2YZNA

Crystal structure of d-alanine:d-alanine ligase with amppnp from thermus thermophilus hb8.
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
319
structure length
317
Chain Sequence
MRVLLIAGGVSPEHEVSLLSAEGVLRHIPFPTDLAVIAQDGRWLLGEKALTALEAKAAPEGEHPFPPPLSWERYDVVFPLLHGRFGEDGTVQGFLELLGKPYVGAGVAASALCMDKDLSKRVLAQAGVPVVPWVAVRKGEPPVVPFDPPFFVKPANTSVGISRVERFQDLEAALALAFRYDEKAVVEKALSPVRELEVGVLGNVFGEASPVGEVRYEAPFYDYETKYTPGRAELLIPAPLDPGTQETVQELALKAYKVLGVRGMARVDFFLAEGELYLNELNTIPGFTPTSMYPRLFEAGGVAYPELLRRLVELALT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-alanine-D-alanine ligase
publication title Crystal structure of D-alanine:D-Alanine Ligase with AMPPNP from Thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Ligase
total genus 80
structure length 317
sequence length 319
chains with identical sequence B, C
ec nomenclature ec 6.3.2.4: D-alanine--D-alanine ligase.
pdb deposition date 2007-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01820 Dala_Dala_lig_N D-ala D-ala ligase N-terminus
A PF07478 Dala_Dala_lig_C D-ala D-ala ligase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 2yznA02
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 2yznA03
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2yznA01
3VPBA 4I4TF 5IYZF 1CQIB 1M0WA 2FPIB 2VR1A 3I12A 3ETJA 5C1OA 3KAKA 4O7LA 4O86A 2V59A 2NU8B 2CNUA 4C5BA 4FGRA 4C5CA 3BSSA 3R23A 2NU6B 3R5FA 1ULZA 4O4JF 4MV4A 1JDBB 3N8DA 3JRWA 2P0AA 4DLKA 2OLSA 5H80A 4YAKB 4O7RA 4WBNF 4O4HF 5DMXA 1KEEA 3OUUA 4FE2A 1IOWA 3TIGA 1UC8A 4O7NA 1B6RA 4EA7A 5J2UF 3RV3A 2ZDHA 1DV2A 4M98A 2YRWA 4HQ6A 4TV9F 3KAJA 1VBGA 5GONF 4YB8B 3HO8A 3R5HA 2FP4B 1WR2A 2NPOA 2NUAB 4RZQA 1E4EB 3UFXB 5JH7F 4O2AF 4XZ3B 5CB4F 4I55F 2Z02A 3KREA 2R6FA 1Z2NX 4M99A 3RV4A 4MA5A 1VBHA 2R7KA 3NUAA 3HBLA 1C3OA 2DLNA 2I87A 2GPWA 5BMVF 3JZFA 4O4LF 4YAJB 1JKJB 1Z2PX 4EGQA 3V4SA 3AX6A 2FPPB 3OUZA 3WO0A 4FFRA 5HBRB 4HR7A 3R9RA 3QFFA 4O7YA 2YZGA 2R86A 2YW2A 2V58A 5C1PA 5JVLA 4NYEA 1DIKA 4ZQIA 2R82A 1T36A 3U9TA 3ETHA 5K2MA 4EAAA 2W6OA 2DZDA 4O7WA 1KC7A 3G8DA 3DF7A 4HNTA 3VA7A 1KJIA 1GSHA 4MAMA 1CQJB 1UC9A 3Q2OA 2W6NA 4E4TA 5KX5F 4EGJA 2DIKA 3TW6A 2W6MA 1GSOA 4XYMB 2XCLA 5FNVF 3U54A 4I50F 4ZOLF 3TIIA 1KUTA 2ZDQA 2QK4A 4MV8A 2VPQA 4FFPA 2PVPA 3BSWA 2Z04A 3LP8A 1CS0A 2ZDGA 1E4EA 3MWDA 4EA9A 5CAEB 5LYJF 1I7LA 3R5XA 2I8CA 1JLLB 2YZNA 4O84A 4M9UA 1DV1A 4J6EA 3LWBA 2XD4A 4TUYF 4IZOA 5I47A 4EG0A 3K5HA 2YZLA 3VMMA 5LA6F 3AW8A 4ME6A 2IP4A 4IHJF 4DIMA 2CQYA 2CZGA 3VOTA 2W6QA 2GPSA 2GQRA 5JQGF 3BFPA 1GSAA 2YS7A 2W70A 3JRXA 2YYAA 3U55A 1GLVA 1B6SA 2WYOA 5JQWA 3VPDA 1EZ1A 5D8DA 2NU7B 2R7MA 2W71A 2R84A 2J9GA 1KJ9A 3Q1KA 5LXTF 1A9XA 4YBZB 1EUDB 4HNVA 4FFNA 3WNZA 1PK8A 5LOVF 4QSHA 4TV8F 3TINA 1BNCA 4O82A 4MV6A 1AUVA 4O7SA 4O83A 5CA1F 4HNUA 4MV7A 5EZYF 4O81A 3MJFA 1EUCB 2W6PA 4FFLA 4FU0A 4O2BF 1BXRA 1VKZA 3KALA 4EABA 3G8CA 5LP6F 1KJ8A 2QF7A 2V5AA 1C30A 2YRXA 3HB9A 4O7VA 4EA8A 4IWYA 2R7LA 4Y8VB 1EHIA 4XYLB 1Z2OX 4MA0A 1A48A 2R7NA 1IOVA 2YZMA 4O7TA 3TQTA 1M0TA 1W93A 1OBDA 3E5NA 1W96A 2W6ZA 2CNQA 2FPGB 3K5IA 2VQDA 3GIDA 2I80A 1EYZA 5BPFA 2HJWA 4C5AA 2X0SA 1SCUB 5BPHA 2R85A 5CA0F 2YS6A 4O7ZA 3RFCA 4FFMA 2FB9A 1JDEA 4FFOA 4O4IF 3MWEA 1I7NA 4IIJF 5KKNB 4L1KA 1KBLA 3ORRA 2C00A 3U9SA 4ZHQF 3BSYA 4MV9A 2DWCA 5J2TF 3WO1A 3N6RA 3RUPA 2HGSA 2PBZA 2GLTA 4IWXA 5HV6A 4M9CA 1OBGA 3BG5A 4XX0B 2YL2A 3GLKA 4ZI7F 2VHEA 2YWVA 3VPCA 4GGMX 2R87A 2NU9B 1GGOA 5C8YF 4MV3A 2SCUB 2CNVA 4YJ3F 5JVDF 1KJJA 1PX2A 3V4ZA 2PN1A 3ORQA 1KJQA 2GQSA 3K3PA 3JZIA 4WD3A 1AUXA 4YJ2F 3SE7A 1CE8A 4MV1A 1M6VA
chains in the Genus database with same CATH superfamily
2DHEA 2IHUA 2Y6UA 1V8OA 2QVZX 4M46A 3OJWA 4MKXA 3TOXA 4M1ZA 1IG3A 4RVUA 3GYBA 1YR3A 4RHCA 1Y1KE 4ARSA 3LX6A 2O2ZA 4D9EA 2AZXA 4Q0YA 3B1VA 1ZHFA 3ZU2A 3LDUA 5C4MA 1XQXA 1SPXA 2C1XA 4PLPA 5CDUA 1G19A 2Q3CA 3RTBA 1PHPA 3K73O 1CJTC 1RR6A 4NPCA 1P33A 2O8NA 4JP1A 4KJZA 2NZYA 2XEDA 3KUXA 3GCZA 4NEHB 1GNSA 5JSKA 2A9JA 2PFKA 3RB0A 1QRAA 2KYRA 5EQFA 1J9EA 4YB8B 4AUNA 2QUKA 4BN4A 1OXMA 5JO0A 1WCWA 5BVGB 2FPMA 3R74A 3FKIG 3TIFA 1NU6A 1EP1B 1TM2A 5KG1A 2GCIA 1ZCFA 3UJNA 5J1TB 3S5JA 1NJ5A 1HE3A 4BFLA 4LWPA 3LW7A 2ZUFA 2Q8NA 2MTBA 5DWQA 5ENDA 4C2TA 1P1CA 2X9NA 2DM6A 3CFYA 2ROQA 1XMQB 4HVTA 2PTGA 3A6DA 3Q7PA 2Q4BA 4GT1A 2J0VA 4OQ4A 4H7PA 4IFEA 1O58A 3FCOA 3KVVA 1A27A 3I5YA 1ZESA 1ZJ6A 2YHAA 3LYHA 1PTJA 2JH8A 3C14C 3OHPA 5JCOA 4CG2A 1XLVA 4LZPA 4R41A 2P0EA 1NVVR 1U9CA 3K2EA 1SKAA 4NL4H 5ULLA 2J87A 4IEFB 3VO8A 2WDTA 2PS3A 4KO4S 3KYBA 4O2AA 1CP3A 1NBOA 1UP6A 2A94A 5IVKA 3TD6A 5KFDA 4XD2A 4X66B 4F72A 4AZ3A 1C9EA 4OVKA 3IKJA 2ABWA 3EVGA 4ZQEA 1CF2O 4FUQA 2IHVA 4NYIQ 4AZVA 3UFBA 1FZQA 4QT0A 3DOCA 3ZY3A 2Q4TA 1U2PA 1J0CA 4G3XA 1J5PA 4US1R 3LC2O 4TUYF 1KK0A 4UQLA 3PXUA 3IFSA 5T4BA 1GEEA 4LHZA 4L5YA 4Z3OA 4JVSB 1SQSA 3V8RA 3NKLA 2QLJA 4J8PA 4POAA 4JJ8A 2E4UA 4RNNA 2QRGA 4WCFB 3KUUA 1I7QB 2PUGA 1QGED 1YJ8A 4WXPA 4QJBA 3BZWA 1IJFA 4IMIB 2WJYA 2UXDH 4UU7A 1BNCA 1TYDE 3PJFA 1Q1QA 1KDYA 1XELA 3NWBA 1M1NB 5AKHA 2R5NA 4MTLA 4JOQA 3TJMA 2A14A 1DO2A 3I4LA 1GNQA 2JIPA 5JZMA 1FVHA 5TEVA 1YRHA 1GFWA 2WAAA 1DEKA 1S02A 4X84A 5LKRA 3KB8A 5AM1A 1EHIA 3HXTA 2DRIA 4G23A 2NSYA 3AVOA 3PKZA 5DHFA 4IRUB 3GUYA 1PFYA 4X41A 1XZAA 2PWAA 2FEKA 5KNCH 4JP3A 5TQ2A 4X9XA 1SJ9A 5D3MB 1P0FA 3OJFA 2NO4A 2CLLB 1SY7A 2PAFA 4YCAA 3PVSA 3RJTA 2C98A 4PGHA 5DT2A 2ZREA 5AHWA 4PFQA 3KLNA 1AQJA 4S1TA 1DKNA 4X24A 1SKMA 1IU9A 2DBRA 1X1RA 3R9XB 1BH2A 4X97A 1KMHB 3C48A 5FUXA 2DUUA 5CVEA 3KQLA 4B0PA 3AERA 3HKEA 3ZHTA 5KYTA 2XPCA 1JWAB 2ZE7A 4F56A 3W8FA 3COZA 4L2IB 2I2XB 3C6MA 3AI3A 1J0BA 5CIQA 3FIUA 4ARVA 1SVLA 1GAEO 2EFHB 3SE7A 3D9QX 4J3FA 3NTQA 3GVHA 1WKBA 5D84A 2RCYA 3A4YA 1U2DA 3Q9SA 3EIWA 4AN0A 3RB4A 3DVRX 4G01B 4CF7A 2XTAA 3Q1LA 1KAEA 1RWKA 3JZDA 4C5CA 4FTWA 3EBPA 1W1WA 3I9OA 3ESRA 1ZK1A 4HWKA 2GZ1A 3QVGA 4LKRA 3QBJA 3TXYA 1GZ6A 4L4RA 2DG2A 1JP7A 4EYQA 2FQXA 1EDZA 2G6BA 4P5EA 4J7UA 3RW9A 3LXMA 3L4BA 2WLTA 5ISMA 3K1YA 3H1GA 5FPKA 2R5FA 1KEWA 4HDAA 2AXEA 4UDYX 3ZX5A 3DBRA 3HFGA 4GPIB 1J4AA 4MTDA 1PR5A 3RV3A 2GA8A 4MUKA 4JB8A 3U3XA 1MCZA 5KWIA 4WN9B 4BFCA 1KAMA 3HBFA 2HQBA 3DDWA 3STTA 1EUZA 1NJ8A 1OXBB 1N1DA 3KHSA 2A57A 3ZH9B 2XMCA 3HM9A 5DTIA 1JXLA 3OP1A 2VK1A 3BZUA 5K01A 2FR1A 2H18A 1W73A 2ZEJA 3OPNA 2DQYA 1VHTA 2YVLA 3DEAA 5BV8A 4HX5A 5HE9A 4KYIB 3WJAA 3GK3A 2JLCA 4R68A 3A9WA 2CXUA 5B30A 3O1JC 4I6JA 1Z5PA 1QK5A 5ILOA 3II6X 1P7CA 2JIOA 3E7XA 3IUJA 1ENZA 1UPAA 3COWA 4JMLA 1ESZA 4QQNA 2IU6A 1G1MA 3DAPA 1QO0A 4Z2YA 2CNKA 3I32A 3TW6A 2HU2A 3TZLA 4BKQA 1Y7PA 2ZETA 4Y2SA 5IVIA 4OXQA 2A3RA 3PC6A 1XTRA 3VMFA 2D5LA 5AXDA 3E18A 4AECA 4ML3A 2VDWA 1L5LA 5ESXA 1CSEE 4E2FA 1XHFA 4NBKA 2VHTA 2PUEA 3SLKA 2FPRA 5C46F 3RC3A 3BDAA 4MS1A 2WF9A 1UANA 4EG0A 2PMDA 4CF5A 2CJPA 1E32A 5JZBA 2JEOA 2FPPA 4RPGA 5JNVA 4OLJA 5DXAA 4H6XA 2VDNB 1COWA 3W7BA 2VSQA 1EZ1A 2RGNC 3NYIA 4JYZA 3K4HA 1FSSA 3SJ7A 3TL3A 1HOXA 1V8DA 4HDKA 1PFGA 4G1BA 5KWVA 1NUSA 2BI4A 3NGDA 2AYZA 3KSZO 2DKFA 1OFIA 1K4YA 3QKWA 4F11A 5LP6F 4EBDA 3FMVA 1EIWA 3ADDA 1XEAA 2VN8A 3ADOA 2XNDA 3RASA 1U0NA 1VC2A 2JFOA 1WS6A 3D0OA 3PIDA 4BO9A 4IV5A 3LUFA 3WGHA 2P1ZA 4KR6A 1EK1A 3E15A 3LPNA 1ZVQA 5KG3A 1B3RA 5HHTA 4JKOA 2FRXA 5FX2A 5IX8A 4XX1A 4Z4HA 2ZUCA 2JB9A 5KPDA 2HDHA 4ICIA 1ZHQA 2BEWB 4GZ6A 4AX8A 4L3WA 4EUHA 4XA8A 5CM0A 3ZHVA 4RPJA 4YXWA 3AIIA 5D3ZA 1E5DA 2XMZA 1N5DA 1CKNB 1G8YA 5HS4A 4BBRG 4I4IA 1P1FA 2P6MA 3N74A 3LX4A 3GEEA 3R4CA 1JEAA 4OI1A 1W8DA 1A5AB 4YRAA 4PR0A 4LRUA 1F4VA 4M9QA 2YXBA 3VNNA 1JEOA 3TQRA 3L7DA 1SUBA 2VP9A 1I1HA 5A5GA 3ZXIA 1J24A 1Z37A 1VKNA 1N34H 5J4LA 3DYVA 4I1RA 3UJPA 3VVBA 1NW8A 2YIMA 2R6CA 2H5LA 4IZHA 2B5OA 2G9RA 1EFAA 5AUNB 3KPJA 4YGXB 1K0UA 1QJ4A 3PG5A 4TT3D 4IIYA 1KYXA 2NAPA 4WBNB 3KYDB 1TA9A 2Y6VA 2ZULA 3CZRA 4TRMA 4C2BA 2QRQA 3W4JA 3QKIA 4KQWA 4GSLA 3U81A 1RYFA 2C77A 2EIXA 4RD2A 1HTTA 1S2MA 3IN5A 2A86A 4B35A 2VJYA 4MMYB 1R4MA 1XNGA 1P61B 2XV1A 3BQ9A 3L7CA 3H0KA 4RB1A 2JJ1A 2P0YA 3ZWDA 3BS4A 2C4TA 5E7JA 1I80A 3LC1O 1AV7A 4CCWA 1JMVA 2NUAB 1SXJB 3X2FA 5FAXA 2IZ0A 3OHAA 3EA4A 1E4EB 4GWLA 2J9FB 3W8DA 1P9NA 1FFSA 1AF7A 4PWYA 3I6BA 3RS3A 4MA5A 5BSVA 3HPQA 2WWGA 2Q7DA 3DWIA 3GAAA 2FW7A 5EZ6B 1R10A 3SSNA 1L4KA 3GJXC 3EC1A 5F4BA 4GQAA 5DPMA 3L0YA 2MHCA 1TT5A 4DABA 2AYXA 1VL8A 3CCFA 3QWAA 5CFLA 4QDOA 1H0KA 2BSQA 2H0QA 4GFDA 5AFSA 2R2AA 1GVHA 1ZC3A 5A5FA 1W6UA 4DDTA 4BGDA 1VIAA 1JMYA 2XWPA 2OYCA 3TNFA 2QENA 1ODCA 1Z18A 2BUBA 4EYOA 1ZHOA 4CLOA 3JATB 3ND7A 4ECRA 3GPCA 3RIGA 1O94D 1GG9A 4X7RA 2B8EA 2Q46A 3M4ZA 1E6KA 3KJNA 3EJ6A 5EPUA 4N5HX 3NJRA 3DHNA 4MUBA 4JYBA 1A0OA 4OIFA 2XCSB 1I6UA 2FFBA 2DPYA 5K0EA 4ED8A 1ZLYA 1JTEA 1G66A 4M7OA 1QS0B 4EJ0A 1J0EA 5DTEA 3PNPA 3HC7A 2JFFA 3GGCA 1EGVB 1KQNA 4ZCQA 3IKTA 4KTTE 5D6OA 1DMSA 4LJ6A 1AHPA 1SC9A 1WMSA 2UUAH 1WZNA 3O9ZA 2YZLA 4LTMA 1GKYA 3O82A 1V4YA 2QW0X 1LZLA 2IODA 5DSTA 4V24A 2QY9A 4R69A 2WTBA 3BFPA 2QG4A 5ADHA 3LH5A 1OYYA 4LRWA 1QGZA 1OZHA 3Q0IA 1SBTA 1X9HA 2C4WA 4EJSB 3DBOB 1W5TA 3EF3A 3DVAA 4TSFD 5JMOA 2NQTA 4BB0A 1U3TA 4QW8A 5JHHB 3O8CA 1P5JA 4LY3A 4OKNA 5BRJA 3HB9A 2GJ9A 4GNRA 1DJLA 2PKWA 4DYHA 4M1KA 4UBIA 2HA6A 5JEDA 2UZ0A 3NOVA 2NTJA 3BRWD 1Y42X 1DE0A 3KU1A 4B75A 2R7NA 2HBQA 3S2SA 3VSAA 3ENKA 3V2HA 4Z7QB 2D0OB 2E9SA 2I3AA 3K2IA 2HHFA 4LJKA 4B81A 4PNZA 3HN7A 3X1ZA 5F21A 5GINE 4NFHA 1NFQA 1MX9A 2HK6A 1IPFA 2FKLA 2HSDA 1Z2AA 4LXUA 3S70A 4QGHA 2BLLA 5IAOA 2WSMA 3KXKA 2DWOA 2ZTSA 2JFPA 1TUGA 4RKEA 3RSOA 3OZRA 3OTWA 2AFHA 3S1SA 3VDQA 2IYOA 4UM8B 2XVXA 2Y9MB 5CGQB 4LDRA 4KWIA 4DG8A 4CKBA 4GP6A 4C7JA 1C1DA 1U3DA 3I5XA 3LUBA 2GEKA 3BK2A 5ANRB 1UBFA 2YOFA 2IPMA 4BMYA 2E49A 4LZWA 1AK1A 3CIOA 2OWDA 3CBQA 4EDFA 4G5QA 3GCXA 4PC1A 3BMNB 3SP1A 3FPGA 4NECA 2C7BA 2ZAGA 3R8XA 4JWTA 3REFA 3M1IA 4MRPA 3R4VA 4PTLA 5KOJA 4D8YA 1A97A 1NQWA 5F33A 1F8FA 1TCUA 2CXPA 2FLVA 4L4YA 1FYWA 1FDWA 5E4FA 2P6UA 1OLXB 4JLBA 1LUAA 2O8FA 3JSAA 4ZAGA 4CMCA 4DLWA 3SYNA 2C9BA 3KV1A 4FNMA 4KLZA 4QDXA 2BTQB 3B38A 4K0RA 5A3RA 1TZJA 1TF5A 3DTVA 4FI3C 3B2NA 5P21A 2SKDA 3ZBTA 5JS1A 1GAWA 1WMEA 2WAQA 2QPOA 5EWLA 1NP6A 3EA5A 4G6ZA 4PO9A 1I7PA 4AS1A 3IODA 1KTVA 4QGBA 3KLPX 1AN0A 5EXSA 4G1UC 2EJCA 3J7AK 3BZBA 2YOHA 2Y2UA 2NU8A 3G7UA 2O06A 2FK7A 3AU8A 3QFFA 2QN3A 4H0NA 2Q2QA 4TVKA 1Z13A 1U7TA 3VQTA 4PTYA 1NBMD 2R68A 1ONOA 1IRIA 2Q2WA 3ONDA 4OU5A 2PX3A 4YBRA 5F73A 2PZJA 2WFMA 2HQRA 4Y67A 4QPDA 4GVLA 3IAM6 3GWZA 4L7QA 1N8SA 1YIDA 1N8KA 3RH0A 2CVPA 1JA9A 4XLLA 1IHXA 4G81A 3HO6A 3PUYA 4IXNA 4MQ6A 1U2TA 2QYTA 1XSEA 3EDRA 4FYXA 3B1KA 4P0TA 3COYA 2PVPA 4JELA 2ZJTA 1IBMH 4A9AA 1SK9A 1CQPA 4PNPA 4QIWA 3KE8A 4IHJB 3F9RA 4BHTA 5JMWA 1JNXX 3CRRA 2XXJA 1VZ3A 2ESRA 3W1BA 4YH1A 1E7YA 1MHPA 2PUBA 1TPZA 4JR2A 4Z1MD 1V8ZA 4HMPA 1BE6A 2IV7A 3DFIA 3U7EB 1D04A 3RKRA 3UA4A 2FWIA 3A7EA 1ET0A 5KYYA 5SYNA 1K83A 2LIVA 4HNSA 1B8UA 3WI7A 2LR0A 4YAFA 1XRLA 2CL7X 4IUCS 4XWAA 3UB3A 4MJXA 1MHTA 3VHQA 1UBJS 5FWAA 1MQSA 3IUQA 1YCFA 2OAP1 4FFLA 2H4YA 4RK7A 1QE0A 2W9BB 1ETUA 4Q12A 3SMVA 4MULA 4JI3B 5JJBA 4MWSA 1GTMA 5LP1A 2AG8A 4R6XA 5LNK1 2ZBVA 3AEQA 3ER8A 4DIBA 3BICA 4GD3Q 1AO3A 4F21A 1RJ9A 2ADFA 2LPMA 1Q22A 3OA2A 1KORA 2AJDA 3ZDZB 3BERA 3WK8A 2CWWA 4P22A 2FRVA 2VTKA 4BAGA 1TUBB 2D5CA 1N5LA 2R3SA 4ZI7A 2IYXA 3DAAA 3H2GA 2O54A 3X1XA 4CHTA 2BHLA 3HCEA 1R0CA 3HWSA 1PEDA 3NHWA 4X7PA 4F9FA 1QMGA 3NM4A 5KTSA 1P45A 5A3QA 3PNLA 2P6NA 5JYEA 4UVHA 4RZUA 4KE9A 1I1KA 4XUDA 4RQTA 5NLLA 1XZ8A 1VPEA 4ZRNA 3KQVA 1U1CA 2QNBA 2WAYA 1TFRA 1UKEA 3ZLTA 1WOYA 2IYPA 2PLWA 1K6EA 4Q21A 2ZGIA 1T3HA 1JRLA 5KFSA 2QIOA 2DLDA 4F4FA 2WTXA 1Y7LA 3IUBA 3ASUA 4UEOA 1G1AA 1O6ZA 2GQSA 3Q7IA 3FVWA 2G28A 5CD9A 1QPGA 2B21A 4LI0A 5FWNA 4BLOA 5ECWA 4KODA 4HGZA 1JVSA 3QUCA 2QMEA 2GS9A 2I4MA 2RF4A 2NTEA 1GXSA 1X7DA 1JEDA 3A6FA 1A8SA 2GGSA 3HCOA 1H9CA 2DBVO 3RUCA 1DQPA 1I6MA 1JE1A 4YDQA 3MRVA 2P77A 3B1ZA 2EJVA 3N0RA 3WYAA 2H4FA 4QQFA 3PU6A 2L17A 4DA9A 3ZDRA 1HKUA 5TQ0B 4BQQA 3IDAA 5EA2A 5G0WA 1ECJA 4FUTA 2IYTA 2HWUA 3PL1A 2OV2A 1KEKA 3T1TA 1K6JA 4FOPA 1R0RE 3VDMA 2D5BA 2NXCA 4ZVOA 1K66A 3AI1A 3RAJA 1GTSA 2GN8A 5DGBA 1Q57A 2AXQA 4C4TA 3A8TA 5L7YA 3WGIA 2JNWA 4DB2A 1S8FA 2R6FA 1FW6A 3D7MA 3PFGA 4RUCA 2XE4A 3G0IA 3AIMA 1VS0A 4CMEA 1EEHA 4MW7A 3GTLA 2PUTA 1OXSC 4C6TB 3QWHA 2PK3A 3L6BA 2B7LA 4CFZA 1IONA 1VYTA 3FTNA 1YONA 3MRSA 2C2YA 3CE6A 3OX2A 3IS3A 5HW0A 5IYDG 3U44B 3TQHA 3UKDA 3EDOA 2OGSA 1CR0A 1YOBA 3L18A 1KI4A 2AQ8A 4JT8A 4GUDA 3IAHA 3UW3A 1FS6A 1KIMA 3B8HA 1L8QA 3GJYA 2JIQA 2VF5X 5B2ZA 3BWEA 3KJFA 4RCYA 2P65A 3K8OE 3UFXA 5I9BA 4MVXA 4EHDA 4RMIA 1JEYA 4M0JA 1K3FA 4A27A 3UJDA 4FBTA 4D44A 1KO4A 3HV2A 5KFIA 4E5PA 1YB4A 1UFOA 4D4MA 1YA6A 4Z7NB 3DE0X 3IQGX 5IAJA 4KKXB 3LTNC 1U9IA 4PRZA 1ZM4A 4R8UB 1DAPA 4NOLA 3DVQX 5JRZA 3ICCA 3CX8A 4ZREA 4TV8B 4Q02A 1WZUA 4P3NA 1Z22A 2RGAA 3TTXA 4A0RA 2G40A 3ZZTA 3V2GA 3NBYB 5K3WA 5AIAA 2G70A 1W0KD 3SQMA 4FU0A 4URFA 1PDWA 1CR4A 3ZTTA 3BJRA 4GMHA 2AUTA 4IHKA 4J29A 3Q3HA 1UXJA 2IPAB 1S68A 4MLZA 4GSKA 1YMUA 1A96A 4EB6A 3WGUA 3OE7D 2ZUEA 5CXQA 3OTOH 3GEGA 5JQGA 1PEYA 3TG2A 5LMNH 3VJRA 1N9GB 1PJ8A 4ZHQB 2IYEA 3HCRA 4XB2A 2QR3A 2PGJA 2PS0A 1JDSA 4A92A 2VUMA 1OX5A 2UKDA 3KEMA 4IHQA 5G0UA 3RFXA 4HDOB 1T5TA 2WWXA 2HK8A 4CKZA 1FVOA 1YACA 2A8YA 2C22A 2V4UA 4IJUA 2WUFA 2P78A 4D43A 1XWFA 3K8YA 4JYAH 4UAUA 4F4DA 3T5AA 2PGAA 4KZKA 3TZKA 4JJFA 1CUHA 3R44A 4X5OA 3CRQA 3KTAB 2JATA 2NTVA 3DQZA 1P72A 1QQAA 3O4JA 2R25B 2G08A 1A5ZA 3O31A 2H65A 2PTHA 3WLKX 3FX2A 2Q29A 3KM0A 2A1TR 5KFGA 5F2KA 3UYYA 4W5TA 2FPIB 4L74A 1ULUA 4UBKA 4C0AC 4N0MA 4BJ5A 4UFZA 3OWHA 5IJAA 3TFQA 2D1YA 1Y8QB 1RM3A 3UXEA 4Z0PA 4LHXA 4CHGA 1T94A 4DLKA 2FMIA 3KJIA 4Q48A 3BJYA 1KKLA 1CZHA 4C0BA 4YMVA 3UK7A 4UXJA 2PQMA 3JQEA 4WAUA 2TS1A 2ID4A 3P4XA 3IT1A 1JFVA 1YIOA 4GR9A 2ZB7A 3KP1A 4R4JA 4AU1A 5K8JB 1TLFA 5B6IA 3K0HA 3GVPA 5IAAA 1WXHA 4FYKA 2ODQA 4D0RA 3RFTA 2ZYHA 3H9EO 4ERNA 4G41A 1QIMA 3GIMA 2HRBA 1ZAKA 4C2MA 3U0VA 4HB2A 5TR9A 4M0FA 1JSCA 3RVJA 3DQQA 4RKQA 1CKEA 3DXXA 3NANA 4JLVA 3RV4A 1K7XB 4FW9A 2P68A 1R4NB 2R7KA 4S1PA 1UDCA 1GFZA 5I3ZA 1ODLA 5AI4A 1PF7E 4G0ZA 5F7JA 4JQZA 2Q9CA 1VA4A 1FFBA 3FAKA 1RKQA 4KQIA 2ZS8A 3T1HB 3KAPA 1N3BA 4BX3A 4UCUA 1E79D 4KQ2A 4XUCA 5B7GA 1PR1A 5EWMA 4A3LG 3HNPA 1F4LA 4RSGA 1HR0H 2IELA 4EAAA 5K2MA 2X2EA 1NIPA 4IEIA 4G0PA 1JH9A 3HSSA 1TU4A 3A6LA 3PQ3A 2Y1GA 2EU8A 4Q4AB 1O94C 2QTTA 4M1YA 4ZQHA 5AI8A 4D02A 2GVDC 5FO1A 2IZ7A 5KJ6A 2AJTA 1C1XA 1ZGZA 1KVTA 2QX4A 3RPEA 1ORWA 2V8BA 2ZAYA 3UO8B 3VJKA 3GJRA 4ZOLF 2XYPA 4LJAA 1DMRA 1I51A 1E9CA 1XD2A 4DWWA 5BMVA 5J4KA 3Q8LA 4RULA 3ZHZA 2Z2YA 5KFTA 4CR7A 1N5MA 4MS4A 4AYBE 1FSGA 1SN7A 3G5AA 2ID9A 1ZA2A 3DLAA 2IJGX 3DZFA 1YDHA 1UP4A 2NU7B 2ZUBA 3MUOA 1NN5A 5EOYA 1S5PA 5GY7A 1SHUX 2BMEA 5F7XA 2X2OA 4JIGA 4H59A 4LVNA 2BFPA 4HHEA 3U19A 1XZNA 3PC8C 2B4KA 2R92G 4ND8A 4MV6A 4HZIA 4IGKA 4OHPA 3B85A 1MB2A 4IHAA 4PG8A 4PWZA 2VF8A 1VHDA 4BB5A 5L3VA 1RI1A 4RD1A 5C2JB 1TLTA 2XVZA 3O4RA 5I7OA 3L8FA 3MGGA 4JZYA 2REBA 4DFDA 5DN6D 5A3VA 1IOVA 2B8JA 2VJCA 1QPZA 1NBME 3HR4A 1FX0A 2A9RA 3AY7A 1OTXA 4F38A 3I2FA 1Z2EA 3I0ZA 4JLOA 5EJ5A 2NT4A 4V2IA 1A88A 2CL0X 4EL5A 2QPTA 1CS4C 2C5EA 4XJVA 4HZGA 1P5HA 3M3HA 5K0LA 3V4LA 2OAGA 2RH5A 4IL5A 1TWAA 1IHDA 4KAAA 5KFVA 1MC8A 3OEYA 5CCEA 4J1TA 1AE1A 4ZFNA 1M5TA 1FB5A 2FF7A 2H1IA 3QPUA 3I52A 2YUIA 1KK3A 4WOCA 4RH3A 4PICA 3LYLA 4N48A 3L4JA 2R8IA 2O2CA 1ZRSA 3MBKA 4UHFA 3THOA 1X0XA 5TIIA 2EFYA 2XAAA 4CNBA 1L2ZA 3SDSA 1KVUA 3RF7A 1HLFA 4EEZA 2XZLA 1PZXA 2HUPA 1T25A 3MJTA 4KMOA 1CE8A 5U1PA 2QN6A 5I5GA 2WSYB 2REQB 2QAJA 3AGQA 3PICA 1MA3A 1I36A 4ZJZA 2CKZB 2OBLA 4PINA 4C5BA 2WD7B 2Y1XA 4KIGA 2B4TO 4XYEA 4AY6A 2UUBH 1JSZA 1GDDA 1KZ9A 5H68A 4GEGA 2YWDA 4XFJA 2R4TA 3RVSA 4QODA 4DV7H 1Y63A 3H7IA 4TV9B 1C14A 4CDNA 4EKGA 1NLYA 4GVPA 2FZ4A 1LDEA 2EEZA 5AW2A 1NVFA 2JDID 2IZOA 2GTPA 5I7VA 4L8GA 1UMBA 1AUQA 1ZCBA 2O2EA 4DHEA 3JWJA 5AKYA 3R9WA 1Z06A 3R8FA 1PVDA 3G9XA 3ZUPA 4TLLB 4KOEC 4ZCTA 5LZ4A 1E64A 1ZD4A 3AF5A 4LYDA 2G25A 2UYHA 4RJLA 2DXIA 2P9GA 5BURA 1CUEA 3IAS1 1U7PA 3V4SA 2GPTA 3VBCA 5DNEA 3ORSA 4FEGA 4LYJA 2XWBF 3H0GG 5AIBA 4OLHA 1OWTA 3E7DA 1TWFA 2TSYB 3GJ3A 4S1OA 2GCPA 3CWCA 2PLRA 3GRZA 4DDUA 4BVAA 5JFGA 4ZP1A 4OK5A 5KSPA 2NV2B 2RHRA 1XZKA 1TGVA 5EMNA 3N9IA 1CRPA 1FFEA 2MCFA 4HNAB 1U0BB 4EHKA 3KEOA 1BA2A 2WJPA 2GZAA 4EHIA 4WKOA 2OZKA 4MB2A 3PGMA 3P2JA 2GO7A 4X8OA 3L8CA 1ZYUA 4CLXA 3U4CA 4HDCA 3O8BA 1KYIA 2D74A 1T8PA 4M76B 2N0SA 2G7MC 3SICE 5TRTA 4IZOA 4RPKA 4LE0A 3DV9A 4YR7A 4XWYA 4DG9A 3A3KA 4C87A 1G3RA 4BASA 1SIBE 5EVCA 2W6QA 1MVNA 2R1VA 5DLYA 2ATIA 3D3QA 2F3QA 4LF4B 5BQ5A 3Q3VA 3JARA 1ZXXA 1Y89A 4EHBA 1LTQA 4ER6A 3CZQA 2JFNA 5M2QA 5THXA 3U13A 4NSNA 3KQKA 4ED3A 3EPPA 1GKIA 3TINA 1UMKA 2ORVA 4OY3A 3EXHA 1EGAA 3I34X 1RYEA 4HYQA 4JOSA 4DMKA 3D8NA 3U6BA 5D1OA 5DG7A 3D8HA 1IWPB 4DPLA 3GDFA 2CB0A 5IBRA 4XFDA 3TYXA 1POWA 1Z9BA 3IOCA 3P19A 2WNHA 3QHQA 3RRYA 4I4CA 1RJGA 1U28C 1T5DX 4MA0A 2PWPA 4WACA 1OF1A 1NRWA 1CJUC 1DL5A 1R6BX 2QUJA 3L84A 4N4AA 4YRIA 3PHLA 2FFAA 2C3PA 4I66A 2GRUA 5DBIA 3U4AA 1T5LA 4R81A 2BYTA 1GTRA 2OBBA 2BGTA 4PO8A 4BNWA 4GXRA 1U0FA 2B5WA 4DV3B 2R00A 4F4ZA 4ZHSA 2BEVB 3T34A 3TY5A 1D0SA 2WHEA 4BVHA 4LF8H 1RAIA 3P71T 4TKLA 4BNIA 5E6RB 5GWXA 2RB4A 3VXKA 2XOEA 4XGIA 4W5RA 2FLKA 3UB2A 9MHTA 4OX9B 5C32A 4CYMA 2FSSA 1PK9A 5KSZA 3ILYA 1YC5A 3REGA 2NPFA 4PY2A 3ABRB 3F1LA 1KFKB 3RS7A 1MEJA 3VV3A 4R7TA 1RWXA 4EHAA 1FZTA 4CM1A 1WQ1R 1SURA 4UBNA 2A59A 4LVCA 2BH2A 5BW8A 4L57A 1Q1BA 3WHLA 4GMDA 4QTUB 4RNDB 3EXG2 3SC2B 2BSXA 3TRJA 1FA9A 2BEUB 2HMWA 2EL7A 1DXYA 2FPXA 3QVOA 2Q3EA 3KOZA 2AOTA 1JDBB 3TW8A 2FMUA 3ADPA 2F9LA 3CHYA 2KBFA 2OYRA 1P7YA 1GARA 3A10A 2O3SA 2WHPA 1RWQA 2CHGA 4Q18A 1U7UA 1XQ9A 1ND5A 5I4KA 2PJRA 5C8VA 2X3FA 4LYGA 5BXQC 7MHTA 3C5HA 3OF5A 2QAGB 3GLUA 2VS1A 3PNSA 4YJ3A 2E21A 2CXRA 2N46A 2TMDA 4KE8A 3OEEA 2HAEA 1HQKA 1XNQB 4Z1OA 2IS4A 4AN4A 4D3ZA 1N1MA 2HSZA 1W46A 3UMFA 4S1VA 3W5DA 2CMKA 1QTRA 1X1SA 3GRRA 3HUDA 1EWKA 1ORHA 2V6JA 3TH5A 5DIZA 4B31A 4O29A 5A5VA 4YRRA 2V0NA 1D4FA 4ZI2A 4O4JA 5CBPA 1MH9A 4OO3A 1TM4E 1OWOA 1OD6A 3N42B 2HA3A 3ITNA 3AV0B 2J4CA 1X1EA 2FWAA 4MYDA 1BU5A 3TRKA 3GRYA 4FEYA 2Q3LA 4P7JA 3FPJA 1AB5A 2J67A 1DIKA 4C76A 2NM0A 4KO3S 2HCJB 1U7DA 4AP5A 4M37A 4E88A 3Q5GA 3GXOA 3RGWS 2JHAA 1XHEA 3V4FA 2AFIB 3MTQA 2VZ8A 5K8CA 1J8DA 1VLJA 5HBGA 4ATNA 3NBMA 2A67A 2P4SA 2OXFA 1DJQA 3D7NA 3EW9A 2G4VA 3ZJ5A 2JGEA 3V1KA 3OM9A 4EARA 3HU2A 2WTFA 4RTNA 4I0WB 1E59A 1QKKA 1IN1A 2HBZA 2IEZA 4OHKA 1GILA 5FLEX 5GV7A 2BR5A 4YV1A 3IMGA 3NUQA 3IBYA 5KFJA 1JPNA 3DH0A 4F93B 4P08A 2HO4A 2Z1DA 4LFBB 3VDNB 3WKAA 4NZOA 1EVIA 2FY8A 2H2GA 3W2GA 2CXTA 3UJ8A 3ZQ6A 5AJUA 2IZ1A 1T0HB 5L3SB 4LF6B 2VA8A 2O2DA 4JUIA 1V96A 4LFCB 5KNDD 2HA0A 4BKMA 2ZSIA 4J49A 3Q1KA 4GQIA 4ER7A 1F3LA 1QH9A 2OQ2A 1XYYA 3GPIA 1UK8A 1ZSYA 4I50A 4UTZA 1F8UA 4DNPA 9LDBA 1OPXA 1JIVA 5ALGA 1U7XA 1JHPA 1FPMA 1KDRA 4AO7A 4BYMA 1ZW1A 3CZCA 3QFSA 5EE9A 2QN2A 1AQYA 2A0WA 3FUXA 3IV6A 2GBIA 2UXBH 1EKVA 1JX4A 2PR7A 3D6TB 2ZT5A 3OMLA 4BLUA 1UBSB 2GBLA 4U2CA 3SD7A 3JQCA 4A7PA 4RB2C 4RVFA 2CXQA 4B8ZA 5KNLA 4OMUA 1W5AA 3C7AA 2QSJA 4YI3A 4DLZA 1KZGB 1YKFA 3JSLA 3OIVA 2GTHA 2BCJQ 4KKVA 3ZLUA 4FBMA 4TMYA 4MB6A 1M5RA 4BN5A 2WFLA 1H2EA 3OIWA 3GT3A 1EUDA 3QLJA 4L07A 3HB5X 2D2IA 3CUYA 5BVHB 1GD1O 3M83A 1XB2A 1Y6QA 3EAQA 1Z3IX 4IH1A 1DXOA 3IULA 4MVJM 1U8CB 5DYNA 1W6RA 4MWEA 3B13B 4XWGA 1P2SA 4RGYA 3AM5A 4NENB 5JVDF 3CW2A 2W11A 4QPJC 4DIUA 1KY3A 1GZ4A 3ENNA 2IHJA 2FG7C 2GO1A 4CUKA 3HXQA 3SN6A 3GLHB 4QNNA 4W9NA 1V8FA 4B3JA 1YVEI 4US2R 3PNOA 4JR1A 3IKLA 1DQYA 3AHDA 4I1UA 4A8JA 2ZJAA 2GNAA 4CM4A 3TB6A 1UQTA 1MVOA 2ONKA 2PX4A 4RD4A 1SM4A 4E12A 3MQFA 4HN9A 4BMNA 2D0IA 2O7VA 2F1KA 5GPBA 3HOYG 4DM4A 1WB4A 4JP8A 2WYIA 1CUUA 3UZBA 3FRIA 1VSTA 3KAQA 2EIYA 4G24A 3OU7A 3W9SA 2GA9A 2JI9A 2RGVA 3THXB 1FSFA 4WERA 3MWMA 3ZHXA 3SQWA 2CXXA 1IUNA 5L1JA 3R2JA 2NU9A 4GLOA 5CG1A 2CL6X 3SY8A 4GE3A 3SIWA 4BTEA 3DZJA 4Y2XA 2PGDA 4QIHA 1WDLA 1QE3A 4YMUA 4MQBA 2HVRA 5L1IA 4JUFA 4X00A 3BGIA 2AKAB 3LPLA 4V0RA 5DH9A 4PAOA 4PYOA 2BP7A 1CUAA 4F3TA 2QMHA 1CRLA 1ZU5A 4KXNA 3UHPA 3KKEA 2M6SA 1NRXA 3WNDA 4LZOA 2YW2A 3VNUA 3MCVA 1HDYA 2BCEA 5ALJA 3IIEA 4DMLA 4W7HA 3FGNA 2JKYA 3RTDA 4LNAA 4YROA 3QEOA 3WK4A 2QGZA 3MJEA 5JJCA 4K2AA 2HDKA 2PYIA 1PLJA 4HUTA 3V1LA 5IABA 4EY3A 3QY0A 2C7QA 4Q9LA 2QXUA 3JVUA 3U54A 1X2EA 4C4SA 2VPQA 1T8TA 3T38A 1PGPA 3IL2A 4PYRA 3GRFA 3EGEA 3FOFC 3MWDA 1NFFA 1QR2A 4W9MC 2VQ6A 1DGQA 3ZWAA 3B53X 4TN1A 4JGBA 1CS0B 1QRTA 2QZ9A 3NAGA 4PSVA 2WWWA 3RUEA 1ZGCA 1M6WA 3R40A 3OUTA 4N39A 4DAOA 5GJVC 1FFHA 1HKHA 2YN4A 5KKAA 2C83A 4ILKA 4X3PA 3G2IA 4OQLA 3OY7A 1PG2A 2RBEA 2C7OA 3I39X 2PSEA 4LY9A 4KVAA 1UMDA 3BHMA 1FMCA 4DL2A 1K1EA 2ZIXB 2RHCA 2Q8PA 2Z4TA 2BISA 5AP9A 2ZOSA 4HLQB 1YB7A 4LSZA 1YDMA 2ZI5A 3LD9A 5ARDA 4H6PA 1TJ5A 5CRIA 1VKZA 5JPDA 3KALA 2AOUA 1G8KA 4TLBA 4U8GA 3M8KA 2ZTVA 2I4TA 3SXJA 5LC1A 3KWMA 4EGCB 2YZKA 1HYGA 2OTCA 4MWBA 1FS4A 4DLLA 1AMOA 1EX9A 3OQIA 4XYLB 4D5GA 3T3PB 3QVKA 5EE0A 3G59A 1CB0A 1WPGA 5CHEA 4DM7A 3PX2A 3QX8A 3CEMA 2VAMA 2CNQA 3JSNA 1EK5A 4IF4A 3AEXA 4HEJA 4LZLA 1QLJA 5CA0F 1Z0AA 5AJTA 2JA6A 1Z82A 1NVTA 2EARA 4ZARA 1G4UR 3JQ8A 1XOIA 4JJIA 4QL3A 1TEZA 1ZOOA 3U3DA 5IEBA 3RYFA 3IDOA 2C0CA 3LHFA 2D7JA 1VRCA 1X42A 3T9EA 3GLIA 4RM2A 1JZQA 4URXR 1I4TD 4P7GA 1QDLB 2D3WA 3FWZA 5KJFA 4AC9A 1GNRA 4Q39A 3H17A 1NBEA 2HGZA 4GRAA 1C81A 5FL7D 4D41A 2QM3A 4U7HA 1ONNA 5D7BA 2H1VA 3O74A 4HLCA 4PX9A 2D54A 4POOA 5C31A 3Q41A 1ZIXA 3EIHA 4EATA 3TPZA 5IP9G 1U98A 1XZCA 3WZ2A 4CTKA 3UPUA 5I9IA 3A4TA 1SCJA 3FF1A 1M2JA 4DOMA 1KEZA 1YWGO 4YMGA 1ZH0A 4N0DA 2PXAA 1ZH4A 3BMOB 1NF2A 3IQDB 5AKZA 1Z5WA 1PT8A 3CX4A 1GGHA 2OG2A 1ESNA 4WUTA 2R7AA 4TTVA 3K9GA 5E3JA 3GTGA 2OHGA 4QSMA 3KTDA 5L8VA 4EX7A 3GFPA 4B8YA 5LZ9A 3EC7A 3NG1A 1S8NA 3NOQA 2R8GA 1E3QA 1R50A 1V9SA 1VB3A 1PGOA 5J2UF 4HFNA 1WP4A 4XDHA 4N6OA 2YWEA 1BJRE 2QRKA 3OIUA 4RAZA 3EAGA 4MEJA 1C0KA 4HZUA 2F64A 5JH7F 4QUHA 3EG9B 2OH2A 4KGXA 4BS9A 4DXAA 3OJCA 1Z4OA 2AG6A 3JQGB 3VI3B 5JD4A 4EGAA 4RF4A 3EZ2A 3NGMA 2J48A 5CPFA 2JJQA 3M1LA 3ZE6A 3QA3E 3U4QB 4UHHA 2QLTA 3GI1A 1ACLA 2JD2A 4YALA 3O2JA 5BORA 1D1SA 1PUXA 1MXFA 5KFXA 2DPIA 4DLNA 1J42A 1MN6A 4R2HA 1DARA 3WIUA 5JUWA 1USIA 2WAXA 4HQNA 2H57A 1YK1A 4HB0A 2FZKA 1DC8A 1R7RA 3PXCX 3G1UA 5K03A 2IH5A 2VQEH 3EB9A 3GP3A 4E5DA 4YR0A 2PKYX 2SBTA 1WTCA 3L46A 1V5FA 2DC1A 4P36A 4X65B 5KG2A 5KVVA 4IIVA 5KO2A 3KHGA 2F4VB 3EVFA 1BWSA 4MQ4A 3T3IA 5C5DA 2R8HA 2Q99A 4MV8A 1A2OA 3HJGA 4BCDA 1RRCA 3HN2A 3ICWA 1DJPA 4PYNA 1I10A 4R0MA 4IICA 4BFUA 2ZBFA 5T67A 1BWPA 3QZ8A 2MSDB 3MOIA 2E37A 1SD1A 1RQRA 4GRDA 1T0PA 2VSXA 4LPKA 2XZPA 5GJBA 4ALNA 3ORYA 2C4VA 4DDWA 3TOVA 4MIYA 4G4IA 5C3EG 1W581 4JV5H 5JDIA 1E2MA 3PCRB 4QA9A 3SG0A 4FBGA 1DOZA 2HF8A 1UPBA 3WNCA 4I1SA 3F49S 1P8JA 3UJ9A 2XUDA 1UDRA 3P8ZA 3WL4A 5I5VA 2DHQA 4V0KA 5IZ4A 5EIOA 2PYDA 3G0CA 2VHCA 2DR3A 5DT9A 3WR5A 2BUAA 3GVXA 5KFOA 4YCBA 4INJA 4KQXA 1WSBA 1JPUA 1H2RS 2HJGA 2QRVB 3B3JA 5IN4A 1BVYF 4ZYTA 1GGFA 1IBKH 5E3IA 4LZZA 2XT9A 4K6OA 1OIVA 4EFBA 3SKXA 3BSFA 1DVRA 1EGQA 3NEJA 3QWFA 2FSIA 4ZZIA 5E1OA 3QW2A 1YU9A 5SZHB 4W5JA 4WIAA 4BGUA 1UINA 2WVHA 1MIOB 3K32A 4H7FA 1U6JA 1FRNA 2H17A 2WJHA 4WOPA 2V98A 3STVA 5EKUA 3JVDA 1QC5B 4DCGA 1HDIA 4KQ6A 2ZRBA 2CLIB 3UCFA 3KNZA 3SNKA 3WSVA 1JBKA 1SZPA 2QD1A 1CUJA 1OH5A 5HA5A 3ZWYA 4DVJA 1I7NA 1VOTA 1Z8HA 5K7SA 4DIDA 1HF3A 2NXJA 5J1SB 4OHWA 3MT9A 2ZATA 1MJGA 3UHJA 4UFNA 4MV9A 5MF6A 3O8OB 3H4DA 4TSFA 4YC7A 2NO1A 4D45A 1GQSA 1W85A 1ZJ5A 5P8WA 2XMBA 2I55A 4R1UA 4EPRA 4LQCA 4MLDA 5K3CA 1P6QA 1T1SA 2H52A 1PGQA 1YR8A 4BIIA 1CUBA 2LWIA 4EOGA 4BMCA 2J9XB 3T7JA 4OPMA 3WLMA 2WWFA 2W8BA 2Q3JA 3V4ZA 2B35A 4KRGA 1VSBA 5CR5A 4X85A 2COKA 3SYTA 2VK4A 3WYEA 4GP9A 1VPTA 4Z4IA 5H7XA 4KWHA 3ZLJA 2G72A 4L15A 4R2IA 4LJSA 3LO5A 3CH5A 3TQIA 4OBXA 5IHXA 1DFIA 4JEUA 2GAJA 5ESDA 2ZYTX 3L77A 1DOHA 1SZDA 2B8TA 4ZCIA 3HHPA 4OJMX 4O8ZA 3C70A 5KDOA 3JQRA 4KR3A 3BTOA 4JUDX 1SUDA 2IDMA 4I5FA 3C8UA 3L40A 5BQOA 3SHTA 5KNDH 3ZHYA 3BA9A 1EJ2A 5GAJA 3ZXSA 1V3VA 3OUUA 4X1IA 5GP1A 2R93A 4LMYA 5C35A 4Q93A 4MV0A 3X2SA 2C7GA 4OHXA 3HEMA 4D9JA 1IYDA 3D4OA 3AUKA 2ZFUA 1E3DA 2X5OA 1XTJA 4I55B 1RBZA 3DZ8A 2FP4B 3MOGA 3H4MA 1Y0BA 4P92A 4JBHA 4GBJA 4ZVLA 1GZ5A 4HH3C 4AMUA 4LZNA 3RSCA 3DMYA 1F48A 4J1NA 3UAOA 2X40A 1NUUA 5GZ1A 4IX1A 3PEWA 5TGTA 4EYSA 3CRMA 1QHFA 5CB6A 5MN5A 5A7FA 4J9PA 1V6AA 1F38A 1C8VB 1XZDA 4HAIA 2L19A 1P4RA 5M5BA 4QWMA 5J43A 2AX4A 2ON6A 1D8TA 4N54A 3PWTA 1IPEA 1EVYA 1LTHR 1U7HA 4O4HA 5BUQA 2HPZA 4AG6A 2WJGA 1V2HE 1Q77A 4HJRA 1M76A 1N3LA 1SGWA 2J6CA 2W6OA 3PTLA 2AFRA 3TM4A 1QNLA 1PJ4A 5LYJA 3TRDA 4P1ZA 1JFRA 2KB0A 3ABSB 1VAJA 1CQXA 4DJFC 4JHLA 5HQ3A 2C9CA 2XADA 1YS4A 1XO1A 4YAEA 4WZBE 3IXQA 1IZ8A 2H4HA 1B1CA 2IMWP 3LLVA 5KMGA 2WIKA 2EW2A 3STUA 2J6SA 4RLQA 3PR3A 4A0GA 4K9PA 1QOQB 4O4LA 3EQ6A 3RF6A 1JFFB 1D9ZA 1Q1AA 5K3AA 2JLWA 2QXYA 1SKBA 3IB6A 3NHRA 2V7GA 3RR2A 1HNNA 4P84A 2CF6A 4P0PB 1V0JA 1TAQA 1CIJA 1NXTA 3CLSD 2ATXA 1UJMA 3LM8A 3EGVA 4C3UA 4J9UE 1Z4QA 1RWBA 1S0NA 3SLGA 3HVRA 4QARA 2BELA 5HIJA 3OOHA 4GX0A 3DHYA 1RI2A 3C6XA 1A72A 4OFZA 4ZOQI 2XNKA 1X7ZB 1Z6GA 2H4XA 3R8CA 3VPAA 4DV5H 4M0EA 4AL4A 1X8JA 1KE1A 3TNJA 4R2KA 4Y9UA 4G67A 5K6AC 1KKMA 3AL0C 2YWHA 2F6RA 5IWAB 4JT2A 3U2QA 1X8KA 4XUGB 1FJHA 2OV6A 3IVXA 5G0TA 4EHNA 4RL4A 3LQYA 3VHXB 4Q1AA 1KSHA 3NHFA 4IJMA 1P77A 2H3EA 5GADl 1OX4A 1FRZA 2RE8A 4QDTA 2ZI9A 4BEWA 3K0FB 2ZS7A 1R74A 1E0SA 1NLZA 3TZCA 1J0XO 4A8TA 3JAMW 2I8LA 4B3XA 4UARA 2ZRKA 3HLKA 2GPJA 4UBOA 1YR9A 3MVEA 3U9SA 5DI9A 4F96A 2EJTA 1UAAA 1NW4A 2A1IA 4PAWA 3ZH2A 1UPXA 4QHSA 3B6ZA 3X0DA 2HZ7A 4A3DG 3T9BA 2PH5A 2QVCA 2QN1A 1X3LA 2HIMA 4XIGS 2R87A 1TTQB 4DJAA 4UW9A 1NPYA 3NETA 3T0FA 2WVGA 2AZ4A 5GVSA 5L3QA 3OEHA 3ZWQA 4IOKA 4CLEA 3WGVA 3GD5A 3IEVA 3CF0A 2PUCA 4AULA 2IUFA 4AJHA 2ECQA 2FE1A 3WGYA 4MZXA 1SO8A 1FCJA 2JIBA 2RGXA 3I42A 3H87A 4DQUA 4BZQA 1L4MA 2XGPA 5DYIA 3VSCA 1CEXA 4BZWA 1SQ6A 3TEJA 3N58A 3L7KA 3IAXA 4I08A 5H16A 2F3SA 4HPWA 2YJ6A 1PG0A 3HE3A 3W5BA 1GCGA 4CIYA 1XK7A 2ZYIA 4JYMA 2TMGA 3F98A 3NVDA 1DC3A 1SD5A 1TAUA 3U60B 2BFFA 4C01A 2FZWA 5EJMA 1XXHE 2B36A 4QLAA 5ICSA 3O3NB 1JT2A 5HFJA 2DUJA 3EIUA 2R2GA 2FN7A 4MUNA 4OJYA 4KHZA 5IYZA 3QZUA 3WL8A 5CX4A 3ZHRA 1TEHA 5J47A 2QRMA 4L76A 2MOKA 3EEYA 5BRAA 4IAJA 4A3EG 4RDCA 3HXPA 2C28A 3D4BA 1CQIA 2NMVA 4RCVA 1VG9B 5E4TA 1CULC 3MR3A 1GL3A 4HLNA 5JE8A 3KKQA 3AVVA 1QF6A 2PLAA 1OW3B 1CYDA 2Y27A 3GIKA 4BVBA 3H19A 4PPQA 3RC1A 2P5TB 1OX6A 1JB1A 3E9DA 4DR3H 4RVSA 3K2QA 5JADA 3CX7A 2QLMA 1BTOA 1TW2A 3HB7A 1X7WB 4W1QA 2MYTA 2VXOA 5A3SA 3AW9A 3G2OA 4OHBA 4M6WB 3JV7A 1QB7A 4BMXA 3PQEA 1QQBA 4LISA 1ISGA 4Q05A 4EELA 1KF0A 1Z5OA 4WGFA 4BLQA 5DLFA 1DT5A 4P4NA 3EEFA 1OBFO 4P58A 2JCXA 1EWQA 4OQMA 1VHJA 4NP6A 2EQBA 2GUWA 1N6KA 3S2GA 3DLCA 3Q8XB 3OM1A 1CVRA 1E3WB 1OXVA 2FW1A 2FKNA 3VC1A 1FRFS 1T9ZA 4ENPA 1USUA 3EPHA 2A9FA 1HQDA 3U7QA 4JX9A 4RAQA 1OAAA 3UENA 1U3UA 4AS3A 1Z7GA 2F7SA 1P5ZB 3STHA 3IP7A 3TUZC 2BCGY 3J7TA 4YREA 1P2GA 3MWLA 2NO6A 4BNLA 3BE6A 5EIHA 4ZYYA 5FLKA 4BATA 1PL7A 3AQIA 4PZUA 1VG1A 4NABA 3CX6A 1S1CA 2BKUA 1PS0A 4ZO4A 2EWWA 3UGTA 1OREA 4O1IA 1MX3A 1N2BA 1AB6A 1BXRA 2VP4A 2ZT7A 3KSBC 2OORC 1BW9B 3P9KA 3ROKA 3WHIA 2IKSA 3PFFA 2YHIB 1C7JA 3WV4A 3HI4A 3H1AA 2WIJA 2C95A 3QFTA 2F9FA 3IQWA 1F51E 2GESA 6AT1A 2DQ4A 3O21A 2JANA 1RTKA 4YECA 3DZKA 3HCPA 1P0QA 3PHGA 4HOYA 3WIEA 4WFJA 4F0JA 1NW5A 4A6DA 4EEXA 1PVOA 4P93A 5BPHA 4HEQA 1CU1A 3NHYA 1N4DA 4IVPA 4RV9A 4XIYA 5LJIA 5CVUA 1I0ZA 4KDCA 3IP8A 1YRWA 3L0BA 5F1YA 4GLBA 4V39A 2C2DA 3GTJA 3R3JA 3OZCA 2BHRA 5LOVA 4DV1B 2ODTX 1SPBS 4WXMA 4D4GA 2CB9A 1OBGA 5JS6A 2G83A 3R7DA 2FX3A 3USES 5FUQA 4LZJA 4I4TA 4MJLA 3HUTA 4CKEB 2OP0A 1E66A 2V5UA 1IUOA 4QVIA 4D0LB 4KK4A 4WNAB 1ZH6A 3JASB 1Z0DA 1QHHB 5JC1A 3UBMA 1JQJC 4P5PA 3GP5A 2XGSA 4JC4A 3VVMA 4FWIB 3LOUA 4P4LA 3EGDB 1FMFA 2CJFA 5EEGA 2ARKA 1Y6JA 2XDAA 1XQYA 4NHOA 1G3UA 4A5SA 5CK4A 3TJRA 4EUKA 2AN3A 5BYBA 1WX1A 1T4DA 4MUAA 5TVGA 4UM9B 1T4CB 3D6HA 4XARA 4UREA 1TQ2A 3D59A 3RK0A 1DLIA 2Q3FA 3IHWA 4GKBA 3SZ3A 1QRDA 2C03A 1VSUA 4KAXA 5KIAA 2QT9A 7MDHA 3VKVA 1QH8A 4X62B 2O19A 1YVPA 3ICQB 1IBLB 5DO9A 1PJZA 3C8DA 3LHIA 4JHXA 5ALYA 1GZHB 3PI7A 1CEEA 5FA5A 4Y2GA 5KNCA 3DV0B 2XB2A 4HXGA 4RY0A 3R7LA 3QU5A 2C4NA 3BXXA 1JTVA 3WXMA 1XZJA 2C78A 4ZVRA 1TDJA 4BNDB 4N41A 4YRDA 2ODPA 3OZWA 3I30X 2GSDA 5A7HA 5JAUA 2J0UB 1IUPA 5E0OA 4HVLA 5DHSA 2HHLA 1KJWA 1WXXA 2A1UB 2OB1A 5BV1A 3AVTA 1M0SA 2A5FA 1JJBA 4TWAA 2AI3A 2ZIAA 2AN9A 3VNBA 2Q5JA 4B7UA 2X5JO 2E5LB 1U0LA 2P7HA 1T9GR 5KTRA 3LG2A 4AROA 4BMOB 4EJMA 3C3WA 2PRZA 3ZK7A 1ATZA 1SUSA 4HN4B 4MQEB 4Y6SA 5IK2A 3DF9A 4QO8A 1FDUA 4BLTA 2PKXA 2VCEA 2JAQA 1U2QA 1M2EA 4FFDA 3QELA 1XKTA 3E7WA 2DSTA 2R6GA 3JQ7B 3O94A 3KHLA 4DILA 4NDZA 3NIBA 1URPA 1XLWA 2RGNA 4B85A 2GJ4A 3HJCA 3SZLA 1N6PA 1NXQA 1BXGA 2H1FA 5ETJA 5KYXB 5CDFE 1UKYA 5HOQA 1M7BA 3ZHOA 1AOXA 1GAXA 5IT0A 1HPLA 1LPPA 4CCSA 4QVGA 4EVQA 3GFRA 5F78A 2V5VA 4UAVA 4HWPA 1OLUA 4EG5A 1X39A 2XGMA 3AV3A 1NJ1A 3VZSA 1JLHA 2Z09A 1HFEL 1DZIA 3WY9A 4YY3H 1R0ZA 2R84A 1K7YA 3FDSA 1KJ9A 1JLSA 2GHQA 2IUSA 5EXEA 2BKEA 3H65A 4RQBA 3FCCA 3UGKA 4JLKA 1NTRA 3R7SA 1T0IA 2OHIA 3NNDA 4L51A 3PZBA 3QNMA 2N1MA 4C7OA 3PFHA 1CPYA 1U9JA 2XCUA 5HVNA 5EXXA 1QV7A 1SULA 3VKGA 1ZBDA 3D1JA 4ERXA 1YDWA 2RONA 1A0GA 5CVVA 3BB3A 3H6KA 4XGRA 3IIKA 2FK1A 1TCVA 2Z3ZA 2A9QA 1LEHA 2VP0A 4HDSA 3AEUB 1K1QA 1QVWA 3ICPA 1XKXA 1QVZA 3O8QA 1AKEA 1PNQA 3D6UA 4IIJB 1E92A 2ZZKA 2VT2A 2CL5A 3NONA 4DV4B 4N3BA 4PS0A 2E87A 2B34A 2BMJA 3H0CA 4LDJA 1RLTA 5CYOA 2X0JA 1XZHA 1WR8A 4BBAA 4J2TA 2FX2A 3WO1A 3ZEIA 5FAKA 5HIIA 4S12A 3RC7A 4PWQA 1WABA 2PX2A 4RNCA 4IQ0A 4TVOA 2FR0A 3LPMA 1TM3E 1DU4A 1DWOA 4CBVA 4W8HA 3PSHA 3IYLW 3HRHA 4PPFA 4YJ2B 1JEJA 5TC4A 3ELUA 1M7GA 1KR5A 4GLJA 1QH1A 5I7HA 1E8MA 3HB1A 4ZCLA 4D3SA 5KFWA 2NU6A 2NXEA 2GZDA 1A50B 3RI3A 5FBVB 1YSCA 1CY4A 2DTDA 1ZJWA 4ER5A 3I12A 1IN5A 5B37A 4JVNA 3OCWA 4F3RA 4R5HA 4DL4A 2JAOA 2ZUDA 1L5GB 1H2WA 3INRA 3N86A 2VWPA 2ILVA 5EHNA 3F8NA 3LV8A 3BWCA 4TKVA 5F2NA 2DUWA 4UXHA 5J2TA 2BSAA 2I78A 5HQJA 5KVAA 4QOFA 3W78A 2JIZA 1N2ZA 4NJEB 4UU0A 4WBNF 3PUJA 3VH3A 4C7VA 2H2HA 3L01A 1S3GA 1NRIA 1R2QA 1E94E 3K16A 2XZDA 2ZAOA 3C3AA 4NMHA 2PMWB 1PSZA 1G20B 3QUAA 4NJOA 3R77A 4XZ3A 4ID9A 1ZONA 1HFKA 4IFTA 4PO1A 1TCBA 3TDNA 5JC8A 1W9HA 5A02A 4NYMQ 2SICE 2X6QA 5EMKA 4IJKA 3QKSA 4KAJA 1ZVKA 4JEIA 5LU8A 3U5TA 1RHJA 1Z8FA 5A6VA 2YC2C 5C4GB 3OM8A 5JAOA 4CR6A 2Q2OA 3DKKA 1DKPA 1K63A 3WK9A 3FKSA 1IOZA 2VUGA 1U31A 4P3XA 3DGFC 1NBIA 3PQ4A 1R4AA 2GEBA 4JC8A 4PLVA 3MIIA 1AX9A 3BRCA 1A5BB 3RREA 1BMQA 3AO0B 1ZUD1 3E8MA 2JDIA 3EYWA 4KVZA 1WD5A 3C74A 3VZRA 2RFLA 4REQA 3EEQA 3PDIB 3KEFA 4MGIR 3EC2A 2PWBA 2WJ4A 4A3KG 4RA9A 4DR6H 4I9HA 4INZA 1E1RA 4EX6A 3BQNB 1AXGA 2ZRAA 2I3GA 3DDUA 4P2GA 4WH0A 5AJHA 3G9TA 3QX9A 2XOXA 4Q16A 1V39A 1VIVA 3H1BA 4EQ6A 4E6NA 3RAXA 2ONYA 1O2DA 1N0HA 1Z0SA 4HC4A 4TZ6A 4C04A 3Q8SB 2V7EA 5AVJA 2CNWD 3K9HA 3SEZA 4MZDA 4GU5A 3O1LA 3F96A 3U4DA 2PL1A 1HZZC 3E9ZA 2XTZA 3CLSC 3EA0A 4OOEA 1Z73A 5B4UA 2QG6A 3LUDA 1PLLA 4Q44A 3QPBA 3BWXA 3EPGA 3DTFA 2QE7A 3I61A 1F5NA 3RU2A 4EP1A 2QTVA 2XB6A 3COPA 2HEIA 5I8PA 1Y6FA 4DSOA 5AKIA 2I1VB 3G6YA 3QXSA 1AUVA 2Q6KA 5IMSA 1PJRA 2IDJA 1D2NA 4HN2A 2LDBA 3VR3D 1ODTC 4LNUA 3PQ8A 2OFOA 3EOBI 5BUSA 3DNFA 1J5EH 4D56A 2R7LA 1EM6A 3P32A 4JA0A 2HC9A 4RZIA 4YLYA 1RPZA 4YIHA 4H7HA 1J9ZA 2R65A 1QZZA 2IEAA 3BWVA 3M82A 4Q9NA 3DBLA 2WSSA 4GH5A 1NKTA 5K3FB 4FDLA 4RSRA 5ALWA 5M34A 3R0XA 1QE5A 2ZR9A 4F97A 4G86A 3HI6A 5F52A 1JG4A 4ZTUB 4O3NA 1OYVA 2J6HA 2NZVG 2GK4A 2H1WA 2ZRLA 3QTTA 4TRNA 1H6BA 3KIPA 4R5MA 2BN4A 2XYQA 2VTBA 3RUPA 4YA6A 4DGSA 3W9YA 2P67A 5C8YB 4DBZA 3K6RA 1Y1WA 1JDNA 1SFOA 4MI3A 2V7VA 1ZOLA 4AMVA 4B80A 1ZN2A 2B25A 1Z5ZA 3QVVA 1NTOA 3UGJA 4H18A 4J4HA 3PW4A 4W5HA 3VYRB 1YE3A 2FUEA 1Q44A 2VBIA 1H94A 2PGOA 4DSNA 5DNDA 4YJGB 2CHUA 2ERYA 4QNRA 4KIWA 4D99A 1SOVA 2Z56A 1TK9A 3LXRA 4KTVE 2XZTA 3TBFA 1SCUA 4KXUA 3MA0A 5LL6b 4KXQA 4EBFA 3W9UA 2Z6AA 2H5JA 5CVDA 2YXNA 5KFAA 3WXBA 4Z9YA 1T36B 3G1WA 5CFOA 2QQGA 1ID8A 3RU3A 3ILVA 1JAZA 1CUWA 1ONSA 2IXTA 3ZWKA 1RJWA 4GW3A 1BVRA 3IJPA 2J3QA 5AXAA 3KPWA 1M83A 4D6PA 3UMYA 1J21A 3HO8A 1PD0A 3LJKA 5FNZA 1PWYE 5JSQA 1KFBB 2GX6A 4WY2A 4FS3A 1UT5A 1RJPA 3WAGA 1U4OA 2IWHA 4RA6B 4XWWA 2VNIA 4H7EA 1P1HA 3QQPA 2QYHA 3S2ZA 1T10A 3O9VA 5AQEA 4MRSA 1M54A 2P5UA 1N2EA 3LIIA 2JCGA 1TKRA 4PLZA 3GFGA 4FJ0A 4NBTA 5HS6A 3IJEB 3FFAA 3GZ4A 2VJBA 1X8XA 1E9VA 3T5HA 3RS0A 1N7HA 3PUVA 1NV8A 3KZNA 3DVLA 4XM0A 2BLNA 5AKLA 3EG5A 3KDPA 3Q9NA 1EAMA 2HJHA 4NICA 2YQ4A 4DLPA 5D5HA 3HZRA 1U5BA 2FMHA 3WIBA 1BE0A 4DV2H 1RYSA 4DUYH 3L43A 1NAHA 2PD6A 1W88A 4P53A 2OCGA 2WOJA 3M7IA 4RMJA 3ZS8A 2AOWA 3TDMA 1LW7A 1JHAA 1IYEA 4KGVA 2K4MA 4QOJA 3YASA 4WINA 3BWMA 1KRHA 5CFMA 2GQ0A 2G82A 1QHEA 4EI9A 2CD7A 2TYSB 2F1HA 3GBSA 3HYRA 2RI1A 1MG0A 2PQ6A 4L7VA 1SRRA 3DJFA 5JTUA 1Q6ZA 1XLUA 4Z53A 2IP4A 4IHJF 1PWEA 2UVQA 1MV5A 3REQA 2DPLA 4DLYA 1RI5A 1SCDA 4JLWA 3PNVA 3LUJA 1WTAA 2XCOA 4KRXA 4KO8A 4RMNA 3I01M 4L8YA 3PHCA 3CB2A 5DSZA 1K6XA 4UMEA 4BQIA 5JPCA 2J59A 4D9BA 4C30A 4N40A 2VTVA 4FFNA 1PFVA 2KI5A 4FCTA 2HMAA 4QUBA 4PPYA 1CHDA 1VLLA 1E1CB 1VPDA 4A3FG 2OO3A 2IUTA 1ZMOA 4M7WA 5COQA 3EN0A 1KPIA 2UU9H 2F1IA 3E4CA 4NOJA 1EVJA 4WKBA 1MGOA 1F0PA 3BBLA 2Y0EA 5AT1A 4JVLA 2X0DA 1N6RA 4JI6H 2NW6A 5I5YA 2R1TA 5LFAA 5BV0A 1H4VB 2RGDA 3IDZA 4CKCA 3GUZA 4LHVA 1G5RA 4EK9A 2XJ4A 3HJAA 1JFLA 2OSBA 4C4XA 3NC0B 3UV7A 2Q1UA 3O0DA 4XJXA 3F8TA 5CA1A 1GGKA 3PIRA 1GKKA 5DX1A 5ERGB 1KAQA 5EE1A 4ED2A 3HEBA 1JFTA 4QECA 3PE4A 5IYBG 4RSHA 1XNRH 2JF0A 3TCXB 1L5RA 1IQRA 1RIFA 2LUOA 1F2TB 2PUHA 4J7CA 2R44A 4LYHA 4N5IX 3NUGA 1GUBA 4AJIA 1WKCA 1CIPA 3VTFA 1HBJA 1FUUA 2ZRMA 1H93A 2QX7A 4Z51A 4V0QA 2J85A 2PSSA 2PLFA 3A1DA 2CV1A 3F3KA 3PTZA 4UUMA 5BY2A 1O8CA 4MX8A 3OZVA 3GJSA 1L1RA 2BM0A 3HUFA 3GFQA 1MPTA 5LUBA 3WL6A 3KOMA 4A6XA 4YUYA 2OXEA 1L0BA 5KX5B 4MV4A 5KQMA 5DVZA 3ZYCA 2R7ZA 1I3QA 5AI0A 4OL9A 5DB4A 4PZPA 5JSZB 4DR7H 2IEIA 3M81A 3I53A 2JGRA 5LWQA 1L5VA 5KFLA 2PJDA 5GONB 3B20A 1E6UA 5B7NA 3ITDA 4N01A 5DBEX 1LX6A 3KVYA 1DTEA 4LSAA 4PYLA 5FI3A 4HS9A 4WMLA 2ZIUB 1L8OA 4YFVA 1LS6A 4CDGA 1S89A 3ZDBA 4YJHB 4MVJF 1BJKA 3VU9B 2E55A 3OQ6A 4WZBA 5DCWA 1GDHA 4P31A 1NWHA 2XTJA 1QFSA 2MU1A 1EBBA 2VPSA 2H8GA 4RHYA 3KX2A 2WZQA 4WXYB 2Q0XA 2F55A 4ESOA 4FT4A 1FFYA 4XCXA 1U8FO 2FVYA 4BNJA 2ZT6A 1AQNA 1AKVA 1JIUA 2VHJA 3L7NA 4WLFA 4LK3A 1V3UA 2ZWIA 2WFZA 4CMDA 3OE4A 1SHZA 3GMTA 1E0JA 5TF4A 3BD9A 3ZDEA 2E48A 3ZY4A 5FFMA 5K3OA 1RABA 3R20A 4Y6OA 1CQJB 3IHKA 1G5HA 5FOSA 1W36D 1HI9A 3GLGE 4M3NA 1G6OA 2I2CA 1HNWH 3WLIA 2W90A 2C3UA 2WKQA 2NO0A 4S05A 1QGUA 2I1QA 3K1TA 3HKBB 1RXEA 1O57A 1N2CE 5KFYA 5AJYA 2B1QA 1NIJA 3H3XA 4LH6A 5AUQA 1USWA 2WD9A 3I64A 3VVCA 2P3SA 2WF6A 1YAJA 4JJZA 4YJKA 3RVLA 1FTQA 2O8EA 1SEIA 5K0NA 5TS2A 3UT5A 3MCAA 1KMNA 2YINC 1DC7A 1J2YA 4MQ5A 4AICA 3MWEB 2WHXA 4RNMA 1X7YB 5JQWA 3VPDA 1E0AA 2Z5LA 4LY6A 5BNFA 1JV2B 4HPJB 4Q4CA 1Z4IA 1Y8RA 1UC4B 4L4XA 4TV8F 3PUHA 1O5IA 2O8CB 1H2XA 2F9MA 1RHUA 4UHCA 3MAAC 4I19A 4HNQA 1E20A 4DUZB 3BM5A 4LOKA 3ZJVA 1XZPA 1XA4A 4TQ9A 4MDFA 3DDHA 4M9XA 3PQFA 1GDTA 3E5MA 3LP6A 3S2EA 1N2XA 1T2FA 4NR0A 3UUEA 1M6VB 3EXG1 4CN9A 2VZ9A 2PX5A 4ID3A 4JBYA 4UD6A 2M1XA 4JITA 3D5QA 4UBJA 1FMTA 2XDWA 5GV8A 4YWHA 4N0EA 3FLEA 3PXGA 4PR3A 2BR4A 1T4MA 1E3TA 3O91A 3SNHA 3DZHA 2GN1A 3H5TA 4Q4JB 1D6NA 2ILTA 3ANMA 2GILA 4Z9FA 3D3JA 4QYXA 2B1GA 3RBDA 4ZHQF 2FJZA 4JBXA 1D2HA 3VUEA 2P9HA 4NV1A 4P3KA 1HLGA 2W9CA 4PYQA 1XDGA 1HEYA 2GJSA 4PPNA 4UNPA 1TW3A 5ADUS 4JI2H 4RY8A 3BE4A 4NFSA 2UXCB 3PHBE 2EOAA 3P45A 4BIMA 4W63A 3ZIUA 4TT3A 1LBEA 2IUEA 3FRJA 3NIFB 1VJGA 3C8ZA 1QR6A 2X14A 5HIAA 2X8LA 1KY2A 3VKUA 3KUDA 3NASA 3SOZA 3K1AB 3QJYA 5AW3A 1YQDA 1NVXQ 4JQSA 2HNAA 1FS5A 4RORA 3PRYA 2FPGA 4ZDWA 3AJAA 5TARA 5JCJD 4DR4B 3OPYB 2VQ3A 4RZ3A 2OUKA 3IRUA 4LECA 1IBSA 1PLKA 2OLSA 3MTGA 3F8WA 2JGAA 4NEGA 1EX1A 2ZTLA 3ZZUA 1OXKB 1KH2A 4AZ0B 1E58A 1GPMA 1MJHA 3D3KA 1M8KA 4NLGA 1EM8B 3OQNA 1L5KA 2BEJA 1UC8A 1XALA 5B4VA 1QDEA 4DMHA 4R2WA 4K7JA 2Q3BA 3I2JA 4NJMA 1PV4A 5EMHA 1OIWA 1BA3A 1QLHA 4QAQA 3FYUB 1ZD5A 3I9MA 2PKEA 2NG1A 3E3OA 3WGGA 1HG1A 4FCWA 3KZMA 5AJZA 3TY9A 4EJ2A 3Q6MA 3H1EA 4GZMA 3DTNA 5E9AA 3HU3A 1IUKA 3LBNA 1VCIA 1E5QA 2HQOA 4HAVA 4BVEA 3CH7A 1FXWF 1R8XA 1O94A 3W34A 5L7WA 2P9YA 1FFCA 2DFLA 4PIVA 3LOQA 2I76A 1GCUA 5BWLA 4PG4A 3OPVA 1TVKB 3CVZA 4BUCA 5EHZA 1ZUNB 4CWAA 3IGFA 5C8DA 2YJ4A 3GUCA 2IIVA 2DQKA 4UTOA 3UHAA 4BGEA 4BRWA 3WYBA 4HTAA 1M1YE 3JD2A 3DOFA 3GD7A 2BW0A 2GZ2A 4WN3A 3LKDA 1GCOA 2RAPA 1PJBA 1OFHA 1Y6ZA 2VF4X 3FIJA 4G0OA 3QF4B 1Q7EA 2ASVA 1SQGA 5FBQB 3O3MB 4CU2A 2V45A 4UD2A 1WF6A 4XH9B 3K5PA 1HNZB 3UNXA 2LE0A 1NXOA 3R6LA 5FR1A 3FGOA 3DOEA 3QTLA 1HEIA 3PC8A 3FDZA 4WCDA 2QG9A 3KB1A 2C5LA 1J2UA 2PZBA 4GM1A 3WBJA 4G1VA 4KHPB 3VSEA 4BV3A 3D4NA 1DQRA 2BGIA 4F5YA 1MQ9A 4C6RA 4MAFA 4X7BA 5HRCA 5DOVA 3BRWA 4ZT5A 5TPWA 3B9BA 4G0XA 2IPXA 1Z5VA 3L8YA 2ZJFA 3P1JA 1GPUA 4UMVA 3WMRA 1ZGAA 3ZHCA 5KJ1A 2JA5A 2RHGB 4I46A 3F9CA 4RV4A 4DV0H 1F8XA 4L4ZA 2QL7A 2V96A 2CBXA 2XD9A 4A5OA 4HYEA 1FP1D 4DMRA 2Q3MA 4FN4A 4AVYA 4HUQA 1I3MA 2XTMA 3GB9A 1KY5A 3H2BA 1Y1SA 3KVNA 4ZV9A 1CUZA 1TTHA 1XTQA 2K2WA 1SCNE 5IC4A 2VQDA 5G1NA 2MDTA 2X5XA 1AGYA 1FDRA 2A9VA 4N5MA 1Z17A 1RXIA 1L4LA 5L45A 3RFUA 4K28A 1NVWQ 4UQOA 4DBLE 1O1YA 5DM60 1S03G 2R0QC 1JG6A 1TZKA 4Y2YA 4L0MA 5LWHA 4MRRA 2I65A 3QE9Y 4U8HA 4DA6A 3X2EA 1DBSA 5JJLA 1Z7WA 4J90A 1L1FA 5DF1A 2CXNA 3LCUA 1WUKS 1IY1A 2AQKA 3BWYA 2I9KA 1YQ9A 3KR0A 4MWCA 2ZU0C 5CLLA 3LT1A 4E30A 4EG4A 4B3FX 4HGNA 3GW8A 1E2KA 5HG0A 4HTFB 4QGAA 1XEWX 2XDQB 3T7IA 4OSPA 4AYBA 5CNMA 1VJCA 3AESB 3TZBA 2PUJA 2NSHA 2COJA 5E38A 1QNFA 3UVEA 5GGXA 4MW2A 3UZOA 2YN2A 3QBEA 2LCQA 2CVQA 3IC5A 1GNPA 3ESYA 3S4YA 2FX5A 2PRYA 4YMTA 3IAEA 3TSWA 1QIEA 3H2ZA 3RSZA 3SWWA 2OCAA 1BQ4A 5FTNA 4KSCA 4Q7JB 2VO1A 5BOSA 4ECZA 4PYMA 5F12A 1NBHA 1WHSA 4FNGA 1PT6A 3QEKA 4TV9F 3TTYA 4ZEXA 2AU0A 4D80A 3QY9A 1XMPA 1YUMA 1SVOA 5AW9A 2OD2A 3AWIA 1NMZA 3JXEA 1AGRA 5DGAA 5DWVA 4A8PA 4CEIB 6Q21A 4N5DA 3CUTA 3RTGA 1NBMA 4F7WA 1RRGA 1TE2A 5ALDA 2Z95A 4GZ5A 3JY6A 3A9CA 5I7FA 4YUXA 3ZUGA 1XE3A 2GEUA 5TS3A 1OFTA 3EGXA 2IEBA 1WZIA 4Q00A 2H06A 3WO0A 1E9BA 4TL6A 1XU7A 5CDFA 4MRMB 3TOCA 2IU3A 3QG1A 5SICE 3R75A 3IH5A 3TNYA 4F46A 3SZRA 2IYZA 3EIXA 3R3HA 2FXVA 1E1LA 1KEVA 5BR1A 4TL7A 3I6ZA 2Q6IA 4CM8B 3V6JA 2RMKA 1M10A 1WOMA 5FNVB 2CE7A 2IHKA 5EAIA 4ZIRB 3URKA 2VAXA 3D8UA 3CNQS 3V8EA 4EKIA 4HEHA 4DBLC 4XYMB 4Z1MA 2BKLA 3D31A 3VNQA 3LLCA 1Y6GA 3O84A 3T52A 4UOZA 1QPBA 4AIRA 2RGGA 4YCMA 2OLEA 1JLMA 5DBFA 3U49A 1M2WA 1N9KA 3OZUA 3KQHA 4JX8A 5EMLA 4ZAWA 3LK7A 3RVNA 4ABYA 1U6KA 5BOVA 5EFZA 3GZJA 1L7VC 2IIBA 3CO0S 3CVXA 3DMHA 2GWRA 2UZ1B 2ONCA 4K40A 2VOJA 2X1LA 3LZ6A 5LYYA 1Q16A 1DQSA 4QFMA 1MQ8B 1U28A 1OV4A 3OT1A 3ULKA 1J20A 1ANKA 4Z2AA 4Y6RA 3FHJA 1YOVB 4YRKA 3LKBA 5KVCA 3PXDA 2Y1OA 1ZUWA 2WILA 5J59A 1JE0A 5IJ0A 4B3TB 2GB4A 4MGKR 1JW9B 5EIWA 2NUBA 4DL3A 1BRTA 1A3GA 3FFWA 4NDAA 2DQZA 5IU6A 3H9GA 1TB4A 3PN1A 3QOFA 3D64A 3IIJA 1ETHA 4PC3A 1BFKA 1M8JA 5F5LA 3Q4GA 5K51A 1QVVA 3MCUA 3CC8A 3WSTA 5JU6A 4RSMA 1C3JA 1LNSA 1E3EA 5HJEA 4CM9D 2QPLA 1VPLA 2V4MA 2MMCA 3FTQA 1CDZA 3UC9A 4R2MA 1DBVO 4JU8A 4WEQA 5JS7A 4TXJA 4H35A 2V7PA 4OOFA 4TOIA 1JKXA 4IJVA 1Z25A 2G0NA 4Q66C 4D4IA 2PBZA 4LDZA 2W2LD 3TLXA 4I1YA 4XGKA 1KQOA 1KYYA 4D8VA 4BB6A 4J0MA 4ZCPA 2AEFA 2CLEB 1YZGA 3KJQA 4QTYA 4CKWA 4QLBA 2BPOA 1DO0A 2B0CA 1DTWB 4NMLA 2QU8A 5IP5A 3EUWA 1W59A 4IRXA 5E6SB 1CJMA 1MKYA 1RWMA 3WWHA 4X45A 1MO2A 1XEXA 5M29A 2GTIA 4ITRC 5BXYA 1REQB 4BMPB 3GU3A 4QRDA 2PQ0A 3M6XA 1W52X 1NQUA 1CJSA 3P0HA 3VVLA 1GG8A 4S1NA 3B51X 4HDMA 2QIPA 2QGNA 2PVSA 5H80A 5B7PA 4AUEA 5K0TA 4B32A 1MRNA 5FHRA 1DNPA 1D1TA 3MILA 3LRPA 2R8JA 3OHSX 3DUWA 2GXAA 2I03A 4DN6A 3PV0A 4EKDA 1WSWA 1OOEA 1AHNA 4I8IA 5DBHX 3L7JA 1Z35A 4P7KA 1N5RA 5JZVA 4OLAA 3B3QA 5FF9A 2MCTA 3D5EA 2JGDB 2OHVA 3WL3A 2Q3HA 2E85A 3GXBA 2SCUA 4HRXA 5CDTA 1WIWA 4WI1A 1HMPA 3I04M 3ROXA 4J9LA 4URVR 3TVTA 3N6XA 3GNTA 1IAQA 3FZNA 3R09A 1KOGA 1DT3A 3AM1A 2JLYA 1OMOA 2J3IA 2QUBA 2RHJA 3GJQA 3L6DA 5KI6A 4HCJA 1P0PA 1R0XA 4KR9A 5FXMA 1PT9A 2YBEA 5BSUA 4IG4A 1V1MB 2I6GA 4WFIA 2PHZA 4YP6A 3V1TC 2WWYA 1BN6A 3PVCA 1COZA 3P2MA 1L5NA 2Y4OA 3JZ6A 1YZFA 4B3SH 3TQSA 1JAHA 3ZX4A 3AKYA 3BL5A 1CERA 3Q8WA 1LH0A 4PF1A 4RF3A 3OQMA 3VU0A 2HLDD 2QSZA 1H9AA 2AI2A 3LDGA 4NS1A 2OCIA 4K9QA 1QOZA 3C3MA 1BXZA 3ZXXA 4L5AA 1W36C 2CLCX 2O2YA 3RHFA 1MH1A 1TL7C 1ACJA 2DEUA 3NBXX 3U1BA 1R16A 2JFYA 4CE5A 4MHTA 2GM9A 3S27A 4B73A 1YD7A 3ENVA 1JYFA 1ISIA 4O84A 5LMUB 1B0ZA 1J06A 1XZEA 2P27A 5JEEA 4J0EA 4U3JB 5F9HA 2CC2A 4R2JA 3NHBA 2XCPA 2F17A 2EFCB 2W7TA 1J8QA 3GV8B 4YQZA 3V42A 4ES6A 3EFOA 4I99A 4QNMA 2BONA 1W0KA 3RRNA 3WDKA 3QMWA 3JRXA 2OK8A 3A27A 2QZJA 3RQIA 3B1JA 3F4BA 2A35A 3R3UA 2VJQA 3OQJA 1IDN1 3LUHA 1LF0A 4C6HA 2G4LA 2G6TA 5EZYB 3WC4A 4YXFA 3MSXA 2ZWAA 4C29A 2WDZA 1HDGO 3ZE0B 3LWNA 4WKCA 1YDGA 2QTBA 2QZ4A 2IBSA 1H42A 3OE7A 1L7NA 3P9QA 4R1TA 4AM8A 3WMWA 3CGWA 4JI1B 1UWCA 2V7XA 1LKZA 4M36A 4WVLA 4FE4A 1WW3A 4IF6A 1BDMA 4AQYB 2QN8A 1Y7TA 1O6BA 1AUPA 1HLPA 1U65A 3T1YB 3DE1X 3BB1A 4YWJA 3FOBA 1BKYA 1GLGA 5LA6A 4IIFA 4RESA 1RW4A 1SXHA 4KLRA 2AVNA 1IZ7A 1PUJA 1UIRA 4DHWA 4X20B 2X7JA 2R97A 4LBVA 4F60A 1TLLA 2KJQA 3NW9A 5KG7A 2RAVA 4OHCA 3ZW8A 4F3YA 1UZNA 4HB3A 2AR0A 3CA8A 1XPUA 1GRNA 4WFKA 1R6DA 3AB3A 1Z62A 3RVDA 4IWXA 3F0TA 3UMVA 1SNYA 5FLMG 1SU8A 1L3BA 3K6SA 4ZC8A 2WM9B 3NFRA 4L9WA 4Q3CA 1JIHA 4MW4A 3NHPA 4OBWA 4F06A 2HI0A 2GFHA 5G4KA 1XTSA 4RK6A 2K2QB 4XSHA 3T5KA 4Y6QA 2IP2A 2X1MA 1LJLA 2C88A 2P2GA 4K9KA 5IG2A 3J81k 4UHDA 1X15A 4A03A 4EMUA 4Y2TA 4A2BA 1LD3A 2Q0QA 3ZW9A 1G2OA 3O2NA 1VM6A 4YRLA 2GD6A 3CVYA 5FBRB 1N32B 4KAFA 3ROEA 2W7OA 4DMFA 1GO3E 1I2KA 3TOSA 5IJ9A 3GEIA 2C3OA 4DREA 1WSDA 2OKGA 3JQQA 1I30A 1TM1E 2DT5A 3MZ0A 3QRWA 4QOSA 2ZJBA 1RM5A 4KXLA