2YZ2A

Crystal structure of the abc transporter in the cobalt transport system
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
266
structure length
266
Chain Sequence
MRIEVVNVSHIFHRGTPLEKKALENVSLVINEGECLLVAGNTGSGKSTLLQIVAGLIEPTSGDVLYDGERKKGYEIRRNIGIAFQYPEDQFFAERVFDEVAFAVKNFYPDRDPVPLVKKAMEFVGLDFDSFKDRVPFFLSGGEKRRVAIASVIVHEPDILILDEPLVGLDREGKTDLLRIVEKWKTLGKTVILISHDIETVINHVDRVVVLEKGKKVFDGTRMEFLEKYDPRFFTSKMLVMRRLVLKGEDPFSMSDDELLERVCNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the ABC transporter in the cobalt transport system
rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
molecule keywords Putative ABC transporter ATP-binding protein TM_0222
total genus 84
structure length 266
sequence length 266
chains with identical sequence B
ec nomenclature ec 3.6.3.-:
pdb deposition date 2007-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2yz2A00
4DB2A 3X1XA 5FI1B 2R9VA 4KYIB 5JEEA 1KDPA 4CEHA 4QJ4A 3AH8A 1G20E 1RPZA 4ZCLA 2YZ2A 1YR6A 1EX6A 2IYUA 3QPUA 4B75A 4Z1MD 3ZS9A 1JJVA 4GOJA 4UJ5A 4YXWA 3O8CA 1DG1G 1U8ZA 4QBIA 3CRQA 1KY2A 1OH8A 4IDPA 4Q03A 5FBVB 4N3NA 1EXMA 1QHIA 4Q47A 1GRQA 1I4LD 2F43A 2ZRDA 2HT6A 1BS1A 3KDSE 5HKKD 1W4BA 1B0UA 4PC1A 5AJYA 2WHXA 1OH7A 3A1SA 4FCVA 2ZU6A 4Q1CA 3VU9A 1W46A 4M1OA 4DSTA 5FPHA 4TQAA 3KTAB 2EWWA 2GJ8A 4II7A 4NU0A 2DY1A 4QHTA 4XTCS 1W5TA 4AKIA 1JXOA 4ZV4A 1XJCA 2LWIA 1FX0B 5KNDA 1HURA 4TSFA 1IJFA 2YWFA 2AWOA 4D81A 3AVVA 2CHGA 3QXJA 4GMXA 1AKEA 2W2VA 3LW8A 4Q9LA 2W6JD 1M6NA 5BYJA 2OEPA 3TW8B 2FPLA 1OPXA 1BMFA 4GOXA 2DFTA 3R8FA 1JECA 3ADBA 3QPWA 4C3ZA 1W36B 1E9DA 4Q4HA 4U7DA 4B48A 4EPRA 1Z6YA 2GCNA 1L8QA 1UFQA 2KWIA 3A36A 5LD2B 4C0KA 1IAQA 2WKRA 2FNAA 2IXEA 1E9BA 1O3YA 3LV8A 3ZQJA 4DLYA 3V4FA 3B78A 4KITB 1W48A 5FUXA 4CEJB 5UKDA 4AI6A 4F4IA 1KO1A 1AJEA 4M1YA 3U4QB 3AM1A 1NVWQ 3LXRA 4PHFA 1RJ9A 1Z07A 3CUEF 4IOKA 2RKOA 4LV8B 2J59A 2ZYUX 2FPMA 1U0JA 2FN4A 1Z0DA 2JLRA 3PEVA 1H65A 2WMOB 1G64A 4LX0A 4Y0AA 1RIFA 2BBOA 3FMOB 1LS6A 3PITA 3A1TA 3MG9A 4JMPA 1U2RA 4EPWA 3GJ4A 3G0HA 3BB4A 3B9QA 1XB2A 3TK1A 2FJUA 5D3MA 2IF2A 4DCSA 2WJHA 1IN8A 1XCGB 2OFWA 2ZJAA 4LV5B 3I3SR 4ON9A 4MYTA 4P33A 2ONJA 2XXAB 2ORVA 4R9UC 1N3BA 4WIAA 3OEEA 1E1RD 1SULA 3C8UA 4TMXA 1OH5A 1WXQA 4LYHA 1P62B 5GADl 2ZU0C 3PEYA 2ZS9A 5CJPA 1HYQA 2GVDC 2JDIA 1Q12A 1S9HA 3P4YA 1J8YF 1SXJC 3GEIA 1Q21A 4PZZA 4Q66C 4OI1A 3WBKA 1F2TA 3TUZC 2OHFA 2DWQA 2HCBA 2AN9A 1P9NA 4I99A 1MRSA 4KLZA 4M4SA 4D4KA 1XD9A 2BMEA 1JEEA 3UMRA 5A4JA 5IF9A 1X86B 3AKEA 3OIYA 2O8FA 4PZYA 3K70B 1QHYA 1TQDA 1WP9A 1U81A 3QVUA 4FMCF 2F1IA 1FOEB 2GCOA 3QENA 2B8WA 3RC3A 1GVNB 1NG1A 3GP8A 2FGKA 5BW8A 4BLQA 4URWR 2RAPA 4XVUA 1FFHA 1G7RA 4PTLA 1SVOA 4PQFA 3RS4A 2GNOA 1WRBA 2RHDA 1Z28A 4DJTA 1FP6A 4P0TA 4XD7D 4LJ6A 5EE3A 4PAQA 3H2YA 2W6ID 2C96A 3PUWA 1UBFA 2F9MA 3AQ4A 3FHTA 1HE1C 2IXFA 2QMHA 3IUYA 1AQUA 3I92A 1ZP6A 4IEIA 3ZVLA 4AKHA 1N6IA 1UBCA 1YZKA 4LJYA 5L3SB 1TU4A 1VCMA 3T06B 2ZETA 4DBLC 3IDQA 2DFNA 3RRZA 2QNRA 2ZI6A 3T12A 4TN1A 1EFUA 2PZFA 3DHWC 2PLFA 3B1ZA 4C0LA 3VKGA 1E9SA 1XZQA 2YINC 3SYNA 5DNYB 1XPOA 2C9CA 2WWGA 3K70D 1G8FA 3NC0C 3RSLA 2QPAA 2C95A 2JLVA 1U0HC 5KPJA 2DR3A 2UZ3A 3A4MA 3Q5EA 2NPFA 3U44B 1OXUA 2CNWA 1VPLA 2GXQA 4FMDB 1GL7A 1TL7C 1S3SA 5EE5B 2P5TB 3ZGXA 1ZCAA 3AGPA 3SJCA 1R5BA 3Q7QA 4LY6A 4KYUA 5DI3B 1YQTA 3OZXA 4KLNA 1EK0A 3A6PC 5FUVA 1TQ4A 4HAZA 2QI9C 3AVOA 1D9ZA 2WJVA 3CKLA 4GP6A 4DUGA 1J7KA 5EP4A 3CF6R 3AVPA 2IL1A 3DEFA 2CJWB 3IEUA 3W8NA 1JPJA 3AP1A 1KO7A 1E9CA 4EIWA 4TWZA 4C0AC 1XTJA 2VHCA 3R20A 4TL7A 3Q85A 4TMVA 1NJGA 4LHWA 2OLJA 4TSFD 1KI3A 4M1TA 1TF7A 3WYGA 1AS0A 5JFGA 2ZI7A 1ZRHA 5BN4A 4V02A 2IYTA 4NE2A 1YZTA 3ZZTA 4B2LA 2B92A 1UKEA 1R4AA 1CR4A 4I1VA 3LBNA 1Z8FA 3X2SA 3AF4A 1ODFA 1U8YA 1QBKC 1UEIA 1KO8A 3VAAA 1VG1A 2ZI4A 5J40A 4KCGA 2J7PD 4IVPA 1OFUX 1YR9A 1ZM3A 2C98A 5TVKA 4A9AA 4JT2A 2ZRNA 1W36D 4S35A 3LY5A 1GRRA 4Q4LA 1CBUA 2D74A 1ZINA 2PEZA 3FDIA 3K53A 4PC6A 3X1ZA 1G3QA 3FKSA 4LJ7A 1LY1A 1XFAA 1R5OA 4LJAA 3LW7A 1ZYUA 1QHXA 1TMKA 4JLNA 1E98A 4LWZA 4P32A 5CLLA 2J9RA 5IT5A 3THWB 1LF0A 3CPEA 2J45A 1ZNYA 2FZ4A 1F2UA 4A0FA 1UDWA 3I32A 4C0BA 2B7CA 3HPQA 3MUFA 4MUBA 4XH9B 3VTKA 3OFND 1A4RA 1M34E 1RRGA 2YNMA 4Q18A 5DO9A 4DKXA 3KFVA 1NI3A 2N46A 4DEXA 3A1VA 2WKQA 3QG5A 1E2GA 2IUUA 3CPJB 2ZE6A 5EP3A 1GZSA 2R8RA 4FXPA 1XX6A 5D3MB 1LF5A 1G7SA 2VSOA 4CIDA 3A4NA 2E87A 4WZAE 3W6PA 4XJXA 2X2EA 5GVRA 1UAAA 4DLZA 3LLMA 1VDZA 1F60A 2VIIA 4ASUA 4DDUA 1NN0A 3GLGA 2GCPA 1NF3A 3R7WA 2QAGB 4KFUA 4C2UA 3V9PA 4KU4A 2QM7A 1SQ5A 3W5IA 4JLAA 4C2TA 5GJBA 3K0CA 4F4CA 1XD8A 3SQXA 3LNCA 2OUKA 2RGXA 3B1XA 1LW7A 5E7IA 1IY1A 2FV8A 2WSMA 4IDOA 4H1UA 5KHOC 3EIHA 2Q0HA 3VQTA 4FD2A 2J7KA 1DAHA 3CH5A 1R6BX 5AUPB 2BMDA 4YONB 1T8TA 4RFSB 2XITA 3EX7C 1EGAA 3TH5A 1OW3B 2Z4SA 4D4MA 4ARZA 1IN7A 1GP2A 3T15A 2SHKA 4WZBE 3R9XA 1CRPA 2VO1A 4MKHA 1ZVQA 4D25A 1DEKA 4P4UA 2CL7X 2CDNA 2QN6A 1TUEA 4DEYA 2OCAA 4D80A 5K8UA 3GEHA 5KSYA 4B33A 1Z83A 5KDDA 2QT0A 2BM1A 4NBSA 2FA9A 3L0IB 2ZRBA 4F91B 4Z8XA 1XRJA 2CMKA 3DKVA 3NKVA 4L4UA 2RHMA 3ZVMA 3GJ7A 2WOOA 1E79D 2GF0A 2HYDA 2IUSA 3FB4A 1K5GA 1UKYA 2JJ1D 2HLDD 1KMQA 2Z6VA 1R0YA 2ECKA 4RCZA 4ZDKA 3C5CA 1E2HA 5F3WB 1NN3A 2OBLA 2FFBA 4CVNA 5K8LA 2PL3A 3T35A 4G1UC 3TAHA 2YVUA 3ZD6A 4IW3B 1G8HA 2CHQA 4TYYA 3RWOA 2WWHA 4BFZA 1OXVA 4DLUA 4AC9A 3K0FB 5BYKA 1AGPA 1ZM7A 4GZLA 1DVRA 1SVMA 3Q72A 3TSZA 3SYLA 4PPFA 4BFVA 1G3MA 3TW4A 1X1RA 2GAAA 5EP2A 2ZRMA 1MR3F 2BCJQ 4BE7B 2V6IA 3VR6A 1ZIPA 4TL9A 3QNUA 5JJIA 1A7JA 2WIAA 4HDQB 4OYHA 2ZAOA 4DSOA 1QHHB 1RC8A 4NPHA 1F2UB 3VNVA 4WVFA 3EARA 3AV0B 3RSOA 1JQJC 4D2IA 1KK3A 3M0EA 2OCYC 1S2MA 4AYWA 4Q9KA 3WYAA 3GLHB 1MO6A 2J7PA 1D9XA 2VBCA 1G9XA 5EJEA 1ZNXA 3HWSA 3MAAC 4HZUA 3OIUA 3BXZA 4F7WA 2IS6A 3K0EA 4M2LA 3LBHA 2F1JA 2CL0X 5AK0A 4R2IA 4JZKA 2WWYA 1IN4A 1K8RA 1P3JA 3WMEA 1EFCA 2FSGA 3FKSD 4HAYA 4DRZA 821PA 1R0XA 4XVRA 2VP2A 5HTKA 2ZPTX 3QXHA 3SDZA 3D3QA 2AXPA 3EIQA 2RGNC 3QI2A 3THXA 3BRWD 3GLGE 3K9GA 2CK3A 3DOFA 3N70A 1E2DA 1HH4A 1KI9A 1XTKA 4V0OA 4O2LA 1EFTA 1Z08A 1E9FA 4GSYA 5C2JB 2PH1A 4QG7A 2GESA 4PHGA 2OZEA 1JALA 2P6RA 4BFUA 3CRW1 1GFIA 4GFDA 4BEBA 3FKQA 4M22A 1II9A 3AKYA 2MSCB 4JBWA 4BUJA 3ND9A 1E2PA 3VNUA 3AGQA 1CS4C 3LDAA 4Q7JB 2FFAA 4OK5A 2ODEA 2D2FA 4ACAA 2ZJ5A 4JBYA 4IFEA 1P6XA 3RWMB 4GRAA 4Q1FA 5HKKA 2ERXA 5AUOB 3I61A 2ZIAA 3NEJA 3U7HB 1CP2A 1N6KA 2C99A 3C14C 1Y3AA 3NH6A 4LI0A 2ZUCA 2GILA 4XVQA 5E4FA 3REGA 3I72A 3TUJC 4ZKDA 3PEWA 1KK0A 2OXCA 3OESA 3KZ1E 4HB2A 3UKDA 5B57C 2ZI9A 1HA3A 1KHTA 1VHTA 4ZDIA 3B1YA 5JS7A 3MRSA 4OBEA 4ABYA 3T1TA 1W7AA 3KUDA 3AF2A 1ZUHA 5JECA 4BFTA 4BZPA 5JCPA 1GL9B 1VCOA 2O0JA 3WNDA 1G41A 3CRRA 3NBFA 4FMBB 2QAJA 3U6KA 1TF5A 2H8KA 3W90A 1JEDA 2QMOA 3ADKA 2FWRA 521PA 1XJ0A 1WBDA 1L7VC 2HT1A 1XNJA 5FUWA 4LPKA 3KKMA 2QEQA 1W2GA 1G3RA 5FPKA 4HAXA 2LKCA 1VG9B 2FE4A 3AF3A 2RGDA 1R0WA 2J0UA 2BKUA 1R7RA 1BKDR 4TTPA 2CCJA 2AK2A 1GRNA 4DC9A 1KI8A 4HDOB 1AQYA 1WQ1R 1J8MF 2EYUA 1U8AA 2JIZA 1COWD 2WPDD 5JMTA 3BFKA 4OQXA 5LDDC 4QOSA 2RGEA 2VSFA 3DZ8A 1OV4A 3TNFA 1CULC 2WMNB 3IQWA 1A1VA 2V8OA 1EX7A 3HR8A 1CU1A 1P4SA 3W9YA 3KB1A 1XEXA 1Z3IX 3UXMA 2ANBA 4PPQA 4PO8A 4TL6A 3CX7A 1RYHA 5AUQA 1ZW6A 5JSZB 2C77A 3QKRB 5AWFC 1OF1A 4O3MA 3WYFA 1IXSB 2EFHB 2Z5FA 3LXXA 1T0HB 3H4MA 3MJRA 2RGNA 4Q21A 2UZIR 2P6UA 2QTFA 1YZLA 4LJ5A 5JSZA 1UKZA 1G1MA 2KB0A 2XZPA 2ZE8A 1VG0B 2A3RA 2BM0A 3QKRA 5HZKA 3THYB 2BDTA 4DCNA 2O0KA 5SZJA 4ZIRA 5JS8A 1AIPA 1E6CA 3ECCA 2NOAA 4LDJA 5AJVB 3BIFA 4OHZA 2FDCA 3G5UA 3SJZA 4ZCIA 2BVNA 2D06A 4QGAA 1F6BA 2CNWD 3I8SA 1RW4A 4I81A 4X8MA 1PVOA 4LBYA 3JVVA 4P31A 4Q9JA 1KO5A 1RRFA 1XTIA 1YVDA 3BB3A 4A2PA 1YZGA 1L4UA 3DDCA 1AKYA 1OIWA 2GJSA 4QXAA 3L8ZA 5EXXA 2HEIA 4AKEA 3CX6A 3GLIA 2ZSBA 3V00A 3LX5A 4DUGD 3K0SA 5JWHA 2GEVA 4KSBA 1CXZA 1MH1A 3PIRA 3RS7A 2OBMA 3TVTA 4DLTA 2ZRPA 3QVVA 4QBFA 4AKGA 3K9LA 2ZYVX 3MWYW 5SZIA 1KOFA 1IY0A 3IIKA 4BFYA 1N2CE 5KSOA 2GDJA 1E0SA 2O8BB 2F9LA 2ZRIA 1RRCA 1C9KA 2GBLC 4QC2A 2EW1A 4A8JB 2G77B 3DOEA 3FYHA 1GL6A 5DLQC 2GA8A 2VP5A 3UPUA 5FTMA 1Q1BA 3KKPA 3T1OA 3DM9B 4DZZA 4C0HA 1QHHA 3O8DA 4D0GA 1MRNA 4F4JA 2CLDX 3GD7A 4GL2A 2GK6A 4JLPA 1YKSA 2J46A 4Q1EA 1EWRA 3FGNA 4A6PA 1N6NA 5KYKA 2KSQA 2YV5A 3FHOA 3ZZUA 4A4DA 3Q5DA 2GTPA 1J2JA 1NBMA 2WJGA 1ANKA 1GNQA 2ZS8A 4IXNA 1U9IC 2QP9X 4NZYA 1XJQA 1S3GA 2V9PA 1AGRA 2XXAA 2JJ2D 2CLCX 3X1YA 3VHLB 4PHTA 3M1IA 2P2LA 4B71A 3IHLA 1EG7A 4C0QC 1IQPA 1DAFA 121PA 3QUSA 3MMPA 2A5DA 4HB3A 1GOTA 4YC7A 1FMJA 1G7CA 4QBHA 4BASA 3GMTA 2FEOA 1AA9A 1SZPA 1Q0UA 3AVTA 2ZVPX 4EDHA 2ZE7A 4R71A 2RGAA 2IYVA 3LA6A 3B85A 5C4MA 5JEDA 2BKEA 5FPTA 4ILEA 3LRPA 3PUYA 3P1JA 2NO9A 5CDFE 3MWJA 4MRPA 4G5QA 1M8PA 4DVGA 5EZ5A 3BC1A 3PCRB 4US1R 4ASUD 2HUPA 2P0EA 2XJ9A 4GPTA 4QJ3A 3K09C 1FTNA 3SQWA 3SFVA 1IOZA 1W1WA 4AURA 3EPJA 4A8JC 2F3TA 4YMSA 3NDPA 1COWA 3QOFA 1IONA 3GLFE 3LX8A 4MRVA 2GJKA 4CDGA 1KDOA 3NHBA 4RKFA 1T5LA 2PX0A 3QEOA 1GNRA 2HF9A 2WOJA 3GFTA 5E3HA 1QZXA 2XNDA 3EW9A 1JI0A 3FE2A 3HPRA 3JZAA 1KKMA 4M21A 3OAAA 1NSTA 5DHFA 2QTVB 2VEDA 1H8ED 4M8NE 4AD8A 5BN3A 2JLUA 3ICEA 1KMHB 2GF9A 3FOZA 1LB1B 3QF4A 3W6NA 3BK7A 1Y63A 1N0VC 1ELOA 4O0MA 2ZRKA 4NYJQ 4KFTA 1MV5A 1QG4A 5EP1A 2B21A 4MRRA 2G1KA 5ELXA 4YMVA 3ZVRA 2EFDB 3WRYC 2K5UA 3L0PA 1W2HA 1DADA 1JAIA 2UKDA 4LUCA 2PMDA 4P3YA 3UANA 3RRMA 1NLFA 2W0MA 4IVQA 1VCIA 5EE1A 1T8UA 2FMXA 3LVRE 1CR2A 3I1FA 3SBDA 1S9DA 5FOTA 4YDSA 4JKIA 1R10A 4HUQB 3EPLA 1CEEA 1LVGA 4UXJA 4MQBA 2IYRA 3SJBA 1UPTA 2F1RA 1SKQA 1SVWA 4MGIR 3ASZA 5TXGA 1TPZA 5ANRB 4L9SA 6Q21A 2CJWA 1NL3A 4PHHA 1NN1A 5BQ5A 3LD9A 2WZQA 1ZNZA 4R98A 4URUR 2ZTSA 4JVNA 4HLQB 3TSOA 4JL5A 4QKQA 4OHVA 4WA7A 2LCFA 2OAQ1 4KVGA 1KAGA 3DO6A 3ZYCA 1NVVQ 2WJYA 2FH5B 4CEIB 1NVVR 4CEHB 2G9NA 2Z43A 1W0KA 1CLUA 1PJRA 3AF0A 4LC1A 2A9KA 3THYA 4LZZA 1T3HA 2QRNA 4B43A 4Q4JA 3B82A 3VU9B 3ADCA 2JJ1A 1NKSA 1M74A 5TMPA 4CEIA 1U90A 4G5SA 1PUIA 2DWOA 3EA5A 3EIEA 3TLXA 3ADDA 4Q7LA 4Q1BA 1M2OB 3AKDA 4EKDA 4A0GA 4AG5A 3G82C 4NCJA 4R7ZA 2PJZA 2FU5C 3CW2A 2IWRA 2BC9A 5FL7A 2ZXUA 1DAMA 1KJZA 2NTYC 3ZH9B 4BLPA 4XWOA 1K6MA 5FOWA 1CJTC 1YE8A 2D62A 1W4AA 2XX3A 2ZS7A 1R0ZA 4I4LA 5DE3A 4BZXA 2J0SA 4TQ9A 2J0QA 3GLHA 5G3YA 1LS1A 1W49A 5IK2A 4A2QA 1QVRA 2VH5R 2IX3A 4DCVA 3AP2A 2QUZA 3NC1C 4Q48A 1XTQA 2IA5A 3MFYA 2EFCB 1KI4A 3UG6A 2A78A 3E1SA 1OHHA 2OCBA 1DTSA 2WAXA 2JJ2A 1M7GA 4A36A 5CK4A 4B73A 1V5WA 1JR3A 1UDXA 3QEJA 2CCGA 2FF7A 2XB2A 3SS8A 4B32A 1E99A 1VYVA 4NYIQ 3IPYA 4A8JA 4Z51A 1QHGA 2BV3A 2NO6A 3H84A 5HE9A 1D6JA 1DE0A 3TSWA 3U7GA 4FCWA 3SYKA 4ZDWA 5FL3A 2AX4A 2R6GA 1AN0A 2QPOA 4W9MC 2W58A 4Y0VA 3UATA 1KTVA 3DKPA 4QNRA 2IW3A 5G53C 4XSGA 1P2SA 4B6FA 3SEAA 4CRWB 1TAGA 4BLOA 1A82A 2ZJZA 2PT7A 4PFSA 4HEJA 2IYWA 1KDTA 3KJGA 3CIOA 1MOZA 5CYOA 4RZ3A 2XB4A 1KDRA 1DARA 2JAQA 1ZU4A 2CK3D 2C2HA 2QGNA 1IN5A 1PV4A 5CDFA 1QVAA 4RFSA 4WAUA 2WWFA 4KSCA 3FPAA 1T3SA 2DHRA 3NWJA 1OLOA 3IBGA 4CEJA 5F9FA 1N6LA 5DI9A 2RH5A 1E32A 2C8VA 3U3RA 1NMZA 5EUQB 3QIAA 1H8EA 5IDVA 1KZGB 3CPHA 3PUXA 1G4AE 4WBSA 3GLFA 1QHNA 2HCJB 3KXKA 3VKWA 3PUZA 2R6FA 3WNCA 2RMKA 1Z5ZA 1S96A 4O25A 4MA4A 4ESVA 1PLJA 5FOVA 4LJ4A 1DO2A 5E7MA 3HR7A 4H9GA 2J87A 5FOXA 1XXHE 1IXZA 4EFLA 1RE0A 3R9WA 4CT4B 2QL6A 2J41A 1P2TA 4HSEA 1EFHA 1ZD8A 1IY2A 3GFPA 2ZJYA 4FI3C 3U3KA 2X8AA 3CWZA 3MCAA 4GOKA 4Q4AA 4F92B 5KNCA 2WVJA 2PCLA 4ITRC 3DMDA 4QRHA 3B13B 5FR2A 4OKSA 4JLMA 1XTSA 3K9NA 4WXPA 4A0HA 3TGPA 2D4HA 3R8CA 1JBKA 1GDDA 4CT5A 3U5ZB 1D8TA 3FHCB 2A7QA 3DVLA 1CIPA 4EAQA 1YRBA 2IHBA 4LC0A 2P5SA 2NO0A 4B76A 3RC8A 3V4RA 3QBTA 5JHGB 3ZLJA 2DWPA 5KDLA 2VHUA 5AJZA 4EFNA 1R8SA 5AR1A 3C5HA 3WHKA 4JL8A 3M6AA 4NKRA 3CM0A 1XWIA 3K70C 3CBQA 3EZ9A 1WBBA 1KJYA 3BWDD 1VYTA 3B6EA 2QROA 2YHSA 3QXXA 1J90A 4A2WA 3TVDA 3RANA 2ATVA 5F98A 2QRZA 2O8DB 1NN5A 1XEXB 2DBYA 3C16C 3I5XA 2ERYA 3GLIB 2JGNA 4BLSA 2Q21A 2MMGA 5FOSA 4A82A 1YZUA 2R6CA 1GIAA 1YZQA 5K8IA 3DPUA 4UJ3A 1UF9A 4F93B 3SZRA 4JL6A 4OQMA 1JR3E 4NHOA 3WHLA 5SZHB 4BFSA 4OQFA 3KX2A 4OI0A 1I2MA 1Q1EA 3EWAA 1EESA 2YOHA 2GBLA 4TT3A 4TZ0A 2VP0A 3BH7A 4YLGA 4B2PA 3N2IA 2CLSA 3L2OB 2ZJOA 2PJRA 4IDNA 4RD1A 2EFGA 2YWGA 3U2QA 4MGKR 2X2FA 2QAGC 3KXLA 1M1YE 1P9WA 2GETA 1XU4A 2R65A 4NH0A 2OAP1 2ZUBA 2OO7A 2ZVQX 4N1AA 4JYCA 4RFVA 2O8EA 1YR8A 2RGBA 4RSGA 4N0DA 2XJ4A 4LOAA 1ZCBA 2KBEA 3I4LA 4CF7A 1Q3HA 4B47A 4EJSC 4M1SA 1GAJA 1DELA 3HU1A 3RS2A 5FTKA 4Q9HA 3VR3A 2Z4RA 2FEMA 3CO5A 4MRNA 4WOPA 1SGWA 2AR7A 4AG6A 1KI6A 3OE7A 4C30A 4MITA 4LK2A 4JLOA 4DXAA 4UXIA 4POAA 4ZKEA 3T61A 2ZJBA 3BH6A 2ZSFA 4TTQA 4TMWA 3ONWA 3I5YA 1MT0A 4PO1A 4A1FA 1AS2A 4TTRA 1Z6AA 3KJIA 4YMTA 4LYFA 4B35A 3R9IA 4HDCA 4JLJA 5EXTA 5FBRB 4RKEA 1CJMA 4TLAA 4DSNA 1FW6A 2I1VB 2REOA 3CNNA 1D5CA 4JLVA 2BHRA 2FG5A 1BYIA 1TADA 4ERNA 3CLVA 3IPXA 4MH0R 5DYGA 5EUMA 4JLDA 3KKNA 5JWOA 3LBIA 1N6OA 5K8TA 1CJVC 1Z6GA 4A0RA 4Q01A 5DIFA 2GXSA 1RVDA 3GCGA 1NVUQ 2NIPA 1T3LA 2I1QA 1ZM4A 2YYZA 4GT1A 5KPDA 1RYFA 1P72A 2F1HA 4AK9A 1T6NA 5FPSA 4HLUC 2V4ZA 4IEEA 4JKYA 1IJEA 2BIFA 2H1LA 3U3JA 2O8BA 1NIPA 3P26A 3IILA 4B74A 3KQNA 1PLKA 3SOPA 4W5WA 3O8RA 4Q4HB 4OHXA 4Q19A 4PSKA 3JZMA 4Q7MB 3I73A 4TYQA 4PZLA 4DLXA 1R2QA 2P3SA 2W2XA 1WB9A 3QQ5A 2QE7A 2VPPA 5DH9A 3SE0A 1NY5A 2ZR9A 5SZKB 2GRJA 4V0NA 5GJCA 2ZRFA 3LAWA 2W83A 1DPFA 1UJ2A 1WF3A 3QF4B 4PPGA 1G16A 4AY2A 4JIMA 4UKDA 3BERA 2GXUA 3VKHA 2ANCA 2O0HA 2C78A 2R44A 5J47A 1UM8A 4EUNA 1IHUA 1KSHA 1I4TD 1FZQA 2GAOA 2H92A 4B3FX 5L3VA 1N0WA 1Z0IA 4E03A 1SHZA 1P2VA 3MLEA 1ZBDA 5IHPA 4DHEA 2OM2A 4EQ6A 5M04A 2BBWA 1LTQA 3K0CC 1NSFA 1W0JA 1Z0JA 3RNLA 4UNRA 1BYUA 2ORIA 4TQUS 4TLCA 2AD5A 2KI5A 2REBA 2ASEA 3H0KA 4QGGA 4FIDA 3FMIA 2CE2X 3TAUA 1N6RA 3OEED 1G6OA 5C18A 4JVLA 5FTJA 1SXJD 5J4YA 2OSBA 2VQSA 2ZRCA 2FPKA 1WDTA 4KVAA 3REFA 4FWTA 4NYMR 4YDHB 4X8LA 4OK6A 1HQYE 3NG1A 1TTTA 2CBZA 1P60A 5JLJA 3KJEA 3W3AA 1R8QA 3FVQA 1CKEA 2VHTA 1VMAA 5DN6A 3ETLA 3TRFA 1IBRA 2ODWA 3VR5A 4KJZA 2WWIA 2GCOB 5HZHA 2O8DA 3AUYA 4EJSA 2WAYA 2XSZA 3IO3A 4M9QA 3U3MA 4BRWA 1E9EA 2BCGY 2EU8A 2C03A 2GZDA 2IXGA 1D2MA 2IT1A 2ZSDA 4H1VA 3FMPB 4B6EA 2NPIA 3U61B 4A92A 4OL0A 1XMSA 4BZQA 1YU9A 2EWVA 2FSHA 3B7GA 5FR1A 1N6HA 3ND8A 2FZLA 2ATXA 3OAAD 1QF9A 3S1AB 3U44A 2AWNA 5FPYA 5JI2E 4A15A 1HT1E 2ZRHA 3MD0A 1OFIA 3OEHA 3P4XA 2WJJA 4M53A 1KNXA 3EZFA 2YOFA 4LYJA 3QKSA 1G5TA 2ODNA 4IDHA 2EFEB 3SR0A 2CL6X 5H70A 1W44A 3IIJA 3Q7PA 3VR2A 1CJKC 1TF2A 3D31A 3TUIC 2OXRA 2PEYA 2QQEA 1KI2A 4U5XA 3AVUA 1NLYA 3TBKA 1NNEA 4G5GA 3BJIC 5H68A 4ARZB 4XTRA 4WW0A 2JLXA 3EZ2A 1DS6A 2IS1A 3ZQ6A 3K0FA 2JJ8A 1JJ7A 4HZIA 2YOGA 3AB3A 3Q8XB 4W5HA 5KSZA 2KJQA 4L15A 1KNQA 1Q44A 4HLUA 1OFHA 4BWYA 3FWYA 1XD2B 4J0QA 1KI6B 1JNYA 1ZD1A 4JS0A 4QGFA 3TE6A 2V3CC 5JJKA 3L8YA 4M9XA 2JEOA 1C1YA 1HE8B 2YJTD 4I1UA 2REXB 1VCNA 3LQRA 2YKGA 1ZU5A 3QG1A 4UNSA 1FQJA 1XCPA 3GJ3A 3PVSA 4RD3A 1PZNA 4TLBA 5IK2D 1VECA 3EPHA 1OH6A 4BRUA 4HI0E 1NLZA 1W0KD 2J1LA 2YWHA 3HDTA 3HYRA 1G8PA 3QJYA 4QHYA 5CM8B 1NJFA 2GJ9A 2W2TA 2JLZA 2NQ2C 5C4GB 1T5IA 4ZI2A 1XXHA 3B8HA 1XP8A 3NHAA 3OIVA 5G41A 2WSSA 3L82B 1VHLA 5CM9C 3WNBA 2OBNA 4A6XA 2QU8A 4OK3A 3GJ8A 4LSGA 4BPBA 2ZQ5A 3RABA 4HYYA 2OG2A 1X8KA 3KQLA 3TJZA 2IK8A 3GJ0A 2NZJA 2JLYA 2QZ4A 5HCIA 2IYLD 4BFWA 2B8TA 3OFNA 4AYXA 1A5TA 3FFAA 1VTKA 3CF2A 1FUKA 1UBEA 1W36C 4QNMA 1DO0A 1X1SA 2O8CB 3WRXC 4PC2A 2Q6TA 1FL9A 5JZVA 1L4YA 3SNHA 1FUUA 4IHQA 1NBME 4XWAA 4LBZA 1DAGA 5EE0A 621PA 4U02A 2N42A 2VP6A 3RRYA 3X1WA 2CEAA 1XEFA 2VHJA 1A2KC 3KL4A 5JJLA 2XOKD 3MJHA 3UWOA 5HE8A 1VIAA 5JBQA 1E0KA 1FX0A 4TYWA 3R7WB 2MSEB 5B30A 1KGDA 1RZ3A 2B6HA 4L8GA 4Q4AB 2BMJA 2GK7A 1BIFA 1OB2A 4D4JA 4AWXA 1BO6A 3IQXA 2ZREA 1OKKA 5F9HA 3AVQA 5AJXA 1X3SA 5BWMA 4B3DA 1O87A 2IS2A 1EWQA 4K81B 4DDWA 2HJGA 1G5PA 2IF0A 2WJIA 4JJZA 4EPTA 4MDFA 3L0SA 4EPVA 4OHYA 4XIGS 1SXJA 1XCMA 2GJAA 3O8BA 1SVIA 4TLDA 2XAUA 2WIBA 2IHYA 4OI2A 5TB5A 4ACBA 2QBYB 4FMCB 4NTZA 1QG2A 4B44A 2O8FB 1Z0AA 2QSZA 5LBIA 2A5JA 3B2EA 3PFIA 3CNOA 1DG3A 3X1DA 4DT1B 5DN6D 2HDNB 2E9SA 3GLIE 2QBYA 4KHZA 3A4LA 4LHXA 4MGYR 4PAOA 3NIBA 5TY0A 3KFXA 5CLQA 2GWHA 1Z29A 4PX9A 4TYPA 1ZIOA 4E5UA 4M1MA 1AK2A 2ZSEA 1II0A 1Z0FA 3GJ5A 3RRNA 5JI3E 4NYMQ 5FTNA 2C9OA 5L3QB 4NYIR 1H8HA 4MKGA 1TUIA 4LJ9A 2EVWX 5L3RA 2J0UB 5J5CA 1PLLA 4TMKA 3U3OA 4GP7A 2GKSA 2V7QA 4NDZA 1D2NA 2QQ0A 3VR4A 2HF8A 4X8HA 5TV2A 4P4SB 2JASA 4AYTA 1RRPA 1Q20A 1XDBA 3C7KA 2BOVA 4YMUA 4MKFA 1FQKA 1SKYE 4ZIRB 5DSZA 3WBJA 1G5RA 221PA 1QHSA 3TMKA 2O8EB 3MGCA 2Q3MA 4KBFA 3WMFA 5KNBA 4W5JA 3N5CA 3CZQA 3EPKA 2HLDA 1ZD9A 4Q1AA 4D6PA 1ZUIA 5F2EA 3TQFA 3D8BA 1XEWY 4NCIA 5HCNA 3ZZ0A 1XBTA 1NRJB 4Q02A 5L8VA 3VFDA 4ZI3A 1II8B 1U98A 2PZEA 1TQ6A 1ETUA 4M1WA 4RVCA 1E2NA 4D4LA 3A8TA 2VLIA 4G5RA 3RYTC 1C4OA 2AKYA 2H17A 5IRCD 3CR7A 5C1BA 4M9SA 4IXMA 2I3BA 1NIJA 4KFSA 1I2DA 1OXSC 1XZPA 2GHIA 2G3YA 2ZROA 8OHMA 5AUNB 2OE2A 4AIIA 1LV7A 4R2HA 2ZRAA 4M1KA 4TMZA 2G83A 2VTKA 3UMFA 1E2JA 1KKLA 3W5JA 3KQKA 2X19A 1IM2A 3A37A 2IYYA 4G3XA 1OIXA 3RAPR 1G8YA 5DGXA 2XTMA 1P61B 5BXQC 3NBYC 4B3XA 1EFRD 1Z2CA 4BECA 1XMIA 2HXSA 4JT4A 1P9RA 1YR7A 3HP1A 3AEZA 3RLFA 2Q9AA 4ZPXA 1A2BA 2AL7A 1U99A 2GZAA 1UADA 1T9HA 3C4JA 4UNNA 4ZO4A 3A58B 1KIMA 2B7BA 4FMDF 4TT3D 2AFHE 2RB4A 1GILA 2VSXA 3ZIAD 1GM5A 3KKOA 2QAGA 2R2AA 4MKIA 4IFBA 1M7HA 3EASA 1KI7A 2DFKB 3L0OA 3AVWA 4QBGB 5FI0B 1HQCA 4Q7KA 2NO7A 1GUAA 3U6BA 1E2IA 2ZJ8A 3UWKA 1WE2A 1FNMA 2JATA 3FTQA 4UNQA 2XZOA 1JR6A 2XOKA 3GJ6A 3NEYA 5FBLB 3U60B 4JVSB 1TQ2A 4IJMA 3BFVA 1E9RA 1E96A 4KV9A 1US8B 4EPXA 2IBMA 3MSXA 2G1JA 1P73A 5A5GA 1CJUC 4HUTA 3WP1B 2OFOA 3OE7D 3RS0A 1E3MA 3CWQA 1RKBA 3EWSA 4GI7A 4L9WA 2ZEJA 4MRSA 1GNPA 3OHMA 3EC1A 5TDHA 2Z0MA 3FFBA 2O52A 1TEVA 2ONKA 2Z83A 2XGJA 3RS5A 3H1TA 5J4LA 3KB2A 4E07A 1G18A 3RDPA 1G7TA 3NBZC 2IYSA 2FFHA 5GJVC 3VR1A 4XWKA 2L0XA 2QE7D 3ZVNA 3QXCA 4G0NA 4WZ6A 3T1VA 4RY2A 3I62A 5JCZA 2BWJA 2VRWA 4IOMA 2VF7A 2F55A 2RGCA 2Q9BA 3SC3A 4C0JA 3PXGA 2QT1A 4Q1DA 3SI7A 2H5EA 4GNKA 2KE5A 2NMVA 2WICA 2F3RA 2OT3B 4C7OA 3ICQB 2OILA 2QY9A 4K46A 1Q22A 4C9BA 1GKYA 1VYUA 2BJVA 4ZCMA 2WPDA 4PANA 3EXAA 3LH5A 4JYBA 421PA 1P75A 4UNPA 1G4UR 1MABA 2PT5A 2IEZA 1HT2E 3ASYA 3IO5A 3KJHA 3BOSA 4NONA 2X1VA 1X8LA 1KYIA 4RZ2A 5DISB 4LBWA 2JLQA 2PBRA 3VX3A 5KUTA 5FH9A 1OJLA 2VF8A 3D7MA 4E09A 2ZI3A 2FSFA 4OHWA 3DL0A 3PUVA 4MGZR 3W34A 3I8XA 1KSGA 4RD4A 1SXJB 4B3GA 1NMXA 1K5DA 1KAOA 3W6OA 1XPUA 3DMNA 1Z47A 4MYCA 4DLWA 2QGZA 2JIZD 3OEHD 1JQLB 2J3EA 3U7FB 2GEDA 3AUXA 4DWJA 2HXYA 2AK3A 2XSZD 4LBVA 3WXMA 2ZRGA 2V1UA 3IEVA 4HAUA 1W0JD 4Q9IA 2G0TA 1MO5A 3QBVA 1E2EA 4D82A 1N25A 3MWLA 2A5GA 5AJWA 4Z1MA 5EQTA 4DCUA 3AVXA 4US0R 4EPYA 1GG2A 4YXWD 1HY3A 4HB4A 2DB3A 2YWEA 2NZ8A 4B3BA 1E2FA 1YZNA 1VIYA 1XMVA 3BS4A 1JPNA 2QTHA 3ZJYA 4C4PA 5A0FA 1OXXK 4PQYA 5B2ZA 4W7SA 2XTZA 2VHQA 2QMEA 2WM9B 4QL3A 3QKTA 4CZ2A 4P4TA 2DPXA 2DYKA 5J4VA 5CK5A 5B58C 1E9AA 3CH4B 1TX4B 1NP6A 1II8A 1SVKA 2AD1A 2NG1A 4D0NA 4X8OA 1G3IA 3CB4A 2ZANA 3MWKA 4L16A 5EZ6B 1N5JA 4HB0A 3BORA 1E4VA 4PO9A 1NY6A 4RZXA 3T5DA 4KI0A 4G01B 4NL4H 4QFMA 3K8YA 4Z8YA 2W6JA 4L5BA 4PR0A 5TARA 1F3OA 1FNNA 5GVSA 2CVHA 1BMFD 4HUQA 3CZPA 2PMKA 1JXMA 3W3ZB 2ZR7A 4QM7A 3EAQA 3CRMA 5EE9A 3THWA 4XOIA 4HLDA 1Q1QA 2HJVA 2NGRA 4UQOA 5EXPA 1XTRA 2AXNA 2D3WA 3GPLA 1OIVA 4FN5A 3E70C 4TYNA 2VL7A 1J99A 3EA0A 3LLUA 4M9ZA 1G17A 3NVAA 5H8WA 1HUQA 3WMGA 5H1YA 3A1WA 1TU3A 2A5FA 1T91A 3EC2A 5J4KA 3RHFA 2X77A 4PXAA 5KTYA 3LFUA 4RD6A 3K1JA 2WSSD 1ONBA 2JCSA 3KQUA 721PA 2D2EA 3B9PA 3BAFA 1G19A 2XNSA 3JVUA 2QSYA 4GBMA 5KO2A 1TNDA 1CF4A 2ZITA 3PQCA 2HYIC 5G3ZA 3SBEA 4US2R 3AP3A 2AKAB 1ZNWA 2O5VA 4ESHA 3B5JA 1S4QA 1OB5A 2BBSA 4DDVA 4OQNA 1OE0A 3T1QA 3OIWA 4O2RA 3BD9A 3B1VA 3THXB 4JLBA 1E1RA 4DLVA 2ZAMA 5HPYB 3AVYA 1D2EA 1P5ZB 1SVLA 3TR5A 4DIEA 1UKVY 1US8A 3KTAA 5LB2A 5EXSA 4Z54A 1NBMD 3CX8A 2LKDA 5HR5A 1OYYA 3LO5A 4D26A 1WCV1 5CB6A 2CE7A 1XXHB 3THOA 1MO3A 2QA5A 1VKJA 4LHVA 3NXSA 2PZGA 4FCTA 1CTQA 1Z6TA 2QM8A 3UG7A 1Z6XA 4B2IA 1E2KA 1MKYA 4CGZA 1CR1A 1G291 1G8GA 4MDEA 2A2ZA 3HYTA 1ZJ6A 2QP4A 1GSIA 1OFTA 2QG6A 5L3QA 5E7JA 4LHYA 5LB4A 3L43A 4MUAA 1DOAA 3TKLA 3F5FA 4OJQA 1BOFA 1ZAKA 5JRJA 1MABB 3QKUA 1DAIA 1U94A 3C41J 1F2TB 3QY0A 2ZI5A 3OF5A 4PPNA 1E1QA 4HATA 5KSPA 1P2UA 3U7EB 1HTWA 2JDID 1G21E 1GKUB 1Z22A 4EJSB 2PCJA 1W4CA 4PSAA 2G88A 2IYQA 5G40A 2IWHA 4HLCA 4P4SA 3VHXA 4C7OB 3BBPA 2FGJA 1N6PA 1KO4A 2C04A 1KSFX 1W4RA 1GKIA 1BH2A 1N0UA 3K0AA 1IN6A 4B3CA 2BEKA 4KXFB 4HAWA 4TZ6A 5FBWB 1P7CA 4URVR 2F7SA 1G3UA 2ZYWX 2BMFA 4PSVA 1W5SA 1OKKD 3BB1A 3QSYA 2H16A 2XNDD 3ZS8A 3ZD7A 3KQHA 4DSUA 2V55B 1H8HD 1LNZA 3PENA 2W6IA 4PQRA 2WWXA 4FW9A 3J81k 3KUCA 3NH9A 3KKQA 4PC3A 5BN5A 1KY3A 5GJWC 3IKJA 3S1AA 3F3YA 3PG5A 4GZMA 2IC5A 1E2MA 1ESNA 1SHKA 3F8TA 4Q00A 3NBXX 2CCKA 2GZHA 4DDTA 3B60A 1ZC3A 3K09A 1E2QA 4DB4A 1UEJA 1FMLA 2BEJA 4LHZA 3BGWA 1U9IA 1E69A 1GTVA 1SKYB 2F6RA 3CRVA 3IHWA 4KFRA 2GVZC 1WA5A 1R5NA 2WV9A 4V0LA 1E2LA 2MMCA 5KDOA 1OXTA 1Z2AA 1L2TA 3E5HA 1HEIA 1YHNA 4CYMA 4MYHA 4PC7A 5CB8A 2F43B 2UVQA 3T34A 2A5YB 1KSJA 3SN6A 1S1MA 2JLWA 4JVMA 1OT3A 2RGGA 1HV8A 1YRAA 3SU8A 1MO4A 2V7QD 3FMFA 4LGMA 3QF7A 2R6DA 3W8RA 1ESMA 1KK1A 2ZUDA 5CJ2A 1KI1A 3BE4A 4EFMA 2XZLA 2AFIE 1E0AA 3IBYA 3D6TB 2A30A 2IS4A 4IOLA 1JB1A 2XEXA 3QPVA 4Q4JB 5D3QA 4TLEA 1SVSA 1FPMA 1X6VA 3GEEA 4NMMA 2W00A 4URYR 4PAMA 2FOLA 1WMSA 1Q1ZA 1YJ5A 4ZDJA 1E0JA 1CRQA 2MSDB 2V1XA 4UXHA 1OHHD 1PUJA 2N1BA 5P21A 4U00A 1T4GA 2YC2C 2R62A 3AKCA 1AM4D 1G6HA 5FUYA 1JR3D 5J4HA 1XPRA 1Z63A 4RD0A 2EQBA 4RZUA 1W47A 2R6AA 1EFRA 1AS3A 3UK6A 3VX4A 5CITA 5JHHB 2G6BA 4KBGA 5FL7D 3CONA 2H57A 3WY9A 5DI3A 2WWWA 4CW7A 1DBSA 1Q3TA 3CR8A 2VA8A 2QMUA 4NYJR 1CR0A 3PR1A 2WTUA 2PX3A 2P67A 1U0LA 4MYUA 3TR0A 2J5XA 1X8JA 2DCUA 3C15C 4LRWA 2W0SA 4WXRA 1RJ9B 4G5OA 1B23P 2OFXA 4URZR 1S1CA 2ODBA 1XEWX 4JLKA 1QDEA 2TMKA 3N2EA 2FFQA 4BLTA 4JSTA 1DAEA 2XTNA 4LV6A 2V6JA 3SJAA 3VMFA 4D0LB 3CF0A 2O8CA 4NCNA 3BFXA 3HU2A 4HZUB 4NCHA 3IGFA 4S2EA 4M0LA 4Q5IA 4RD2A 3HU3A 3T5GA 3NDBB 5FFMA 3GFOA 3SHWA 4BGDA 3HJNA 3PEUA 3U4QA 2OV2A 2I4IA 4GDFA 1ZM2A 2Q3HA 4V0KA 1Z0KA 2GXAA 3M4YA 1NMYA 4B34A 2P6NA 2JLSA 4DIDA 3ZIAA 4F38A 5E95A 4YQFA 4E22A 3NTUA 5CIQA 1Z06A 3AF1A 3P27A 5KU1A 2OESA 1E4YA 1DAKA 3GJXC 3GLHE 4IVRA 1J70A 3GQBA 4DCTA 1E1QD 3P32A 4KODA 4GMDA 1M7BA 4KO8A 4TMTA 2IUTA 1ZUNB 3CNLA 5JWRA 3GLFB 2RCNA 2Q9CA 1IXRC 3B1WA 5B64A 5JRZA 5FOUA 1RFLA 2IYZA 2C5LA 3DM5A 1GITA 4OI4A 1FP7A 5FBQB 1F5NA 3KXIA 2ZYTX 2YC4C 5FTLA 4IRUB 2IEYA 3PJRA 3P20A 3Q3JB 4JJKA 1ZMXA 2ZR0A 4NCKA 4BQSA 3LWNA 2WKPA 1XF9A 2BBTA 4BFXA 4EQ6B 1GWNA 4QGHA 2QP3A 3DZDA 4BEJA 2C9YA 4QJ5A 2CXXA 2OLKA 1E79A 4JSYA 5DHAA 3SHFA 4DT1A 3ZDQA 2OCPA 1AZTA 3PV0A 3IIMA 3TQCA 1S0UA 4OQLA 1ZM9A 4K8OA 2CHVA 4V0ME 1OYWA 2JA1A 2KBFA 4HAVA 5CIWA 4V0MA 1KZ7B 1N5IA 2AHOA 2HV8A 3E2IA 2VP4A 3O47A 1FTSA 2G0NA 2V54A 2E1RA 2H18A 3EZ6A 1NKTA 2PLRA 4XSHA 5C46F 3LQQA 2D7CA 2ZJ2A 2Y8EA 5LPNA 3QXSA 3GLGB 1KK2A 4I1OA 1KJWA 2EYQA 4LPSA 2D7DA 1AZSC 3RS3A 3RVBA 3Q9LA 3K9HA 2H7VA 1NVXQ 4QM6A 2FSIA 1KMHA 2P65A 3EZ7A 4I1SA 5DYIA 1N5LA 1XMJA 2DFLA 2WBLC 1I4DD 2Q3FA 4RJLA 4LYAA 2J0VA 4IDQA 4KAXA 2ORWA 4JBXA 1JAHA 2NO1A 3SFZA 1Q57A 2QPTA 3BH0A 4C0SA 1ZC4A 4OJKA 1QRAA 1VG8A 5CYPA 1TEXA 4IOJA 4FWIB 4RCYA 3UMSA 3A1UA 3H86A 2CVFA 2GEUA 3K0AB 3EG5A 3TIFA 3WP0A 1XD2A 4N0EA 2FX3A 4LCBA 4NP6A 2IYXA 4YMWA 4IKEA 4FINA 1T0JB 1SXJE 5L3SA 1E94E 1UBGA 4XD7A 3LVQE 2ZRLA 1LFDB 3UIEA 2VYFA 1F48A 5KOYA 2ZM5A 2ZSAA 1NG9A 2VP9A 1S8FA 2ZE5A 4V03A 3F0TA 2BJWA 3QE0A 4URXR 1V43A 2QORA 4QHSA 2QENA 4TL8A 4LJ8A 4BLRA 3QKSB 4DLRA 5LD2C 2ZRJA 1N5KA 1OSNA 4DLSA
chains in the Genus database with same CATH superfamily
4J8PA 1VB5A 3LLVA 5CX1A 5FI1B 1ZQ9A 4EK9A 4QT0A 4NWIA 3CVYA 1CY8A 4CLDA 4IGKA 3HE3A 3AH8A 3BCSA 4QJ4A 3NORA 5AJUA 4ZCLA 1A5SB 1I0ZA 4ZOLF 5IDQA 5IS2A 1J5EB 4Y2TA 2IYUA 1JJVA 1QS0A 3EEBA 3F46A 1GAXA 1PJTA 3IV7A 4UJ5A 1F6WA 1DG1G 4U39A 4QBIA 5ALKA 2ZTVA 2Q5IA 4RTPA 1DIAA 2I4TA 4DRYA 3FYUC 1ZD5A 5JMOA 4JNCA 2NP7A 2DUNA 3L8FA 2H4JA 3GUHA 4UHCA 2HT6A 2JARA 2LRHA 2XDQB 2OCDA 2WJ4A 4B2YA 4MV4A 1SXPA 1AB5A 4P98A 2WHXA 1EWKA 4BO4A 1E8DA 1V6AA 1E7RA 3A1SA 4H7JA 4HDRA 4Q1CA 3VYWA 3X44A 1RRKA 4M8IA 4E12A 2P9BA 2RGRA 1P18A 3GEMA 5DZSA 4DRXA 2C2ZA 5AVUA 1BCSA 4W63A 4Y2GA 1VIVA 3F97A 3UUFA 2AW3A 2GKOA 3WA6A 4II7A 4P4GA 2LDXA 5EXDA 1L1QA 4MNTA 1JXOA 4KR7A 3ZBPA 2LWIA 1FX0B 5KNDA 1HURA 3RU7A 4C4ZA 4TSFA 1IJFA 2AWOA 3KSRA 4YV2A 3AVVA 1PFGA 2FPXA 3K4HA 5C1DA 3E6AA 1GCUA 3RI3A 1FSZA 2E4WA 2JEYA 2COKA 2SCUA 3ENVA 4Q9LA 4NQRA 2OEPA 3OETA 2FPLA 3BHIA 4KR0A 3R8FA 1XZKA 4HWOA 3HDYA 1VE9A 3ADBA 1U3DA 3QPWA 3F9RA 4PXYA 4C3ZA 4WY8A 1W36B 5AKYA 1NVMB 2B36A 2VBGA 3GPDG 4Q4HA 1RM4A 3BXFA 4K3UA 4F9GA 3PK0A 1M6VA 2B25A 3ORHA 3HCFA 5DW3A 5KTRA 4V1CB 1UODA 1XV5A 2FNAA 3DFFA 2AQHA 1O3YA 4S05A 2HTEA 3V9AA 3NGXA 4L0DA 2QIPA 1XNQB 4KITB 3BM5A 1WCYA 2XD9A 3KSDO 3M33A 4UDXX 4EHBA 5KNDH 3EA4A 3H2IA 3HVRA 4CEJB 4AI6A 1KO1A 1AJEA 1G21B 3RGWS 1K63A 1WUTA 1GD1O 2ILTA 2Y0PA 4K0RA 4WLVA 4Z7OB 2BD0A 1JDVA 1RJ9A 4LV8B 4PG4A 3VJMA 2ZYUX 1O6GA 2FN4A 3OZBA 2JLRA 3DXZA 3PEVA 4DAOA 4E1AA 1TT7A 2W6CX 2WVHA 1RYZA 5BSWA 1H9CA 3H5NA 1RIFA 5JZMA 2YRXA 3MG9A 4OGGA 2ZBQA 5DF1A 4O5AA 4YRAA 3B9QA 1EJBA 2JFFA 2FJUA 4QICA 2CDAA 3FLAA 3TZBA 4DV6B 1SC9A 2PU7A 1VQ1A 3N7UA 3DAOA 2O2YA 3K1ZA 5HIIA 1IN8A 4HO1X 4CT0A 5CTAA 1ZY2A 2PBLA 4LV5B 2QUAA 4DA7A 4H1WA 2YV3A 4MYTA 3IDZA 3A3OA 3QH4A 2B0JA 2NUTB 2NSJA 2J3LA 2XYPA 1ZCZA 4KLCA 4EHAA 4C78A 4FQ5A 2A8YA 4JC4A 4TMXA 2Q3DA 1JZQA 4KL8S 4LYHA 1P62B 3EXIA 2VPYA 3I45A 3R3HA 5IDXA 2OC4A 3N0RA 1R00A 1HYQA 3DW1X 3GNSA 3EZXA 1SXJC 4PZZA 3GEIA 4Q66C 3ZI0A 4DJJA 1XKTA 4F1WA 3JR3A 2DWQA 4UCWA 5CB4B 1PWEA 1I2BA 3G2OA 3JQEA 4YASA 1QRUA 2HD4A 4KLZA 3C3CA 3UMRA 2UU9B 3VNRA 1X86B 3NRCA 4PNHA 1S7CA 1WP9A 2YUTA 3QVUA 2C61A 5AVXA 1DKQA 4QRDA 1M1YB 1CUZA 2B8WA 3NNNA 4KZPA 3H1BA 3EOAI 4OUKX 4X0EA 3EZGA 1L7PA 2AN3A 1FFHA 4IIHA 2C5FA 3KHUA 3PQ2A 4YP7A 3U3RA 3GVIA 1WRBA 3IP5A 3LL7A 2IUFA 1P19A 3AR6A 3G2LA 3NHLA 2FG6C 3RFFA 3UJ3X 2XH8A 2UVPA 3HLTA 4C6HA 5JS1A 2E49A 1IBSA 1GT91 1P7YA 4PPYA 2PUGA 3IR6A 3QE3A 2NWQA 1R16A 4PX3A 3FHTA 1HE1C 4I55A 3IUYA 5L7TA 1ZP6A 5KX5A 1EXNA 4PLCA 2VYVA 2Y1GA 4NG5A 4LJYA 4TZTA 4UARA 2RI6A 4YPVA 5L3SB 1FJGB 1TU4A 4D8XA 1FQOA 2B2NA 2JZNA 2ZETA 3T06B 1FFXB 4BKUA 1YI0A 2DFNA 2P8SA 2ZI6A 3Q6IA 2PLFA 4U8HA 3T3PB 4C0LA 1E9SA 1XZQA 4MO2A 5MGBA 2C9CA 1GR1A 4Y6GB 1G8FA 3NC0C 2DP4E 2C95A 1ISIA 2OM6A 3BGOS 1N75A 5KPJA 2DR3A 3Q5EA 4E6EA 4LN1A 3S99A 2C7OA 1O9HA 1Z5WA 2HK8A 1VPLA 3ELWA 4FFNA 2N47A 4AW9A 4BVBA 3MPOA 4UOZA 4CIAA 1BWPA 3BA6A 5DLDA 5DXAA 1PS9A 1KEWA 3D4BA 4ISBA 4N8SA 5EE5B 2BEVA 3RJ9A 5EJ4A 2AVNA 2PRIA 3GT3A 2C3UA 1JIIA 5DI3B 5IJ0B 2JS7A 1EZZA 4ZYZA 2RD2A 1YQTA 1SKUA 2P6OA 4C7VA 3ESZA 5GZ1A 4HMOA 5KX5F 1LW6E 4G0VA 4WCFA 2PIAA 3T9DA 5GY7A 3IP9A 3KUXA 1R4MA 2QI9C 4RH1A 3W05A 2WJVA 4F9TA 4IF6A 3UJ7A 1J7KA 3VR2D 4JU8A 3ACDA 3DEFA 5FD8A 5LKAA 4E7PA 4GLJA 3HXOA 1FP4A 1C50A 1SUEA 4JEUA 2J5KA 4RA6B 3W8NA 1JL3A 1TM2A 2VPIA 4RMIA 1NHGA 2VPXA 5ILOA 4EIWA 4C0AC 1BJRE 1XTJA 1S2DA 1YB4A 4TL7A 5AXCA 5EJ9A 1EJ6A 1U0RA 2WD8A 1BX0A 1AS0A 5JFGA 5DX0A 4W8OA 1XZHA 3AY7A 3AIKA 1H5UA 2Y6VA 1H66A 1YZTA 1WO8A 3T1HB 3PNQA 5CVDA 1AUOA 4YN3A 5HF6A 1DJMA 1Z8FA 2GN9A 5EEHA 1K9VF 3FUUA 4XPIB 3X2SA 4CM8B 5JU6A 2WU0A 1QBKC 5KYYA 3OM8A 3GT7A 3PGKA 2ISCA 2PGJA 3DZHA 2O8NA 4CHGA 3O3CA 3BGSA 3L3BA 1EFVB 4LX8A 3WTCA 1IJKA 3NKLA 4GG1A 3TLJA 4Z0TA 3TTUA 3OM1A 5DTRA 2ZRNA 1Q6ZA 2UUPA 1W36D 1RACA 5CBPA 2JIBA 3GI1A 4Q4LA 4UE6A 2D74A 4PC6A 4OHCA 3E0XA 1OAKA 2CJYA 2DBZA 2I7VA 4MPTA 1HSZA 3GJTA 4BX3A 4PYIA 3PDIB 4E70A 5A5VA 4N76A 2Y4OA 1IRIA 1N3LA 4N0MA 3M34A 2AEFA 1MG0A 2FUG1 1Y9AA 2MHCA 1GO2A 3SKYA 3WV5A 1K08A 2V7EA 4BNUA 1QHXA 4ZT5A 2LZ0A 5J2UA 3JSXA 4E46A 3THWB 3I01A 4H0NA 1C7IA 3LWZA 2JAXA 3TQOA 2WQ7A 1NX6A 2J45A 2PT9A 3UWPA 1YB7A 1Q0SA 4C0BA 2B4YA 1VJ1A 2HRDA 5KWEA 2CMHA 1WD5A 2PMBA 1PCXA 1T1SA 4XH9B 2CSUA 1DIBA 1N0IA 3UGQA 3OFND 1A71A 5DO9A 3H3XA 3T7TA 4DKXA 3ZR4B 4AJ9A 4H0CA 4M1ZA 2QMZA 2WKQA 1MX5A 1B0AA 3QG5A 4C76A 4P53A 4ETWA 5E6UA 2XNCA 3FUVA 3V46A 4FXPA 1XX6A 1ZK3A 1LF5A 4YFYA 1EFDN 2VSOA 1RZRD 2E87A 1R9GA 4B85A 1QHEA 2DFVA 3WGGA 2BONA 5I51A 4UNIA 3DEZA 1BSVA 4EG5A 2Y99A 2OPHA 3GQBB 1O94A 2P2DA 1QQBA 2MIIA 4MV0A 4HQKA 5H80A 2GCPA 1GKKA 2LUOA 2Q99A 5ITZB 4B6QA 5DLYA 2QAGB 3Q1LA 1KOJA 3GGPA 1NQAO 5B3LA 5I8PA 2ORED 1SQ5A 5FB3A 2BGNA 4RKRA 5K6AC 3BPSA 4MP3A 2HRZA 3UW3A 4IQ8A 4PEVA 6REQA 2BKLA 3GO4A 2YXLA 3K1AA 5EUCA 2BTQA 4HCJA 2AJDA 3FF1A 3NM5A 3ZNNA 2JFHA 3LNCA 4IUYA 1V4NA 4MRAA 5EJ6A 2EP7A 4Y2YA 2C8KA 4EY4A 1IY1A 4L3WA 3GT0A 1BKSB 1HR0B 5BVGB 5THQA 3HKCA 1L4NA 4XIJA 5FLXA 1E0AA 2BMDA 1BHSA 2FR1A 1HDZA 4YONB 4ZVOA 3ETNA 2XVYA 1DV1A 1EGAA 1X42A 2VQDA 3TH5A 5K01A 4AXBA 3EX7C 4FYWA 1YCGA 5D00A 2B98A 3O74A 2SHKA 5HF5A 4LGVA 1ZIDA 5ARDA 4D5EA 1SUDA 3VSBA 1Y4ZA 4CFSA 1GXSA 3P5BA 2H9YA 4L5AA 2OFPA 3ET4A 4LSZA 3E7FA 3RVJA 4P4UA 1F38A 1TC1A 3FF4A 4UW9A 3VRHA 5KTMA 3V4SA 5KSYA 2HJSA 4B33A 3K35A 2I6XA 1JIUA 3A1FA 3L05A 4MV7A 3ZY4A 5ALVA 3BSFA 2GKGA 4V0SA 2CMKA 5T5QA 2OBXA 3DEAA 1M10A 2NAPA 2GF0A 2IUSA 2V3VA 4A10A 4P0PB 1N3IA 1U31A 3OSZA 3VXKA 4C0XA 3AVYA 1NQUA 4F7DA 4LISA 5EMLA 3CE6A 1X7DA 1BDMA 2CF6A 1E2HA 1QDLB 3TD2A 1JU9A 1XRMA 3DE2X 1NN3A 3EFHA 2OBLA 3HLYA 3INNA 3WWYA 4BEVA 1XCOA 2P2GA 1ZKDA 5K8LA 3SVLA 3FPCA 3IAFA 4DLKA 3TAHA 2IIBA 2WTMA 3ZD6A 4C7MA 1NJ8A 4IW3B 4JJAA 5DX8A 5BPHA 1SWVA 1AMNA 3TOSA 2OL4A 4R6WA 1EVZA 5EJMA 5FHQA 3I01M 4ZAZA 4BMVA 2VHZA 4H1HA 2WWHA 1Z73A 3HZHA 1DAOA 3L7DA 1W19A 3QHQA 4GNRA 4YQEA 3PJFA 2ZWAA 3DV0A 1OX4A 1QCDA 4DLUA 5BYBA 1YULA 4EKGA 3K0FB 4GYKA 1OLXB 3LCMA 3UNXA 3WK5A 1I3NA 3K8QA 4GZLA 1J9EA 3SYLA 4BFVA 3TW4A 4DA6A 1M2FA 3DFMA 4IXDA 2C7PA 1EQUA 5EP2A 2O3UA 2ZRMA 4BYGA 3S2FA 1GA4A 3AFHA 1HRDA 2V6IA 5HZGA 5LKRA 5FBKA 2JLAA 2ZPAA 2D13A 4K03A 1QHHB 1RCFA 1RC8A 1J09A 1TIPA 4AJHA 3LLSA 5LDHA 3RSOA 4BVLA 4D2IA 2GM4A 1KK3A 1BQ4A 1I3LA 3V8BA 3AK4A 4AYWA 3AJDA 2B4RO 1JTEA 5DU2A 1IEVA 1Y5RA 1ZJZA 3NAGA 3QEMA 4PYLA 4YP9A 4F0JA 1T2NA 4S1VA 3G0DA 4XCQA 5ECGC 2FR8A 3JQBA 2WKSA 4HZUA 4KO1S 1GRCA 1KFKB 1WUYA 1YUBA 4TN5A 2AB0A 4DJDC 4M2LA 2GNAA 4MAMA 2XDYA 3ZU4A 5AK0A 4HT3B 1FS4A 2DR0A 4CKBA 4XYGA 3N8KA 2FSGA 3BJRA 3CA8A 3FKSD 4HAYA 2VP2A 3SDZA 2H5LA 2ZPTX 3G13A 3D3QA 4ARSA 4GWGA 4CMEA 1X1TA 2RG1A 2RGNC 3KLMX 4OQYA 3BRWD 5J43A 5ITZA 1JSCA 1WP4A 5THXA 5CA1F 3AZPA 4U3JA 3QNWA 3LIIA 2DKFA 1FB5A 3R4CA 1E8MA 4J90A 1EKXA 3VR6H 5IWAB 1BJTA 1C9JA 4O2LA 2XYQA 1EFTA 4BGIA 1Z08A 1E9FA 2A92A 3MLAA 2XKKA 3M9WA 1JHOA 4B8WA 4FHGA 3ZKWB 5EJ5A 3U17A 3COZA 1K4KA 4PHGA 3L4JA 1KVQA 2P6RA 4HR7A 3OA0A 4YCSA 4Y1RA 4DV2B 5CDUA 4H1TA 3HDGA 3IKTA 2CFTA 5F1KA 4BEBA 1U2DA 1RJGA 4M22A 2XWQA 4D4IA 5B58T 1DCMA 3QX8A 4DV5B 2XUOA 3HB0A 2FFRA 5T3UA 3EDYA 4JBWA 1TJ3A 5K0TA 3A28A 4E3ZA 2NSHA 4EMSA 2I67A 2FTKE 1O08A 3ESXA 1E2PA 5BNZA 1U1DA 3DYIA 3H4IA 1NLMA 1MFPA 4NULA 1P6XA 4X63A 4GRAA 3C7AA 2RH8A 4Q1FA 5HKKA 5AUOB 4DDMA 4YJKA 1DG9A 3U7HB 3LDHA 1CP2A 1DPGA 3KJNA 4JZYA 4UATA 4E4TA 4DNOA 5HS6A 7GPBA 1QR2A 2ZUCA 4ZYXA 4RPGA 2Q5CA 4A03A 2PUHA 2X15A 3I72A 4NZ9A 3GGSA 4ZKDA 2OXCA 3I6BA 4XQCA 3ZOZA 4HB2A 1MEOA 5B57C 3ENKA 2ZI9A 5C5IA 1KHTA 1T0PA 1WW2A 4CCYB 1HDIA 1SELA 3B1YA 1N1EA 5J3JA 2QX8A 2HBQA 2FCAA 4MYRA 3QMMA 3TXYA 2R8EA 4R5MA 2GPJA 3E22A 1W7AA 4IGEA 4P0QB 4DQ0A 1F7UA 4AZ0B 4HS9A 2A9QA 2RHHA 3UM9A 5AW5A 2D5AA 4N65A 1FMFA 1U8UA 1G41A 3WKDA 4J0EA 1XMOB 3OJXA 4J2OA 2H8KA 3R41A 3O95A 4GIBA 3DONA 3W90A 4TVKA 3GFRA 1JEDA 2C4WA 1GTMA 1VE6A 3PE4A 1Z15A 3S68A 5ALJA 2Z3ZA 3NBAA 3EJWA 3BICA 4ZFNA 4EO4A 1NE7A 5LZ2A 4M8SA 2ZM6B 5JMWA 3IAEA 1PFWA 1ZWKA 2I6GA 4Y6PA 4PINA 3HY4A 3HBMA 2QEQA 4D57A 1G3RA 1O4WA 3JWPA 3ZGNA 1JSRA 2ZB8A 2LKCA 2HADA 2SKEA 2V6MA 1VG9B 2WF8A 3N87A 4HAXA 1E6EA 1R0WA 2J0UA 2BKUA 3EMKA 5BPFA 3AF6A 4QYTA 2AK2A 3IHKA 1WDKA 3ZIUA 4BQQA 3KQSA 1KI8A 2FP4A 5CT6A 3MQ2A 3PQ6A 1Y1KE 4C6TB 1GLVA 3PD7A 3G9ZA 3IDSA 5JMTA 5A6SA 5AYVA 1L1RA 1CB7A 4OQXA 4XX1A 1KE2A 4NPCA 3LUCA 2RGEA 4CFZA 4I1PA 2PSSA 1GAQA 4FE7A 4LAFA 2A1IA 1B76A 3PX3A 2OC9A 1T4MA 3G0CA 5I7FA 2WMNB 3OU2A 3PE3A 5MGNA 4I36A 2IH5A 4UHJA 4BMNA 4QU9A 1P4SA 3KB1A 1RXCA 2VR1A 3IIEA 1A3CA 3EXIB 3QWIA 3LUJA 4TTSA 3J7AC 2DSNA 2JFBA 4PPQA 4G9EA 1CQIA 3HUUA 1ORRA 4CTKA 2PGOA 1RYHA 3BUSA 5K0GA 1UPBA 1T1RA 2TS1A 5ALSA 1ZLXA 2Q4BA 3TLEA 1OF1A 4UHBA 5DKFA 3UH1A 1CQJA 1T0HB 3FPKA 3H4MA 3L6BA 5CVUA 3WK9A 1SKMA 2RGNA 3O1IC 2HA3A 5ALIA 4YWJA 5L7WA 1IVYA 5J1TB 4BVJA 2QTFA 1Q7BA 1BN6A 2GK4A 3GJYA 4IICA 1UKZA 1Y1RA 4GYJA 4B6JA 2A3RA 3LHSA 3QKRA 3THYB 5G0TA 4KN5A 5MN4A 5HM6A 2AUMA 3BFJA 4RTQA 4UUAA 1AIPA 3SIPA 1E92A 2IU3A 1REQB 3EQ7A 3WK8A 1OWNA 4UEJA 2Z09A 4NXNB 1EVIA 4OHZA 5JJCA 1L4MA 1Z12A 3L7LA 3Q8MA 4CUJA 3E61A 4CMKA 1P6UA 4RQTA 4X8MA 1PVOA 2PUAA 1A7AA 3AG6A 4H0FA 4LBYA 1M54A 1FNSA 1UFVA 1W96A 5TQ0B 1DCTA 1VL2A 3O03A 2ES4A 3VHRA 3H4VA 4A2PA 2RAUA 5F35A 3HUFA 5BSFA 4LJRA 3DDCA 1LLCA 3OTOB 2SKCA 2I5PO 3T1YB 4ND1A 4PYRA 3FRJA 3WFIA 2FLKA 3DAHA 5D85A 3HEBA 4QO8A 1HPLA 5EJ2A 2JVJA 1QR6A 3NAMA 1Z18A 3ZOKA 4MHSA 5JWHA 2GEVA 1MH1A 3S4YA 2J9FB 2OBMA 4J0HA 3F4BA 5ALQA 1F20A 3H1EA 4AKGA 4L9AA 4MQEA 1XZIA 1GQFA 1KJJA 2J3QA 3H6HA 3OEWA 4QYMA 4UZEA 1NNI1 3MWYW 5AKJA 1FSFA 1CF9A 1KOFA 1IY0A 1K06A 1N2CE 1NU8A 5IF3A 1C9KA 4QC2A 5HNKA 2H8GA 4A8JB 1JFRA 2G77B 2EQAA 3DOEA 3FYHA 1KDYA 3M3HA 3W04A 1ZVKA 5DLQC 2VP5A 3COPA 3UPUA 3Q3CA 4IDDA 4HRXA 1E5TA 3T1OA 4L0MA 1GSAA 4KE9A 3HACA 1QHHA 4L8VA 1U2PA 4F4JA 2JFQA 3RHZA 1SUWA 2PKRA 4JNKA 3JQ9C 4PGFA 4DREA 1MPXA 2XOXA 1YKSA 2DFDA 4F8YA 2X58A 2J9ZB 3DCNA 4FFMA 1XZBA 3CVVA 1EWRA 1QQTA 1D6MA 4EO7A 4O5OA 1N6NA 4OXIA 2YV5A 1DKNA 4A4DA 1Y5MA 3KVYA 3Q5DA 1WQ4A 2GTPA 4UHEA 4WOCA 2C54A 2ZBUA 3W5BA 2IKQA 4UHDA 1USIA 4NJEB 1QZ3A 4NXMB 3DTTA 2QP9X 1DAPA 1PGQA 1RFGE 1S3GA 1SIOA 3B51X 3HA5A 3CFYA 2IZ1A 5G4KB 3RNOA 1R9MA 5F7XA 2CLCX 5EHZA 3VHLB 4I5GA 4EDFA 2F67A 3D8HA 2C1EA 3BIXA 3M1IA 1THZA 5K3SA 3ZBQA 4TTJA 1EG7A 1W73A 5C81A 121PA 1ZN7A 4JJ4A 3STWA 4MCHA 3OJOA 2EJBA 2EEPA 4IZIA 4JITA 3R7LA 4IXTA 5EZYB 5GWXA 2K2QB 1LGYA 2FEOA 4LVUA 4R71A 2QG9A 4GAEA 4Y0NA 2OO5C 3WYNA 2X8BA 5D6OA 2BKEA 1DQRA 1V71A 4U6NA 3HXTA 1QB7A 3PUYA 3P1JA 4NMHA 2R6ZA 4MRPA 1M8PA 4PYKA 4MWTA 1V8DA 4BNWA 1QG0A 1G55A 3BC1A 4O29A 5J2TB 1Z5GA 1YKFA 5ALNA 1XRRA 2QV7A 2ZDHA 3JAWA 2QS9A 1NURA 4AURA 1W1WA 4A8JC 4OO3A 1C7ZA 1J0EA 2C4UA 4LZWA 2KQUA 3K6JA 1DDGA 3YASA 1ADJA 4RTLA 3HN6A 5C7OO 1KQFA 2W42A 3LX8A 4AQ7A 4MRVA 4X85A 1RYEA 2GJKA 4UMVA 4CDGA 4RKFA 2EHDA 3FUCA 3O0DA 4WKCA 1Y8RA 1NW6A 3UAWA 3L92A 3CGGA 3PJDA 4KGXA 1W5AA 3JZAA 1VLQA 1H6BA 3BXPA 3HPRA 1P2DA 3TQHA 5KTPA 4G56A 4ZEMA 1ZR2A 5TNXA 1R3UA 3VUEA 4AD8A 5BN3A 5CH8A 2JLUA 4KUEA 4J1NA 4PX5A 3W5VA 2GUGA 4IM7A 1VBMA 3BK7A 1L7RA 3V8PA 3WQQA 3ANTA 3PRKE 2O54A 4ZWNA 3H6KA 4YJGB 3ML1A 4RDXA 1C0PA 2N0SA 3H8JA 4UD2A 3TIIA 3LMKA 4NU6A 3R6LA 4MRRA 3KHTA 2G1KA 1JW9B 1ZEMA 4HNGA 4YMVA 3GFGA 1MAAA 1I6WA 2JI8A 1JAIA 4LUCA 4P3YA 2A67A 2PMDA 5JCJA 1QYVA 3LUHA 3RRMA 3UANA 2XIJA 4X71A 1RQRA 3SXJA 5FEUA 1VCIA 1FUEA 1T8UA 2LR0A 3N7AA 1RQNA 2FMXA 1CR2A 3JQ8B 4LS3A 2YS7A 3PHHA 3I9JA 3MGBA 1R10A 2PR2A 4DGSA 1WDMA 1LVGA 5IAOA 1NZJA 2CZQA 2VAPA 3I9V1 3KOYA 3LY9A 1IZ0A 3QK7A 4YTEA 5B1HA 1U3UA 2FN3A 3BTOA 4LNUB 2IYRA 5FT9A 3RREA 1H1TA 1D07A 1RMQA 3FIUA 1PW7A 1H2WA 5HQTA 1W8IA 3ASZA 2ZBFA 5KZMB 4RPJA 2C94A 2C5BA 4L9SA 4X90A 5IM4A 5I9SA 2CJWA 3FMGA 1A9XA 3ZJVA 1FDRA 1KZ4A 1O0SA 4GQAA 1QWOA 3AT1A 3BILA 2WZQA 3EFOB 4K9MA 5G2OA 5TGZA 4Y6RA 1ZNZA 1DEOA 4KXMA 4URUR 2WM2A 3UAOA 4AAYA 5A5DA 5HZMA 3SC2A 1I94B 4FEYA 3TSOA 4JL5A 1GG5A 4OXRA 3UCXA 5BQOA 4HQ6A 3D0OA 2C31A 3CURA 4L57A 1NVVQ 1NXOA 2XZDA 4CEIB 2VNJA 1NVVR 1ESDA 2G9NA 1RWVA 5BT8A 5ADVA 4QELA 4ZCPA 2VT3A 2G36A 4RAOA 5ICSA 3BDIA 4Q4JA 2CDRA 2Y67A 4XWGA 5EMHA 3EIUA 3ZDEA 4B7CA 2PGNA 5BV0A 1E1KA 1NKVA 4EY3A 1PJ8A 3ADDA 3FNRA 1XZ8A 1W35A 3BWXA 3JARA 2JZOA 5BR7A 3OZIA 1IXYA 4YFVA 5FADA 4QOJA 4AG5A 3G82C 3C3YA 2PJZA 4TZKA 2YZNA 2IWRA 2BC9A 2ZXUA 4KKXB 4BO6A 2DWUA 1J33A 4MARA 1K6MA 1ZH6A 2PRKA 2ZS7A 3HCEA 5DE3A 5C34B 4BZXA 2J0QA 2OP0A 4TQ9A 2VCEA 2FQXA 3BSWA 4RQAA 1P0IA 2VH5R 4LRSB 4OXQA 4DMKA 3QEBZ 3Q11A 2YN2A 1CE8B 2C59A 1LFAA 1UCFA 2KM1A 1XTQA 3AHJA 4Q48A 4YRDA 2B35A 1X7ZB 3MFYA 4M0PA 5CD9A 2EFCB 1GFSA 1JLHA 1XEAA 2JGAA 4X20B 2A78A 3E1SA 4IXWA 3ZH2A 1I6MA 3KD2A 1P17A 1S8NA 1N2IA 4D3XA 3A26A 3QVGA 3QE4A 1DTSA 2WAXA 1QV7A 4G4GA 3ZLBA 4IIJA 8LDHA 1JR3A 1Z37A 2FF7A 2F48A 3DWEX 5KOIA 3JXEA 3QU5A 4B32A 1GTJ1 4NYIQ 4ZP1A 3RTEA 1AUPA 1DWQA 2H7XA 3FFWA 3UMVA 4OLBA 3H84A 2OVBA 1LPNA 3DGFC 4DVJA 4U63A 5FULA 3BBLA 4N5LA 5T41A 2CBXA 3SYKA 1JIJA 5EJAA 3JYLA 1SO8A 3BHJA 3UATA 5AW4A 3B38A 1YB1A 5C7YA 3VZRA 3QE9Y 1KTVA 4INZA 4XSGA 3JRWA 1GCOA 5GOZA 2E4VA 1TAGA 3C6YA 4YR7A 2ADOA 2PY6A 4NAHA 4CMEC 5JPCA 3QLUC 4PFSA 5BRAA 4L22A 4PLGA 5LMUB 4L28A 4HEJA 1U7UA 1KDTA 3FTCA 4GKVA 1E4EA 1MOQA 2XQFA 3CIOA 1CS0A 2GOYA 1BCRA 1XNHA 1XQYA 3L7YA 1ZU4A 2DFPA 4KO4S 2ZQZA 1BH6A 1IPFA 3CISA 3CXRA 2K7ZA 2NVBA 3OWXA 4Z53A 4MPDA 4LFAB 3ZQKA 2QGNA 3DAFA 4G63A 2X23A 2OCKA 4NOMA 3TTSA 1L3IA 1YDFA 3RM3A 3OZDA 4KSCA 4IG9A 2PKCA 3NPAA 5AK3A 5EZQA 5EVJA 3TQSA 3K31A 5F9FA 4CEJA 1CYDA 3I5UA 3I83A 4N47A 3UA4A 5BXYA 5HRAA 1E32A 1YQDA 5FLYA 4UTZA 4WOKA 1ZOPA 3DG9A 3CEPB 1TK3A 1WULS 3T5CA 3CPHA 1FRVA 1Q7RA 4Q3KA 4WBSA 5JRDS 3WNCA 3L0BA 5DW0A 3VO9A 1H93A 1Z5ZA 2VKQA 1B1AA 1JDSA 3CUKA 4OIMA 3R7NA 4EJ0A 4Z5XA 3PRHA 1OWPA 3V34A 2A9VA 1Z4NA 3IPLA 1PQYA 4LJ4A 4CMIB 4MTLA 1GADO 3M3PA 3HR7A 5E7MA 2BRUC 3OZCA 3B2QA 2J87A 1XXHE 2J5QA 1QIJA 1HDYA 1WW8A 1CEXA 3ET5A 5HBRA 1TUBB 4MZDA 1CZNA 3R9WA 2UUCB 3GZTB 3SR4A 3H1GA 1P2TA 4HSEA 4UOQA 3WJ2A 1KGSA 3GFPA 5PGMA 2HM7A 3ZJ4A 1F8FA 2WP0A 5EKDA 4HGQA 2B4QA 2VHVA 2ZBVA 2XCIA 4AJEA 2V0NA 4JUAA 2I3DA 1QOZA 3DMDA 3HN2A 4QRHA 2UYHA 5LUAA 4PZ0A 4LWQA 5JNWA 1UXHA 3K0KA 1W1UA 2A4KA 2PG3A 4KIUA 4WPGA 4HXEB 1CIVA 4MWCA 3W4KA 1X1EA 4A0HA 3KQQA 4YP0A 4L76A 5GMOA 3R8CA 4DLPA 1ODIA 4ZYVA 3AQIA 2OYRA 4CT5A 3FHCB 3LCUA 1FNDA 3CZAA 4MVXA 2IIPA 1LA2A 5IMBA 3ZWDA 1T26A 4GE3A 3RADC 1KR5A 2NO0A 4XRRA 3GOQA 1I3CA 2ZWPA 3NANA 3O7WA 5JHGB 1PEAA 3WDLA 1JHPA 2DWPA 1Q74A 1CUUA 5JATA 3P2IA 1JIXA 1GGKA 2POQX 4HADA 3MAGA 3EGDB 4PIVA 1K4MA 4UVHA 5T6BA 3M1AA 5THKA 3RFTA 3NX4A 3WADA 1SOMA 4F60A 3DP9A 5ICGA 3GUYA 1RLMA 3B6EA 4X92A 4YJ3F 2Z8YM 4A2WA 4YV0A 5ADHA 1J07A 3GGGA 4M9UA 3GCXA 3KCQA 3RBVA 2XUKA 1L7EA 3C16C 3INRA 2ZUTA 5KEIA 2BFEA 3GLIB 3I5XA 4KWIA 5F7ZA 3W7AA 4JGIA 4A82A 1ZN9A 4RHCA 3UTCA 5B2FA 3ZU3A 4WINA 2R79A 3MGGA 4HKTA 3ZK8A 3DUWA 4RS4A 1RYNA 5AP9A 4ID9A 4JL6A 2RIPA 2GF2A 1BN7A 3HRHA 3QV1A 4G0MA 4R81A 5SZHB 4PYNA 4O4HA 1FFYA 3KX2A 1Q1EA 3EWAA 1IQRA 1NMEA 1QYIA 5CPBA 3B89A 5A9SB 1A5AB 4NRDA 1EGHA 4B45A 2YOHA 4TZ0A 1JPVA 4TS4A 5FNVF 2P9ZA 2VP0A 4J1TA 2QRGA 3OP1A 3L2OB 4AULA 3R5JA 4GYYA 1V41E 1W6UA 4ZI5A 4MGKR 5CNMA 2RJNA 4LE0A 3AMVA 4NECA 1XU4A 1Z4QA 1PDVA 5DMHA 2OO7A 2ZVQX 1EDDA 1PGPA 4GUDA 2O8EA 5DBHX 3OOSA 4MW6A 4UVGA 1SMKA 2CHEA 5LZ7A 3TMYA 2FPIB 2WIJA 4Q6BA 1ZCBA 2PUJA 2PH5A 3I4LA 2O57A 3R0ZA 2XDQA 3CT4A 1O6FA 4EJSC 3SZMA 3RS2A 5CW2A 4XVCA 3NP9A 1A5ZA 2Z4RA 1THMA 4ZCSA 2WNSA 5AW6A 1DTEA 4Y2PA 1B6TA 2E4AA 1RQ7A 4ER7A 4HL6A 4PLVA 1AV6A 5JANA 3HC7A 4P7KA 4RDIA 3EDQA 4MITA 4C30A 3I3OA 4JLOA 3ZGOA 2C1ZA 3AU9A 2I3GA 4MV5A 4POAA 5GZ6A 4B6OA 2ZJBA 3BH6A 2ZSFA 4RHFA 4C4XA 1VL6A 4EKNB 1GPUA 4H35A 3DULA 4KQMA 3W9SA 1MT0A 4PO1A 4ZEOA 4TTRA 2K87A 5K05A 1BHJA 1FXUA 4EABA 1Z2NX 3EMVA 2HV9A 4REQA 5EXTA 5FBRB 3K05A 2QZZA 4RKEA 3SDSA 1QE0A 4MUIA 4OB8A 4C22A 1D09A 1GFWA 2RG7A 2OA0A 4MVWA 4GKJB 1B8UA 4XPIA 2HX1A 4G1FA 5DSXA 1BYIA 1ONOA 2R66A 4OTZA 5EG5A 4ERNA 1SVNA 3WNQA 4C89A 5EUMA 1NYRA 5DYGA 4LF8B 4GDMA 1EAMA 1QQ7A 1UC9A 4J0CA 4JLDA 1IULA 5F2NA 2HOQA 1EX1A 1I5EA 1PFYA 4LMAA 3TOZA 2GXSA 1TCCA 4TV9B 1RVDA 1P2FA 1J39A 3KPJA 3VZPA 4B0OA 4W7HA 2I1QA 2YYZA 1P7VA 4IKOA 4DV1B 1HLGA 1VI6A 2F1HA 2EG5A 3IQFA 5FPSA 4EZBA 5ICCA 1Q1NA 2F1OA 2FXVA 4KXUA 2V4ZA 4HMPA 2BIFA 2H1LA 1NXXA 4FBMA 1LDBA 4IMPA 3W6UA 2B6NA 4F3NA 4EGJA 1O6CA 3IILA 4B74A 3I05A 4W5WA 3P2MA 4OHXA 4PSKA 1WUKS 3WGHA 4TLMB 3Q3VA 1DKOA 1K3UB 2O20A 4X66B 2JIDA 3DMTC 1ZUD1 2NTVA 1A69A 4GLLA 5LWQA 2X0FA 5DH9A 5C8YA 1CUYA 1DC7A 3DO8A 4Y6LA 3VPFA 2K2WA 4V0NA 2FEKA 2ZRFA 3PCTA 4ZI7B 2W83A 1DPFA 2M6RA 2X4GA 5EKSA 1WF3A 4UOEA 5JARA 1DUSA 3QF4B 3PA6A 1JEJA 1G16A 4KQCA 1A8QA 2R7KA 4LZLA 1U7HA 5B4UA 4KVFA 2EW2A 4UKDA 3VKHA 1RVV1 2GXUA 3U9LA 2O0HA 2X5KO 5KVQA 2F00A 3WMRA 2R44A 5J47A 3V32A 4BNHA 3HDQA 2WWTA 3V7FA 1KU6A 4C3OB 3DE3X 2H92A 5L3VA 3GUCA 1BGVA 1OD6A 1P2VA 3GEGA 2RGWA 4HXYA 3PZRA 4KQJA 2YY6A 1QH8A 4PE5B 4RSMA 4QXRA 4COKA 3JATA 1H0HA 2VPTA 4EQ6A 1LTQA 4AWAA 1NSFA 1W0JA 1GPJA 3JQFC 1OZ0A 2FJPA 2Q50A 4Y1FA 4PRZA 1FS6A 3V7NA 2RHCA 2VXYA 1JYFA 1UBOS 1H4TA 2KI5A 3NOXA 2VKTA 3QVXA 4QGGA 4AN0A 1Q0LA 4MVJH 4X1YA 4WFKA 2JRCA 2P6PA 4GC5A 3GW8A 3PJGA 4JVLA 2YVQA 3Q8LA 2VH2A 4J76A 2OSBA 4OGKA 4IHAA 2ZRQA 4KAJA 1QMPA 1LDNA 2BMWA 2VBFA 4KVAA 4JJGA 2QJRA 4YDHB 5JPDA 1MC8A 1PYGA 3D02A 3SYMA 3NG1A 3VH3A 3OH8A 1TTTA 1S3FA 3A4TA 2C7RA 3B20A 2YYYA 1YTUA 5JLJA 1B14A 5CJJA 2C5SA 3U48A 2Z9DA 3RIGA 3VU1A 3IP3A 1WLYA 2AQIA 1V1RB 2LTAA 1ARZA 1DUVG 3DZFA 3GP3A 1Z7WA 3BMQA 5H3HA 1EVJA 5DN6A 4IF4A 4KJZA 2WWIA 4OA5A 2Z3VA 1NUQA 3Q98A 3OLXA 4YNBA 4JGGA 2EU8A 2IXGA 1EFLA 3A0UA 1D2MA 3BWYA 1Q0HA 3HH8A 3FMPB 4H1VA 1ZVJA 4CR7A 3T1NA 1JKXA 1PSWA 4ME6A 1YU9A 4TTVA 4I4TB 1XZAA 2FSHA 1N6HA 1VLHA 4Z2YA 3OAAD 1SQGA 5I4CA 4DS3A 3S1AB 2H4HA 1P39A 5FPYA 2ZRHA 4BGEA 1OFIA 4OLFA 3FA2A 1KETA 3K15A 3FTNA 4M53A 4UDOA 5AW8A 4G89A 1NVGA 1ODJA 1G5TA 3QKSA 3TLGB 4BO5A 5JJBA 2ODNA 5J58A