein
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
358
structure length
358
Chain Sequence
PSIRVVNLKKYFGKVKAVDGVSFEVKDGEFVALLGPSGCGKTTTLLMLAGIYKPTSGEIYFDDVLVNDIPPKYREVGMVFQNYALYPHMTVFENIAFPLRARRISKDEVEKRVVEIARKLLIDNLLDRKPTQLSGGQQQRVALARALVKQPKVLLFDEPLSNLDANLRMIMRAEIKHLQQELGITSVYVTHDQAEAMTMASRIAVFNQGKLVQYGTPDEVYDSPKNMFVASFIGNPPTNFLRDFSVSVENKQTILKRDDVIIKLPEPVDVKLKEVVVGIRPEHCRISRERVENSIPGVVYVVEPLGRDIIVNVKTEKGEIIKVFGDTGKAPQPGENVFLVPDLRKIHLFNPETEETIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Sugar ABC transporter, ATP-binding protein
rcsb
source organism Thermotoga maritima
molecule tags Transport protein
molecule keywords Sugar ABC transporter, ATP-binding protein
total genus 88
structure length 358
sequence length 358
ec nomenclature
pdb deposition date 2007-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF08402 TOBE_2 TOBE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2yyzA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2yyzA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2yyzA01
3IBGA 3AGPA 1N6OA 1E9FA 2H7VA 4HAYA 2RGEA 5E7IA 4B74A 1GAJA 1D7QA 2FSIA 4M9QA 1Q12A 2E2HH 2Q21A 5FUWA 1EWRA 2I5HA 1OT3A 3BFXA 4A3BG 2OZEA 1Q81C 3Q5DA 3K8AA 3DZDA 1CRPA 3PG5A 3R8CA 1KMHB 1S3SA 4A3FH 3HYTA 1YHAA 2UUCL 3O8DA 3Q7QA 4NCHA 5JBQA 3FKIH 1Z6YA 4HIOA 1DBSA 3P27A 4QJ3A 4Q7JB 4EQ6B 2Q2HA 4IDOA 4DR5L 2YC2C 3AF2A 4B3GA 3OTOL 1T5IA 1KI8A 4YXWD 3SYLA 2D7CA 3I8XA 3JVVA 2AK2A 4Q4AA 2ZJYA 3TK1A 2JLYA 2ZRDA 1WBBA 2PNRC 3IQWA 1P9NA 3P20A 3CX7A 2FDCA 4LWCA 1CU1A 1G1MA 3U60B 2JQOA 4KLKA 3C41J 3LWNA 3T5GA 1HTPA 4YDSA 4LJZC 3B85A 3I5XA 1Z63A 2WJVA 1L7VC 4LF9L 2WWHA 4CGZA 3U7HB 2JJ2A 4POGA 1J5EL 1XTQA 2QA5A 3CX6A 3S17H 5CB8A 2KENA 3GDEA 3K7UC 1N8RC 3BIFA 4JYCA 3QKSA 2HHHL 3BH7A 4WXRA 3U7EB 1KHIA 1MO5A 4DLUA 4XSGA 2Q6TA 4Y0AA 2H1LA 3HU1A 2K14A 4DKXA 2ZRMA 4K0KL 2IF0A 2OILA 5K8UA 5GAGC 4DWJA 4MITA 4DXAA 4OWTB 1UKYA 4DLRA 1X6OA 3TJZA 1KYIA 1J70A 4TL6A 3GP8A 4G1UC 3CCMA 4GOKA 2RCNA 2B29A 1I94L 1W0JD 1K8MA 2I4IA 4HJAA 1L1OB 5C0XH 1KJWA 2X2FA 1KY3A 3VKGA 1YVDA 4HAVA 4Q4JB 3UK6A 2HIXA 3SJCA 3K53A 1J7KA 1KI9A 4MRVA 3MUFA 4NBSA 1Y69U 3S1NH 1T9HA 3CRLC 3IIJA 1IY1A 4IEIA 5F9HA 4EPXA 4LF8Q 3ADCA 3MWYW 1JR3E 1E3PA 4KN7C 1KK0A 1C9KA 4TMXA 4C4PA 4PZZA 3ZD7A 1GHJA 1OFUX 5D3MA 1NJGA 5FOSA 4JI2L 4BEJA 3SEAA 1JJ2A 1UJ2A 4PG3A 1PV4A 1YR7A 1KJZA 3P4YA 4CEIB 1B7YB 2XNDD 3AUYA 4MUAA 3TUIC 3VNVA 5KSPA 5M5XH 1KDTA 4DV2L 3W90A 1DAGA 4URXR 3T56B 1PLKA 3M4OH 4C0KA 2E5LQ 1U94A 3T5DA 3GJ8A 2REXB 2HJGA 2OCAA 4QC2A 2ZU0C 2NO7A 4G3XA 4LFBL 3TW8B 1ZAKA 3QKRB 4KXFB 1HNZL 5TV2A 2CNWD 4KYIB 1E96A 1TU2B 3TZUA 4HJ8A 2GEVA 1Z6XA 3IHLA 1EK0A 1K0RA 1VDZA 5GADl 1H65A 5B57C 5H1YA 4R98A 2YWHA 1KAWA 4IW3B 2ZAMA 2DPXA 1IJEA 1W0JA 4PC7A 4RSGA 1QRAA 3RABA 2XZOA 2JIZD 1TXYA 2ZVQX 4PQYA 4Q1AA 1EGAA 4NYJR 2O0KA 3VU9B 4FN5A 1ZNXA 3GFTA 4LV8B 2OXRA 2PH1A 4U5XA 5FOWA 4BASA 1Z0JA 3HU3A 4BZQA 2EQSA 2MMGA 3DZ8A 3VX3A 4EJSC 1Q3TA 5EP4A 3AKYA 1IBRA 1QG2A 2XXAB 1G291 4C3HH 1E9CA 1N2CE 2BH2A 4C0QC 3FGNA 2RHSB 4LF7L 2OWOA 1N5IA 1A2KC 1NBWA 1LNZA 1VF7A 2AFIE 3QF7A 4RZUA 2IUUA 1ZYRC 1G16A 5AWFC 3L0OA 1P61B 3ZYCA 3SQXA 3BZCA 4GZMA 2A2ZA 4LJ9A 4OQMA 3W8RA 1OKKA 2FPLA 1A0IA 1PLLA 4PMWA 2O5IC 1KOFA 2B7BA 3CM0A 1VF5C 1SR3A 2WP8J 3T1VA 4JL8A 1KDPA 4KFTA 4BFVA 4B34A 3K0SA 2WJIA 2ZR9A 1VQFA 1H9MA 4MTNA 2ZR0A 1PH3A 2ZYWX 2HYDA 5FUVA 1J90A 3TBKA 1E2KA 3AF3A 4LX0A 4QJ5A 1TQ4A 2W2TA 1AGPA 4NYIQ 1TX4B 3IEVA 3F0TA 1OH8A 4RD4A 3VHXA 1V1QA 4DUYL 1AZSC 2WWXA 2XTIA 3K81C 1E9SA 1Z83A 2UXBQ 1Y8PB 4HZUB 3C8UA 2DNEA 1QVGA 1E9EA 1LS1A 2FWRA 2QP4A 4PPNA 4LBZA 1E7ZA 4A3GG 2PX0A 4LK2A 5FJ8H 1E99A 4Q7LA 3AV0B 1AQUA 2FX3A 1W36D 4BY7H 5E95A 1VECA 4DR3L 2BMEA 3B9PA 1TF7A 3U3KA 3GLGB 3PEYA 1ONLA 4JI7Q 2K50A 4JI1Q 1E94E 2FFAA 5G3ZA 2QP9X 2V7QA 4Y0VA 1E0JA 4KBGA 2AX4A 2QPAA 1KI1A 2WWFA 3Q7PA 1R8SA 5FTKA 4URVR 2X19A 1KAOA 4KVAA 1LACA 3PVSA 2ZE8A 1R4AA 1ZUIA 2WOJA 4BFYA 2OHFA 4JI8L 3KDSE 5UKDA 1VQAA 3ZQ6A 2OTJA 2BE5D 2W00A 3UIEA 1ZCBA 3L0PA 3QKUA 3CCSA 3HOWG 1RRCA 2QTHA 3ZJYA 3WWVA 3SHWA 2YTYA 4A3BH 2FNAA 1E98A 1Z29A 1XEXA 3HP1A 4D82A 1JI0A 4UP7A 1D5CA 1VTKA 3R8FA 2FSGA 1ELOA 5EP3A 3B60A 3MJHA 1RVDA 3U3JA 1XD8A 3W1GA 1N36L 2R6FA 4DKAC 1HNWL 1ESNA 2IX0A 1W2HA 1TKWB 1YQTA 1NMXA 4RJLA 2GF9A 2XGTA 3IDQA 3U4ZA 4KITB 2UUBL 1PJRA 4EFLA 2IS2A 1SVSA 4WBSA 3UDFA 1TAGA 1OPXA 3KXLA 1W7AA 1PH1A 4X65L 1HURA 4C3IH 2ATVA 3G82C 2ZRAA 4GMXA 1VG9B 4LF6Q 3GTKH 1UFQA 1XMOL 2GVBA 5CIQA 1KI7A 5SZKB 3SFZA 5FTNA 1WCV1 621PA 3IRBA 2GXAA 5IP9H 5JS7A 1H8HD 3LXXA 4DV6Q 4TYNA 4HDOB 4TYWA 2P67A 1TWFH 4HAXA 1S96A 3S1RH 3DPUA 4OQXA 4R4QA 4OHVA 1UKEA 1YHBA 1UEIA 1FUKA 4TN1A 1IW7C 1QHHB 1IBLQ 3GTJH 4AG6A 3BWDD 1VQGA 1LF5A 4HLQB 1BIFA 4K8OA 1TWHH 5C18A 4EJSA 4JIMA 4A3MH 4OX9Q 4H0LC 3GO5A 3N2EA 2AXNA 1GVNB 5B30A 4YCUA 3GJ5A 2X2EA 4OK3A 1EOVA 3ZH9B 4QBHA 3OIYA 3RC8A 1EFCA 1R10A 1VIYA 2DWQA 5JZVA 2YWFA 1JJGA 2ORVA 4JC0A 2ATXA 4P4SB 2PX3A 4DEYA 1ZIPA 4HDCA 3STBD 3CF0A 3V00A 3ZLJA 1MRNA 1SMYC 1GL7A 4LF9Q 5BN5A 1QVFA 3ASZA 3FMFA 4OXPA 1H9RA 2P6NA 4LUOA 4LV6A 1CR2A 5EZ6B 4OHZA 1SULA 4ZCMA 4JVMA 4DLYA 1GUGA 4NYIR 5JSZA 3AYHB 2JDID 1R0ZA 1DEKA 4B3BA 4E22A 4OO1I 2GDJA 2ZTCA 5AJ3Q 1HE1C 2X77A 4P32A 2MQHA 1XEFA 4RKEA 1D9ZA 2JLVA 4O2DA 1UWVA 4NL4H 2JLWA 2JAQA 4V0LA 1XF9A 4DUZL 2CL7X 2QT0A 2J45A 2D74A 2VY3A 1YHNA 4OKSA 1IBML 5H68A 3H3VH 1XMIA 1XTRA 4BY1G 4X62Q 5FL3A 2B8TA 2WIBA 2G9NA 4IOKA 1ZM4A 4F38A 1Z0KA 2DY1A 2ZRPA 1YNNC 4PO8A 1WBDA 3S24A 1E2FA 1UADA 2HDNB 4QGFA 2IYYA 4PFSA 2G83A 4QXAA 1YJWA 1XTDA 4C0JA 3THYA 3L2OB 3MLEA 3C5CA 5JWHA 4DT1A 4IXNA 2BA0A 2RKOA 5FTMA 2PI2E 2BJWA 2P0EA 4A2WA 4POFA 3VR6A 4RCNA 2ORIA 4PHGA 5KHOC 2P6UA 4AYWA 1HZ9A 1CJUC 1OSNA 4JYAL 3U44B 4CEHA 3D6TB 3IEUA 3D31A 1NLYA 5IP9G 1G3UA 4PQFA 4PHFA 4A1FA 2EXDA 1Z0DA 3KJIA 3MGCA 4LPKA 2VQEL 2GCPA 1JBKA 2BC9A 2C78A 3EN2A 2DYKA 2OCPA 5EUMA 2C95A 4MDEA 2PEZA 3HGBA 4BBRG 1L0WA 3TS0A 1PH2A 4A3MG 4PC2A 4RFVA 5EXPA 5FOTA 2HEIA 2IY5B 4BBSH 3A4NA 4A75A 2JA8H 3KKNA 3LDAA 4QJ4A 3QF4B 5H8WA 1U0HC 4LFAL 1Z5ZA 2V6JA 2VIIA 1E6CA 3X2SA 4OI2A 5DO9A 1EWIA 3JAMc 4LYHA 4M9ZA 2VTKA 5J47A 5JRZA 2V55B 3HFZB 4BRWA 3T53B 1GKUB 1NVXQ 1NLZA 2JEOA 1VQBA 1GNQA 4P73A 3EWAA 1HR0L 3TSZA 4OYHA 4W7SA 1SHKA 4HAZA 3TVTA 2YWEA 3CF2A 2QMHA 2QTVB 3K9HA 2MSDB 4LC0A 2Z0SA 1UE6A 1KAGA 4KU4A 4RZXA 4J0QA 3OZXA 4XVUA 1DO2A 2C98A 1OKKD 2WWIA 4UNPA 2B6HA 4TQUS 5C0XJ 3CCLA 4CT5A 1QG4A 2IX3A 5CM8B 3G71A 1CR1A 4M1YA 4GOPA 2CVFA 3HR7A 1F2TB 4YY3Q 1XXHA 1KRSA 4DV4Q 1P2UA 3B7GA 1BMFD 3L7ZC 3NEMA 2KWIA 3BD9A 1I3QH 1E1QD 4MKIA 2KHJA 4C0BA 3CPWA 1RC8A 1U90A 1Z0FA 2K4KA 3GJ7A 1MIUA 2C35B 4HDQB 1EQQA 2A5GA 4LK1C 1U8AA 3BGWA 2CHQA 1II0A 3OIVA 4L5BA 5IYBH 1T3HA 5M3FH 5C46F 4LFCQ 2E74C 5BW8A 4NCKA 5BQ5A 4WJ3M 4G7HC 4B48A 1OXVA 2JA7H 3ZJYC 1XDBA 4B3DA 2GAAA 5C4XH 5JJKA 3I61A 4JL5A 1P8LA 2O8BA 2NZ8A 2WFWA 4IOCA 4A8JA 1E4YA 2VZAA 4Q1BA 2JLZA 3B2EA 1X1RA 2YYZA 2Z0MA 3ADKA 3UANA 2O8FB 3PF5A 1NMYA 5FOXA 4A0GA 2G88A 3AP2A 1IN7A 4X66L 5K8LA 1DAEA 2EFGA 2A7QA 2C96A 3KQUA 2BIFA 3TAHA 1W36B 4JI1L 3WDNA 2E87A 2IXFA 1QVCA 3DM3A 2JATA 2QMOA 1IXRC 2KCMA 3GLHE 2F3TA 3PGZA 1N3BA 1X8JA 4DEXA 1G51A 2CFMA 3J81j 5CYPA 2WM9B 3LNCA 4ZIRA 1IY0A 1E1QA 3RS2A 2BDTA 1Y3AA 3LBIA 5IRCD 4US2R 2G77B 2WSSA 1SVMA 3CPFA 721PA 5DI9A 4B71A 4GL2A 4JI0Q 3U4QA 1C9OA 1YZLA 4ZPXA 1Y63A 4OHXA 3GLGE 4X8LA 4B3RQ 1VYTA 1RL2A 2WJGA 2H57A 5FTJA 4ACBA 3VR3A 1W0KD 2P2LA 5AR1A 1VMAA 2QU8A 4XD7A 4E5UA 3CW2C 1VQLA 1HT1E 3LVRE 4NE2A 3EXAA 3OEHD 1JJCB 2WWGA 2ZITA 3KOJA 3QG5A 5CIWA 5L8VA 4C2TA 3AQQA 3RS3A 1N6LA 3CZQA 2J1LA 3TW4A 4IPCA 4UP9A 5K36H 2WKRA 1HPCA 4LBVA 4IVPA 1GNRA 2P5SA 4B3FX 2DNCA 1MABA 3OAAA 1JXOA 2EFHB 3PO3H 2LKDA 1DELA 4BUJA 3AEZA 3B9QA 4DR4Q 1P5ZB 1XX6A 2ZUCA 5L3SA 4TLEA 3FFAA 2F1IA 5JEEA 1VQ8A 3DOEA 2Q3FA 5CYOA 2O8DB 4IEEA 3U6BA 1GKIA 2QTFA 5EE5B 5IYDG 2W2XA 1QHSA 4A36A 2N42A 5IF9A 4X64L 3PO2H 3QF4A 4BZPA 1IBKL 4BECA 4YXWA 2O8EA 3K9NA 1KC8C 3EC2A 4QNRA 4FDBA 4Z8YA 3UMFA 1T4GA 1XMQL 1BYIA 1W3SA 1S9DA 1IYVA 1US8B 3P1JA 1Z8FA 5AJWA 1E2HA 1XCMA 4PTLA 5FPKA 3QBTA 3LA6A 1XJQA 2I3BA 3R20A 2HT1A 5BWMA 4M1TA 1I2DA 2ZAOA 2BJVA 3BU2A 2VYFA 2DCUA 5DGXA 3W3ZB 3RNLA 3IIKA 1XNJA 3HJNA 3AP3A 1KHTA 2J7KA 3EA5A 2W6ID 4LHVA 4P3YA 4BFXA 3AVWA 3CF6R 2DFLA 1R0XA 3W6NA 1LB1B 2Q3HA 4LNQA 2D4HA 2KHIA 2C8VA 3QKSB 3HKZG 3T1HQ 4JJZA 2R44A 5KPJA 3CPJB 4HB4A 3A1WA 1XMOQ 4B3CA 2K52A 1ZBDA 2OT3B 3ZDQA 1XD2A 4TVAB 1P2VA 3RRZA 4EFNA 2ZU6A 1UEBA 1MO4A 2W83A 4RZ2A 1PH4A 3E9HA 5HZKA 3ASYA 4DUGA 4FMDB 3U7GA 1A7JA 2XGJA 1YZUA 2GJ8A 2X8AA 1PHJA 4EPTA 1AKYA 1CJKC 1E1TA 2W2VA 5IY0A 3ZS9A 4BY7G 3DO6A 3UE0A 5AUQA 3KF6B 2GILA 1BMFA 3IO3A 5AUNB 2RF4A 4JI7L 2CNWA 3C15C 5J4VA 2AR7A 2OFOA 1TWCH 5LPNA 1CS4C 1SXJA 5A0FA 4PPFA 4X62L 3SBDA 3PF4A 1KO4A 4F93B 2RH5A 1N33L 2ZREA 4DDWA 2GXUA 3T34A 3WYFA 5G40A 2QSYA 3A7LA 4OONA 3CC2A 3J7A5 1NLFA 1XD2B 1OXTA 2AMCB 4A76A 2D3WA 1COWA 4HLCA 3BDOA 3AKDA 1EFWA 2KBNA 2ODEA 2YTXA 2XZPA 2ZM6Q 1IW7D 1O7IA 2VRWA 4DT1B 5EXXA 4JYAQ 3DKPA 1SZPA 2B63G 1Y1VH 1HNXL 1JAIA 3EZ2A 3VNUA 1J2JA 3TRFA 3K0CA 3VR2A 2K7VA 3NC1C 5AUOB 2O5VA 1AKEA 5C0XI 2FEOA 1P73A 4IOJA 4BA2I 1N5KA 3MJRA 5TARA 4AC9A 5KYKA 4P31A 1W4CA 4JYBA 4KSCA 4OHYA 3I72A 3W1BA 1KL9A 2CK3A 3B1YA 4O3MA 2IHBA 2IEYA 3J81k 4GDFA 2D5DA 4R2HA 2KBFA 1DADA 4A82A 1EUJA 4KHPL 3AUXA 4NXML 4GKKL 1QZHA 1JXMA 4X65Q 1NKSA 1DPFA 2EFDB 1X55A 2FFBA 1DAKA 1F6BA 1XTJA 4DLZA 2RAPA 1TQ2A 4QHYA 3SQWA 2PI2A 2VP2A 3EZ7A 3LV8A 2BKUA 3CPHA 2PLFA 5KPDA 4W9MC 1QZGA 2BM0A 4JV5Q 1N0VC 2JGNA 1GD7A 2OCEA 2WSSD 3D4RA 1HUQA 5KNCA 1XPUA 4TL8A 4TWZA 1X56A 4LF5L 2EWWA 4PHHA 2ZM5A 2ZYTX 1ASZA 4MGZR 4YMVA 3THWB 1NTGA 4JBKA 1OTCA 1SN8A 3MXUA 3P4XA 2QUZA 3U4VA 3PIRA 1KZ7B 1HNWQ 2J0SA 3AVTA 4Y7NH 1X8LA 1QZXA 1NJIC 4OO1H 1FNNA 2OM2A 2FZLA 2N78A 1RFLA 1UDWA 4DLWA 5C4GB 5M3MH 3DOFA 4DLSA 5FBVB 5M5WH 221PA 4JLJA 2C77A 1VQEA 3KB1A 3CCJA 1GM5A 1DAIA 1ZU5A 1UE1A 1ASYA 3GLFA 4DR1Q 2R93G 3GLFB 4R4OA 1JQLB 1QUQA 4LHYA 1XBTA 4LI0A 1L2FA 2ZRLA 3KZ1E 1KQSA 3NBHB 4A3KH 3UKDA 4LDJA 2NMVA 3THYB 3KKPA 2HJVA 3BOSA 3O8BA 3DXJC 5CJ2A 4DCVA 3HOYG 5JFGA 1NF3A 2A68D 4AQYL 4D25A 5JWRA 3NTUA 3K0AB 4F91B 1IM2A 2AKYA 3UDGA 2ZYUX 4V0KA 3SOPA 2Z6KA 4N1AA 4V0NA 4L9SA 5B2ZA 1NBMA 1H9JA 2HLDD 2A19A 5JHHB 5JLJA 4GNXA 1QHXA 2XTMA 3TREA 2A69C 1DAFA 4ZO4A 2O8FA 1N0UA 1TMKA 4X8HA 4IPGA 1BBWA 3AH8A 2UXDQ 4KVGA 5DHFA 1NMFA 1AK2A 2L5TA 1J99A 1Z2AA 2GTPA 3KX2A 1I50H 4MYCA 3A36A 4PHTA 4TYQA 1EYGA 4Q1EA 4TT3D 5EXTA 1KIXA 2MO0A 2JK8A 4EQ5A 1H95A 1M8PA 2QM7A 4TQAA 4JG2A 4YCWA 4PO9A 4DB4A 3R9IA 2QG6A 4D0GA 3FHWA 4R4TA 1IXRA 4GNXC 1LY1A 3H0GG 5JEAJ 1JALA 2DN8A 4FCVA 4PANA 4RZ3A 1JEDA 3LO5A 4NCNA 4CVNA 2V4DA 4QJFA 2L0XA 3KTAB 2NOAA 1KNXA 4A3CH 4LGMA 1S9HA 2GAOA 1GDDA 4M1OA 3QVUA 4JKIA 4AYBG 4JI3L 4M22A 4G5RA 4R9UC 5DN6D 4R71A 1W4AA 2EQBA 1ZYUA 1JMCA 2F9LA 4P33A 4FCTA 2NPFA 4AYTA 4DR6Q 1I4TD 1YKSA 4KHZA 2ORWA 4V0ME 1E2JA 3CRVA 3MAAC 4DLVA 2XB2A 1VG0B 3RSOA 3G48A 1CTQA 1DG1G 2NN6I 3LLMA 4LF4L 1M7GA 4JK1C 1SXJE 4NU0A 4JLVA 1II9A 3I8SA 1NNEA 1SQ5A 4F92B 4AI6A 4DV7Q 1YR6A 2QF7A 1NVVR 3FVQA 2OSBA 2REBA 4DR7Q 2RGAA 1I5FA 3S2HH 3HOZG 3FMPB 4BLTA 3MMPA 5DHAA 2Z83A 4R4IA 4DV1L 3KJHA 2Q2UA 1AE2A 2F7SA 3PITA 4O2RA 3SBEA 3PEWA 1SXJC 4I81A 2C04A 2XTZA 1PH7A 4LJ6A 4UNQA 1YE8A 5AJVB 4NKRA 2QQ0A 2B8GA 1W5TA 1TWGH 2F9MA 3C7KA 4JSYA 4LSGA 3CBQA 4A3FG 4RD1A 2VF7A 2IA5A 1SKYE 4DJTA 2CWAA 2HCBA 5IWAL 2B3GA 4Q48A 1P2SA 2NO6A 3QUSA 1W44A 4DIDA 2IXEA 2D0PA 3I55A 2GKSA 4UXIA 1Z6GA 5FI0B 4GP6A 2AUKA 1AIPA 2OBNA 4YMSA 2WTUA 3IBYA 2CMKA 2IT1A 3UWOA 3CMEA 4A8JB 2ZI6A 3OEHA 5FPYA 3TQFA 4MRRA 2EVWX 4I7ZC 2K5NA 1D2NA 2R7ZG 1Q21A 4EUNA 4DLTA 2FFHA 4URZR 2R92G 2IYRA 3T51B 4QL5A 2JEBI 3PIPA 2XAUA 4I4LA 2A30A 3D3QA 1IN8A 2J0UB 4Z51A 5C44G 3QPVA 5J4KA 2I5LX 5LDDC 4G0NA 3DHWC 2ZI3A 5FI1B 4JI6L 1WI5A 2VHJA 1J6QA 4BWYA 1Z47A 4Q5IA 4HJ5A 1S4QA 4AURA 2ZUBA 3NBFA 3U50C 4AWXA 821PA 4AH6A 3KQNA 4X64Q 3HWSA 5LMNW 1W2GA 3B6EA 3CZPA 1GG2A 2ZT9C 3J7ZC 4IDPA 4B47A 2ZUDA 3EPJA 4BA1I 1U8ZA 5C4MA 4OO1G 1O7LA 1FNMA 3W9YA 2IK8A 3G6EA 1XMQQ 2JA6G 2V6IA 1EFRD 4DV4L 4FCWA 3B82A 2QQEA 3THWA 5F3WB 5FL7A 3EPKA 2GVDC 1R5NA 2ZSEA 4JLMA 2HQLA 2VBCA 1G8FA 3QOFA 2B8WA 5C2JB 1HZCA 5SZIA 1HZAA 2BV3A 3CR7A 3OESA 1G6HA 4JOIA 5F98A 4Q9HA 1UBEA 4RD0A 1VHTA 4IPHA 3H3VI 5KO2A 1P6XA 5C0XG 2WPDA 1G5TA 4MZ9A 5GAEC 2UUBQ 4E03A 3O8RA 2G1KA 2FPKA 3DMNA 1U8YA 3A4MA 1E0AA 3AVVA 4M9SA 2WVJA 4HAUA 4P71A 4I99A 5J5CA 5LB4A 2ZM6L 1COWD 2D7DA 4B3SL 1K3RA 4F4IA 4C3ZA 4ZDIA 4IPDA 3KQLA 1YR8A 2XNSA 1LUZA 3KLWA 5JEAG 2IYSA 1R5OA 1Y1WH 4FINA 1HT2E 4LY6A 5G53C 1Z22A 1LFDB 1KKMA 4Q1FA 3SI7A 1H8ED 1EIYB 4QGAA 1Z3IX 1IJFA 3AFQA 3U3RA 3T12A 1YZNA 3BC1A 3LW7A 4FMCB 4H1VA 1G9XA 3VA7A 1M7HA 4H13C 4V02A 4Q66C 1X3FA 2QRNA 4H1UA 1OH7A 4IQZA 2NO1A 2R6CA 2VA8A 5L3QA 1IYUA 2VW9A 4EKDA 4YWKA 4A3DH 4D6PA 2MNAA 4A3CG 3FPPA 1P9WA 2C9YA 3PENA 4QHSA 2K5HA 1G64A 3OFNA 1U9IA 2QEQA 3NXSA 1FOEB 2F1HA 3SFVA 3UE1A 2IYTA 2CW0C 2XNDA 1VCNA 4XVQA 4BLSA 3IHWA 3SU8A 4TLCA 2V1UA 5IT5A 2ZTEA 4OWXB 3I5YA 2A6HD 4JI5L 2J0UA 4KFUA 2NO9A 3I3SR 4Q7KA 4DV5Q 1F2UB 3CRQA 2YWGA 4Q4LA 1MO3A 3KJEA 3RDPA 3CRW1 3GJ0A 4CW7A 4ZDJA 2D2FA 3U7FB 4QOSA 1E1RA 5AJ3L 5IYCH 3KJPA 4C30A 2V4ZA 1E2DA 2RHQB 2CCJA 1Q82C 3AF0A 4ASUA 3U5ZB 1D8TA 3EAQA 2OCBA 4ZI2A 4ZCLA 1A82A 3NWJA 1SE8A 1O87A 2ZE6A 1IAQA 2ATWA 3FFBA 4PSVA 4CZ2A 2N46A 4ABYA 4DAYB 1E9DA 2WIAA 2CLSA 3BBPA 3OF5A 3M85A 1U99A 3B1XA 3WNBA 3GLFE 4A3JG 2G0NA 3B13B 4MGYR 3LWUA 3NENA 3ERSX 1U2RA 4YMTA 4JT4A 1E0KA 4BQSA 3KLRA 2R93H 2JLRA 2QM8A 4MUBA 1B0UA 1E79D 1OYWA 4WJ4A 3A58B 4A15A 3LXRA 1TPZA 1TNDA 1MABB 2XB4A 1X54A 3RRNA 3TLXA 2FFQA 1TWAH 1OB2A 5HTKA 2IS6A 2J5XA 2XOKA 3CLVA 4NPSA 2KI5A 4EJSB 4DNTB 1Z28A 3BXZA 2D0OA 1KGDA 1XJCA 1NKTA 4Z1MA 2QE7D 3LQQA 2E2IH 2CBZA 4LYFA 4TTPA 2DFTA 4DR5Q 2KCCA 1AJEA 3S2DH 2VQSA 4LRWA 4OJKA 2BOVA 1OHHA 4L4UA 4P4UA 3WBKA 3PCOB 1KD1C 1XNRL 3S16H 1E69A 4LW1A 2FGKA 2CKZB 2GRJA 3LY5A 3MD0A 4BY1H 3VFDA 1VG8A 2WPDD 3HOUG 2K5UA 3GJ3A 3NDPA 4PC3A 4ERNA 2R7ZH 3OW2A 1HEIA 2DFKB 2HV8A 5JI2E 3GLIB 5IHPA 4YWLA 2VO1A 3RHFA 1H9SB 2ZETA 3WRXC 4JS0A 3D7MA 3EG5A 1GRQA 2I1VB 5JWOA 3PUVA 2R6GA 3PUWA 1YZ6A 2F1RA 5K8TA 4NB3A 2JE6I 1C0AA 1P3JA 4KMUC 4FMCF 3THOA 3UPUA 4QG7A 4AQYQ 2N3SA 3KFXA 1X3SA 3DLLA 1ZM9A 1CKMA 4HUTA 4IJHA 2PZGA 2ZJ8A 3H94A 1SXJB 4LOAA 3H86A 3ZZUA 3GTPH 1FJGL 2WAQG 5C1BA 1TTTA 3EZ9A 4Q4HB 5EE3A 3NHBA 5FR2A 3IILA 3AVQA 4M0LA 4CF7A 1OYYA 2QAGB 3J80c 3CMAA 2VL6A 4BFTA 3E2IA 4JT2A 1T5EA 2VF8A 3AB9A 3Q5EA 5ELOA 1A4RA 3TS2A 3IGFA 4Z54A 2H92A 4GZLA 1KO8A 1MJEA 1IOZA 3K9GA 4JLNA 1NI3A 4C0LA 1SMXA 2QZ4A 4LJ8A 3G5UA 1YJ9A 4HB2A 1KY2A 1WYDA 1D2EA 2CJWB 2CJWA 2GF0A 3ULPA 3EIHA 3CXCA 1K5DA 2NVYH 2YU9H 1U81A 2PMDA 3CW2A 4UQOA 3GEEA 2GVZC 2RGBA 4B35A 3V9PA 2FSHA 4WIAA 2H16A 1KSJA 3HOXG 1HE8B 1Y1VG 3K09A 4DR6L 3LGJA 1N6HA 2PPBC 3LH5A 4FI3C 2A6EC 4G7OC 2WJYA 3RR5A 2XSZA 5JMTA 2FGJA 3OIUA 2P5TB 3RYTC 2FE4A 3WYGA 2IYUA 4QQBX 1SKQA 4KODA 4DHEA 2CE7A 2EYUA 5HGQA 3ZQJA 4DV7L 2EW1A 3T1YL 4NXMQ 2ZI7A 3H1TA 3EPHA 1DARA 4LF8L 1RYHA 4MKGA 4TMTA 2WAXA 2GA8A 4DK3C 1MRSA 3CCUA 2QGZA 4UXJA 3WMEA 5C4XG 3TUZC 2GBLA 4I1UA 2PZEA 2ECKA 4JI2Q 2JA7G 1ZM2A 2VHUA 2ZRBA 2R8RA 3OEED 4YMWA 4YQFA 4C7OA 2QPOA 2NG1A 4U00A 5FBWB 1Z6HA 3QJYA 4RG1A 4LUVA 4J15A 3HOWH 1FMJA 5IWAQ 3IUYA 4EPRA 4Q4JA 1JECA 1D2MA 3CAMA 5EZ5A 3X1YA 1U98A 2ONJA 3SNHA 1N0WA 2PCLA 1E2PA 2QGNA 3AGQA 4O2LA 4ZDKA 1NRJB 4A3IH 1AS2A 1L8QA 1KO7A 4A93G 1F2TA 1NBME 1XXHB 2QORA 1K6MA 2NZJA 3N5CA 4A3IG 1IZ6A 5IYCG 1K8GA 1WP9A 1G17A 3KYHC 4A3JH 5TB5A 4NONA 1VQIA 4R1JA 1VQ4A 1P2TA 1WCMG 1AQYA 1UPTA 1YZGA 4OL0A 5CM9C 3A0JA 5FFMA 3LAWA 1Q86C 4ALPA 1V43A 3G4SA 4F7WA 3RZOH 3F2CA 4LWZA 2ZSBA 3NC0C 3ADDA 1VQNA 1HA3A 4D4MA 1T0HB 3EW9A 1K73C 1P60A 3RRYA 3X1WA 4NXNL 4WAUA 4DSNA 1AZTA 1VCMA 3ICQB 1E32A 2NO0A 2QBYB 4JBWA 3WNDA 2Q2IA 4D80A 1LM0A 5F2EA 4K0KQ 3VDYA 4LF7Q 4ZV4A 1SLJA 2B7CA 3PR1A 1JJ7A 3FHTA 4PR0A 5LD2C 4B3ML 3AF1A 5K36G 2IHFA 2A6HC 4URWR 4LV5B 3UG6A 4XD7D 4Q4AB 2E76C 2ZTDA 5IYDH 1VHLA 5KNBA 1IN6A 1I2MA 4LJ7A 4FMBB 3MWKA 1HR0W 4ME3A 1WOCA 1N32L 1NY5A 2KBEA 1IYJB 3O47A 4LYAA 4QL3A 4BPBA 2HF8A 5TVKA 5GVSA 5CK4A 1NVVQ 1L2TA 5TXGA 4LUCA 3GQBA 2IF2A 2BBOA 3EIQA 3CKLA 1X65A 4NYMR 1BH2A 1WMSA 4KFRA 4TKOB 2UVQA 3A8JE 3L2PA 4JLAA 3TSOA 4ZCIA 1LYLA 2KE5A 2OUKA 5DI3B 3K0CC 1XPOA 3DMDA 4GZYC 3PFIA 5C3EH 2WB1G 1Q90A 4N3NA 2LXJA 5FPSA 4IOLA 4RD2A 4GT1A 4JI3Q 1YJ5A 4JLBA 4KBFA 1N6IA 4CRWB 1YEZA 5FH9A 5FBLB 3LBHA 5M5YH 3BFVA 4TSFD 5A5GA 4B32A 1Z0IA 2PJRA 1S8FA 4BFUA 1E24A 1CSQA 4GMDA 2VH5R 4A6XA 2YKGA 1BBUA 2JA6H 4JZKA 5IDVA 4FW9A 5KSZA 2O8EB 3MWJA 2WJHA 2ODBA 1Z06A 3WHLA 4LPSA 1SKYB 1P4SA 2CQOA 1QHNA 4BFWA 2ZQ5A 2ERYA 4KO8A 4L9WA 4RKFA 1OW3B 2DWOA 2VP0A 4W5WA 4GN3B 5EUQB 2YHSA 4Q21A 1VKJA 5TY0A 4DCUA 2WV9A 2DR3A 2C03A 2NGRA 3ETLA 3N70A 4HLUA 1P72A 5B64A 3I4OA 2W58A 3OEEA 2O8DA 2R6AA 2ZIAA 3UWKA 4AG5A 4OHWA 2WSMA 4ESHA 4CEJB 4KKUA 1HTWA 1GKHA 4TMVA 3R7WA 2EIFA 1Z07A 3BJIC 2H18A 4OWWB 1Y8OB 2CL0X 3ECCA 2F52A 2QGQA 2QRZA 4DV6L 1B8AA 3U3OA 4HB0A 3LNNA 2BWJA 3VHLB 2ZR7A 1K5GA 3T15A 4MGKR 2PBRA 3PUXA 2XZLA 5GADC 1QHIA 1HQCA 2JA9A 1IBLL 4ASUD 2NVXH 4EFMA 5K8IA 3I1FA 4KCGA 3ICEA 2MSCB 3SC3A 3EIVA 1T91A 2WMOB 1XNQQ 5JI3E 1GL6A 4R7ZA 1GIAA 2Q3MA 1XP8A 2NN6G 4DAMA 1MKYA 1G20E 3AFPA 5EAYA 1PH8A 1QHHA 1SGWA 2GK7A 1ZNZA 1N25A 2J7PA 2UZIR 4A3EG 3DKVA 3P32A 1VIAA 3I4MG 3DL0A 5EE0A 5B58C 4R2IA 2Q9BA 4D26A 4A3EH 1ZP6A 3CPEA 2JCSA 1ZNWA 3IO5A 1E2ZA 1KK1A 4GOJA 4DCSA 4GKJL 2NN6H 4AIMA 2GN5A 2JJQA 1ZD8A 3K8YA 1R6BX 3CO5A 2Z6KC 3H15A 4LF6L 3QY0A 4MKHA 4YDHB 1GUNA 1T5LA 3SJZA 4BLPA 4NZYA 1FYCA 2IYVA 1Q1ZA 3RZDH 1CJVC 1KSGA 4B43A 1HQMC 1ZW6A 3PXGA 3TVDA 1I6VC 4KI0A 1K83H 1HZBA 3CC7A 3QI2A 1L4UA 2FSFA 2P3SA 3FDIA 3K09C 1CULC 3PO2G 2OTLA 3IPYA 1FTNA 3SJAA 4ZI3A 3SR0A 4F4JA 1VQCA 2A78A 5HE9A 4Q47A 1DS6A 1BOFA 4BBSG 2GK6A 4LF5Q 4DR3Q 4B2PA 4LJYA 1WF3A 1P9RA 3PQCA 2AN9A 3V4RA 2OV2A 1E2MA 1UBFA 1MO6A 4MQBA 5DLQE 1EFRA 4Q19A 4Q4HA 1HNZQ 2IXGA 2QI9C 2CDNA 4PZYA 2W0SA 2O8BB 2F1MA 4M1MA 2ZPTX 5AJXA 2H8KA 1II8B 1E2EA 4CEIA 3BB3A 5AJYA 4US0R 2JJ2D 1SVOA 2WJJA 3FKSA 1NN1A 1G4AE 1GRRA 1E2QA 2PEYA 2BBWA 4ACAA 2BH8A 1JB1A 1J5EQ 2WAQE 1B70B 5FJ8G 3GEHA 4C3JH 2JA1A 4PZ7A 3FWYA 3L8ZA 1R0YA 2BMFA 1ZINA 2AKAB 3LRPA 4FXPA 1CF4A 1UM8A 4QRHA 3RWOA 2F4VQ 1Q0UA 5IK2D 3R9WA 2Q0HA 4YHHQ 2LWIA 3P26A 1B9NA 2IYQA 3RN2A 2JJ1A 5G41A 3TIFA 1YRAA 2GXQA 4I1OA 4JBJA 3FKIG 4M8NE 3K70C 5FLMH 3K80C 1NN5A 4GI7A 1YR9A 4LHXA 3VTKA 1CR4A 1PUIA 1W2BA 4PZ8A 4LFAQ 1XTIA 4EPVA 5CB6A 2MSEB 5E7NA 1XMSA 4DC9A 1A63A 4ZKDA 5KTYA 1M1KC 2AD1A 3OAAD 3FKSD 1TUEA 2JA5H 4N0EA 4JVSB 1WE2A 2Z5FA 1CXZA 3MFYA 2A8VA 1GWNA 2BMDA 4A8JC 4TMWA 2HF9A 1KI4A 3WRYC 2OAP1 1QDEA 5P21A 1NMZA 2OG2A 1FR3A 4JKYA 3M4YA 1W0KA 2IC5A 2PJZA 2ZTSA 1XEWY 4C0AC 1DAMA 3VR1A 4IFBA 4G5OA 2IHEA 2CL6X 2WHXA 4TTRA 4LHWA 1O78A 2WWYA 3SN6A 4L5RC 1ZKOA 4MRPA 3RS4A 2CHVA 4L15A 2E1RA 1YHQA 4BFSA 3NE5B 2VEDA 2XSZD 3FTQA 2XJ9A 3K0FA 3GMTA 4OI1A 2ZYVX 4QGGA 4P0TA 3U44A 4CEHB 1VQ6A 5M3MG 4GBMA 5IT9c 2FA9A 2XX3A 4B6EA 1F48A 1Q3HA 1JR3A 2QBYA 3M7NA 1JQJC 4JLKA 5HPYB 5LB2A 1JNYA 1G7CA 4KKSA 3S15H 1MOZA 1WRBA 3BH6A 1LTQA 3OFND 5D3MB 3RSLA 1HR0Q 3RS0A 4BRUA 1KO5A 4DRZA 4KV9A 5TMPA 2GZDA 3SYKA 1LVGA 5KUTA 3HPRA 1PVOA 3PV0A 1CKNA 3VR5A 2OO7A 4US1R 3J80i 1VQHA 3BB1A 4W5JA 4HATA 2F1JA 2OE2A 4JVNA 2AUJD 3TNFA 5L3VA 1CRQA 4DV2Q 5GJBA 3GPLA 4UY8C 1E2IA 2VHTA 3UATA 4GS3A 3RN5A 3LQRA 5GJWC 1ZVQA 4C0HA 1H8EA 4FIDA 4S35A 2DBYA 4IDQA 2CE2X 5DYGA 4LFBQ 2WBLC 3TAUA 3TE6A 4A2PA 3E1SA 4HIDA 4B3TL 2IWHA 1KTVA 2OFWA 1T3SA 4ARZB 3VKWA 3BAFA 2ZJRA 1OH5A 2UUAL 1AGRA 3BS4A 1YVCA 2VQFL 3QIAA 2L15A 3KF8B 1N36Q 3BFKA 3F3YA 4OBEA 2I5MX 4BGDA 2OAQ1 4HJ9A 1SVIA 4DDUA 3WBJA 3PEVA 4B44A 4Q9LA 3U9SA 1Z08A 2GCOA 3H0GH 2BHRA 3KTAA 3ZIAA 3TSWA 4D4JA 4Q7MB 1ODFA 5DI3A 4AK9A 1E1RD 4PX9A 1QHGA 4IJLA 4P4SA 1W4RA 4A3LH 1CTMA 4XH9B 5KDDA 2JLUA 3U61B 2UZ3A 4ITRC 3ULJA 1IQPA 2F43A 1K8AC 4RFSA 3CRRA 3OOCA 3TR5A 3CD6A 4ZDWA 2IWRA 1TL7C 3AKCA 4Q18A 2YOFA 5GQOA 3RLFA 3AVPA 4KLNA 4A0FA 4M1SA 3M4PA 2KCTA 4XIGS 2J59A 3CF5A 3W6PA 2F6RA 3NDBB 2PCFB 3KL4A 3MG9A 1CUKA 2YNMA 4JI4L 1S3GA 3NBZC 2PMZE 2QEXA 1KKLA 3REGA 3Q8DA 4IO9A 1SVKA 2RGGA 4A0HA 3EWSA 4QM6A 2ZS9A 3RS7A 2A3RA 2FEMA 1Z6AA 4LHZA 1FQKA 4JCVE 1T8UA 2JJ8A 4GRAA 1NVWQ 5AUPB 3K70D 3SGIA 3A5UA 3B78A 3VAAA 4AKIA 2LKCA 1GJXA 3A8IE 2R7DA 4HR7B 1NY6A 4ILEA 5DLQC 4DSTA 2XOKD 1BS1A 3W5IA 4TMZA 4JI0L 2VP4A 5L3QB 3RAPR 1RYFA 4TSFA 4H9GA 4MGIR 3QPUA 3THXB 5DISB 1SRUA 4PQRA 3LVQE 5JEAH 2OLKA 4DSOA 4LJ5A 1G8YA 2Q9CA 1A6XA 4TYYA 1KZGB 5FUXA 2RGCA 1M34E 4NPHA 1CJTC 4P75A 2ERXA 2NVTH 2BVNA 3SZRA 1B9MA 1MH1A 2A1AA 2PQAA 2ZSFA 3QKRA 4GPTA 1GP2A 2GJKA 4M4SA 3GJ4A 1GFIA 1XU4A 3I4LA 1RKBA 5FLXc 1H9KA 3C4JA 5BYKA 3CRMA 1GNPA 4YLGA 1A1VA 3I4MH 1IONA 2CHGA 2QMEA 3CR8A 3JAMi 1HQYE 3CC4A 2ZANA 2FXQA 4HAWA 1JB7A 1FP7A 2N49A 3QEOA 3QXSA 3ZVRA 1YRBA 4EPYA 3ZIAD 1GILA 1G3RA 5C44H 1DOAA 2CLCX 1DXMA 2JIZA 4NXNQ 3CH5A 1BDOA 4DNRB 5FOUA 3LLUA 1UKVY 3KUDA 4FWIB 4HJ7A 3ZD6A 4OI4A 1ONBA 1IXZA 4DV0Q 2V1CC 3R9XA 2BM1A 1JJVA 1C7YA 1IHUA 2W0MA 2VQEQ 1PLJA 1SXJD 4X6AH 1L1OA 1XNQL 1E2VA 3QQ5A 5HCIA 4A6PA 4ESVA 2F55A 3SDZA 1UKZA 3B1VA 3D8BA 2ASEA 1K8RA 1YNXA 1N34Q 2EJMA 1MT0A 4WW0A 3CUEF 3K0XA 2AKWB 1R0WA 3I73A 2GEUA 3KFUA 3EZFA 2FMXA 3M1IA 3B1ZA 1U5KA 2R92H 1M1YE 3S1QH 5ANRB 3AVYA 2EU8A 4OQNA 1LABA 1UDXA 2IBMA 2OXCA 4G01B 4PAQA 2E75C 2IYXA 1RJ9A 3E9IA 1VCOA 4PSKA 4DLXA 1WJJA 5LMUL 5JRJA 4Y52H 1Y14B 2DWPA 4IDHA 521PA 4MYHA 1JR3D 2DUDA 2WAYA 4EIWA 4KAXA 3EX7C 3KXKA 3QENA 5JCPA 3Q8XB 1EFUA 2Z4RA 1PYBA 4V0OA 5CDFE 2LMCB 2IS4A 4CYMA 4NYJQ 2VS1A 4B3MQ 4V03A 3ZS8A 1OIVA 4V0MA 4AYBE 2BBSA 4TQ9A 5EE1A 1XWIA 4L8GA 3KQKA 1AH9A 1HJPA 3NH6A 1KSFX 1EX7A 2FU5C 2F4VL 2IX1A 3CH4B 2H5EA 3UMSA 1NG1A 2V1XA 1S2MA 3T35A 4JJKA 3F2BA 3WYAA 3GTOH 1GKYA 1XMJA 3RANA 3ZZTA 1IN4A 4UNSA 4EQ6A 1OFTA 1Q57A 4GNXB 3UDIA 4GLAC 4IRUB 4WZBE 5LD2B 4YY3L 3PSIA 2JEAI 3GCGA 4IVRA 4B2LA 2IS1A 1WB9A 1E9AA 1QBKC 3QE0A 5FL7D 2HT6A 5EE9A 3L43A 2ZJPA 3FB4A 2A5DA 4Q1DA 1YZTA 3IKJA 3TQYA 2ZVPX 3IIMA 2PCJA 3I62A 3BZKA 3CCQA 2FV8A 1GO3E 2QAJA 2XEXA 2YINC 5CJPA 3OHMA 4DIEA 5JEDA 4AKHA 4G5GA 4YCVA 1QF9A 3K0EA 3BERA 3Q3JB 3PUZA 2AFHE 3RRMA 1EQRA 1VS0A 4ZIRB 5JHGB 1UE5A 4DK6C 3JZAA 2EWVA 4RVCA 2UXCL 2AWNA 1XJVA 1J8YF 3C14C 4Q9KA 3QPWA 4C2MH 1E9RA 3CIOA 3KFVA 2O8CA 2YTVA 2UU9L 2VUMG 1CI3M 2QAGA 1HCZA 4NHOA 4HB3A 4JL6A 2KJQA 4M53A 3I4NH 1XXHE 2B92A 1XEWX 2XXAA 5H1SE 4HSEA 1AE3A 4TZ6A 4WZAE 4CIDA 1MJCA 3B6YA 4DNIA 3FMOB 1P7CA 4GFDA 4QBFA 3NBXX 3QXXA 1SFOH 2ZJQA 1IL2A 4I1VA 5CITA 3A8KE 3OPOA 5LMNQ 2MMCA 3RC3A 1JPNA 3A1TA 4TMKA 1E2WA 3M9BA 3U3MA 3GFOA 2FH5B 2V7QD 2ZRGA 3EIEA 5IE8A 2WWWA 3NELA 2IUTA 2A9KA 4WZ6A 1DCZA 3FP9A 1R9TH 1OE0A 1K8OA 1DTSA 4KN4C 3UG7A 3GTGH 3ZVMA 4WVFA 1II8A 3QVVA 3EA0A 4XWAA 5DH9A 5FUYA 3GLIA 4URUR 1KDRA 5DIFA 2CXXA 3GLIE 1Q8KA 4BLOA 5HKKA 3BH0A 1A2BA 1ZUNB 3GJXC 4UPAA 1H8HA 2ZI5A 2C5LA 3K1JA 4GNKA 2BE5C 1ZRHA 1N6NA 4IVQA 1CJMA 3E0EA 4L16A 1JR6A 2Q9AA 1FL9A 1G3QA 2R2AA 4PZ6A 1CEEA 1XPRA 2ZRIA 4L5QA 2ZRCA 4Q03A 4DZZA 3K9LA 3CNNA 3NIBA 3A74A 3LW8A 4BXXH 1E0SA 2GJ9A 1HYQA 2G6BA 3HOVG 3T1YQ 3NKVA 4DDTA 4PXAA 1Q7YC 2VHQA 3WNCA 3J81i 3KUCA 3QXJA 4JBMA 2VP6A 4M1WA 2IEZA 4DR4L 3VU9A 4DSUA 1Z9FA 1M90C 2BBTA 4LFCL 1Q20A 3H4MA 4DB2A 1MKHA 5BXQC 4DK1A 3PEUA 3OW7A 1U0JA 1ZC4A 2HIVA 1HY3A 4NTZA 5ELNA 5GAHC 1PYSB 2ANCA 3ZGXA 4BZXA 5HZHA 4DR2Q 5EP1A 4ON9A 5A4JA 1VQ9A 1G3IA 5E4FA 2YJTD 2FOLA 4LJ4A 1S3OA 3FHCB 2R7FA 1Q1QA 1F60A 4PZLA 1FFHA 4HI0E 3TH5A 4MDFA 2G3YA 4S2EA 3NHAA 3L8YA 3Q72A 4LF4Q 4GOXA 4HLUC 4IKEA 1Z0AA 3DM5A 2Y8EA 3JC66 4NH0A 3HOZH 1DVRA 1AN0A 4DR7L 1JT8A 1JPJA 6Q21A 4OI0A 1EWHA 4GKKQ 1KMHA 1OHHD 1YZQA 2NIPA 1AS3A 1NE3A 4Q9IA 3SJBA 1Z6TA 1GUTA 1S72A 4RD6A 2GCNA 1KI2A 4POAA 1EWQA 5IYBG 4EX5A 4DV3L 2J46A 4LBWA 3R7WB 1E2LA 1G5RA 2IW3A 2V54A 4HYYA 1XZPA 3BE4A 2W6IA 2YC4C 2O0HA 3T1HL 1GHKA 3I56A 3S1MH 1S1MA 2FF7A 4QHTA 4QBGB 1FGUA 2RB4A 1RJ9B 4W5HA 3WXMA 3IPXA 1UBGA 1ETUA 1TUIA 3TKLA 3NBYC 3GD7A 1OXXK 5JECA 2K33A 2B63H 1DAHA 2EFCB 5TDHA 1OJLA 2V3CC 3AM1A 4YHHL 1ESMA 5DN6A 3U58A 4LZZA 1NG9A 5AK0A 3QEJA 3KDFA 2BKEA 4P74A 2VLIA 5J4YA 4UXHA 3HKZE 4X66Q 3AB3A 1RRPA 4XWOA 2JJ1D 1FW6A 1LW7A 4MKFA 4A92A 2JLSA 3SHFA 2H17A 3F8TA 3QG1A 3HOUH 5J40A 5J4HA 1NJFA 3A37A 3AVOA 4DV1Q 1SROA 1ZC3A 4DVGA 4L5SA 2F3RA 3PCRB 4B2IA 2ANBA 2OESA 2GWHA 4A3LG 1RW4A 5FPHA 3WMFA 3X1DA 4AYXA 4MH0R 1AS0A 2CEAA 2PLRA 3RWMB 4H02A 1EXMA 2NPIA 3FMIA 1PH9A 2ES2A 1YIJA 4C7OB 4UP8A 1NP6A 1NN3A 2MFIA 4A4IA 4WOPA 4IOMA 5DE3A 2HLDA 2OCYC 2I0QA 1E79A 2DB3A 3N2IA 5GJVC 1YBYA 1I6HH 3EZ6A 4DV0L 2QPTA 2J0QA 1G8PA 2D62A 4IOAA 3ULLA 5KOYA 1CFMA 1X86B 3O8CA 2GETA 5F9FA 5BR8Q 4E07A 3GTLH 1XEXB 3QBVA 3HDTA 3WP0A 3GTQH 1R5BA 4A2QA 2QE7A 4QGHA 4JLOA 4TLAA 4NYMQ 1N34L 1N5LA 2O8CB 2BCGY 2C9OA 4OK6A 1GVPA 1V5WA 1W4BA 2AK3A 3QXCA 1X6VA 2G0TA 2BA1A 3H0KA 4TT3A 3PIOA 4XSHA 4HUQA 3ZZ0A 2NTYC 1ZMXA 5BN3A 2JA8G 1CKNB 1X3GA 1FQJA 2J41A 2ZRKA 3TEHB 3H84A 3L0SA 4FMDF 3SS8A 3Q85A 1J8MF 1XD9A 4A3KG 5JS8A 2ZXUA 4HEJA 4O0AA 4DUYQ 1FVIA 2LCFA 4NCIA 4PC1A 1BYUA 1E22A 1E2NA 3MEFA 5J3BA 4GSYA 4UNNA 5CDFA 5KSYA 1LF0A 2KSQA 2YZ2A 1JE5A 4Q01A 2VL7A 4XVRA 1BVSA 4Z1MD 3M6AA 1OV4A 4EAQA 4RD3A 3RS5A 4F4CA 1FL0A 1FMLA 1FTSA 4JV5L 1T0JB 1IBKQ 1L4YA 1W46A 2ZRJA 2A5FA 4M9XA 3V4FA 4QIWE 1UF9A 1KJYA 1U9IC 1TEVA 3AQ4A 2WB1E 2FJUA 4B3TQ 2XJ4A 5CLLA 4A4DA 2GJAA 4BBRH 3LX8A 1VQJA 4A3GH 2UUAQ 2QSZA 2VQFQ 1LS6A 3KXIA 4CDGA 2J7PD 1N9WA 4HIMA 2JXMB 1VPLA 3AKEA 2EVBA 3BB4A 3PO3G 1M7BA 3FKQA 4UJ5A 5FLMG 4XTCS 1S0UA 3ZVNA 3QXHA 2FPMA 2B8FA 2HCJB 2OBLA 4TL7A 5C3EG 1XRJA 1UAAA 1NN0A 1ZUHA 4MRSA 4A9AA 1Q1BA 3ER0A 4DR1L 1XTSA 2XTNA 2ZSAA 1H9SA 2D2EA 2GVAA 2JA5G 2CCZA 2A6ED 5FTLA 5KU1A 3RVBA 3X1XA 2QROA 4G7ZC 3RLNA 1QVRA 4MYUA 5EXSA 1JAHA 2K5VA 5ELXA 4DPGA 2RMKA 1DGSA 2UUCQ 3B1WA 3CWQA 3ND8A 4R4CA 2H5XA 1I4LD 2NQ2C 1N6KA 3KKQA 2YOGA 1PA6A 4C2UA 5DNYB 1OB5A 1G8GA 2E8GA 2WKQA 3HYRA 4KFSA 2W6JA 1GRNA 3C16C 1P16A 2WOOA 2RHMA 1OXUA 4BXXG 2YVUA 2OEPA 4TL9A 1NBMD 2AD5A 1S1CA 2R9VA 4AKEA 4LUZA 1D9XA 1N33Q 1P75A 2N8NA 1XZQA 1AM4D 1T8TA 5C4JH 1KI6B 4HZUA 3U4QB 2Y0SE 4KHPQ 1KK3A 2G1JA 4D81A 3H2YA 1A8VA 5FOVA 4E09A 4Q00A 2C2HA 2GNOA 2E2JH 2JLQA 4OJQA 2VSOA 4JI6Q 2EFEB 1M74A 2WZQA 1VQ7A 3FYHA 4G5SA 4DV5L 5M3FG 2HHHQ 3EPLA 4K81B 1OXSC 2N1BA 3HKSA 1G41A 2QNRA 1RRFA 2UXCQ 2V8OA 3QKTA 3S1AA 421PA 3OYYA 4P4TA 2D06A 5EP2A 2ZJ5A 4XWKA 3I7FA 2DGYA 1HNXQ 4IFDJ 2NVQH 5JJIA 1KK2A 1EESA 1IN5A 2ODNA 2ZJAA 4UJ3A 2J87A 5JCZA 2E5LL 1YJNA 2CCKA 4PPQA 4N0DA 4BFZA 2GXSA 1KO1A 1FZQA 1OLOA 3M4QA 2RGNA 4ARZA 3STBC 2ZS7A 4DBLC 3VKHA 3TMKA 3CRKC 3U2QA 1Z2CA 1G7TA 1OIXA 1W49A 2GHIA 2TMKA 1O3YA 4I1SA 1RIPA 2RGNC 3A1SA 1F2UA 1G6OA 1G7SA 2AHOB 2LXKA 1GL9B 4M1KA 4IFDG 4IJMA 3W5OA 4BEBA 3ADBA 3SE0A 1M2OB 2CLDX 4HLDA 3GJ6A 3K70B 3QSYA 4MA4A 4RCYA 1VQ5A 2ZRFA 5LBIA 2IYWA 3CWZA 1VCIA 3OE7D 2HXYA 5FBQB 5H70A 4GLVB 4GLXA 4NDZA 3EC1A 5KNDA 1EFHA 2GEDA 3CX8A 4CT4B 2OFXA 3CP0A 2VHCA 4DR2L 3FE2A 4URYR 3VQTA 1N5JA 5M04A 2J9RA 3F5FA 4GP7A 2J0VA 1CKOA 1YNJC 4II7A 4LBYA 5FBRB 3T06B 4Q9JA 1EG7A 2GZAA 1IBMQ 4NMMA 1PFSA 4UKDA 5AJZA 3M3YH 2ODWA 4JBYA 4GOPB 121PA 4K46A 2VUMH 1TF2A 2IYLD 3OTOQ 4B33A 4NCJA 1NL3A 3TQCA 4X8MA 5KDOA 3CCRA 4GN4B 2RGXA 4B73A 2A5JA 2UXDL 1R7RA 3A6PC 4BLQA 4KJZA 2Q2TA 3OIWA 4RFSB 2AL7A 4TTQA 1HV8A 2RHDA 4TYPA 4BE7B 5SZJA 3EQLC 5GJCA 5JSZB 1VYVA 4IHQA 1DG3A 1WXQA 3WHKA 1QJOA 1GUSA 3BORA 1GOTA 3BG3A 1TU4A 2OBMA 4YONB 2VPPA 4B3XA 3HR8A 1YZKA 1GTVA 4CEJA 4D4LA 3T61A 1RE0A 3VR4A 4L5TA 4PPGA 3VMFA 3PJRA 4MRNA 3AVUA 3GTMH 3K7AH 3M0EA 2QAGC 4WA7A 2J3EA 2GJSA 2ZI9A 4KLZA 2R6DA 1OIWA 4FWTA 1X1SA 1YU9A 3E5HA 3A1VA 3FHOA 1W36C 4XJXA 2FZ4A 2VSXA 3I2ZA 3RLOA 1YI2A 3I32A 4FD2A 1WFQA 2PQAB 4PAOA 2GBLC 3QNUA 2O0JA 4JLPA 2DFNA 3IQXA 2IHYA 3KJGA 3NEYA 3KDFB 4IDNA 2ZJZA 5A35A 2PT7A 1Y1WG 4PO1A 2Z4SA 3FPAA 1BKDR 4H44C 3MRSA 4C0SA 1PZNA 4D2IA 3THXA 2D2CC 2ONKA 5BN4A 1KNQA 3PUYA 4HIKA 1G8HA 1M6NA 1VQDA 1JEEA 1ZCAA 3D0FA 1CP2A 1LV7A 2BDOA 3ZVLA 3NEJA 2CCGA 3AF4A 1Z7TA 2LSSA 4G5QA 1GITA 1FX0A 4YMUA 4RY2A 1ZD1A 2A5YB 2Q8IB 2PNHA 2X1VA 5HKKD 1FX0B 3EARA 5E7MA 1G19A 4YWMA 4APVA 4JMPA 4EDHA 1HH4A 1XJ0A 3KJOA 1UEJA 1CLUA 5CK5A 3S14H 2SHKA 3MSXA 2YV5A 4ZKEA 3WP1B 1G3MA 2YOHA 5DYIA 1NIJA 1ZM3A 3K0FB 1UBCA 2ZE7A 4YC7A 1NY4A 1W1WA 1I94Q 3LFUA 3T1OA 1GUOA 4LC1A 3KF6A 4AD8A 2EJGC 5BR8L 1ZD9A 4QGUA 1ZNYA 5E7JA 2QMUA 3CNLA 2VNUD 2AWOA 4JOIC 3UMRA 3KQHA 2F43B 1FUUA 4L8JA 4JI4Q 2C99A 2EDGA 3X1ZA 3T1QA 1EIFA 2BMJA 3B8HA 1NSTA 3AP1A 2W6JD 3S1AB 1CBUA 1OF1A 2PZFA 5KSOA 2HYIC 3DEFA 4QFMA 4KYUA 3HU2A 2RGDA 3KB2A 3IFTA 5HY6A 2GESA 5L3SB 1RPZA 1MR3F 2QT1A 1HH2P 3BRWD 1L1OC 3MXNB 1CKEA 2GCOB 2ZJOA 2WMNB 2ZROA 2IL1A 4DCNA 4OGQC 1VQOA 4QY7A 4MYTA 4Z8XA 2IUSA 1XB2A 4JBXA 1A5TA 2QL6A 1EX6A 1TF5A 2R62A 4JVLA 3W5JA 1YITA 4X8OA 1FJGQ 2ZE5A 4OQFA 4TZ0A 1WCMH 1G4UR 1DE0A 3BK7A 2EJFC 3AEVA 2PMKA 1IY2A 5BYJA 4M2LA 2MO1A 1N32Q 1G21E 1MV5A 3LD9A 1G18A 5FPTA 4P72A 1US8A 2BEJA 4KKTA 4A93H 2K75A 4RMFA 1SHZA 1E9BA 1TU3A 2CVHA 5GROA 2ZRNA 3GFPA 3NVAA 4IFDH 4AIIA 1G7RA 1TADA 3VX4A 1E4VA 1TQ6A 1ZIOA 1EFTA 4TLBA 3TR0A 1KXLA 3CCEA 1D6JA 2XITA 3W34A 4OK5A 1E3MA 1S40A 2ID0A 1NIPA 1PUJA 1X3EA 2UKDA 4AKGA 2VSFA 2REOA 1VYUA 1QHYA 5L3RA 3LX5A 5E3HA 2QA4A 3N6RA 4EPWA 3NG1A 5HCNA 2A69D 1X8KA 4DDVA 1B23P 2QN6A 3HOXH 1IXSB 3A7AB 1I4DD 3UDXA 2AHOA 3W8NA 3U6KA 4B3SQ 1OFHA 3REFA 5IK2A 4B3RL 3F1ZA 2UXBL 1DO0A 3HPQA 3EBEA 2K32A 4Q02A 3Q9LA 5IP7H 4LCBA 1ZJ6A 4O25A 1XTKA 1GSIA 4B75A 1QVAA 5FR1A 2HXSA 3A8TA 4IFDI 4MNOA 2CK3D 2PT5A 1AA9A 4RCZA 4NP6A 2AXPA 1F5NA 1PH5A 3JZMA 4C9BA 4DCTA 3I4NG 5EJEA 1R2QA 4DUZQ 4PAMA 1W5SA 1VQMA 5IP7G 4OX9L 4DK0A 2ALYB 3ONWA 2EYQA 1D8LA 3F2DA 1ZU4A 4A3DG 1GZSA 3GLHA 4QBIA 2VP5A 3UXMA 3FOZA 1GUAA 4GN5A 1XNRQ 1T6NA 1ANKA 1KSHA 3K0AA 3KKMA 4XOIA 5HE8A 2WICA 1WQ1R 4WXPA 3RNUA 3A4LA 4M21A 1BKBA 1XCPA 2B21A 4GOPC 2KB0A 4B6FA 2Y0SG 4DV3Q 1C1YA 1KIMA 4HZIA 3NH9A 2NZHA 4AY2A 1OFIA 1KMQA 5LMUQ 2DHRA 2VP9A 1R8QA 1QUQB 3DVLA 4HUQB 1N6PA 4QNMA 5GVRA 3CB4A 4BLRA 1KI6A 3CONA 2FG5A 3I92A 5EQTA 5DSZA 1TEXA 4JI5Q 3SYNA 3CQZH 3CCVA 1RZ3A 3WMGA 1CIPA 3HOYH 3C5HA 4B76A 4QM7A 2P6RA 1XFAA 3W6OA 1WA5A 1VQKA 5G3YA 3A5ZB 3GLGA 2JASA 3GLHB 4OQLA 1Q44A 3TRZA 1NVUQ 2JDIA 2F3IA 4LYJA 2ZRHA 1BO6A 3GEIA 4UNRA 1FPMA 2ZEJA 2QP3A 1Q1EA 3MCAA 2GZHA 1V9PA 4Q1CA 2ZSDA 1NSFA 3B5JA 3EASA 2O5JC 1FP6A 3FMCA 3ND9A 3W3AA 4JLDA 1VQPA 1NMGA 2OQKA 3KKOA 4D4KA 2ZS8A 1CSPA 4PV1C 2QENA 5HR5A 1K9MC 1KRTA 2Z43A 2ZJBA 5CLQA 4A0RA 2JLXA 1G5PA 4O0MA 1UE7A 4U02A 2IYZA 1A62A 3CNOA 4PC6A 2HUPA 3LBNA 1PH6A 3E70C 1KI3A 3L82B 8OHMA 1PMRA 3A1UA 2ASBA 4XTRA 4JI8Q 4IFEA 4D0LB 1W47A 2E9SA 2FN4A 2OLJA 5SZHB 2PL3A 3T1TA 4TLDA 1G6PA 1Y8NB 1SVWA 3TUJC 1XCGB 4JSTA 2A68C 2V9PA 1U0LA 4IXMA 2P65A 4U7DA 2BCJQ 3G0HA 3DM9B 2QY9A 1ZM7A 3OE7A 4LJAA 1Q22A 1Q46A 3BJUA 1C4OA 2C9CA 4DUGD 1KDOA 5JJLA 4D0NA 3J81c 2UU9Q 2R65A 1RIFA 1SVLA 1F3OA 4PSAA 2ZJ2A 3WY9A 2Z6VA 2I1QA 5J4LA 1X9NA 1V8QA 1RRGA 1E2GA 1T3LA 2O52A 1OH6A 3L0IB 3MWLA 5D3QA 4QKQA 3AVXA 1E1OA 2OQ0A 1W48A 3TGPA 2CWPA 2BEKA 1DD2A 3DDCA 2ZI4A 2KA7A 1LTLA 4GKJQ 1CR0A 5LMNL 1VG1A 1WDTA 2WKPA 1N6RA 1P62B 3HOVH 1TQDA 3JVUA 1XMVA 4KSBA 2NZOA 5KDLA
chains in the Genus database with same CATH superfamily
1QAOA 1VXOA 2Y1CA 1SCNE 5HTOA 1L6RA 2RGEA 3DHQA 4QOJA 5E7IA 1D7QA 2QTZA 2SECE 5DNEA 5DIZA 4A27A 1Q12A 1M6HA 2E2HH 1QAQA 4TXJA 2I5HA 1NQVA 3ZU3A 2WTMA 3LFHA 4U6NA 4B9EA 4FNGA 4IQFA 2YWCA 3GA0A 3Q5DA 3R8CA 1EJ2A 3SR1A 5NLLA 2CYBA 3IL8A 4MQEA 1YHAA 4NCHA 3HFSA 2B83A 1NAIA 1EWKA 3FKIH 4IBOA 1L5SA 3AL3A 3DV9A 1Z6YA 2VZ8A 3P27A 4PFKA 2TMPA 2RE8A 3LX6A 1L3CA 1D0SA 4MUHA 4ZJUA 2WJ6A 3PC7A 2Q2HA 5HKAA 4DR5L 2YC2C 4UHEA 2I4OA 1HQRD 4GDMA 3OTOL 1K27A 4BJ1A 3IJRA 3FXAA 3WIBA 2ZJYA 2VTBA 2J5KA 3BEOA 3RARA 3U26A 3H2KA 2PNRC 5EPKA 1P9NA 5ECYA 4D6XA 5HF6A 1ACJA 3P20A 3DWAA 1PW5A 2BISA 2NTNA 3BWXA 3JD4A 4LWCA 1G1MA 1H0RA 3NLLA 2JQOA 1CB0A 3LWNA 5IKXA 1HTPA 1Z68A 5D2CA 2Q0XA 5CDHA 3UK1A 1MHTA 1X1EA 2WWHA 3FTEA 1LQTA 2O6HA 3N8NA 1XTQA 1J5EL 2QA5A 1ZH6A 2VHVA 3CX6A 3EY9A 5CH8A 5DEOA 4WXRA 5DIFA 4D56A 4ZZ3A 5B2FA 5C3XA 5KNCH 4A36A 3FCAA 5DOVA 4GBED 4CLRA 5A9RA 5DM70 4Y1RA 1DWPA 2QLLA 2HU5A 4L02A 5HGJA 3MM4A 2GPJA 2EGUA 5G4KB 2CNBA 3EGIA 1A98A 4QUCA 1AG9A 2Y6VA 4OWTB 3D8SA 1UKYA 4DLRA 1J8VA 1CRZA 4YUZA 1GPNA 1T5DX 3A06A 3VGJA 3EEYA 1SQSA 2EF0A 1W0JD 3D54D 2I4IA 4Y18A 3KALA 2XRQD 1YVDA 4Q4JB 4H0FA 2GAFA 3SJCA 1J7KA 1H4TA 3D5TA 1KABA 5IKOA 3S1NH 1JKMA 5AVTA 4DV7B 2B8JA 1AQLA 4RE6A 4IEIA 5LQAA 5K51A 4NBVA 3MWYW 1NNUA 1O95A 2E1PA 1KK0A 4KN7C 2XE8A 3KOOA 3PQ8A 4X20B 3USCS 4C4PA 2MJ8A 4PZZA 2VBIA 3W3AH 3ESYA 4C76A 1RVV1 5T4FA 1NJGA 5FOSA 5K0JA 1JJ2A 1MIOA 4I08A 1GCAA 3V2TA 3P4YA 1IIRA 3CE6A 1YJ8A 3GJQA 5K0LA 1B7YB 4HDNB 3K2QA 4ZGBA 2QR2A 3AUYA 3P9RA 4LDZA 4MUAA 3VNVA 1QZUA 1PD0A 1TKAA 5DXJA 1HNXB 3GJ8A 4HADA 4FYVA 2IJGX 2Y1GA 1K3TA 2Y0BA 3QKRB 1WPQA 1HNZL 1KMIY 4C0KA 1ONOA 1OBOA 1VSBA 4KYIB 2GEVA 3V7WA 5ECGC 2BDNA 1PSWA 1VDZA 2N88A 2EKDA 4J90A 3G2IA 3G0OA 1Y5RA 5CFPA 4IW3B 1PEKE 3BHNA 2DPXA 4TVBA 1X2EA 2XNJA 3RABA 3JAML 3AEKB 1I7SB 3FWKA 1U3VA 4H1WA 1ZS9A 4CTKA 4AKTA 2O0KA 2XVXA 4RSRA 3GFTA 2FR8A 1EZ8A 2X4GA 2EZVA 4MVJG 3ILSA 4ID6A 5CV4A 3FRIA 4BZQA 4MIYA 1B6RA 2OCGA 1JG2A 2Q5QA 4JQYA 1PU2A 2MR5A 3GG2A 1IBRA 4N3AA 2YZ7A 1G291 4W9RA 1M6YA 5AM0A 5A6SB 1X7YB 1KMCA 1EVYA 3X1ZA 4GQAA 4IX9A 3EIFA 3FGNA 1B2RA 1YL7A 5THKA 1N5IA 4KX3A 1TEHA 5JC1A 4L6IA 4JJIA 1A2KC 3JZIA 3H5AA 2EP8A 3EWNA 1QOQB 1G16A 1PTOB 2VYQA 5AWFC 3DMTA 3ZYCA 5I3ZA 2V0NA 2R6ZA 1C1XA 3CY6A 2ZSUA 1YKGA 2YUTA 2IXAA 4ZT7A 4JL8A 5JDIA 2I76A 1V35A 4KFTA 3N75A 3CLUD 3STHA 3WGTA 3K0SA 3IMGA 4GXQA 3UWDA 2YNMC 4E5DA 2Q27A 3R74A 1SIWA 1RWQA 2ZYWX 4JX8A 1L7AA 4JLWA 1O0SA 1SUFA 3AF3A 3C2QA 5F1KA 4AF8A 3DP9A 1BS9A 2Z4HA 1TQ4A 2I2XB 2W2TA 2YY5A 2HFJA 3LDGA 2ACWA 3MS7A 1V3UA 3PC6A 4LQDA 4NYIQ 4LXIA 3NHMA 4Y6QA 3RSZA 5EEHA 1TQOA 5F4ZA 3RSGA 4JDPA 1E3SA 5ES4B 2WWXA 2I2BA 2HSJA 1E9SA 3GA5A 3OJLA 4Y2RA 3UJ7A 1Y8PB 5EIOA 5IHXA 2DNEA 1E9EA 1GXSB 3DLBA 4ZAWA 4EX6A 3QLTA 2GPYA 3KIPA 5JXIA 5ALNA 2WRZA 1TT7A 1RI2A 1S5PA 3S17B 3RAGA 5BOSB 1UMDA 4IJVA 1V7CA 4B83A 2PU5A 4Q34A 4OGFA 3B9PA 3GLGB 5BOSA 3R44A 1WTCA 5AVUA 3QUCA 1RYYA 2FFAA 3JW8A 2SCUA 4OLFA 3LU1A 3B8EA 3JD2A 1H05A 3NCHA 1E2UA 1L5MA 2B0CA 3E22A 4Y0VA 4WNYA 1XR3A 4WFIA 5GM2A 4EARA 5J2UA 2WWFA 4CQLB 1KI1A 1SIOA 1I80A 3Q7PA 3WGNA 4DA9A 5KINB 2ZP1A 1ESDA 2WSBA 4XT3B 3M6UA 1QR2A 3FOWA 4BKPA 4MMYB 3CKMA 1ZUIA 2WOJA 2WUFA 3GZNA 4BFYA 2AJ8A 3D6NB 3LPLA 4HN2A 3VZDA 3AWDA 4CGYA 1HKUA 3H3FA 3K6SA 4H31A 2F0KA 3AU7A 1T6YA 2VVTA 3HOWG 1CUXA 3BHMA 3CW8X 3LQFA 2QTHA 1U7XA 4UHKA 5I7AA 3D7RA 1JDBB 2BN4A 2IP1A 2N47A 2P62A 2W22A 2F4IA 3SEQA 3SHWA 3ZY5A 3IR7A 1A4XA 5JCJD 1VJCA 3LNTA 3ZNQA 4FFMA 3MQ4A 2GNPA 2IYEA 5DP1A 1ELOA 1NXPA 2IELA 2F4NA 3L6OO 4PZUA 3PMFA 1A8HA 3U3JA 2YYAA 3ZOKA 4CKBB 3W1GA 3WHPA 4DKAC 5AKKA 1W2HA 2ZCUA 2A9QA 5T8KA 4Q4CA 2FKNA 4F8EA 5INTA 2GF9A 4MR7B 1QQBA 1N33B 2UUBL 2DPHA 2YHBA 3X3MA 5DYNA 2VRCD 4EFLA 5IAAA 5K4GA 2IS2A 2ZCVA 4KMSA 4ZUIA 3IL2A 3KXLA 4DV1B 4WFN3 3PXCX 4C3IH 2RH9B 1KVUA 2Y1WA 4GMXA 1GFSA 1N2OA 2GN6A 2X5KO 4TWIA 3SXUA 3VO9A 3N8IA 1ETHA 3WXBA 2XV1A 5SZKB 3C3WA 2VUTA 3IRBA 3NAMA 5LIPA 2GXAA 1H8HD 2PZJA 1S8OA 4TYNA 1U5BB 4NOMA 4D5GA 3E7FA 2P67A 4JV5B 4ZQ3A 1O2DA 1SK9A 3DPUA 1LT5D 2PANA 4R4QA 4H7KA 4HPXB 5EZ6B 1FS4A 1AC5A 1FUKA 3C8DA 5LN1A 5KSWB 1EYCA 4XUGB 4FTWA 3GZTB 3CW9A 4AG6A 1VQGA 1LF5A 1L7XA 1QGED 2HO5A 4KAFA 1FFYA 2I65A 3MBKA 3GXOA 3HVHA 5ALZA 3E3NA 4GNRA 3RV4A 4AMBA 4EJSA 4OX9Q 2CJFA 3GO5A 1R0KA 2AXNA 1GVNB 3W05A 5CA1F 3DAFA 3FIJA 5JRDS 2HAEA 1BO0A 4BNXA 5C8XA 3DAYA 4QBHA 5HJ5A 5KYNA 4E5PA 2CC2A 2D5IA 1R10A 2ORVA 1NQ5A 3DEHA 1RJWA 5LA6F 3ZLJA 1MRNA 3WAKA 1SMYC 5JH7A 2RSOA 1TVKB 2WF7A 4D9HA 5BN5A 2ACVA 3NSWA 4LV6A 621PA 4IH4A 4K1LA 1P3DA 3D8GA 2N0SA 4HVTA 5DM1A 3QI7A 5D84A 4U4AA 5FUMA 4EO9A 4NESA 3TBHA 4HNRA 1UM9B 4M38A 4EBFA 3HM9A 2BCOA 4IMJB 2X77A 3JR7A 3F90A 1U3UA 2B2NA 3DFFA 1E8NA 1XCJA 3ANTA 3CZ4A 4O2DA 3MWDB 4G0MA 4QO8A 5LKAA 1JHPA 1AMOA 2JAQA 1GGFA 1T29A 2OCDA 4FJ0A 4WKBA 4DUZL 3RROA 2CL7X 2Z98A 3G1WA 3I01A 3N39C 2D74A 1WHSA 4P3KA 2C59A 4XYBA 4H4CA 5H68A 4XQGA 2D00A 1X70A 1D3AA 1JJIA 4YRJA 5EJGA 3ROTA 3ZYZA 2IDKA 4TVSA 2BTOA 1JA9A 1ZM4A 1SNMA 1WDMA 1NMSA 2PAAA 3AJDA 3IULA 2RGYA 1QO7A 4IXWA 4OHMA 4CLOB 1KEPA 2LKVA 2PGNA 1UADA 4J0EA 1OUMA 1LTTD 3DDHA 4QXAA 1RXSA 4B79A 1FFBA 1N5OX 2AQ8A 2HJ9A 3W9BA 4A2WA 2PI2E 3AWIA 4Y7NB 3DOHA 5KAPA 1TVXA 4RCNA 4YRDA 3ZXXA 1EIHA 4MPRA 2LP4Y 3A4VA 2QR5A 1MI2A 4JYAL 3NM4A 4GI5A 5K2MA 3U44B 2CB0A 4WVLA 4CEHA 3L8DA 1G3UA 1ZSYA 2Z09A 4PHFA 4A1FA 1WSWA 3WQSB 3MGCA 4LF5B 3Q8MA 2ES4A 1PYOA 2ZKIA 4J6HA 3RODA 3MEQA 5GIOE 4MDEA 1EXWA 3O8OB 1WDWB 4C1NI 2FEXA 4BBRG 1L0WA 3CVJA 3DOJA 4A3MG 4FHEA 2VUSA 1RPJA 4YJDA 5E3IA 3PXBA 5BY2A 4CIYA 4FDLA 3TDNA 3G7UA 1XZAA 2RAFA 3A4NA 5I6YA 1EXNA 4FNOA 2CFRA 3EPPA 4X61A 1ZOLA 4DN6A 5LOVA 4H7FA 3C6YA 1OXMA 1U0HC 3ZY3A 1RLUA 1MO2A 4QICA 1CWUA 1IHPA 3LIIA 1E6CA 2EKPA 4FYXA 2W43A 3WGMA 1J1IA 3X2SA 4RVOA 2GLXA 3PXUA 4FU0A 3JAMc 2COKA 1DRWA 3J7AF 2XOEA 4M9ZA 2O2GA 4YP9A 3TFQA 2V55B 5J47A 3T53B 4EYEA 3BK2A 5A9SB 4FHZA 4BTLA 2CF6A 4P73A 1PDWA 1PYGA 1PQ4A 1B6TA 4NWIA 4OYHA 5KNDD 3H4IA 4DGZA 2ZSKA 4OHPA 4ZVVA 2A9OA 1SHKA 3I83A 2IZOA 1PV1A 2QMHA 1A1SA 4EFDA 2AJCA 3C3AA 3GHHA 2L17A 5JASA 1WP4A 2Z0SA 4KU4A 3GRCA 3KSUA 4J0QA 3ETCA 1MC4A 4ENUA 1AGYA 1I7PA 2FUNB 2A0YA 2WWIA 5C0XJ 2Z2XA 4O33A 4UNPA 2ZUUA 2IX3A 3R7FA 5LJLA 3GZ4A 4RQUA 2H9AA 1CIJA 3OG9A 1XZIA 4MCHA 2DKFA 1DBIA 1ENPA 1KRSA 4DV4Q 2IEGA 2PMWB 2XGGA 4O2AB 1FU7A 4JI7B 3NEMA 1SNPA 2KWIA 1ZQ1A 3SKVA 1LU9A 4YV7A 2W2QA 1U5BA 5AVVA 5LDHA 4GPD1 1YA6A 1WMBA 1OI7A 1F2LA 1Z0FA 2OORA 4FGKA 3QO2A 1BD3A 1SB8A 4HDQB 2JHAA 4L2IA 4R8KA 4DSZA 4EG1A 4EG6A 5EGTA 2CHQA 4NIMA 3NAZA 4RZHA 1ZDMA 3M6WA 5IYBH 5ELMA 3OO1A 1T3HA 2PR7A 4Q39A 2C2OA 2CW5A 5C46F 4A3MB 4LFCQ 5BW8A 4ZCPA 4YYEA 1GNSA 1U8CB 1OXVA 1OWPA 1YZHA 5ETJA 3VDXA 2YQZA 4XPIA 1NJ1A 3ZWBA 1GUWA 2YN4A 3R24A 2O8BA 3H9JA 1FYEA 3GOQA 3OJOA 4KMOA 4AJHA 4NU8X 4E4TA 1ZI9A 1VMPA 4URFA 1X1RA 5EZYA 3ZKWA 4II3A 4AJ9A 2MGSA 4RA8A 1NMYA 3A2MA 3NWSA 2G88A 2H63A 1E3WB 1QE0A 2OHIA 5DYTA 4B3MB 4R6WA 4ARAA 4KR7A 4X7BA 1MXFA 5K8LA 1EP3B 1DAEA 4AP9A 3PNVA 4HGNA 1Z2EA 2A7QA 2C96A 3T7RA 3W4JA 3KQUA 3KEQA 1VOTA 5AICA 2E87A 1W36B 2IXFA 2JATA 2QMOA 1RWBA 4LF8B 4FB4A 1ENFA 4P2GA 1NP3A 2PD3A 4YPFA 3LUKA 2CFMA 5AESA 1Q0QA 3HWX1 2RK4A 3LNCA 3VXKA 1TCAA 3W9SA 2OHVA 2HNKA 2H07A 1ZOIA 3EUEA 5AYVA 4DA6A 3OMGA 1GPWB 3PE3A 3Q7TA 5BMOA 4US2R 3LWDA 4MTLA 1JHQA 4BAZA 4CKYA 5DNCA 1MOSA 1FXWA 1JIUA 3TGLA 4MWDA 4B71A 3MVEA 3RG8A 5IPFA 1RHKA 5I48A 1I5RA 1J9GA 1EUDA 1WZEA 1JJAA 5BR4A 4KK7A 4NDXA 3NGLA 4ALLA 4MV0A 2HQ1A 4ZQBA 3F47A 3ZV4A 4X8LA 4B3RQ 5KDDA 5DBGA 1IZ0A 1IOWA 2IOFA 3GLGE 2P1RA 2P2LA 4BO4A 1M34B 4Z4FA 4UMVA 2B78A 2B2TC 1YAJA 2CZQA 2EBWA 1SYEA 2ESRA 2FOIA 3OEHD 3QG5A 1JJCB 3BZDB 1DONA 3AW8A 4TN5A 3UH1A 4C2TA 4Z4CA 1TY0A 3CZQA 1M1UA 2AEJA 2J1LA 4UP9A 1UP6A 4NBRA 1QWYA 4WE3A 4D80A 3LI2A 4E1AA 5A0TA 1SNCA 2P5SA 1E8MA 2ACEA 3ZQUA 2DNCA 4C3JB 3CTMA 3DVAB 3L6UA 1CFJA 1DELA 3FETA 4YWJA 2VCHA 5BSTA 3Q6NA 2ZUCA 5DK6A 5H82A 4L63B 2RKBA 4CKEA 2EJWA 3MOGA 1A3UA 4WLUA 1BROA 4GX1A 2TS1A 4IEEA 2PUJA 4G1MB 1UDBA 4L51A 1F20A 5IYDG 2G06A 3JALA 4RV4A 3U0VA 1KE2A 5AIAA 4X64L 1WTHA 3PO2H 1CIVA 1E62A 2PZTA 4BZPA 3IEMA 4YXWA 4AS1A 3OP4A 3K9NA 1KC8C 3EC2A 4RHXA 3AMUA 4NJEA 4FDBA 5AI9A 2KYRA 3UMFA 3TXAA 3VMMA 1W3SA 5DTQA 5JC8A 1Z8FA 2BT4A 2VDKB 5AJWA 4ALMA 2ATCA 2Q4BA 1VL5A 3C98A 1E77A 3BULA 3HV2A 4H18A 1S5FD 3R20A 3UYKA 5ARBA 5BWMA 5KOJB 1I2DA 2VYFA 2JH8A 3W3ZB 4AMVA 3M9LA 4JBHA 3A2KA 5B7QA 1XYGA 1KHTA 4CM7A 2JS7A 1XZJA 5LNK6 3KT3A 1E3JA 1ONNA 1ZG3A 2BEUB 3A2NA 3DOCA 3W6NA 3W2GA 3EXHC 2P75A 1MIHA 2KHIA 2D4HA 5D86A 2Q7XA 3A1WA 2FHSA 1O5OA 2JAWA 5TQVA 4B3CA 3PT9A 1Y5MA 1NOKA 5TMBA 2GEKA 3ZDQA 1WTQA 1TKCA 1BA3A 2P5ZX 1A9RA 2ZU6A 3R7AA 2JFQA 4F38A 4FFOA 2GYUA 3L6BA 4RZ2A 4H7DA 3ASYA 4NG5A 3DBLA 4Y1FA 4F9GA 1TK2A 1FJGB 1YZUA 2XGJA 2XUGA 4EPTA 1CJKC 2RAUA 5JE8A 1E1TA 2W2OA 1EY4A 3FYSA 3NK9A 5G1PA 3G8AA 2FZKA 5A5EA 4XUEA 2QSUA 4YRAA 1U2EA 2RF4A 3ME5A 4OU4A 4AZSA 2VHWA 3VVLA 3QWIA 1TWCH 5CBPB 4N6OA 3SBDA 1Q14A 3PF4A 1NCVA 3DV0B 1KO4A 4U7FA 2RH5A 1N33L 2ZREA 3EG9A 4UFPA 1W34A 1ADYA 4DDWA 5F7OA 3KQOA 1WY5A 3ZLTA 3JYOA 2QSYA 4CG2A 3B6IA 1T36A 3J7A5 1XD2B 3B6MA 4TVOA 2AMCB 1NF8A 1NR2A 3GYGA 4HLCA 3PHHA 4IG4A 2O7RA 3MCWA 4MV6A 4OIFA 1ABEA 5DMXA 3ZXUB 3U7IA 3FI0A 2NVUB 4DT1B 3PDUA 2FWJA 3OURA 3ZE8A 3JAMA 5JY1A 4TTIA 3LF2A 5C5MA 3U3ZA 3ZYYX 3BDIA 4ZZ1A 2X86A 3EZ2A 1OFGA 3D8TA 4D42A 5COYA 1WAMA 3EVNA 4LNHA 1CM9A 4ARIA 2F1OA 2K7VA 3EC7A 3NC1C 1WCIB 4H60A 4LWQA 4CM8A 3ZLUA 4EYOA 2FEOA 1CUWA 4IOJA 4L4RA 4NK4A 2EE1A 4WA8A 5TARA 3SVZA 4P31A 3TLMA 1CY4A 2WB2A 3URMA 2X8WA 4I14A 2ZXOA 1ZVMA 4GDFA 1DQNA 2PO7A 4R2HA 2IKQA 2KBFA 4RK0A 3H8SA 2OMKA 1H1LA 3AUXA 1ADFA 1PWZA 4NXML 1POXA 5CXXA 3O8QB 4YRPA 1EVIA 4LSWA 1QZHA 1I51A 3PE6A 4CE6A 2Z1DA 1HDEA 1E1CA 1EBUA 1DPFA 4KPUA 1DBVO 3CU7A 2C3PA 1Y7PA 2W4MA 3CB2A 4OXXA 2RAPA 1BBXC 1YOBA 1QRDA 4DLZA 2V0GA 3OTHA 4KIFA 3HJGA 4BAGA 3GRFA 5D8DA 4X90A 4IUYA 1AQIA 1AMUA 3CPHA 2PLFA 4M49A 2HHHB 2JC3A 4UEWA 5LMZA 1D09A 4PSUA 3NEPX 2WSSD 3TAXA 3D4RA 2J4DA 2DU8A 5L6LB 4TWZA 4L8LA 1XQVA 4PHHA 5AI0A 4OPMA 1J8IA 2I2DA 3OT1A 4MLCA 1I2AA 2QVZX 2IY8A 5KNBD 1E4EA 1FQWA 3B89A 2BH9A 3IA2A 3P4XA 3MXUA </