2YZNA

Crystal structure of d-alanine:d-alanine ligase with amppnp from thermus thermophilus hb8.
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
319
structure length
317
Chain Sequence
MRVLLIAGGVSPEHEVSLLSAEGVLRHIPFPTDLAVIAQDGRWLLGEKALTALEAKAAPEGEHPFPPPLSWERYDVVFPLLHGRFGEDGTVQGFLELLGKPYVGAGVAASALCMDKDLSKRVLAQAGVPVVPWVAVRKGEPPVVPFDPPFFVKPANTSVGISRVERFQDLEAALALAFRYDEKAVVEKALSPVRELEVGVLGNVFGEASPVGEVRYEAPFYDYETKYTPGRAELLIPAPLDPGTQETVQELALKAYKVLGVRGMARVDFFLAEGELYLNELNTIPGFTPTSMYPRLFEAGGVAYPELLRRLVELALT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of D-alanine:D-Alanine Ligase with AMPPNP from Thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Ligase
molecule keywords D-alanine-D-alanine ligase
total genus 80
structure length 317
sequence length 319
chains with identical sequence B, C
ec nomenclature ec 6.3.2.4: D-alanine--D-alanine ligase.
pdb deposition date 2007-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01820 Dala_Dala_lig_N D-ala D-ala ligase N-terminus
A PF07478 Dala_Dala_lig_C D-ala D-ala ligase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 2yznA02
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 2yznA03
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2yznA01
3U9TA 4M98A 4EAAA 5C1PA 2YZMA 3JRXA 4YJ3F 1Z2PX 5D8DA 1C30A 4EGQA 1E4EA 2HJWA 1BNCA 3TW6A 4EGJA 4O83A 1AUXA 2PN1A 1GSAA 2W6OA 5LYJF 4XZ3B 1C3OA 4MA5A 5LP6F 4YJ2F 1VKZA 4ME6A 2NU9B 2FB9A 3OUUA 4DLKA 4O7LA 2PBZA 2X0SA 1DV2A 3V4SA 1M0TA 2YS6A 3U9SA 1OBGA 1OBDA 2YYAA 4QSHA 1PK8A 3R23A 3Q1KA 4J6EA 3E5NA 2OLSA 4HNTA 1EUDB 5JQWA 2WYOA 4MAMA 5DMXA 4EG0A 2GPSA 3OUZA 2W70A 4RZQA 5I47A 2XD4A 2YW2A 3BSYA 5BPFA 1M6VA 4O2AF 3VPBA 2DWCA 3I12A 4FFOA 5LOVF 4O7RA 1KUTA 4Y8VB 2QF7A 4E4TA 2CNUA 3WNZA 3HB9A 4IIJF 2W6MA 5CAEB 2CQYA 4IWYA 4FU0A 1EZ1A 2YRXA 2R82A 4TV9F 1WR2A 5BMVF 2CNQA 2YZNA 1JDBB 3U55A 4YBZB 3GLKA 4EA7A 1VBHA 3TIGA 4M99A 1EYZA 1B6RA 2VPQA 5J2UF 3LWBA 2FP4B 2YWVA 4O7VA 2FPIB 4YAJB 3KAKA 2YZLA 1SCUB 3RUPA 3RFCA 4FGRA 1CQIB 2CZGA 2HGSA 2VQDA 3MWEA 3ETHA 3R5HA 1JKJB 3WO1A 2R87A 5C8YF 2YZGA 5KKNB 4M9CA 4FFLA 4O82A 4C5CA 1A9XA 4EA8A 2J9GA 3DF7A 3TIIA 1DIKA 2IP4A 5CB4F 1UC9A 3JRWA 3ORQA 3VPCA 3ETJA 2W6NA 5HBRB 2Z02A 2I80A 1W93A 4IZOA 4TUYF 4MV9A 2FPPB 5H80A 1KJ8A 1W96A 1UC8A 2YL2A 2GPWA 2C00A 4O7WA 5JQGF 4WD3A 1KJQA 3K3PA 3N6RA 3RV4A 1KJ9A 1GSHA 2W6QA 3R5FA 2NUAB 4I50F 1EUCB 3AX6A 5FNVF 3R9RA 4FFNA 1KBLA 3VPDA 3TINA 2VHEA 4O7TA 4O81A 5C1OA 4O86A 3VOTA 4TV8F 3GIDA 4HQ6A 2Z04A 2W6ZA 4YAKB 1KJIA 3NUAA 1JDEA 4M9UA 5CA0F 1T36A 2VR1A 1JLLB 3WO0A 1PX2A 3MWDA 2DZDA 1GGOA 3BSWA 3VA7A 4ZOLF 4ZI7F 4HNVA 2GQSA 1KJJA 3QFFA 2PVPA 3JZFA 2QK4A 4O7SA 5LXTF 4GGMX 3RV3A 2R7MA 5LA6F 5KX5F 3TQTA 2NU8B 3KREA 4O4LF 2XCLA 2YS7A 2ZDHA 2R6FA 2GQRA 4IHJF 2R7LA 2I8CA 2NU7B 2W71A 4MV1A 4MV3A 3KAJA 1M0WA 5GONF 4FFRA 4O4IF 2ZDGA 4MA0A 1Z2NX 4O7ZA 1E4EB 3BG5A 2R84A 2YRWA 2V58A 5HV6A 2R7KA 3LP8A 2SCUB 1ULZA 3MJFA 1AUVA 2DLNA 2FPGB 1EHIA 4O7YA 2ZDQA 4O4JF 3V4ZA 1CE8A 2R85A 2V5AA 4FE2A 1DV1A 5EZYF 1KEEA 1B6SA 2CNVA 4EA9A 4DIMA 5JVDF 4FFPA 2GLTA 4O84A 1CS0A 4O2BF 2I87A 4MV4A 3AW8A 4HNUA 4XYLB 5IYZF 1GLVA 4O4HF 1CQJB 5JVLA 5BPHA 2R7NA 4O7NA 4ZHQF 5JH7F 3G8DA 4HR7A 4NYEA 3Q2OA 4L1KA 1A48A 3ORRA 1I7NA 3U54A 5J2TF 4EABA 5K2MA 1GSOA 4MV7A 1BXRA 3BFPA 3UFXB 1IOVA 2R86A 1KC7A 4MV8A 2V59A 3HBLA 4FFMA 3VMMA 3K5IA 1IOWA 4I4TF 3HO8A 2W6PA 4XYMB 3N8DA 3BSSA 4MV6A 4C5BA 1I7LA 3K5HA 5CA1F 2NPOA 4YB8B 1Z2OX 2DIKA 4IWXA 2P0AA 4XX0B 4C5AA 4WBNF 4ZQIA 1VBGA 2NU6B 3JZIA 3KALA 4I55F 3SE7A 3R5XA 3G8CA
chains in the Genus database with same CATH superfamily
5HWSA 4FTWA 4AMVA 4Z3OA 2AQ4A 3CY6A 2ZBFA 3NG1A 4W82A 1KNQA 3EVCA 4CIBA 2ZJ3A 1U0GA 3A4LA 2VUUA 3EZXA 4MIYA 5HMLA 4BNNA 621PA 5HNKA 1T9ZA 1FY2A 3DBVO 4R2HA 2NZXA 1EE1A 3HZOA 4IIYA 1KAHA 5I9MA 4BMVA 4HAZA 3REQB 4AG5A 3T1HH 4F4DA 2BH2A 3T5PA 4X6LA 1NBIA 4UTXA 5T8KA 1G19A 4AO6A 2VDOB 5FX2A 4D0SA 1QRTA 2P79A 3JASB 1R0LA 821PA 3KDAA 4R05A 2QZ9A 1KS9A 2F3TA 3N40P 3J7AK 1KS2A 5GQSA 2F9FA 4LE2A 5C52B 4KQEA 3X1YA 1XTTA 5AVQA 1Z29A 1UDRA 2E3JA 3HCDA 1J2YA 4UARA 3GU3A 4BYGA 1PQUA 3O8OA 4Y9RA 3NBZC 3GB8B 4JQSA 1RE0A 3H8JA 2W6OA 2JIZD 4H4CA 1GGKA 3RS2A 5FBVB 1FUUA 2GAOA 3A9WA 2CHVA 2V7QA 4KQJA 3S6JA 4TROA 4B2PA 2FOIA 4UBMA 3WGQA 1M8JA 5K3AA 4DY6A 1MTZA 4MA5A 3ELWA 4RLHA 2D5AA 1C0KA 1Q19A 1XXLA 1RYDA 221PA 5EXTA 2P2GA 4BGEA 4D4JA 2AOVA 5ILGA 3WGMA 5EQFA 2ZE7A 4B9AA 1YDEA 4IWNA 1G5QA 5A4IS 1NBAA 1HDRA 1XDZA 2B3DA 2VSYA 3LBNA 3PF8A 4M55A 3C6QA 3A4MA 2GX6A 4KZPA 4F1WA 2NU9B 4OHXA 2MYPA 2YHUA 5BUZA 1ZJYA 2JIBA 3DCYA 1BHO1 4L85A 3ZY3A 1F8YA 5JSHA 2VQFB 3UG7A 5JH7B 2ZCJA 1XPOA 2YWXA 4HDRB 1D0IA 1THTA 5TPWA 1JLHA 1ZVJA 1FFGA 5BVGB 4RLSA 2HR1A 3VSEA 1SQ0A 2BGJA 1SCAA 1BKYA 1WUHS 3AF2A 4RNCA 4EMTA 4I5IA 4ZU6X 4ZQCB 1H66A 4JYZA 5LIPA 3UZUA 4AZ0B 3G6XA 3MT8A 4FXPA 4QRIA 3DL0A 2WD9A 1ULAA 4RIIA 3Q1KA 4WCFA 1JXMA 2OV8A 2CCJA 1P7ZA 5LMUB 1G21A 3PW5A 2HDOA 3WFJA 3FZYA 4ER6A 4MQUA 3GP3A 3REQA 3DAGA 1IK4A 4CEJB 3I5YA 1E61A 3QKRA 4BCCA 2X86A 4COOA 3C14C 3LOQA 1YS1X 2W2QA 3KFLA 2QMOA 2OXIA 3U80A 5DGAA 5FO0A 5C4GB 5IVPA 3PNBA 3ER8A 2FKNA 4RZQA 1FRNA 1O4WA 3EF3A 3NBYC 1BS2A 3RNOA 3B2NA 3CXUA 2JHFA 3R8CA 3X1ZA 3KB8A 2YJ6A 4AT1A 1AN7A 2CKZB 3PXGA 4EI9A 1JFFA 4IGAA 4EA6A 4KVZA 4G67A 1RC1A 4MHOA 1S5PA 1UINA 1C4XA 4GR5A 3EZGA 3IR5A 1X7YA 2V4MA 1MOPA 2A33A 2Q3LA 3BIWA 2ZATA 4UREA 4LG1A 2FXVA 2PJUA 3RANA 4XSGA 3ROXA 2QF7A 2H51A 1PL0A 3RIMA 5TT1A 5AKGA 1M1YB 3DNPA 4NENB 2XMBA 3H5RA 1NVVR 2W6MA 2DWOA 3BQMB 4NBVA 2P9BA 4F3CA 3GIPA 4HO1X 4IYRA 2HEIA 3LBHA 3T7AA 2DG2A 4PAGA 4AX4A 2B6NA 2V4UA 1B8UA 4NCBA 4UFOA 1F2TB 1Y63A 3EPGA 2HRBA 1TJNA 3A4IA 1W44A 5A71A 1W88A 3KQHA 4OGWA 1X9HA 4Y2VA 3OSUA 4RXMA 1Z6XA 1SQGA 2F62A 1W581 3DUFA 4RMNA 4BVHA 4Y6LA 4F84A 3N2NA 5C1BA 3B7WA 4KV9A 4PCAA 3SS9X 1W4CA 3DF9A 3BE5A 3EQ2A 2W8KA 3O47A 4D3XA 5KQMA 4DQDA 4DR3H 3CNNA 3ANSA 4Q44A 4GDFA 3L01A 3D81A 3VX3A 4HAWA 3OZVA 3JQEA 5TEWA 4DSOA 1LS6A 1WW3A 3DBOB 1SU4A 4NMMA 2IXBA 1H2HA 1FMFA 1H3FA 2I2XB 4MUNA 3KE8A 4MCIA 2PFKA 1GNTA 2CLSA 4GLOA 3RVPA 4E88A 1XVUA 4D57A 3HZHA 4FW9A 5DCYA 2UXCH 2GCNA 1KQNA 2PANA 2H59A 3WZ2A 1H2FA 4ZV9A 3T7CA 4C01A 4C7XA 4BQIA 2C31A 1UZNA 3BGWA 3LKVA 5FD6A 2QEQA 1D8TA 3AXTA 3GT0A 3B6ZA 1T5TA 3OQHA 4I1SA 4KXWA 2H0RA 2FP4A 3MFHA 1Z5PA 2QMEA 3UNXA 4IGKA 3JCZA 3UVEA 4RDHA 5ICCA 1LTKA 1PR0A 3PT9A 3I6QA 1JKMA 1XL1A 2C7GA 2NLOA 3NRCA 3ND6A 1U1FA 3GEHA 3K0BA 2PV0A 2ATLA 2HV8A 1ID8A 2C29D 4BKUA 4R9UC 3ONNA 4RZRA 1SB9A 1F6BA 4ZVPA 3T4UA 4BP8A 2ZB4A 4HEJA 2ZI4A 2Q9CA 4DT1B 2Z8XA 3ID6C 4DQXA 5JXWA 1M6VB 2FRVA 1UPFA 1JVNA 3IVAA 4IIVA 4H27A 1JIHA 4Q9NA 3T38A 1KZ9A 2H2DA 1FTGA 3CUKA 1NBME 2OYRA 2C7RA 2PZFA 6REQB 2HT6A 1C9DB 5IT9A 3O26A 5EE3A 2ATCA 5K0GA 2NU6A 3KKPA 1W47A 4GIBA 1G3QA 1W96A 5HRCA 5EJ6A 2RK6A 1PVDA 5H8WA 3ZBQA 4DC9A 1SCQA 3CV3A 4WIAA 1Y81A 2Y1FA 2C7BA 4WGGA 2XXAB 3HQ4O 1SUCA 1EQUA 3PW2A 3ROKA 3BE6A 3GRAA 4PANA 3HPRA 3PO2G 1L4GA 4LBYA 4REQB 1DP4A 4ARZB 5I9LA 1FDIA 1I51A 1LQTA 1LXCA 2H4HA 4EPVA 4AQYB 1IRIA 2IDZA 1SGWA 1DWQA 1H5UA 2WDZA 1MG5A 4HDAA 4D0RA 1T2CA 1AUPA 1PSDA 1XEAA 4AUKA 2AZXA 4OOFA 3G89A 5H9VA 3DDSA 5K20A 4DL5A 5AQEA 2ZUTA 1XZMA 4O63O 5JUWA 3SHFA 1WUIS 2ZIFA 3GVXA 5FLMG 4G1FA 4WQMA 3SJCA 3RG2A 3EW9A 4FONA 4OGGA 3VTZA 1SKBA 7REQB 1BYUA 1K7XB 5BSMA 3QUAA 1VLZA 5KJCA 4B17A 5SY6A 4CKWB 4R2IA 5IT0A 3KTAA 3R3SA 2WM8A 4B0PA 4HVCA 2JFXA 1YZTA 3H11A 4P33A 1VL2A 2O8VA 4D4KA 1JAHA 2ERXA 3I1IA 3M4NA 3M9XA 1TZMA 2WAQE 2C42A 3PWKA 1UBRS 3KLBA 4I4CA 4QXMA 2RH8A 2ZYAA 5KTOA 2BFAA 5C0OE 3DE0X 1YQGA 4AJHA 4BCBA 3L79A 1S9HA 4HDSB 2EERA 3WWHA 1CF2O 1D2EA 2HXGA 2RCYA 1AKQA 2PUJA 4PAQA 4XX1A 5BOSB 3WGIA 2DXIA 2VHEA 2YXLA 1XQYA 4JYAH 4A5SA 4CCYB 3IMCA 1EFRD 4OJYA 1TU3A 1U0OC 3L04A 5JNLA 5DWDA 4YMIA 1VAJA 5FYQA 4BVLA 5HQTA 4HG2A 3FNEA 5C8DA 3WS7A 4A73A 3VZSA 1U6JA 2BGNA 3DMHA 4KGXA 5E4TA 5KNBD 3KR2A 2CB0A 3G0GA 4KXXA 1GQRA 1UDCA 4MJ7A 3JQRA 1YZKA 5JRDS 4CVNA 3ZWXA 1FRQA 3ECCA 4GI7A 4MI9A 3PKJA 3U3OA 1T3HA 1YAJA 1XAHA 3U1BA 2AN5A 2D7JA 2EU8A 4CTJA 3IPAA 5JBIA 4WN9A 3A1VA 1ADYA 4XLTA 3M9WA 2J9ZB 1GVNB 2Y6UA 2GFHA 4D9KA 3P0IA 2OGWA 5JALA 1TVEA 3TO5A 3TZKA 2L0XA 1TWAA 1NJ6A 3VA7A 1A2BA 3TOXA 3TNLA 4IOMA 2ISSD 4HNVA 1XCJA 3OP4A 4RTJA 2PT7A 1VBNA 2QRVA 4OQYA 4ENRA 3HSSA 4O7SA 2YHIB 1RQXA 1E3JA 2VSQA 5LXTF 1Y37A 1E9RA 3CX6A 4IMRA 1I5OA 4OUKX 1ZIXA 5C2JB 3P4XA 1A4IA 1UBEA 4PFSA 1K3FA 4LH7A 5BYJA 4AURA 4H59A 3OJEA 3NP9A 3CLSD 2OZEA 3UMFA 4UMEA 5A9TA 5LA6F 4OMCA 2Y92A 4AYWA 1I2AA 4WY8A 1Q6ZA 3C8ZA 2MWMA 1BRMA 5K2OA 1K3TA 1VP3A 3OOWA 4BCDA 2ZREA 4KPUA 2OAP1 4BO0A 4EB0A 4QT0A 4YDQA 1EX1A 3NCTA 4O4LF 1HEYA 4DIOA 2C9CA 5I8WA 1EGVB 2YN4A 3P4UA 3D02A 4RJIA 1Z22A 1GAWA 5DI3B 2VHWA 4UFZA 3HDQA 5KNCA 2VNKA 2QLTA 3H0GG 3ZZTA 3W5VA 3M4XA 4AJJA 2WK1A 4J94A 5C37A 2K5UA 3KXKA 5JANA 1NURA 3KZOA 3OZTA 4GVLA 2RIRA 4WOBA 5U1PA 3U39A 1JSCA 1M0WA 2G3YA 3ZVNA 2QDXA 2VK8A 2W0MA 2BFEA 4FFRA 1JHZA 3DOHA 3QXHA 4JCCA 5LQUA 2DTEA 4ZJUA 1NR7A 2H4XA 5DGHA 4R31A 1BVYF 2Y1WA 2D5LA 4GXRA 1J2EA 4MUYA 3VNUA 2WWRA 3FMPB 4JC5A 1WUKS 1EWRA 3BF7A 4ZTBA 1XU7A 3HCFA 5G41A 1UKBA 1F2TA 1VB3A 5FRDA 4M46A 2WV9A 5EP1A 1N34B 2DR2A 4HEQA 1XEFA 3FPLA 4X1IB 4MQ4A 1DTWA 4KREA 1K5DA 2FXIA 2QUHA 2Q27A 2B61A 1T5SA 1KQ3A 3I9MA 3OOEA 5YASA 4DY4A 4CL2A 1PJ8A 3MJFA 3WAJA 4YRTA 4V39A 5ESXA 3TWOA 4AZ3A 4BWYA 3TL3A 1Q12A 2DLNA 3DAFA 4EX7A 3GXOA 4A82A 4YMLA 1P0CA 2O7NA 3W3AA 1RRPA 1XN4A 4WWHA 5JDCC 2V5AA 4K2AA 1X13A 1EM8A 2BZ1A 3K6SB 1U31A 4YQZA 4A93G 3KETA 2YUTA 4YECA 3LQFA 1J5EH 1DKRA 2BEUA 1SZCA 3C5CA 4Y1RA 2ZIZA 1YFKA 3N86A 1IBLB 4JI4B 3C3EA 4BQQA 2O5CA 3V97A 2Q4TA 3GO4A 3C8DA 2AC4A 2GDJA 3IO3A 4N8SA 4YRKA 1FMCA 3PGA1 4MGYR 1FXWF 3ACBA 2AFRA 4WZAB 1WBBA 4M8NE 5KAMA 4M0KA 5DTJA 2KHZA 2ZYUX 4TSFD 3QELB 5CJPA 2O8EA 2F6RA 3RYFB 4PO3X 3VR3A 2GZ2A 3WP0A 3I6ZA 3JZAA 4CF6A 4I50B 3H1AA 3O4RA 4AN0A 1C50A 4UQLA 4Y9SA 1USGA 1BW9A 4QEKA 2NN3C 1N1DA 5K3BA 3VAYA 4EMSA 1ZQ9A 4EJFA 4BMPB 5LB2A 4B3RB 2B6HA 1XMSA 1N33H 1JHRA 1PEAA 2NO4A 5BR8B 2FPMA 2H8KA 2D3TA 5ALPA 2E6UX 2EQAA 4A27A 5HZMA 4FCTA 5THQA 3TR5A 3IHWA 4KVFA 1VIMA 4QFMA 4DPMA 1YOBA 1YJAA 3MMSA 3GZNA 5DLYA 4ZANA 3L7KA 3TX2A 4N48A 4OQXA 4CI0B 3L0BA 4EJ6A 1V45E 1P29A 3EA5A 3WHLA 2GERA 2PBLA 5KMGA 2AL7A 5F2KA 1WZ2A 3JSXA 1XAJA 3ZJVA 3JYQA 2IYRA 4KN5A 2FTKE 1KVUA 3V6KA 1LWOA 4P82A 4PGMA 1SUDA 1SQ6A 3SM3A 4C4SA 1MD9A 2YV3A 4CIAA 2FPKA 3VZBA 4J7UA 3NPMA 3SR4A 1YZGA 3L8HA 3CKKA 4F2HA 1DKMA 5T4HA 3D6UA 3UJ7A 2QD1A 1H1TA 2WP8J 3WRYA 5T5QA 1F7VA 2VBIA 4HPJB 2LCQA 1SEIA 4O4IA 3FOEC 2QAGB 1UJMA 3GFTA 2QQ5A 1R0KA 1VKOA 3OT1A 3R0VA 4ND5A 5CUQA 1U9ZA 3GLRA 3GK3A 4EJSC 1DG9A 4UDXX 4IIFA 3TW4A 3AKCA 3AEUB 4QGFA 2HGXA 3TYXA 1IBMB 3I2IA 1IL0A 2NXCA 2A0UA 4FHDA 2DPJA 3WLKX 3OIVA 4IJ5A 4J8PA 1RYSA 5MN5A 3MWDB 3LPDA 1JIUA 2XECA 3KD2A 2E2WA 1VMAA 3NBYB 2OHGA 3GJRA 2EKBA 1ZD2P 4N0DA 4EHJA 2XE7A 3MWLA 1ZR2A 4F91B 1ZU5A 5GJVC 1MB4A 5CA0A 1HGXA 4NQRA 1MT0A 1VIVA 2ATIA 4W5NA 1KDOA 4MI6A 2WFLB 3I9V6 4H35A 4WASA 3TQFA 4EY5A 1Q7BA 3FWPA 4Y6GB 4H6VA 3TXYA 4ZAWA 5F98A 4D96A 4D0LB 3WIOA 2QY6A 3HL4A 5I5EA 3KU4A 2PL3A 5AM0A 4B3SB 1W25A 2VAXA 4YMGA 2HA3A 4F46A 2PMZA 5L1KA 5HFAA 3J81W 1ITZA 4WLFA 1TT5B 2PG3A 3TDNA 2QIPA 4MKFA 3U4QB 5BVHA 5DTIA 2QTAA 1UEXC 5FBLB 4WZBB 2NZJA 4JJFA 3V7FA 3VJLA 1SBZA 4M21A 5KFQA 1AKTA 1J99A 1RCTE 3FVQA 3NC4A 3DLTA 3AVWA 4YT5A 1GP2A 3ZU3A 2C77A 3EY9A 4NLLA 2K7FA 1O5IA 2H7VA 2OV3A 1ZMTA 1U5AA 1A8SA 1GQ2A 1LB1B 3ZGNA 4BNDB 3EVBA 4FC6A 2X4IA 4UHCA 5CYOA 3K0CC 3OQIB 2EHDA 2IV7A 1E4YA 3H19A 3MFIA 1AJEA 3SC2B 2A1HA 1NXVA 3EQ8A 3ZI4A 1TIBA 2JGFA 5BN5A 3FUUA 5C1PA 3JRXA 1FSSA 1I24A 1QOPB 1WKBA 4PWQA 1BXRB 2JLAA 1CSEE 2BT4A 3NTVA 2R79A 1JHQA 4Q4LA 5BXYA 4YJ3F 5KT3A 1JIIA 1UKAA 2GM5A 3PR4A 4TQUS 1UL1X 1YE5A 3FTQA 1U2ZA 5DBEX 4PZPA 2C84A 3GLFE 1TPYA 1KMHB 3TW6A 1MOQA 1N9GB 1IUNA 2VXCA 4Q24A 4WGFA 5CLLA 4PAMA 1LX7A 4JH0A 4YRLA 3TRFA 5AVRA 1H05A 2V9CA 2VG8A 3E48A 3A1WA 4MW6A 1W76A 4D92A 2KBFA 3EEBA 4B3HA 4J9RA 1PJBA 2PN1A 2HN9A 2C82A 1A97A 3T5LA 1JYSA 2WWIA 3BWVA 4BO1A 5J58A 2B78A 2IYEA 3RFFA 2PS1A 4CU5A 3LV8A 5LYJF 4E14A 2APJA 3WC4A 3JSAA 3AT1A 3RR2A 3TKYA 5IWAB 4UULA 4Q93A 2HF9A 5EIWA 3DNFA 1JHDA 4WKCA 5ERGB 1ECJA 5JXHA 5LPNA 1T8PA 3ZXSA 5L6MB 4K6FA 1FTSA 2PXAA 2QTCA 4HGNA 3VR6H 2FE4A 2J67A 1W87A 2XMPA 4Z9XA 1DFHA 4JI3B 2VWGA 4Z9FA 4MMXB 1NUTA 1G42A 2IYUA 5IKPA 3WWIA 2AKAB 1M2WA 3LDAA 2F3UA 2CMGA 2MDTA 1T36B 4LOIA 5AJZA 5I5WA 3L4KA 3V4RA 3EGCA 1TAUA 4E94A 2X1VA 3NU1A 3SVZA 1QXSA 1VFNA 1E59A 4P4NA 4CBVA 1ZH4A 4PX3A 4WESA 5FR2A 2G5GX 1KEKA 4C0BA 4PV7A 4C3UA 1H2EA 5KFEA 3KE9A 2AF4C 3BS4A 1XTUA 5AVZA 4CEHA 2ORVA 2V74B 1G60A 1ZD9A 2QLLA 5B3KA 4WCVA 3TMKA 1X1RA 3BL5A 1VE9A 1QS0A 4Q3KA 3TUJC 4CC6A 4DSZA 1ONNA 1WSAA 3CR8A 3VUFA 3R6WA 3SSOA 2VDVE 4Z0TA 3WK6A 3DUWA 5JSQA 2ZU6A 4PQGA 4G4SP 2EOAA 3DEZA 3F7NA 3PJRA 5SZIA 3M6IA 1KK3A 2P4HX 4Q47A 1EUDB 3WKBA 4P83A 2I2DA 1WQ1R 4Z8XA 3E82A 1CRPA 1ODIA 1YT5A 4FOLA 3K71B 2A9JA 3LW7A 1QYIA 4RSGA 1Z33A 3TEFA 4DM4A 3S81A 4UATA 5DM60 1R64A 3G1UA 2F8SA 1NXOA 3ZWVA 3PX7A 4MVWA 2EWMA 5JNUA 1F6DA 2H1WA 2PT6A 3VDMA 2COIA 2CLHB 2HNKA 4G0ZA 4LY0A 4ZCLA 2QTNA 2QBYB 3FHJA 1FYDA 5GMOA 5BW5A 3RNLA 1DKLA 3AV3A 4KIFA 3S3TA 3TNYA 4C7OA 1HE3A 1NUQA 3L0SA 2DFPA 2WJWA 1W0KA 3H2KA 2W2LD 3MUFA 2NVWA 4OAQA 1JDJA 4B5KA 5ALDA 5JD4A 3NC1C 4Q4JB 1A5SB 3C3CA 1OFTA 1OX5A 2VK4A 4M9RA 1UJ6A 2J9YB 1TW3A 5CX1A 5BRAA 3F74A 3H3JA 4RF4A 1BWQA 4EHDA 1E3TA 4R40A 5TSDA 3K0CA 1UMDB 1U9YA 3H4TA 3UXYA 4UPEA 3S2FA 2CQYA 1OPRA 2EAUA 4QASA 1G55A 4FZVA 1CIPA 3PD7A 1E4GT 1FNNA 1R6VA 1G0OA 5BMVF 1E6KA 2FX2A 2GJAA 4BAZA 2CLKB 1NVAA 3EWIA 1G9XA 3BTOA 4TQ9A 1DSSG 1B43A 5IUKC 1YS7A 5JNVA 5JS6A 2B35A 4HN2A 2XI4A 1GFZA 3FGOA 4HC4A 3EBLA 1VMIA 1Y7HA 3SZLA 5KTTA 4TZ0A 2BBSA 1OLXB 2EZ8A 2IX3A 4U6SA 4YYZA 5M5BA 4IGEA 1T2VA 2F4VB 5FF9A 3DOIA 5K6AC 1IQ0A 3M6FA 4RY2A 9ATCA 2RKWA 4D46A 5JC8A 3FWYA 3H4BA 2C5FA 2ECKA 1GKIA 2P41A 3HA2A 2Q2UA 3UKOA 1KU0A 3A2NA 2WTMA 3OJWA 5A02A 5CB4A 2R5NA 1LQ2A 4X3OA 5BR4A 3MBKA 2AZTA 1L5VA 2ZZNA 3O73A 5F9HA 3L92A 3ZOKA 3HLKA 3PGXA 3HGTA 1IATA 4K1LA 1RRCA 4QW8A 1T3NA 1WR8A 1SCJA 3LQ1A 1HRDA 4I1YA 4LRSB 2DECA 5E2BA 3SHOA 2BKXA 1SD1A 2HGZA 1X8KA 3HBMA 2NT3A 3INYA 4KQWA 3E3LA 2GJ8A 1LPNA 2QX7A 2V96A 3ZJUA 4DMFA 4BN4A 2JGLA 1ONPA 2AG1A 4DCPA 2GN4A 2HIMA 2NVYA 2IA5A 1OOEA 5G0SA 2QMYA 2Q41A 3EDQA 5DSZA 4Q1FA 1RADA 1N34H 2XWBF 2I2BA 3V1NA 2JIPA 2VPTA 3FOWA 4PHCA 4WXYB 4CMCA 1QU3A 3IAXA 4S12A 4YR0A 4OHVA 4D9CA 2W2PA 5A4AA 5CDSA 2PQ2A 1C9EA 4BFVA 1IFXA 4MS3B 4DF3A 1HMPA 2W6NA 2O9JA 3NRBA 4I46A 5E2IA 2C07A 4JAVC 4LI0A 3OSNA 1P0PA 4AW9A 5I01A 2Z58A 3TQHA 2Z43A 3ZX4A 1QIIA 1DX4A 4ATNA 4ZT2A 3EEFA 2IGBA 2KS6A 1UXGA 3DAYA 3QXJA 4BLVA 2O8BA 1N6RA 3VHQA 1UC8A 1A1SA 1GTMA 2LIPA 1TEVA 2GARA 2RONA 3K8YA 3LRXA 2AFIA 1H2ZA 5IARA 3DE2X 4A2WA 1FFAA 1H5NA 5F7OA 1E7RA 1KVQA 1RZ3A 1SR8A 3QWHA 1KI6B 5JQGF 2VJPA 5A0FA 5IBCA 4HUQB 5C35A 4DAAA 4N5NA 4I14A 3QU7A 3E61A 1OWOA 2GK4A 4TL9A 5KTSA 3W9SA 3PLNA 4K9NA 1BD3A 2UXBH 3COYA 2VUMG 3BSFA 4AVYA 1XP8A 4EJSA 2E4VA 3OM9A 1NMSA 3LX8A 3H42B 3QMWA 1WXFA 1T6BY 4LHWA 1DRWA 5KFPA 4RVHA 1RLTA 2VBGA 7YASA 3K70C 3PEUA 2X1LA 2PVSA 1YTUA 2PU5A 2Q4OA 1D0SA 5GIOE 2OILA 2Q2TA 1XWWA 1XRNA 4QNRA 5GTDA 1F1JA 3M4IA 2VYND 1Z8DA 3RC9A 2PX2A 1A50B 3R9RA 3QPBA 3CVWA 1DLJA 3ZLVA 2EJWA 4D9HA 3BH7A 1OLSA 2A5DA 1UQUA 2AEMA 1IVYA 4CDGA 2JFWA 1ZH0A 1E2FA 3CPEA 3ZIAA 3R3WA 1SHUX 2JI9A 1K98A 3D3JA 3NYQA 3IBTA 4ASUA 3W5DA 5KFFA 1N9KA 1F4VA 1C7ZA 3W77A 3BDAA 5IYZA 4V0NA 1Q77A 2RGNA 4WL0A 3O38A 1CR2A 2N75A 4TT8A 1DEHA 1QH9A 2HU2A 4OYRA 4JXXA 1P0MA 1A76A 2PO5A 1AKRA 3EVFA 4MJLA 3R7FA 1UAGA 4DR2H 3IQHX 4UE2A 5HJ7A 3EIXA 1TZKA 2OV6A 1KY2A 3KTFA 2KYRA 2HV9A 2ETXA 4KQFA 4L0MA 4FT2A 4D9JA 2Q7DA 1FFBA 3DFZA 4ER7A 5KEIA 1N32B 3EIUA 2XVYA 2REBA 2XIJA 4N49A 3RDPA 2ZRHA 3NWOA 2XT0A 4YAKB 2YZ7A 3D54D 4L9RA 2ZXFA 1JWAB 1KPHA 3WNCA 4EJMA 4NMLA 4HH3C 1P60A 3SR3A 3EYAA 2RHRA 2G6TA 4J0CA 3LY9A 3TVYA 2VR1A 1QHXA 2HHLA 4O1HA 5ER6A 4LZNA 1U04A 4Z0HO 4BPRA 3WO0A 1RXEA 1WOMA 3GRFA 3HSYA 1N5DA 1PX2A 1RIFA 3H1PA 1NFRA 2M32A 3GLIA 5ITWA 2ZWVA 3UV3A 2DZDA 2WAYA 3O91A 4CG3A 2JLBA 1ZAUA 1T4DA 1KWGA 4ZK6A 4YI3A 5IK2A 4ZOLB 2QK4A 2YWHA 3ROPA 3HUTA 1HL3A 1UKEA 3DDNA 2EYQA 1NQTA 3ESYA 1ISFA 3DT8A 2YJZA 4FLMA 2AGOA 1P5FA 1G8SA 4LDAA 3CTPA 1XMVA 1U3GA 2R7AA 2I33A 3T1VA 2R4QA 4JN6B 1WKCA 4U7HA 1TF7A 2BQRA 2Q8NA 1IXZA 5EJ9A 1H3EA 3TQTA 1FSGA 1KIAA 3BDVA 1Z6PA 2ZWAA 3QNWA 3U3XA 3DTYA 3C39A 2I7XA 4NEGA 3KSUA 4MDFA 5JJLA 4J2OA 4K0RA 3T12A 3FPFA 1FVIA 1ZD8A 2FZCA 2YS7A 1KJNA 3H99A 3ILVA 1EFTA 3LUFA 2V6JA 3LQRA 1NFFA 4JR0A 3ZS8A 2GB4A 2NUBA 3AI2A 5CIWA 1T3LA 4K3VA 1NOIA 2WKRA 4PZ8A 3AF4A 4ML3A 2W98A 3HU2A 3N76A 3FBWA 2CXXA 4UJ3A 4F5DA 1QKKA 4R8KA 2JGIA 1XJWA 2NO6A 5CFOA 1SULA 3AXSA 4M7EA 2BFNA 2GSDA 3GAZA 4CLRA 2WMYA 5F9NA 4ALLA 1QDUA 1O5OA 4BBZA 4DQUA 4ECXA 5LB4A 4COKA 4O2AB 1ZGAA 3ENKA 3H9CA 5KG2A 2J6SA 3I61A 2V0CA 3R75A 3OLVA 1YV9A 4RPCA 2JLZA 1KYYA 2HJVA 2RGBA 3VC1A 5LQAA 2EWVA 5SZHB 3QTLA 2A57A 5B58T 1E4EB 2N0SA 4V3BA 1QUFA 2NXWA 3LDGA 4R8VA 2YRWA 4R8UB 3O6VA 2X0RA 4Z8YA 5EJ8A 2FLNA 4JYCA 4F04A 1T25A 4DQKA 1UC5B 5HV6A 3ZHVA 4WBNA 3C8MA 1X80A 3GD7A 1W85A 2BFCA 5TGZA 5SZJA 3GRUA 1RJDA 2DHQA 2WMNB 3CO5A 3EZFA 3HEMA 3K20A 4O59O 5H82A 2NP6A 4MB6A 1BHSA 1KEVA 1VL8A 2Z30A 5LP1A 3GWGA 2BP7B 4LY9A 3SC4A 1G9SA 3TEKA 1NM5A 1E9FA 4TMXA 4YP7A 5LBIA 3UXEA 1IMOA 4WY5A 1NJ8A 1FXUA 2Y0DA 4YMTA 4ZVNA 1WQ3A 1IYZA 2IU3A 5ILQA 4W5OA 1JNXX 3NHKA 2DR0A 1RYNA 2IEZA 2ZTHA 4DR6B 4ZKEA 4Y6PA 1R9NA 1C7QA 2NO0A 2XWQA 4BO2A 1GZUA 4F2GA 2C4HA 1AGYA 4H7IA 5GGXA 3L1VA 2P9ZA 5KVQA 3T1QA 1NVWQ 2GCOA 3KOYA 4HWOA 1GNSA 3WB2A 2WA2A 4DJDC 2E7ZA 4JQOA 4V1CB 1IN4A 4PPYA 1MVNA 1OR8A 3I09A 2I7DA 3EEOA 4V0QA 2DEUA 2QX6A 2JI7A 2GEFA 4J90A 4DA0A 3WLHA 2VJMA 2PUTA 3VV2A 3CSWA 3AHGA 1Z38A 1DO0A 3B6MA 2NVUB 4ED0A 1B8PA 3ABSB 3AP2A 2DY0A 2G36A 3I2HA 3AR6A 4TTTS 3A11A 4HWTA 5AXAA 2CXTA 5T8KC 2IPAB 3L7NA 3WB9A 4Q8FA 3VPXA 5IYZF 3FW1A 1MORA 1C8VB 3GJZA 1GLVA 4M88A 1OWLA 3RUIA 2R7NA 4Z3DA 1OAOA 4I4NA 2JA1A 2I99A 1SZJG 3RJ9A 5CBPA 1EKPA 1J06A 1YVUA 5LOVB 3RGZA 2O2GA 1SXJB 1I1MA 2YJTD 2B25A 3GTJA 1IG3A 3AR9A 3KHLA 3EJ6A 3FTPA 3FSJX 4R9SA 1DQZA 5EC8A 4RIFA 4JWTA 2OQIA 4BLSA 2KSWA 1GRQA 4FR5A 4O2LA 2ZJBA 3BD6A 1XXHA 3ZDQA 5KG1A 2VAMA 3FLBA 2F1IA 1DO8A 1FK8A 2C9DA 3RSCA 1R4NA 3NB0A 2FF5A 4EH1A 1A9TA 1YS2X 4XYLA 4QTTB 4CE6A 3CG4A 1XCGB 2NXNA 3O4GA 1HWYA 3B8HA 3H0EA 2IZ5A 4IXWA 1D2CA 2JHCA 1PD1A 2ENWA 5CDFA 4C76A 5JTUA 5F3WB 4U0JA 3H2IA 3QVVA 2AEJA 2OBLA 1RK6A 1M2OA 1P8JA 4IIDA 4RMJA 4Z3KA 1QHIA 4KBYA 1FFHA 5E7IA 3GV5B 2BGTA 3L49A 1XMOH 2VJKA 3QNUA 3MBOA 4B4WA 2WT8A 1S2GA 2QQ0A 3KVNA 1QG0A 4DM7A 4OL0A 5CITA 1TC2A 1TLFA 2I2FA 4GLLA 3DZCA 3NP7A 1XQ1A 2YXBA 2NUTB 2XMZA 3LY7A 5K51A 2VPSA 4FGUA 3GAMA 4AUNA 5HF5A 1DIGA 1KZ4A 2QZJA 2P6RA 4R54A 1Q0LA 3LM8A 1X9NA 1K5GA 3BXZA 3TG2A 3ZPXA 1I1OA 4YAGA 4M37A 5C7LO 1V39A 3L0ZA 2GBLC 3QXGA 4KJZA 5KQSA 2O3JA 2W37A 1EI9A 1XZNA 1FYVA 4PXSA 1X0XA 4BMSA 4W1PA 4EOGA 4QWWA 5AW8A 1I7LA 3GZTB 4GQBA 3KJNA 3DD5A 4BQRA 2OFPA 2JBAB 2V5UA 2H00A 3H84A 4M38A 4JI0B 1DJNA 3GDFA 1V5GA 4JB2A 1NG9A 3LHSA 3QENA 4QA9A 1AURA 2AQIA 5EHIA 3NC0C 1L4UA 1GXSB 3QMVA 3ZY2A 1K9VF 2QJWA 1CKOA 1RI2A 3L8FA 3HS3A 3NEPX 1FX1A 4I55A 4M1SA 5DWVA 2IS4A 3GFBA 4CKYA 4AKIA 3KZNA 2AFVA 1NW8A 3MR2A 2WIKA 2Y66A 1J9EA 3GJ0A 4CKEA 4NPCA 4YRNA 3W8FA 4I1UA 1X9IA 3NYRA 1VKNA 3FDZB 3WKAA 1KJZA 4Q12A 2P1ZA 1G5IA 1PW5A 4OSOA 1J6UA 3D3NA 1DIRA 1ODTC 3I73A 1A5TA 2Z2ZA 4OK3A 2QORA 3DEHA 3L0OA 2VJYA 3DG9A 2H4JA 3FYSA 3FLAA 3VYWA 1SIWA 4EGCB 4IHJA 1D6JA 2P62A 3Q0TA 4AWBA 1VI2A 1P17A 3WQRA 2B2CA 1NVBA 2A58A 2JA7A 4KK4A 1ESMA 3U60B 1IPEA 3H8SA 2LRHA 4BUZA 4MEJA 5IDVA 3SX4A 5HJEA 3U44A 2ES4A 2G4VA 4PVCA 3SM9A 3L06A 4LIPD 4NZMA 3NVMB 3QHQA 1IDOA 3GP5A 4LGCA 3ZDZB 5BWOA 5EFOA 3QV2A 5AM3A 2DTXA 2FW0A 4YIKA 1GTSA 5IJWA 1WDLA 3FKSD 2H4WA 1BFUA 2PS0A 3AFIA 3GJ8A 2QRQA 3N7UA 4TL7A 5F9MA 1NN3A 3L8YA 2UVRA 2X5JO 1NA5A 5H68A 3BHJA 3AF6A 2ZRPA 1A0GA 1H9AA 1E3QA 3KKLA 4XFDA 4X1OA 3WHKA 3KL4A 2INGX 3CF0A 3OZAA 4KLRA 2R8IA 4PY2A 1R18A 2A9KA 2B4YA 2QSYA 4JCOA 1FCJA 4NH4A 5DULA 5JOQA 4LF7B 3HK2A 5EOYA 2QSZA 3F9RA 3CLRD 3V9PA 5AYVA 4FJ1A 2FLPA 4FE4A 5IX8A 5HKKD 4PG4A 2I4NA 4AFNA 5TQJA 4JJGA 3U7RA 2EBFX 1YB4A 4DSAA 1YB2A 2XMRA 1M1ZA 2F9LA 3D3EA 3PUVA 1Y5NA 2JA2A 4MKRA 3GCGA 2HY7A 3H3FA 1BCRB 5INTA 3ZDCA 2FPLA 4ZI7A 5L4LA 3W6OA 2B0CA 2C3PA 3SR0A 2UVPB 4PPNA 1FFXB 4RIGA 4G07A 2FGJA 1U2RA 2IEAA 2H1FA 2D2IA 3V4SA 4IDCA 5B6PA 2QZSA 1WS6A 2IZZA 3ZU5A 3U0BA 1ISMA 1VFPA 3GRPA 1UKCA 2BFMA 1IXYA 1SC9A 2OP0A 2DHRA 2XEXA 2IYOA 1D2RA 5C3UA 1MIHA 1U98A 4JBLA 4YC7A 3H8WA 1E1RD 2FFJA 2GWHA 3MJHA 4QEZA 1SRQA 3ZHSA 2HSJA 5I5VA 1FNDA 4GWLA 1EFUA 3TVTA 2RHHA 4BFSA 2BBWA 2XB4A 3WY9A 4PGGA 3ZTWA 3E5NA 3HBFA 4LF8H 3BA8A 2QE7D 3UT6A 2FE3A 1ENZA 3PJDA 5IJZA 1KTVA 2V55B 3ZCUA 5AWFC 5FTNA 1O58A 4UCUA 4TV9B 1ZVKA 1JPNA 2QU8A 2P35A 4XQCA 2Z08A 3ND8A 4R2MA 3E84A 4LF4B 2O2CA 2QTRA 4DLUA 5BV0A 1T0BA 2VSFA 2V3CC 3D4IA 5KFBA 1DBVO 3EVDA 2YQ5A 1OW3B 2CNWD 3KHUA 2C20A 3UJPA 3BSYA 5BNFA 5C4XG 3JWHA 1ESNA 4KZKA 5DEOA 3WNBA 4DWJA 5DMHA 5DCLA 1EK6A 3W9BA 1VJ1A 5IF3A 1H2WA 1I6KA 3ANNA 1T94A 2F00A 1U80A 3RO7A 4MI1A 4ALJA 3K70B 4EY7A 3LA6A 1NLMA 2BFWA 3E1GA 4UQPA 3OA0A 1YIOA 3E22A 4UMDA 3WIUA 1GZ4A 2POCA 4LSGA 1WUJS 2XB8A 4QT4A 4MVCA 1L5FA 4DHWA 2GCIA 1HFKA 1RAIA 3D7LA 3IX7A 4FMPA 4X54A 3NBFA 2IUUA 5JARA 3BT7A 4PLGA 3RRBA 3OFNA 3B6JA 3CF2A 3SS8A 1CDZA 3LK6A 4I6GA 4OKSA 3KAQA 1PFUA 4QQFA 5G02A 3CVUA 3WIDA 2HRCA 3T4EA 2LDBA 2D0OB 2R11A 2H18A 3GUCA 3GUZA 1TKBA 2AXQA 4IDHA 4Y7DA 1CD5A 1SHKA 1GY8A 1NYRA 2MT9A 4KMRA 3LVRE 1ZQ1A 4QVIA 1BH2A 4X0EA 3F73A 3ZJTA 5EIAA 1X92A 3T7IA 4A23A 3GEPA 1KORA 2Q0XA 1MJGA 4RVDA 3SN6A 5JY6A 4AJ2A 2CYAA 1GTL1 1PR1A 3M4JA 1U5BB 2WYIA 3A3NA 2XQFA 3Q5EA 4MR7A 4TRMA 4OQZA 1Q7TA 1Y7IA 5LN1A 1QX4A 1H0HA 2SNIE 2VPZA 2SKEA 2BPOA 1QUEA 3H5IA 1C9JA 3Q3JB 4PQEA 3GLGA 1C3LA 3TIGA 2XJ4A 3CH5A 3ESBA 4I4TA 5JVDA 2CJWB 4RTSA 3RFTA 5SYMA 3HOVG 1S3FA 1EB8A 1WU8A 3DV9A 3VR5D 4ASUD 2QQFA 4PN3A 1XQWA 4ZZ0A 1CWUA 1AB5A 4JQCA 3LI2A 1TADA 5DG8A 3KKEA 4ARVA 5JI3E 3QVGB 1U4OA 2Y9MB 4R2LA 1IPFA 1E1CA 1AK1A 2WIJA 4B79A 2NGRA 4US2R 1Z8FA 3TSOA 5KYUA 4DHEA 3P9IA 1E7WA 3N0VA 1FEZA 2WNHA 1SOWA 2GBIA 2PPVA 4PCVA 1CLEA 4JV5H 1LA2A 1IEVA 2NV6A 4LK2A 4BY7G 1M6NA 3L7OA 3G7UA 1UJCA 3ZHOA 3JYPA 4BV8A 5J4YA 1MUUA 5C8YB 3K8QA 4KIUA 4EVIA 1L4FA 4BXXG 2G70A 3BH6A 3DEAA 3QMMA 1YR8A 3UUFA 3O75A 4HHEA 5I5YA 4ZAVA 3JQ7A 2RKOA 3KKNA 2O23A 3LBIA 3IILA 3KKKA 4OYLA 1VB5A 1Y3IA 4TLCA 5G4KA 4EA8A 3OHSX 4WADA 1DIKA 3OC0A 2FG7C 1KHHA 4X45A 3NWBA 1YJCA 4CFYA 2ONCA 2BLLA 1IEWA 4MUGA 3BJEA 2V6IA 4YRZA 3DTFA 5KNCH 1TLLA 1Z26A 3LQYA 1M5RA 1EXDA 4CM9A 1JQBA 3B5EA 1XSEA 5CFQA 5HKBA 3GJTA 1ZW6A 5LFAA 4IIHA 2GO1A 2G7ZA 4UVEA 4V0RA 2PJZA 3NDRA 4NEQA 1A04A 1UT5A 4JUAA 5LLSA 4EHLA 2DP4E 3ADBA 4E4YA 4JFAA 2WR8A 3IPCA 3AVTA 1NTRA 2RHOA 3OCVA 4ADSG 1MZVA 4AY3A 2KI5A 5E6SB 1K8ZB 1MT3A 3F96A 2BTOA 2XIQA 3ESXA 3DBRB 4WXMA 1JZTA 3AF0A 1LBSA 3N0WA 2B1GA 1J39A 1CUSA 1ISIA 1L3CA 1CNEA 1U8CB 2WU0A 3AG6A 3R3VA 2HO5A 2DE0X 4Q4HA 4UU7A 1WDMA 5EKXA 4L8VA 2FDRA 4PLCA 4O7WA 3SGLA 4DLTA 3C3MA 4YDRA 1TEHA 4PR3A 1XX6A 5EVJA 4HDMA 4BQSA 4BZQA 1GV1A 1KJQA 2COGA 1BE1A 1PS0A 4BTEA 2IYZA 5F7ZA 5JC1A 5JPCA 3O94A 4R0VA 4XFKA 5H1YA 2GPBA 3R3JA 1DBSA 3DJYA 3BJMA 1EIWA 5HIIA 3CJRA 1T5OA 2FUEA 3OTIA 1D5CA 4FEYA 4UHBA 2D0DA 2JJ2A 2NVOA 2XNCA 3PJGA 4XGNA 4TVBA 3RLIA 4EHBA 1TQ6A 2LW7A 3LMLA 4FKMA 3KSRA 1RE1A 1SM4A 4BXOB 2QUIA 4EAQA 1AF4A 4FZRA 1ZXLA 3K94A 4QDKA 3WBKA 1XRJA 4UM5A 1I6MA 2OMEA 4FFNA 2AOXA 4KR6A 3Q85A 1V6AA 2IYPA 2JEYA 1DI0A 4P35A 3T1OA 3T3GA 4ENQA 4EJ0A 2O4UX 3TINA 5CT5A 3PUXA 5LQKA 5T14A 3NGDA 1Q50A 4Z2YA 4HADA 2GZDA 4R51A 4DR1B 4LYFA 3HJGA 2PK3A 4G5FA 4NMWA 3STWA 1Z5NA 3ZHQA 4H7KA 2B21A 5DNUA 5AKIA 3ZY4A 1UJ2A 5F3RA 3I5AA 3UY4A 1UFVA 3R2JA 2C5GA 3W5BA 3IA2A 3E0XA 3WWOA 5A5EA 1SXJC 4ZAZA 3EGOA 4EMBA 1OFUX 8GPBA 3U3DA 2M6KA 4Y1EA 2VTKA 4UHEA 1JDEA 1IJEA 1EVKA 1T36A 1K7YA 4QPCA 4ZPJA 5AKJA 4B6QA 1Q1AA 3HH8A 3KB1A 4BY9E 2C9MA 1X3SA 2HQSA 3MVEA 5E1MA 1QKIA 3S2UA 1M6WA 1YOVB 3B9BA 3NONA 5C32A 1O03A 2FFQA 3AONB 1H1LB 3CEAA 1DO2A 4RSRA 3ZU6A 4MWDA 1RAEA 2FSVA 1L6RA 3AUUA 5LYYA 2C22A 4IQ8A 3QTBA 1IPHA 5DYIA 2GVZC 3RVKA 1WAMA 2WSIA 4M0CA 2DLDA 2HG8A 1X7WB 4FOTA 1ZM3A 4CPDA 3RTAA 5JJ5A 1E6LA 5THKA 1R4MA 4ZVTA 3ND7A 5KFGA 2JEJA 1EUZA 3HY4A 1Y8RA 1K6XA 1PWYE 3I9LA 4Q0YA 1TTPB 1SVMA 4OATA 5D6NA 5E2AA 4ZVKA 3ZW8A 4DR5B 3GJXB 3TBKA 4MQLA 5CYFA 4FEGA 1OA0A 4PBRA 1XZPA 4FGJA 3BUSA 5HUHA 5KNDH 3ETEA 2GXSA 3IUJA 2HAEA 1NVUQ 2LKDA 3B9QA 3OCJA 1Q83A 3QZUA 5G4LA 3I01M 4ITRC 3SIXA 4JC8A 3EJWA 3T34A 3A1NA 1DDOA 2I8CA 1PK9A 3AL3A 2C35B 5A3VA 5KTNA 1J2UA 3K9GA 3OICA 2C3OA 3OU2A 2QR5A 2YVQA 1H42A 4GM0A 2ZR7A 2R8HA 5HCUA 4Q6WA 3IIMA 3UOGA 3WWZA 4L95C 2Q8PA 2OXFA 2PX3A 4UM7A 1K7CA 1YK0A 3OQIA 4RVSA 3DXFA 5EXPA 3TN7A 3VR5A 2GRAA 2CWWA 1N5IA 4FKZA 5EJMA 4E22A 5AFSA 3V2IA 2QZZA 3OEHD 1JIVA 1LKZA 4ZIRB 1XU4A 4B82A 3N7AA 4FS1A 3AU9A 3YASA 2O20A 4QUHA 3K2BA 1Q20A 2WILA 3PVXA 3OFSA 2OD2A 1EVEA 2W4QA 2IEIA 4UM8B 1LI4A 4H7PA 3U31A 1ZN2A 3CE6A 3CX4A 4K6CA 2W7PA 3FCYA 3Q8XB 3R7WA 2GD6A 3G0CA 4MVJI 4UHKA 4AJPA 5KU1A 2IOQA 2OZKA 1NW6A 2BFOA 2ODAA 4J0GA 4PYMA 2IEBA 2HADA 4YEDA 2QNBA 5DBIA 3VC3A 4R0MA 5IVDA 2R5FA 2R1VB 2Y4RA 2CBXA 1KZYC 1NVDA 3D4BA 1OI4A 1IAQA 2VT2A 3DBLB 3DFUA 4FM9A 1BMTA 1Y9EA 4H1TA 5SICE 2YWFA 3SHTA 5JMTA 2WQ7A 1H8EA 3FOCA 4Q1VA 4RFVA 4RKFA 1Q0UA 4NC9A 2FPGB 4A3DG 2I67A 3ZZUA 1A8QA 2JCYA 1L5ZA 2XWJI 4GX0A 4O4JF 1T3SA 3L9WA 3GR6A 4FYMA 5CT6A 2QPOA 2XOEA 4LH6A 1EFCA 2HWYA 2O8DA 5CTJA 1E5VA 1VLJA 4MVJP 2WPNA 4A0GA 1Z6TA 1XA4A 5H81A 2BSQA 5BNTA 4JJ6A 4G4GA 4NJOA 2FSSA 5FFMA 3W3ZB 4CL0A 2A14A 1VYHA 3L07A 4C2TA 2CF6A 3PEYA 1UOPA 1QQBA 1YL7A 3UMGA 1TFRA 4L0QA 4JOQA 5C5IA 1XIVA 1OBFO 4IV0A 4GL2A 2VFAA 4UBJA 5LLDA 5JFTA 1NP7A 3AR2A 5B4VA 1J70A 1P91A 1BTOA 2LPMA 4AYBA 1RYMA 2Q1WA 3LPAA 3PKZA 5DU2A 3FSEA 2AB0A 3FDJA 4L15A 3I5MA 5GV8A 4RTMA 2JLSA 5ITZB 2RH4A 5BSVA 1WXXA 1MO3A 5I51A 1DC8A 1TB4A 2EDAA 5B4TA 2OORA 2HWXA 2Y67A 4OHRA 3IV6A 4GI2A 2FPUA 2B7LA 3ZTYA 4BV3A 1Z4PX 1RM4A 2QP9X 1CE8B 4K6KA 3TNDA 3AC0A 4R1MA 4DXHA 2FMTA 1DAIA 1P9NA 2Z6UA 4JT8A 2CY0A 1NJGA 2Q2NA 4QJ3A 1PQWA 1IWBB 1KETA 1IVNA 5BQOA 4B3MH 1TD1A 3UAZA 4EW3A 3U54A 1EXWA 4I99A 1U3WA 2WM9B 3RFVA 1E5TA 3NKFA 3NC0B 4DMKA 1M2KA 2X8WA 3GRZA 3IMEA 3VZPA 3RTXA 2DCUA 5AI9A 2EP5A 3NT5A 3G82C 1GPLA 3DO6A 3G23A 4JEMA 5IC4A 5F5XA 1RXWA 1UNNC 4TL6A 1Z0IA 1WPXA 3BK2A 3S1AA 1XDWA 2R6AA 3EFEA 2B8EA 1P9WA 3QV1A 5EZ6B 2XNDD 1YDWA 5JQGA 2J3EA 1KE2A 3ZHXA 4LX0A 1C9NA 1F9AA 1X7ZB 1GXSA 3KSDO 3KWLA 2JLVA 3O1LA 3TRJA 4ANFA 4FWIB 5LMNB 1SXQA 1RPTA 3AHFA 3WDSA 2EF0A 2Q3JA 3E7PA 2G1AA 4GOOD 4BVJA 4E21A 4LQ4A 1GADO 1AHIA 3KHKA 3TH5A 4FFDA 1KYZA 1R6UA 1X6VA 3G2OA 2WMDA 4GZLA 2BM0A 4XQ0A 5FUXA 1YRQA 5BR1A 4LHXA 1QP8A 5KOIA 4ZEOA 3PQEA 3UUWA 2X5OA 3LIIA 2BIFA 4AC9A 3ICPA 1TLTA 1F17A 4XDYA 1M1NA 2MR6A 1S8FA 4BRUA 4DABA 3AVQA 2YWCA 5KFIA 1FVXA 1KAEA 1NU6A 3BJIC 1ST2A 4MR8A 3I04A 1QC5A 1X7DA 4UTPA 1YUNA 4L4SA 1UODA 4DIKA 4H1WA 5ICMA 3SZ3A 5FLKA 4OJQA 5JCJA 5HZGA 1GQFA 3QF4A 3FYCA 2NUTA 3F98A 4A92A 5I5UA 3TW0A 3DZJA 4C5BA 2NIPA 3AHCA 1FFEA 3PUZA 4MMZB 4OGLA 4CM3A 2KMLA 3DE5X 3EOZA 1GEEA 2FPIA 1WXQA 4EHAA 4W5JA 4CLXA 4P4TA 1HFWA 2GM4A 3LYLA 3OZCA 3PR2B 2HQBA 1GL6A 3OPYA 4K8RB 2J32A 4KXVA 4WLNA 2BGRA 3WL7A 2NPOA 3HB7A 1Z2OX 5A2QW 2P6OA 3T9AA 1TCVA 1NXXA 1Z83A 1YGYA 2ZS7A 3HJHA 4O2RA 1XPUA 3I4MG 1LLFA 3NBXX 4B46A 5C46F 5IBRA 1R0SA 5JCPA 2ZUUA 1M5TA 2E49A 2FX5A 1WJGA 2PX6A 2Q3FA 1HPLA 1R9GA 1QF7A 2QVCA 1VBGA 2WG2A 5ADHA 3OVMA 3JQDA 3MK31 3VR2D 4U3JA 5BXQC 1BFDA 4DSNA 1CETA 3GN2A 1YS4A 3ZEAA 1RBZA 4UCSA 2QWXA 2VN8A 4M7RA 4WACA 3WGOA 1HNWB 3ELYA 2J8ZA 3KT6A 1P2VA 4JJ4A 2E87A 1I1QB 4K6NA 4BVEA 4FCVA 2W2XA 5ALMA 4ITVA 3P9KA 1PWZA 4Y7CA 4Z54A 1TMKA 3PXCX 3U7HB 5CBPB 1O94C 1G7RA 1CNFA 3NXKA 2E4XA 2VHUA 1WB9A 5BT8A 2X0KA 3C4QA 2VP5A 5AVXA 2YZMA 1N2GA 1JT2A 4PX9A 4H7HA 4DW8A 1RPZA 1E6UA 2ZVQX 1CY1A 3PU6A 4J3FA 5EZ5A 1M8KA 3AFGA 2JAXA 1KZGB 4N5DA 4TRRA 4EG1A 1EESA 1ZLXA 3CTMA 3QA3E 4IV5A 1JG2A 1OLUA 3BMNB 4O83A 3L7JA 1QFJA 2MTBA 1IWOA 2RMKA 4DRYA 1QGZA 2X5NA 1U3UA 4JODA 4PZEA 1SD5A 3L6DA 2R8BA 4NCJA 3PXAA 3U2QA 2ORYA 1YASA 2IYYA 1VGQA 3GYBA 2UAGA 4ZZIA 4FHCA 3MNFA 2WHRA 5K01A 4Z99A 3G59A 4OA5A 3KU1A 3E9CA 5DHRA 3OLCX 3JWIA 3HKCB 4E2YA 2B5OA 1SBQA 1QF6A 5CEJA 5F1OA 3S8EA 4BY1G 3HR7A 1SA0B 2IF2A 2PIDA 4JZKA 2ZW9A 5D7NA 4BKRA 2CD7A 3KSZO 4S1TA 1X1EA 4P3YA 1QRUA 2JANA 3I8XA 1KEWA 4F6RA 5BWLA 1ACJA 2FJ0A 3GGCA 4TXHA 4OGFA 4M7WA 3ZV5A 1NC1A 2GCPA 1JDNA 1OIXA 2VRWA 3HVKA 3PN1A 3WIVA 1B1CA 1CS4C 5G0UA 1LSSA 3X1XA 2YS6A 3FFBA 3TLEA 3RUHA 1N5OX 1RABA 2QLBA 1P4GA 3A36A 4FHFA 4N0EA 1A98A 5EMNA 5H3HA 3GQCA 4B3JA 3P2KA 1JDBC 1ZGGA 3GUHA 5DEIA 4B4KA 2PCJA 2WIGA 4PEVA 1R5OA 1UAAA 1J25A 1QP4A 3UPTA 3UK1A 1GAXA 4ZXPA 4LFBB 3U3RA 1TYDE 3VOSA 4BLUA 1KI3A 1OFHA 4D0NA 1NQVA 4QO8A 4LS3A 1W4LA 2YYZA 3CIFA 2ZWOA 3PQ8A 4HAVA 3AMVA 3CEMA 1KI4A 2FG5A 3DVAA 2LE0A 4OMFG 3JQAB 2WYOA 4MAMA 5DISC 3DMRA 4KXLA 3I4NG 4LNUB 1FL9A 4YJ2B 4CLRB 4FK8A 4ZYZA 5BMOA 5LQMA 4J2HA 2C4MA 2SCUA 3BVPA 3QLUA 2CWDA 5ALQA 4URXR 5AJHA 5GJWC 3SIWA 3S1SA 3VNAA 1AV6A 4U7FA 4C3VA 4EB8A 1Y5RA 3MTEA 1FP1D 2HDWA 2FZ5A 2GEJA 2WUVA 3GFRA 4WT7A 3TAUA 4HWRA 2QT0A 3FCSB 2ZJ4A 3H7IA 2F17A 4ER0A 4Z49A 2TMGA 2ZIUB 3F3KA 4MDHA 2E18A 5J23A 3FYUC 2GQ0A 4IIGA 2QYZA 4OHOA 2Q5OA 1PSWA 4E2ZA 1OJLA 2Q5FA 3GARA 3GPDG 3OTQA 4DPKA 2UU9H 2W9BB 4LOAA 4BNUA 3OSZA 3NUZA 5NLLA 4O5AA 1QIKA 3INTA 1VBMA 3DVQX 1DJQA 1JKXA 1HORA 4BP3A 2IHBA 3BKXA 1V8DA 1XV5A 4ETIA 3IYLW 5C53B 4BTVA 4REQA 1XPRA 3UA3A 1NQWA 1G66A 3C70A 2XYQA 4UVGA 1SH7A 4JLOA 1WMBA 3JZMA 2DUMA 2QIOA 3H1FA 3TTUA 4CW7A 4P7JA 3L4EA 1JR6A 3EHDA 2XRZA 1YB5A 1GLNA 1KYXA 1GG2A 1YA6A 2IPNA 2BMFA 2GN2A 1SPXA 2YXPX 1G2WA 2B1RA 4YBZB 2WAAA 3OFKA 4GT1A 4MLZA 1MLDA 2W2LA 4ARZA 2YWGA 1IXRC 5EZYB 2CV0A 2O2JA 5J9FA 2YCLA 1VBHA 4TKLA 3ZCSA 2JLCA 4P86A 4F71A 5K8CA 3M1YA 1Y8AA 1ZSYA 1B6RA 4G36A 5CM8B 1RU3A 2B1IA 2IXTA 2VRNA 4EYQA 2CVQA 2FPIB 2OPHA 1CKNB 3T1YB 1BAPA 3UYKA 4KNWA 3LC2O 2FI1A 5M29A 3IVXA 3ZBUA 2Q9AA 4WVLA 1JP7A 2HMUA 2PKWA 3QVJA 4QWEA 2RH9B 2DPLA 3CUWA 4PR0A 1GILA 5BWNA 1CDDA 3FUWA 3B6EA 2W42A 4AKSA 2Y4OA 2QVYX 1WDKA 3P0EA 5K1ZA 4URVR 1D1TA 4K9LA 4MW9A 1SXHA 3ZV7A 4B5LA 1QRDA 1A9XB 4CQMA 3GVPA 4MUEA 4INJA 4RQTA 2OZVA 8ADHA 1Z37A 2FX3A 1UR5A 1DTEA 1JKJB 4N3NA 1PQPA 1ZK0A 2I1WA 5TF4A 2VBFA 3VGJA 2V45A 5C8YF 1WSDA 3ONEA 4NNOA 1PL6A 1RNLA 2FU5C 2G1KA 2GHIA 1Y7PA 2N9UA 2O6LA 1NF9A 3B9PA 3I39X 4J1TC 4TYWA 3KXIA 1VHJA 4URHA 2HIVA 2O06A 1NQOA 2JPDA 4Z1MA 3IBCA 5CXSA 3LKZA 3D7KA 3HN7A 2BEVB 2PDAA 1ZVQA 3RSZA 1YJXA 2VAVA 3CLVA 2BF4A 1PJTA 5KYVA 4MIKA 4DMCA 1BE6A 2VTVA 3L8DA 1WSBA 3M9LA 3K35A 1SN7A 3ABZA 1AU9A 4W5QA 5DTEA 3BL8A 5T4BA 1NQ5A 3FSGD 1XLVA 2WQZA 1EEXB 1IB0A 3D8SA 5T6BA 3G1WA 10MHA 2H63A 5JCXA 2FN3A 4M36A 1YOVA 3P26A 4BGDA 4GP7A 1CQXA 1CT9A 3W1GA 1J24A 2JIZA 2WBLC 1VL5A 3F6RA 4FJ2A 2Z4TA 3M1LA 1LBQA 4LRWA 4OIMA 5JADA 3GN1A 2PGDA 1ISJA 3A37A 2GRUA 3C6YA 1YL5A 3DGEC 3GRCA 5C34B 5CURA 1MCZA 3EXG1 5JYDA 4ZCMA 3IEIA 1BCSB 1WDWB 5KYWA 2I34A 4INPA 1MG0A 1NBMD 2C00A 1EGHA 3LQQA 5KFZA 3FF1A 4QDXA 4QLBA 3VBCA 3FMAA 4B35A 4BFZA 3I58A 3P5BA 4OH7A 3HOUG 4X8OA 4XFJA 2CVOA 1ZSVA 4EP1A 1GIAA 3RWOA 2GKOA 4PG6A 5ITZA 3RV4A 3PDJA 2P69A 4OHFA 1I3NA 1QE3A 1JX6A 2XNSA 2Z8YM 3LGSA 4KODA 5JMPA 2ASVA 1K2WA 2WSBA 1NNUA 1T6YA 3PC6A 1IBRA 3HKEA 2D06A 1VTKA 2XV1A 3DZHA 3QVXA 1B7GO 1F1BA 2P3QA 2ZSFA 2PGIA 1G5FA 1A7JA 1D2MA 1HNWH 2GBGA 2DBRA 1JR4A 2IW3A 4KGZA 3T3IA 3RTBA 3PIDA 4L3VA 3AX6A 4MSUA 2F43B 5H4HA 3C3YA 2CHGA 2WHYA 3R3YA 1KBLA 3QVWA 1EFVB 5BN3A 1W52X 4UXHA 5KVCA 3WX0A 3ETCA 4BGUA 3RVQA 5AJXA 3PD1A 2IW1A 2ZUEA 2ZS9A 3IUQA 4LXQA 4NU6A 4WKNA 2A4MA 4YIHA 4CEJA 1SMKA 1LDNA 1R5BA 3MJ4A 4KGDA 1VCIA 2WJ3A 2QT1A 3D64A 3KHGA 2OHIA 1C9KA 4TLMB 4YUVA 5LD2C 1PO7A 3AVXA 1AY0A 3C87A 2BFBA 3TRIA 4O7TA 2GN1A 2VPXA 4DUZH 5EWMB 5KFNA 5F51A 3CM0A 3TE6A 3QEBZ 2XQGA 1KYVA 2A4KA 4MWSA 2HWWA 4IDOA 3DP9A 2R8YA 4XQ9A 2VDUE 4YY3B 2A1IA 2BKVA 1H0KA 3QEOA 4OB8A 3ZGZA 3QJGA 2VHVA 2AD1A 2YJ5A 3KPUA 4XYEA 2DH5A 1E9SA 3B38A 2OZLA 4TUYB 4KWCA 1JEJA 5JBNA 3SDSA 3RFXA 5C5EA 1Q57A 3VI4B 1WXDA 4BWVA 2BEKA 1XZIA 3LNTA 3KQSA 1SBYA 3TM4A 2HBYA 2XRFA 5FP0A 4C4ZA 5HP4A 4GPTA 5BUSA 2FWRA 4LV5B 1JLLB 4V0OA 3M89A 2JZNA 3AF1A 1X1TA 2UZ0A 4CFZA 1WRBA 1RWQA 3BXGA 1G17A 5KFVA 2VNSA 1XN1A 4BXOA 4Z4IA 1GGOA 1HH4A 1O95D 3KSMA 3SFVA 2QJTA 4DG8A 3GT3A 5LLTA 5LL6P 4FB5A 2IXDA 2O2SA 3M82A 5DRYA 1SD2A 3KT3A 3AY3A 4KQ1A 3OAAD 4R6WA 1UMDA 2NUPA 1DBPA 1EX9A 1RMQA 4A6DA 4CQLB 2JS7A 2SECE 4R81A 3TSAA 2OCKA 2EGGA 3P5SA 3S0JA 2IHYA 4B3TB 3R7BA 5TS3A 2GK6A 3KOZA 4IG9A 1N5MA 1YQQA 1YVDA 1E3SA 5F21A 2BFBB 3QMPA 4JX8A 2CL6X 4E2WA 1RP7A 4GI1A 1YB7A 4IJKA 1N0VC 1X8JA 4F3KA 4X62H 2JVKA 4DMUB 2JFHA 3NFRA 1KI7A 1A2QA 1KERA 1JHVA 1PX0A 2ANBA 2XDAA 2Z6VA 2R6FA 3L18A 2ZUWA 3MAGA 1EFVA 1V5WA 2FSIA 3OIWA 3ZE9A 1I3KA 1JEOA 1KZ6A 3PNLA 2NU7B 5U4QA 1SJ9A 3LLMA 3TSCA 3EPJA 2AVNA 3KZXA 4NOMA 3O82A 2VHCA 4KAAA 4JD5A 1JPUA 1VYUA 3PNSA 3ZOZA 1GCUA 1WPRA 1FJHA 3UTCA 3DCJA 3HYTA 3Q3VA 3D6FA 4KYUA 2R7ZG 1L7EA 3N41B 1MDFA 5BNZA 4MA0A 2IY7A 3QVGA 1V1JA 5IDXA 1MNQA 1G1AA 2P5SA 9ABPA 1EQAA 4I9GA 3HRIA 3GVCA 3DFMA 2AQ8A 1DEKA 4JB0A 1K08A 5FPSA 3A3OA 3MCAA 2H2HA 3WLLA 1GDTA 4LDNA 4LV6A 3ONDA 4S2UA 5ALXA 2OWOA 2VYQA 3K6RA 4P31A 4MKXA 4XM1A 1V4YA 1E4OA 3OJXA 4A3MG 3GEDA 3V4FA 3LCMA 4UOQA 3A4VA 3CW8X 1A96A 1NR1A 2X7XA 3A3KA 2H7YA 1EH5A 4EBFA 3IUEA 1QAQA 1G8PA 2VUIB 3LK7A 2H1RA 5L1IA 1ZNQO 4N6OA 4QUGA 4ZYXA 3C3WA 4A36A 1NX6A 3PC2A 3Q7RA 4HN9A 5KFDA 4LFCH 3AFOA 1D2AA 4NJEA 4BNLA 4B4UA 1ZA2A 1M34E 2NU7A 1LPMA 3W2FA 1QPGA 1GPYA 3OTOH 2PGOA 2ONJA 4IYJA 4UASA 1O57A 3WYAA 5DKFA 2QD4A 1IVSA 3DXZA 3K0HA 4OUDB 2DLCX 5BSWA 2Y27A 4QUBA 1U99A 2FOXA 3GNTA 3E22B 4FZJA 1T0JB 1ZCFA 2BM9A 3GG9A 3OX3A 4JUBA 4QX6A 4XVRA 4O84A 2DTDA 2P77A 3BRQA 5FUWA 1NMXA 3PPWA 2NOAA 3KQTA 3ZE1B 5ESDA 1FMLA 3HM2A 3JPYA 3V6LA 2B83A 2O2IA 3IBFA 5EIFA 5K4HA 5KKCA 1KMIY 5C1IA 3ZH2A 1SU8A 4GKJB 1BXKA 1S3IA 1BOOA 3OKPA 5EJ5A 1ZGJA 4YJFA 2B63G 1Q3KA 3GJ7A 3PW4A 1B23P 3P9XA 1L7MA 5K4AA 2AKYA 1UMKA 1E1MA 1KARA 1CB7A 2AXPA 1RXCA 4LJ4A 2Z0MA 3ZXUB 2QRMA 3PIRA 2JFQA 4G1VA 5JNSA 4PC1A 4IZIA 1IE3A 1IN6A 4BZXA 1B73A 2K6GA 4J0EA 1RI4A 4X1KB 3HXMA 3GLVA 1JLLA 3T5JA 3FDSA 1J8DA 2WWXA 3LP5A 4FNGA 4O5OA 4RHXA 4RAZA 4B40A 4EYEA 1IY9A 1MAWA 3PHIA 4TL8A 4A6XA 7MHTA 1HK7A 1WWKA 3JTEA 4AY6A 1AO3A 2CDNA 4KHPH 5DH9A 5H70A 2R1ZA 1P1CA 1PKXA 1XHEA 4HH0A 4R2WA 2JFBA 2XRMA 3CPSA 4D8YA 1W75A 4C0AC 4PO1A 3SIRA 4EG3A 1I30A 4EKYA 4F11A 1QJCA 1RP1A 5EWEA 2AJ8A 2XA1A 1N0WA 2A78A 2QRHA 1N7IA 3KPVA 4KX5A 4RESA 4EZBA 1M66A 3ZK7A 3UFXB 4OHUA 4HMOA 5IN4A 1TE2A 2ZI5A 2PGNA 3QRWA 2C5EA 2IH2A 3FM9A 3STUA 2FDXA 2NTEA 3J80A 4TOIA 2EEZA 4N5IX 1Z16A 1EKVA 2F8MA 5KNBA 1QRSA 1P5ZB 3LWZA 5H4GA 4MYSA 2UU9B 2JJ1A 5JW6A 5J63A 1NXQA 2C4UA 1VDZA 2IS1A 1CZKA 3IT2A 5A62A 5EKSA 1VPLA 1OCEA 1P4AA 3H6GA 4H3SA 4NEHB 1YZUA 3QP9A 5E4JA 1E0DA 1M8PA 2B92A 2FF7A 4RACA 1H4QA 5U9CA 3HKDA 3SYNA 3V80A 2DQ4A 1TX4B 1C7IA 3RI3A 1EWKA 4HAIA 5AK0A 1GCIA 5G0TA 3JWGA 4C7KA 2R1TA 4PN7A 1B93A 1PJLA 1VLMA 1P74A 1PR2A 4D3ZA 1GFIA 1NY5A 3IDSA 1COWD 3R5KA 4L4XA 4Q66C 4D5GA 3TDKA 1Z13A 1IZZA 2EW1A 3EVAA 5ULLA 1WH2A 3IKTA 5HM8A 2DABA 3TPZA 4N9QA 2IPMA 3BRWD 3Q9UA 4GH5A 5EQDA 3WGTA 4G23A 5AVTA 5JASA 4KL8S 4YJKA 1OXTA 2VATA 3UUEA 5JJBA 1QVRA 5BR8H 2QI9F 3DBHA 5ECGC 4MO2A 4MHSA 4E1VA 3UQ8A 3TY5A 2ZOSA 5D7BA 3TZBA 3UGTA 1BCSA 1FLVA 2G40A 2GFIA 4KB5A 3WLFA 4BFLA 3GCZA 4E7PA 1ZJ6A 3VTKA 3RIEA 4NU5A 1P6UA 3O2SB 4GOND 1CEQA 5AT1A 4ZI2A 2EIHA 1F2VA 4FINA 1HV8A 1E6CA 3NHAA 1N0HA 1WE2A 1XNRH 4AS2A 4QXAA 3TMAA 3ZGYA 4I55F 1N7HA 4L7VA 2QVBA 4DLRA 4W5TA 4DYVA 3GOQA 1YA8A 2CVFA 2OL4A 3N05A 3ZCQA 5IS2A 3EQ9A 1ZL2A 2VDMB 1QGED 2OE2A 1L9XA 3B1XA 1X87A 5DOZA 1PKEA 2ZANA 3OWOA 1RXUA 4LZAA 3L6CA 1QCCA 1VA4A 3DS8A 3RC7A 1SXPA 3BRCA 2I55A 4JX9A 1EVLA 4LVNA 4Q1CA 5J3JA 1IN7A 1Z34A 3GMDA 3PJEA 1L5SA 4BKMA 5D87A 4X00A 3ML1A 5DFAA 2JGRA 1BKDR 3PGLA 1L7BA 4RCVA 5EINA 3V32A 1EK2A 1XCOA 4HEHA 1YDGA 3CGWA 3D2LA 4UMFA 5SY9A 5LIRA 2WTFA 1HTBA 3GJXC 3PUKA 2HCJB 3I2JA 3TMYA 3K8OE 2ZRDA 4DGQA 4FS3A 5IUJC 2IQIA 5HYVA 4HTFA 4B85A 2XF2A 3VR5H 3CO0S 3CMMA 1LSJA 2BDUA 2Z2YA 4BBJA 2EJ2A 1H9BA 4EI7A 2ADFA 3OPQA 1X0VA 4D74A 2H1VA 2GT1A 3U4IA 1KQGA 1OTHA 2CXPA 1TKAA 3NWPA 1ZZEA 4NCXA 2J3MA 4WKBA 5JDCA 5LDHA 4K0KB 4JB3A 3TZ6A 3VNRA 5FUVA 5DLFA 1BGVA 1KEUA 3OE4A 3SU8A 1X14A 4US1R 1F7UA 3BGIA 3CUYA 3RAJA 1C4KA 5KG5A 4Y2XA 3CUTA 4R5HA 3AI7A 2BAGA 3AJAA 1WXGA 4LCBA 3U16A 5IXJA 3KYHC 4XWAA 2OFFA 3T3HA 2G1JA 1E1RA 1XZGA 4QARA 3UK0A 5L53A 2P68A 3F0TA 4RPKA 4IUDS 5A2QA 3C7CB 1DIBA 3Q3HA 2QMUA 1K7SN 4YDHB 3ME5A 4GLJA 1H2AS 4Q48A 4YNBA 1TNDA 1NL3A 1E3EA 5TGDA 1EGQA 1V5EA 1ZXBA 4XIIA 1P1IA 4OOEA 1TZBA 2KSQA 2QVGA 4AG3A 2VXOA 1HX7A 2UYHA 4JBYA 1NUAA 2AUMA 4KQ9A 5FPOA 1E8MA 3EF0A 3SZRA 3PNYA 3CWQA 1YIDA 2X1MA 4OB7A 5ALUA 2WYVA 3S70A 4CMEC 1RVDA 3L05A 1PT9A 1YRHA 1TDJA 4NFHA 3UPDA 3CLRC 1OMOA 2PXCA 4QXPA 3T3NA 3IKVA 1Q3HA 6NULA 4LJLA 3ZWAA 4DIEA 5CTAA 2W70A 3IOCA 4JU9A 1RYZA 1JB1A 4ECTA 1W35A 2C3YA 3HFSA 3HZZA 3LUGA 1R6XA 2ODWA 1A8UA 1E92A 3FFXA 2CKMA 4DUZB 2X7HA 1IMJA 1MJHA 2D5BA 3II6X 4IIXA 4UNIA 4WZAE 1MO6A 3N2GB 2PKCA 3NAMA 4P08A 4X63A 4G0UA 2CT8A 3VPBA 3MOGA 3QYJA 3H5TA 5DN9A 2Q5EA 4DMGA 1NATA 4HLUA 1O2DA 2R66A 3ESAA 3G8YA 3KKOA 2ODTX 1A5ZA 2GVDC 3PQFA 1T8UA 1K5PA 2BI8A 1KUTA 4NAHA 4MR8B 4OB6A 4TZTA 4WEQA 2HA6A 1KDZA 4E3WA 3QG1A 4HZUA 1BWRA 2GCOB 1TI7A 4AECA 2I3AA 3HCRA 5E8RA 3EB9A 5FI0B 4YT2A 1C1HA 3F46A 1FBTA 5HTKA 2Y77A 3X44A 1SK8A 4FVTA 4IR1A 3MMXA 4NYJQ 4D45A 3AESA 5DK6A 1VCMA 5K3FB 2WC1A 2PFSA 2YZNA 2CNQA 4KPYA 3LZCA 5I7UA 2OLJA 1LVUA 3BOSA 2FQQA 4EW2A 4TSKA 1T2AA 3DCNA 4TKMA 4CKEB 4DDKA 4G24A 1AQNA 1ORDA 2WIAA 1W19A 1Z7BA 3FX2A 3AO0B 1A27A 3D6JA 4MXDA 4P1ZA 3W2IA 3F6CA 5KUTA 3C3BA 5TE9A 2ONZA 9LDTA 2ORED 4DJFC 5KPJA 1KKLA 5EVCA 5C44G 3R8FA 4S1NA 4NRDA 5EE5B 5CW1A 1N3IA 5FUYA 1V71A 4A9AA 4FHZA 1MX3A 2JBAA 3CE9A 3Q3EA 4FYIA 3R5JA 4IQ4A 5HIJA 1U2GA 2SBTA 1CY6A 1Q6YA 1B04A 2ZB3A 4G81A 4UQOA 1WM1A 2NSYA 1II0A 2EEPA 1CXZA 3CHYA 1RYEA 1NF8A 1CZNA 2D5CA 3F2IA 3N2KA 3ENQA 2PZ8A 3RROA 5G2OA 3Q7SA 2BTQA 4PONA 1XRLA 1ZIPA 1MPTA 4K9MA 1OKKA 1Z5VA 4M9QA 3VR4A 1OXMA 4HDSA 1Y3BE 4XUEA 4D9NA 5KG4A 3B3AA 3ZW9A 4EQ5A 1ISRA 5CYGA 1Y1VA 1UBJS 3ILSA 1XKLA 2L17A 521PA 4K26A 1PNRA 4TMWA 5ILOA 5AHOA 4AJLA 1KEZA 3DMNA 4LXIA 4RGQA 4HXGA 3A2LA 1HQDA 2MSCB 3HXKA 4Z2AA 4DCNA 4OQEA 2OCAA 5ADWA 1Z74A 4XD2A 3Q2IA 4R69A 4RS4A 3FRHA 2D00A 3MFYA 2CUZA 4KCGA 3K6JA 3KB6A 2PUCA 2J0UA 2O3TA 4PBSA 1TYEB 1V6CA 4AMZA 5A4FS 4ZYLA 4LV8B 4X61A 1OH7A 4XJXA 2CNOA 4QFCA 1ZO8A 5TVKA 4B34A 1DFIA 2C95A 2R2AA 5CB4F 3BILA 3AEQB 3KYBA 4C0QC 2JB9A 2IHUA 3Q0EA 4TV8B 3RVBA 4AJ1A 1J7JA 4IQFA 1TQ8A 1FB5A 2ATXA 3FOBA 2J3IA 4B4OA 4GPD1 4EF5A 1C1DB 1S2LA 4KQIA 1AHHA 3TF5A 1CEYA 3H87A 4WOCA 1SHTX 2RC6A 4EITA 2FZVA 5IT4A 2FMHA 3HNRA 2JASA 4RW0A 1K9SA 1NQAO 2Q46A 2ZSJA 4U3JB 1XXHB 4RS3A 1VE7A 4OLBA 1GTZA 4OI4A 1EGAA 4QECA 5HW0A 4NZOA 5FWYA 2GTPA 3G0OA 2F8LA 4ONEA 3QIAA 2WE6A 2V7TA 4WNAA 5IN5A 3RWBA 3STTA 3TD9A 4M49A 2WUDA 3RS8A 3LC0A 4PLPA 4KOEC 3QA9A 3O3MB 3JQCA 4ZVOA 5J1TB 3AQIA 1JGTA 1QIJA 2GPJA 3KTDA 3WYGA 1W94A 1RRKA 4KEAA 2QV7A 3I53A 3KO8A 4UAVA 4F96A 4YCSA 4YLYA 5JS8A 1ESDA 4DOMA 1NW4A 3N6RA 2I54A 4ZTZB 2F64A 2VRCA 4KLNA 2NVUA 4PNHA 3LPLA 2X8JB 2XLCA 4ZIRA 2V3VA 3R5FA 1Y3AA 4BB9A 3T95A 3QVSA 3THYA 4I8DA 1M6EX 4LE0A 3TB4A 2CVHA 4IIEA 2C8VA 3JQGB 1U8TA 3GXBA 4LRYA 1IJKA 4MINA 2GD1O 5G0VA 2WTAA 1RKQA 1E60A 1PS8A 2O0MA 3LT5A 3NANA 3NHYA 1N36H 2QRJA 4MPDA 4EO9A 3NXSA 2PZJA 1KIMA 4EHIA 2DRIA 3NBQA 3RABA 4D9GA 3SNHA 3KLNA 2I71A 2OCIA 4JWKA 4HFJA 3FRIA 3OZEA 4QQRA 3UQZA 4L57A 3D8BA 2IYFA 1XKTA 3MRSA 4NULA 4V0MA 1Z56C 2WNIA 5DXJA 3E4DA 1YKGA 3T06B 4DC1A 4EQ6A 4CEIA 5F9FA 2F1RA 3QU2A 1ILEA 1E9DA 1KWKA 3QU9A 1E1QD 3LQSA 1DUVG 1X80B 2FW7A 4Z53A 4IO0A 2Q45A 4D4IA 3BK7A 4HBZA 5DO9A 2PO7A 4FGKA 1QRRA 2YVKA 4N5LA 1QFMA 2L42A 4U4AA 4N12A 1ORVA 3NM6B 3W6ZA 5KJ6A 5KYYA 2PLAA 1M74A 3C5VA 3KDSE 5AKHA 5ALIA 2NVBA 1IJBA 3C85A 1DCMA 3IVCA 5DOVA 2X41A 1P1JA 2A6PA 5IYCG 2G83A 2JKVA 3NX4A 3PWZA 2GWRA 1G6KA 1W5AA 4LJ8A 3CGGA 4MUBA 5EPOA 2ZM6H 4AXBA 4Q7QA 4B3GA 2HUPA 4LC1A 4LMAA 1YBVA 1X70A 3DOFA 2WDTA 4ZAGA 3WP1B 3BERA 2ZBGA 3PXEA 1E3DA 2YWEA 4W7HA 2ZRCA 1GGMA 3X1WA 4KFRA 3SLRA 4RORA 1ISSA 3R5TA 4GGMX 2W2KA 3RV3A 2I62A 1YBMA 2R8XA 5ITVA 1I2LA 2UV8A 4PYIA 2BI4A 3SBOA 4RA9A 4F8YA 3QEMB 2HSEA 1Y1PA 2DT8A 1W2GA 4ZYUA 1U90A 4O8ZA 2R1TB 1LPOA 3GIMA 1WMEA 2NTYC 2AI2A 2WV7A 3CUEF 3E1SA 4GYJA 4HVAA 2BL4A 1QQ7A 5B2EA 2O54A 4YLEA 5FPKA 1AO0A 4UCTA 1MJNA 4IH1A 4IINA 4OX9B 4QYWA 1N3BA 4G41A 4HMPA 4K1XA 3S99A 4H0FA 5KYXA 1ADCA 4MGHA 1UT6A 1NRWA 2WM2A 5E1DA 4YX9A 3ANMA 4EG8A 1XO1A 1GPBA 2FPOA 3JQAD 3R9IA 4HQRA 3L7YA 1OY1A 1IH8A 1U63A 5K7SA 2XA9A 3IJRA 2EW8A 2J45A 4PPFA 1V4BA 1TRHA 2Q2OA 4AL4A 3K0AA 3F9IA 3R0JA 5FHQA 4BHTA 3PQ2A 4L9SA 2GHQA 3TLAA 4MWTA 1OILA 1H6DA 5DT2A 3UYLA 2O3SA 5L9XA 1XLTC 1U2PA 4JP8A 5B30A 2R84A 3VOBA 1FJ2A 3LFUA 2VAWA 2PSSA 1MAUA 1BVRA 4KUHA 2X40A 3GDOA 4IMPA 4RK7A 2X8BA 4YAEA 5LUBA 2C2MA 4MICA 5IJ0B 5DXAA 5EUBA 1PDWA 2YC2C 4JEUA 1G59A 1W6RA 1O6ZA 2G71A 1MXFA 3C1UA 1JA9A 4BATA 1V4NA 4PQFA 3PNOA 1EXVA 1JX4A 1UWLA 2F67A 3A9UA 4X1KA 3WGZA 1I0IA 4L02A 2E85A 3DD1A 2C8LA 4F86A 2R85A 4K46A 4E5UA 1ZSNA 1VRVA 2AFHE 3AEXA 1JQ5A 3KC2A 2YV5A 3D4LA 3NEJA 4GRDA 4IP0A 4N1AA 4Q82A 4TX1A 5FTJA 4AICA 5DISB 2R8GA