2YZNA

Crystal structure of d-alanine:d-alanine ligase with amppnp from thermus thermophilus hb8.
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
319
structure length
317
Chain Sequence
MRVLLIAGGVSPEHEVSLLSAEGVLRHIPFPTDLAVIAQDGRWLLGEKALTALEAKAAPEGEHPFPPPLSWERYDVVFPLLHGRFGEDGTVQGFLELLGKPYVGAGVAASALCMDKDLSKRVLAQAGVPVVPWVAVRKGEPPVVPFDPPFFVKPANTSVGISRVERFQDLEAALALAFRYDEKAVVEKALSPVRELEVGVLGNVFGEASPVGEVRYEAPFYDYETKYTPGRAELLIPAPLDPGTQETVQELALKAYKVLGVRGMARVDFFLAEGELYLNELNTIPGFTPTSMYPRLFEAGGVAYPELLRRLVELALT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords D-alanine-D-alanine ligase
publication title Crystal structure of D-alanine:D-Alanine Ligase with AMPPNP from Thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
total genus 80
structure length 317
sequence length 319
chains with identical sequence B, C
ec nomenclature ec 6.3.2.4: D-alanine--D-alanine ligase.
pdb deposition date 2007-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01820 Dala_Dala_lig_N D-ala D-ala ligase N-terminus
A PF07478 Dala_Dala_lig_C D-ala D-ala ligase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 2yznA02
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 2yznA03
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2yznA01
4QSHA 2YS7A 3VPDA 4EAAA 4HNVA 3ETJA 2QF7A 5LA6F 5BPHA 3UFXB 4FFMA 4WBNF 3Q1KA 1CS0A 4L1KA 5KKNB 4MV4A 4C5CA 4MA5A 4FFRA 2SCUB 3V4SA 1JDEA 2ZDHA 4IIJF 1SCUB 3KREA 3NUAA 3SE7A 5CB4F 4FFLA 4E4TA 1C3OA 5JQWA 1M0TA 2DZDA 3HBLA 1KEEA 2R84A 2DLNA 2CQYA 3TIGA 5C1PA 4GGMX 4C5AA 4FFNA 4IZOA 1DV1A 1PK8A 3RV3A 2ZDGA 5I47A 4HR7A 4YB8B 4YAJB 2W6OA 3MWDA 3G8DA 4YAKB 4MV9A 2YZLA 3TW6A 2PVPA 3G8CA 2CZGA 4YJ2F 5FNVF 3QFFA 3VPBA 1M0WA 1DIKA 3AW8A 1EUDB 5LXTF 3K5IA 5C8YF 4O86A 2HGSA 1BXRA 2DIKA 2NU6B 3Q2OA 4O7VA 4O7TA 1DV2A 1KJIA 2VR1A 2I87A 3WO1A 4O2BF 3GIDA 4O7WA 4M99A 3GLKA 4XYLB 2PBZA 2W6QA 4EG0A 4O4IF 2R7KA 1EHIA 1W96A 3TQTA 3ORQA 1GSAA 2R7NA 2GQRA 3R23A 2VHEA 5JVLA 1B6RA 4MV7A 5CA0F 3VA7A 4MV6A 4NYEA 1UC8A 2NU8B 1JDBB 2XCLA 2WYOA 1CE8A 3VMMA 2R87A 4HQ6A 2W6NA 1IOVA 1ULZA 1WR2A 4MV1A 1CQJB 2YL2A 4XX0B 1KJJA 4O7ZA 2I8CA 1E4EA 5LP6F 5JQGF 1JLLB 2V59A 5KX5F 3LP8A 5CAEB 4M9CA 1BNCA 3TINA 3R5HA 5J2UF 4YBZB 1T36A 4O4JF 4DLKA 1VBHA 2FPGB 4MA0A 2YWVA 4EGQA 3JZFA 2FPIB 1CQIB 2GPSA 1M6VA 5GONF 1EZ1A 2YS6A 4O83A 2DWCA 1KUTA 3BFPA 1GSOA 4I55F 4O7LA 2FPPB 1GSHA 1A48A 4FFPA 2CNUA 4TUYF 4I50F 3MWEA 2W70A 3BSWA 1KJ8A 3VPCA 2R6FA 5C1OA 4HNTA 3V4ZA 2W6ZA 3WO0A 4HNUA 4WD3A 4M9UA 4O4LF 5J2TF 3TIIA 2X0SA 4O7YA 3HO8A 1I7LA 1Z2NX 5DMXA 2NPOA 3ETHA 2V5AA 4MV8A 3BG5A 3E5NA 3U54A 2W6PA 1JKJB 3I12A 4Y8VB 2YRXA 2FB9A 3R9RA 2I80A 2R7MA 3BSSA 2GLTA 2NU7B 2YW2A 3OUZA 2VQDA 2YZMA 3RV4A 3RFCA 3K3PA 4ME6A 4ZI7F 5JH7F 3JRXA 2PN1A 3KAKA 5H80A 2P0AA 4J6EA 5HBRB 4YJ3F 3U9TA 2OLSA 1E4EB 2R82A 1I7NA 1GLVA 5HV6A 3BSYA 4MV3A 4TV9F 2YYAA 4RZQA 3U9SA 4FFOA 3K5HA 4TV8F 4M98A 4IWXA 5K2MA 2YRWA 3N6RA 2GQSA 1B6SA 1OBDA 4O2AF 2QK4A 3AX6A 2C00A 1AUVA 1GGOA 2IP4A 1KJQA 4FU0A 2J9GA 4IHJF 4O82A 4O84A 3JZIA 2CNQA 4EA9A 4DIMA 4O7SA 4IWYA 4FGRA 2XD4A 5D8DA 3MJFA 2Z02A 2R86A 4O7NA 4C5BA 1EUCB 5IYZF 4XZ3B 5CA1F 4EGJA 2NUAB 3KALA 4ZQIA 2YZNA 3U55A 2W6MA 5EZYF 4I4TF 1AUXA 1W93A 2R7LA 3LWBA 5LOVF 5JVDF 2FP4B 1EYZA 1UC9A 3HB9A 4XYMB 2CNVA 3N8DA 3R5FA 2NU9B 1OBGA 3RUPA 1KC7A 3WNZA 1VKZA 1KBLA 2R85A 4EA8A 4MAMA 4ZHQF 2HJWA 2W71A 1PX2A 3DF7A 4O4HF 1KJ9A 2V58A 1VBGA 2Z04A 3VOTA 2YZGA 5BPFA 3JRWA 3OUUA 3R5XA 4EABA 4EA7A 2ZDQA 1C30A 4O81A 1Z2PX 4ZOLF 1Z2OX 1IOWA 4FE2A 3ORRA 3KAJA 5BMVF 4O7RA 2VPQA 2GPWA 1A9XA 5LYJF
chains in the Genus database with same CATH superfamily
2VHZA 3T3IA 2YINC 1XDWA 4K9PA 5EHIA 2BPOA 4AJHA 1GAQA 5JD6A 3WMEA 1KEZA 1O5IA 5A4DA 1I01A 4LOKA 4PLWA 3UFXA 1GAEO 5A6SB 4B84A 4EHDA 2L42A 1NJ6A 3GGDA 1JUDA 3DR3A 3ICEA 2Y1CA 3E1KA 3IP8A 2AFRA 2DG2A 1L7XA 5KWVA 3GJRA 1BXZA 4TXJA 5P8WA 2BBWA 3OIVA 4ZIRB 2QLNA 3NZEA 4JQCA 3P52A 4HUQA 2UVPA 1FYWA 5C7OO 3M9XA 4K9SA 1OUMA 1RYDA 4J1SA 1CK4A 4BGDA 1VGQA 3K9WA 2GZ2A 4TVSA 4TXNA 4NX2A 4AECA 5K0CA 1CR0A 3ZWAA 1XROA 4FMBB 1U8EA 5H1YA 2GGSA 4WNAB 3ZJUA 4EGSA 4Z4IA 4AZ0A 5F4ZA 4FMDB 2D0DA 3LCUA 2DAAA 4HJXA 1ID1A 2HU5A 4GYJA 4KQCA 1H6BA 4AXXA 1XZQA 3QH4A 5DE3A 3CRZA 2Z2KA 3NVKI 4CV0A 5KT4A 3HEBA 4G5QA 4N5NA 3LWZA 2CL7X 4N8DA 3QU4A 2V7GA 2GCPA 2VXBA 5KX5F 1H4VB 2IPMA 3CNNA 3RUFA 2D5AA 5MHTA 3ONVA 3KWLA 1SJ9A 2FOIA 4MJLA 1A9TA 2PMFA 4J0IA 3EGWA 3GMDA 1WB4A 1W85B 4DRZA 4C01A 5CCXA 1RYEA 1W1WA 1SPBS 4RF4A 5CM9C 4N9QA 4FGWA 1YNOA 4DV4H 1TAHA 3BQMB 3OKPA 4FN4A 3ODGA 3DE6X 4RPIA 2PZMA 3KXIA 3PL1A 2G5CA 1R50A 4XH9B 4ZAVA 5ICMA 5F3DA 3ZV6A 5LR6A 4LXHA 3VPCA 4X8OA 4Y6QA 2QTTA 4UCOA 1VP9A 4B82A 3WK7A 4IOJA 1JG1A 4GMXA 1B0UA 3BK2A 1QIMA 4FHFA 3THYB 4Q44A 1H9BA 5KTPA 1S8AA 5E8JA 3QE9Y 4OCZA 3QG1A 1UKZA 1JEAA 2REQB 3U7FB 1YB7A 5DM0A 1XZPA 2N1MA 2N75A 4BNDA 4F5EA 4B7XA 4TTTS 1FFBA 4M9QA 1M67A 3DWIA 1IMOA 5JPCA 5D00A 5FLYA 2C1XA 4K6GA 3RARA 3AUUA 3CCFA 5CDUA 3ZWPA 1QZXA 1Q7TA 4EGAA 1YBMA 4YMLA 1EQ2A 5ALRA 2D2IA 1F6DA 3E2IA 4FW9A 3OG9A 1MW9X 3PGA1 1NP3A 1QX3A 3OT1B 3KTOA 4DL4A 3DE1X 3Q7EA 2B99A 3PPYA 5D8DA 4YIKA 2Z43A 4KOAA 4BY1G 3M70A 3RTXA 4IR7A 5SZHB 4K3UA 2VNIA 4I1PA 2Y6UA 4MQ6A 2JA6G 4IIUA 2YDYA 1PU2A 4QUJA 2GD0A 3UWSA 5BT9A 4QREA 4IO1A 4V02A 4FKZA 4Z5XA 1I36A 2Y77A 1NPYA 4IJUA 3UJ3X 4YPVA 4ZD6A 3A9CA 1X6VA 4YIHA 4M89A 1B42A 2P6UA 3U0VA 2PR7A 3EDMA 4RHXA 1Q3TA 1L5NA 4MS4A 2FLLA 4PHCA 3WAJA 4NLLA 5IF9A 3QPDA 4OI2A 2WDZA 1GNQA 5GGYA 4Q1FA 3U4AA 2WPDA 3H86A 3MJEA 4U7WA 4HAVA 5J4YA 4IEEA 2R92A 3FB1A 4HDCA 4JI5H 4DB2A 3HR4A 4DB4A 1N2CE 5EJ6A 3GJ7A 4H6VA 3CNOA 1FY2A 3L2OB 5K3DA 5J5VA 1D0IA 2YS7A 1C8VB 3O4GA 4MR8B 1QOPB 3DQPA 1QAQA 2R8BA 2AG8A 2ID9A 1QGDA 3SSOA 4EYHB 1Y9ZA 4WZ6A 1ILEA 4C76A 3OTGA 3DVRX 5F7XA 5ALGA 3IT0A 4C7MA 3OZWA 1V3UA 1V95A 4AULA 3L9WA 4G25A 5FWAA 1SRRA 3D3WA 5KG7A 1ZAKA 2P65A 3MTIA 4U2CA 1PF7E 2PYIA 3OU2A 2ZGVA 3EXEB 2CMDA 2R47A 1W1UA 4DF3A 2WTAA 3COVA 4NOJA 5C46F 3OQ1A 2KW5A 4V24A 3R1IA 1DVRA 1SCNE 1KVSA 2ZRIA 1DV2A 1NBMA 4Z4CA 1IBSA 4BTLA 1DKQA 1N2EA 5DQHA 4RENA 4F85A 1VL2A 4PLVA 5CVTA 2ZYGA 3AUSA 2VCYA 4YRAA 1NXSA 1ZNZA 1YB5A 4WBNB 1SG6A 5AXCA 1GG2A 1LS1A 4WNCA 2YN4A 2NX2A 4MQEB 3NNDA 3QHAA 3BACA 2CMFA 2C9ZA 5JWHA 5FADA 1PGOA 2XGQA 3PT5A 1T0JB 3NOOA 3W6PA 4X6XA 3NKFA 1AKQA 1E2KA 3K2EA 3GU3A 1W6UA 3FUTA 5HIMA 3OT5A 2C78A 4NCXA 2OSBA 4D9IA 3IKLA 1KYYA 1P3JA 3BWMA 3M89A 4BFVA 3M5DA 1DMSA 4NBTA 4AX4A 3EIHA 1F0NA 4N3BA 4LI3X 2CFOA 5DGIA 3GGGA 2EWWA 1MOZA 3AEKB 1RXVA 1M8GA 5ISMA 1ZM2A 3ZBUA 2X3FA 2PGJA 1BAPA 1NW4A 3RFVA 1QLJA 4NXMH 4BIMA 1WF3A 4F2DA 5D1OA 1EQUA 6NULA 3SI8A 4NE9A 5KPJA 3U7JA 4WJZA 1RWKA 5KWJA 4HFNA 2JF0A 1U0BB 3RJMA 5CDFE 3ILHA 2DFKB 4MYCA 4XAQA 3DF9A 1WY7A 5M3BA 4FIDA 3WIBA 5J4VA 2QA5A 2P9BA 3I12A 3ZIAD 1TUEA 1US8B 4MWCA 4MW4A 2ASVA 2CWDA 3E1SA 4GMGA 4BJ1A 4CU5A 1K8XB 1UBRS 4S1PA 1LI7A 3JALB 2VA3A 3OA2A 3JARA 4KV7A 1JHPA 1YC2A 2GZDA 4CDNA 1V1JA 2WOOA 3QKUA 2PZAA 5JD4A 3TQQA 1ECCA 1SZJG 3L1UA 2GAJA 2V4UA 2DE0X 4DCJA 4UMEA 1DAOA 2Z8ZA 2EC5A 1ORWA 3AVWA 1DUIA 1TI7A 4ZEWA 2ZBFA 3DOCA 3GPCA 2JLAA 3LC7O 5F2EA 3O8LA 4ZO7A 4U63A 4KIWA 2G28A 4K7JA 4ALNA 4KQWA 3FZEA 2J3EA 3FNGA 4U39A 5AHRA 1ZOSA 4WHMA 2I22A 5BSGA 3K70B 4AIRA 2Y0BA 1H5QA 4CEIB 3WL5A 1I1OA 1RLOA 2XQFA 5DOZA 3BA6A 3NHKA 4J16C 1L5HB 1RWPA 1DWUA 2W2OA 4KQ1A 2XPCA 1CLUA 1VL8A 1EE1A 5EIAA 1S1CA 3UAVA 2C5EA 3IDOA 3L6BA 3NUZA 2X2EA 3WL7A 5EWJA 2QRMA 2JFZA 4M7RA 4QYTA 5C4MA 1BGVA 2WT4A 1OWOA 5CLJA 5KYXA 1JAZA 3G2QA 1WDMA 1Z13A 4DA9A 1XRMA 1PT6A 4II7A 1XVTA 4BCBA 3DEFA 4QSHA 4CL8A 3RWOA 3WLRA 2DEUA 1UBEA 2QT1A 3QVMA 4ZDJA 2VAPA 1F8XA 2BEUB 1YT5A 3DDNA 4M1TA 2IBSA 1FX0B 1T24A 1VYHA 5A4IS 2XIQA 2BFEA 2DZDA 2WT8A 5BQOA 3A1VA 4A3GG 5SY6A 3EZ7A 4A2CA 3ZCUA 2V6JA 3KB1A 1Z5UA 2YIVX 4KUGA 4G0MA 3DL0A 3OZXA 1YE5A 3HCWA 3GYBA 3LXMA 5AJZA 4FI3C 4PYKA 5B55A 3WKAA 1KJNA 5KYGA 1GNTA 1MAHA 3BOSA 4D3SA 3KQPA 1DIKA 2XNSA 1GRVA 5HUQA 4N54A 4Y1GA 4TL6A 3DAGA 4TTQA 5DBIA 1C9JA 2W2LD 4B8ZA 3AL3A 3F4LA 1M83A 1NDUA 3JZAA 4GZLA 3RS4A 3TBKA 3TDNA 2F8TA 1UBHS 3GGCA 4HX2A 3SCZA 2R7NA 1TMGE 5CEEA 2HF7A 3RC1A 3VA7A 5HZGA 3W2TA 2M98A 2JFQA 3OWOA 1XEWY 5BRAA 5L4LA 3KTMA 1XNGA 1IBMB 4QOSA 2MJLA 2DF8A 1IOVA 5ALDA 5A5GA 3CF6R 3AL0C 4XX0B 3ON5A 1U8TA 3TQHA 1GU7A 1E2NA 1XC7A 4INPA 1Q7CA 1V9LA 2XUAA 4KSYA 4FLEA 1ZIYA 4DC9A 3K1TA 1IZ7A 1KKUA 1T4CA 3T99A 1EZ4A 5EZ5A 2CXTA 2KQUA 4YRJA 4DMCA 1DKRA 2WABA 4QXRA 5LBTA 4PYLA 4YGYA 1SOMA 1J0BA 1QPBA 3PO2G 3CEHA 1EFRA 3MINA 2Q4DA 1L2ZA 4ZI2A 3BH7A 3AYXB 1QRRA 2AJCA 5KFOA 3DZBA 3NAGA 1N0IA 2WHYA 1EGVB 3EFOB 2WM2A 1I6WA 3BRCA 3BA9A 2QQEA 4KDCA 4ZDIA 4WLOA 1Z37A 2FI1A 3FWNA 3ZJTA 5TV2A 1YMQA 3KJGA 4BZPA 4K0RA 1U63A 3GYGA 5I9BA 4OBXA 3WL8A 4UM9B 1HRDA 3NP7A 3DYVA 1SG0A 3LIPA 4N5HX 4GSKA 5CP8A 4GKJB 1HDCA 2XUZA 2Q46A 4B6FA 1YJCA 3N0XA 4CVNA 3JQ8B 3WGNA 2QI9C 3EW7A 2WIDA 1IUPA 3TLJA 2OBBA 2C88A 5HNEA 1U6KA 3ZHOA 1LV7A 1PFYA 2JCBA 3E2PA 2R0QC 2O2DA 2O8BB 2BGTA 3DTNA 4UE2A 4AKHA 1Q16A 3BHJA 4WKBA 3WRVA 1UAAA 2JAWA 1C9NA 3WNDA 5IYZF 3X2FA 1WXDA 2A57A 1RBMA 4F5YA 3W5UA 3PFCA 2HLDA 4RGVA 1Y9DA 2R44A 4YJFB 3AWIA 3R7NA 4PCAA 1HTTA 2QD3A 3JS5A 2Y2UA 2GUGA 2YR0A 1J2YA 4BFWA 3EE6A 2M6KA 4ARVA 3BULA 1YKGA 3M6AA 1N25A 4JJ8A 4GGPA 1LDNA 1I10A 1MZBA 4HWSA 4FW8A 2ZUEA 3KIPA 4GM4A 3UM9A 1FDOA 4B80A 3L7DA 4Y2PA 1T6ZA 3H18A 2EHJA 4BUJA 2Q6TA 2O6HA 1DCKA 2CCKA 3PW5A 3G8AA 3H9GA 4KQKA 4TKZA 3A6ZA 2HF2A 2E2IA 3VKUA 3MAGA 2OWEA 1COWA 2NU8A 3Q2IA 4RTQA 3DKVA 3PD7A 5E7MA 3D8TA 2HO4A 3KELA 5F5XA 2O8NA 1P1CA 3EXFA 3K9FC 2IU4A 2YTZA 3WGVA 2XCOA 5KNBA 5IM4F 4D2IA 4YI5A 2BGWA 3FPFA 1UPXA 4QTXA 1DWOA 1QNLA 2ADFA 2OG2A 3LNCA 2H16A 4P4UA 4F9TA 1GRNA 1RAIA 4Y2HA 4FTWA 5C1DA 1RQRA 3ILVA 2COIA 1OBHA 4V0QA 4O86A 4DWVA 2CYBA 3Q2OA 3LUAA 3HU3A 1D6MA 2XBMA 2CDAA 4WK6A 1SULA 1TVEA 2AUTA 4EEKA 1QPZA 3TL6A 1IHPA 2M2IA 3A1WA 2IBKA 1FMFA 3AI7A 2IBMA 4BQFA 4V03A 1CUXA 1Z6PA 2RG1A 4PO1A 3IAAA 1EJ0A 2QMZA 2VDQB 5BVHB 1WOMA 3AW9A 4H6WA 3GBVA 1U5BB 4Y2XA 4ENPA 2HRQA 4CCYA 3MWGA 2BJHA 5EJ2A 1BSVA 2IXAA 2QW1A 2PDAA 1EUQA 3LT1A 2V3CC 3KETA 4DXHA 1SWWA 4RHEA 1L8OA 3T1OA 1RJQA 2YJ4A 5HRUA 2ZJ2A 3O84A 2I9KA 4EY7A 3GUUA 2AJBA 3BH0A 2OO5A 2X7HA 1O94D 3EGOA 3HKEB 4Y2VA 4E6NA 4MUHA 3AHEA 4H77A 2D3TA 5FO0A 4D4GA 4JYZA 1OV4A 3MD9A 3VFDA 1QB7A 2AI3A 2YWDA 3AY0A 1FCJA 3N0WA 5HJ5A 3RS7A 1XQYA 2YYYA 4NAVA 3TAXA 3TSZA 5D5HA 2RONA 5B3JA 2FW8A 3M5PA 4AF6A 4K8RB 1F17A 4P38A 2EJ0A 2W4QA 1M2HA 1RAHA 2I3DA 2WKWA 1FP4A 5A9SB 2FPKA 2ZJ8A 3LLCA 4FHZA 4I5GA 1R0SA 4BLOA 4M1MA 2HVRA 1KETA 1FQJA 1GTL1 1QK4A 4DIDA 1WMDA 1FS6A 1MEEA 4JV5H 4TV9A 3CZAA 3CNEA 3H9CA 4H2DA 3P2YA 4PSDA 4M86A 2DPLA 3QVXA 2IHVA 1HKHA 2MMGA 4Y2JA 3W8NA 1WDKA 3IVMA 3NHBA 5DWVA 1QP0A 3OU7A 1TT5A 1H0RA 1MIHA 2WWXA 2FJ0A 2JGRA 4UM9D 4GI2A 3LHKA 2QT9A 4GMDA 4JFAA 3G2HA 2Z02A 2BKXA 1ETHA 4CEHA 4NBLA 3E18A 4JCOA 4IUDS 3OQIB 3QA9A 3DV0B 2CJFA 4D8WA 2A9VA 3NTXA 5AOVA 1QHGA 3TKLA 2AS0A 2JAHA 3P1JA 1H6DA 4BVJA 5DISB 1W581 4ZMBA 3DCYA 4MGZR 2CBGA 1ZAYA 2G88A 4OIFA 3HEMA 1J2TA 1ZISA 4L9WA 4NABA 1KY4A 3E05A 1KBLA 3I53A 4KSBA 4ZI7B 1AGYA 2PMWB 4AP5A 4HNQA 2R5WA 5KTNA 1PP4A 4EUKA 2II6A 4HFMA 2UXBB 3ZHCA 5KJCA 6LDHA 2QPAA 4UCVA 1J9EA 3BICA 1O0BA 5AESA 4WOKA 2F9LA 5CB6A 1EWKA 3SGIA 1USIA 5EIWA 1GQQA 1U2EA 1H8ED 3STUA 5LA6A 1XRRA 3T3EA 4MP3A 3CKYA 3KPJA 2BTOA 3V1NA 2WSSA 4IXWA 4ZV7A 4TMKA 1EFKA 2JB9A 1HI9A 4DA7A 1GAWA 3G7SA 3OFSA 1F8FA 5K3BA 1L4LA 1MDBA 2NTEA 3IQFA 4YMWA 3MQ2A 3K5WA 2NM0A 2R6JA 3D1VA 1T1GA 1WHSA 3I9V6 1JEQA 3AF5A 1WVMA 1E58A 2IGBA 4ABYA 2AOVA 1OZHA 5DN6D 1DX6A 4IVRA 1DO0A 1EE2A 3RVBA 3KKOA 3OOWA 3KOUA 2FPRA 3DDHA 4ZHQB 1MVLA 5IT9A 3BXOA 4FP9A 2ZBEA 1KH3A 5K45A 3I2FA 1EDEA 1CB7A 3B1WA 5IXSA 3AUJB 5LXTF 4RVGA 4H4DA 2I1LA 4QW8A 2P2NA 4AXBA 4AWAA 2G4LA 3R9IA 1HDRA 1RM0A 5EMJA 1PJQA 2PTHA 3SS7X 4FS3A 3JR7A 1W2WB 3MTJA 4CM9D 4V2IA 3E70C 3LJKA 1BGWA 1XCPA 2OGZA 2V7PA 3SDBA 4ZVOA 2O05A 1P2DA 3HDGA 5CNKA 4KSCA 3TN7A 3T5GA 4R7TA 1G18A 3NW9A 2O2JA 4DKJA 2GFIA 1F0KA 2GXSA 4JI3H 3KHUA 3EB9A 3DLHA 2XE4A 3SVTA 5A3QA 1GV0A 2OBXA 2A1TS 1ZICA 1OCEA 5EJ7A 3EF3A 2BQRA 2I4NA 1FP1D 1ZI6A 1IZ8A 1L5ZA 2I8CA 3BD7A 4WADA 2OYSA 1Y1SA 4H7DA 3L7JA 1VGVA 4MWGA 1GT91 2FK3A 2C2KA 1JDTA 4V0MA 4F2HA 4NDZA 1VCHA 4J9VA 2Z9DA 4Z99A 1UFVA 4L8GA 1U2DA 2LUOA 1G4AE 4JB2A 3U44B 1J90A 5E1MA 1GAJA 2AFHB 2VRCD 4U7JA 4I55F 4RC9A 1JLSA 4M9RA 1BXRB 4EY8A 2G17A 4NQRA 3H8SA 2ONZA 2F4VB 4G3IA 4JP3A 1W0CA 1SELA 4QDZA 3HXMA 3HABA 3BCSA 3QOWA 1CY8A 3SE0A 4K40A 2TMKA 3U0GA 1BMTA 2CXRA 3DTVB 4NFHA 4L27A 4COKA 4HRVA 4OF4A 2XVYA 3ZI0A 4Q7MB 3A1DA 1YTUA 2G5PA 1CZOA 1SKYB 3UQYS 1T2CA 3RUAA 1ISSA 2G1AA 3HJBA 3C7DB 5BN4A 4RFSA 2W6JD 3HOZG 4O4JB 5IG2A 3CUVA 5KG4A 5E7QA 5JPDA 5FAXA 2P11A 5L3VA 3KL2A 5IMSA 3N43B 3DHEA 2AFVA 4LZOA 3RC8A 1RC1A 4WFJA 1SH7A 4EA9A 4IDOA 1RRGA 3ZE0B 1UK8A 3TNDA 5EZSA 3M4XA 4JITA 3LUGA 4RPLA 4XB2A 4FC7A 2YZNA 1FYXA 2HMSA 1ZK4A 1AUXA 1Q0SA 2YHIA 4JI7H 2MYPA 5BR8B 1IBKH 2EBFX 2WQ6A 1CW2B 1IBLH 1UP4A 4HDMB 3RFXA 2DR2A 3LKDA 2GCOA 4YRTA 2G6TA 4G5RA 4TN1A 1UK9A 3REGA 4Z1MD 1RE0A 5L9AA 2VWGA 4CG2A 1YA8A 1O03A 5F9FA 2WBLC 1ZXBA 5KG1A 1U1GA 4X64B 4BMCA 1R9TA 1Z4QA 1WCMG 4A2BA 1CY1A 1Y7IA 1PSWA 2J30A 3WK8A 4AN1A 3M49A 3KLPX 1PAUA 4LF8B 1A9XB 4OJYA 3VOSA 4MLCA 1HDIA 1OFTA 3QKSB 3BJRA 4CCSA 5DNUA 2I55A 1KE2A 1I30A 1SK8A 4Q8FA 2PIDA 3KVOA 3HKBA 1P4AA 3WK4A 1XCOA 2V0CA 1NY5A 5DX0A 1MC1A 3LBNA 3NAQA 4C5CA 2CGEA 3ORYA 1PZNA 4YK7A 4HS4A 2ZDHA 5CVEA 1WCIB 2PH7A 5D7NA 5A0FA 2G4CA 5LMNH 3R5JA 5AKYA 1JFFA 4IQFA 3W5OA 5MN4A 3Q6NA 2OCAA 4NEHB 4YB8B 2J45A 5AKGA 1TMOA 4S0XA 4U0KA 2QGZA 2VDWA 3M6LA 4LMAA 1ZNQO 4YAJA 5DULA 2BQ3A 5KHOC 4MH0R 2GK3A 2BR0A 4P7FA 1D1PA 1G66A 2GBIA 5ICSA 3MFHA 2FR8A 3UK7A 1KK2A 4H6PA 4YREA 5GQSA 4EI7A 4R05A 3NORA 4FYVA 4U5XA 2C0CA 4L2IA 2ZPAA 1R1DA 1YV9A 2B1IA 1P60A 4LFAB 4H4CA 4P8RA 5TE9A 1V8FA 5BWVA 4MITA 1IWBB 2WNSA 4I3GA 2EIHA 4XASA 4UMVA 2AF3C 1TKAA 3KZKA 3P97A 3A1SA 5CYFA 4U7CA 3LVBA 3AB7A 1G8FA 2ZBGA 3SFVA 1J09A 2ROQA 4KN8A 4L8VA 3QKIA 1EI9A 4QU0A 4DLVA 3S4YA 4CQNA 4B8YA 3C45A 3LZCA 1DJOA 3HNOA 1NTRA 4JVLA 2OCXA 2K2WA 3Q3GE 1QGUB 2ABJA 3BWVA 3BGSA 1N0UA 2XQKA 2VWPA 4BNGA 5C81A 3A0RB 1MT3A 4MVJA 1ODCA 4JK3A 3ZK9A 4ARZB 4FHDA 3ZPXA 1S2IA 4CKCB 1M3SA 3KHLA 1GUBA 2JL1A 5JAOA 3HOUG 1EX7A 3A6EA 2XNDA 2R1UA 1ZFNA 3QV2A 2ZJ1A 1W4LA 2VQ6A 3SHFA 2J1LA 3RGZA 2C4WA 3PITA 1U8FO 1QG4A 3O5AA 5DOVA 3VO1A 3AI3A 1ZYUA 1PGNA 4NYMR 2VK2A 4Q9IA 1NW6A 5EMNA 3VC2A 3X2EA 3J7AC 3TY5A 3G5LA 2G9ZA 4YCLA 4TQGA 2IV3A 3LUCA 4WUTA 3UB3A 3GFPA 3QPBA 1Q44A 1N92A 4RABA 2A94A 4QIHA 2HK6A 2PN1A 3PQ4A 2P0AA 2G9QA 4DBZA 3A28A 2W2KA 3QVJA 4D9MA 3ZDEA 4JX9A 3QW2A 3LY5A 3ZWXA 1Q0QA 1Z0IA 3UK6A 2Z08A 2Q5HA 1FTGA 2NTJA 3R5KA 2BZ0A 1QO7A 3G0GA 3IH5A 4CF3A 3U80A 1JBKA 3BTSA 3O9MA 4UBLA 5KOHA 5KUTA 3FAZA 5K3EA 2XOXA 3D02A 3TTXA 5EZYF 4C3UA 1B3BA 2P2CA 1R64A 1R0RE 4G1FA 1PCXA 3KSDO 4EZEA 1R0CA 1ZNWA 3S1AB 2VPPA 2L0XA 4GI7A 1LRJA 3SFTA 1JJVA 2JGAA 1V4BA 4EG4A 3CE6A 3UICA 4Z0HO 1N2CB 3CO0S 1XDSA 3C3KA 1XVIA 3RIEA 1BU8A 4DBLC 2KX7A 1II9A 1EUDA 2DMRA 3AL2A 1A2OA 2HDKA 4YAIA 2XRFA 2J3QA 3VNSA 1KZ4A 4DMKA 1BW9A 1MC8A 2V55B 1Z6QA 3NGXA 2BT4A 2ZU0C 4RMJA 4GWKA 4PQFA 5DXAA 3NHFA 4QWWA 3VUFA 4F6RB 3A6DA 4WI1A 1K66A 1TU3A 3FTNA 4L6IA 4TQ9A 1X1QA 1DIOB 1OA1A 1XNQH 4MGYR 5DW0A 5FL7A 2E4XA 5CLIA 1QAMA 3A4MA 1A8UA 3O83A 3DAFA 1GDHA 4BNTA 3DNFA 2X58A 2G7MC 5KU1A 2VAMA 2YN2A 1MXHA 2ZB8A 2J3JA 5HQJA 2I7CA 1X8KA 1GPBA 3WYNA 2NVWA 4KU4A 4KVAA 4EPRA 3MWDA 4GRDA 5IT5A 1O8BA 2OA0A 4CG1A 4N7BA 1QRUA 2AKAB 2H0QA 4XVHA 4GS5A 3VU1A 4UXJA 2QG9A 2UUAH 3LRPA 2C42A 2XF8A 5FPSA 1Y33E 4PIVA 1XFAA 3ZHZA 2DWPA 3BHNA 3VX4A 1WQ1R 3AHIA 2GCGA 3PE3A 2OVFA 2Q6OA 2ONJA 2WWRA 2DWUA 3K53A 3L6CA 1V3TA 3DUWA 1OLUA 2HRBA 1HV8A 1LW6E 5BRNA 3UEOA 2P2YA 4OXRA 1KL7A 5ERGB 3NC4A 1FK8A 1J7JA 4W7IA 5CB0A 2F4NA 1AQUA 3G9TA 1H0KA 5D51S 2ZBDA 1HUQA 3VMMA 3HFSA 4YCAA 4WK2B 4YNBA 3OF5A 1L5FA 3WLPA 1Y7PA 2ADOA 1CQJB 2YHAA 5JDCC 5FTLA 4RAOA 4PZUA 4WCFA 1HE4A 3AY7A 5C3MA 2K87A 5D6OA 2O8DA 5HBRA 2BFCA 4ENRA 1RW4A 1RCUA 1YQEA 3LWDA 5KT2A 2JIQA 3Q5GA 3H1FA 5DYWA 5G02A 3ELBA 2BZ1A 2ZRAA 3TZEA 4B3TB 2XKAA 4RGQA 1SKYE 3K8OE 5AKLA 3ZEIA 2FSFA 4P9NA 4YR9A 4JLNA 3BMNA 1K27A 4Q7JB 2GAAA 4EMTA 4LVCA 4D8TA 5ARDA 1TIBA 1HXHA 5IASA 3KK0A 3P0EA 3HQ4O 4LOJA 3RB0A 1U7WA 2G09A 1A4UA 5KFGA 5JISA 4O3OA 4PTLA 3ZCTA 1QF6A 3L82B 3QKTA 5EIEA 1IYDA 2W6ZA 4GPBA 4W8HA 5KG3A 1V5GA 4OA5A 3TY8A 4KFSA 3UPTA 4A6EA 4RWEA 2NO7A 3QXGA 3UJNA 4Z3OA 4C22A 3RT9A 4ZAWA 4O3SA 1Z25A 2NZVG 1BVHA 4Z51A 3KLMX 2Z4RA 4RDCA 4WQMA 3J80A 1I32A 1Z9BA 4GPIB 2G08A 1D2GA 2I66A 1H8HA 1RZRA 4PX9A 3HDJA 4LGVA 3WYFA 1S97A 3H2IA 3WQQA 1SM4A 3FWPA 3FLMA 4LVOA 3N2IA 3EPIA 3M1AA 1K5GA 1X80A 3VZSA 3GL9A 2H2GA 1OLXB 2ID8A 5K2MA 3TNJA 1Z22A 4HI0E 4LFCB 4FZVA 2X6TA 3BB4A 1LEHA 2JGDA 5J40A 1CDZA 1F8UA 3BE8A 4ARUA 2J3DA 1DRJA 4G4GA 1A95A 4OLHA 1U9IA 2WAQA 2WJVA 5T3YA 5I5SA 1JSXA 3ABRB 3L84A 4FB4A 4I4TA 1KTAA 1JW9B 3T3MB 2QTLA 4IKPA 3WLNA 4PNZA 1EHCA 1EX6A 1AC5A 3LCCA 4IDFA 3B6ZA 3DBOB 4QUGA 2QTHA 4FJ0A 2BBTA 2NTVA 5I5EA 3QUCA 2QLJA 5FA6A 2BM8A 9GPBA 1MENA 3WHPA 1C29B 3Q6MA 4F91B 1J42A 1TEXA 1P0CA 3I6ZA 5GWXA 1R8QA 3R76A 2FLPA 2BEVA 3A25A 2C5AA 3HXLA 2QU7A 4OLJA 621PA 5LSAA 1ZPDA 2ZIVB 3JVDA 5EE5B 3IOCA 1EXDA 3NJ8A 4WA7A 3GDHA 4NFYA 1UIRA 1IOWA 1CXZA 1AF4A 2YNMD 4Q8EA 4LZZA 3IVRA 3AIMA 3RAJA 3HU1A 2YWBA 3K9QO 2LWIA 3VDXA 5JFTA 1R3UA 1J5EH 3EULA 1NXTA 4P83A 3DEZA 2HJHA 3ZUGA 3SX4A 4RXUA 1RM5A 4HLNA 1ZAUA 3OZUA 3CLVA 2Y9PB 4FZRA 1C1YA 3OHAA 2G9VA 2W2MA 3HO6A 2R6DA 2VKQA 2AKEA 4RNDB 1UJ5A 4HDQB 2AI2A 3GG2A 1GNVA 2V1XA 3SQNA 2ODEA 4W5TA 4PNEA 5DNWA 5EKSA 3VV3A 3WLFA 3LE8A 5D3MA 1EFLA 2NXNA 4JBIA 1U11A 1DKPA 5JCPA 3A4NA 4YJ2A 3WMGA 4J8PA 2UKDA 4IQ0A 4F1WA 5FBWB 4QULA 3F8SA 3I4NG 3UJPA 2B37A 4QQFA 5FNVF 1OKKD 2VJOA 1ZS9A 4KLCA 2AHRA 2B2XA 2Y3IA 4JEIA 1YAJA 2O5RA 3EISA 3PSHA 4D74A 4C1BA 4QU9A 3TLGA 1AKTA 2E4VA 5EE1A 3RS8A 1Q0LA 2GYUA 2O57A 1K9VF 1Z4OA 4WBXC 2JA1A 5GMOA 2XYPA 2ZYRA 2HMVA 3JYHA 5EJAA 1EG7A 3S70A 3BJZA 1S68A 4NZPA 1X7ZA 2QJFA 4YHBA 3A8TA 3U49A 2H08A 3RUDA 5KWEA 2I6XA 1BEUB 3PUHA 1PFWA 2AK3A 4YRNA 4E5KA 2CHVA 4YHHB 2VWHA 1VCOA 4QL3A 1YCDA 3ZY4A 1TZKA 4CR6A 4NCIA 3P9IA 4IINA 1BGXT 5ETJA 4M9CA 4KXLA 4A3KG 4Q7EA 5EIXA 2FPGB 2PMZE 3VNAA 1BKYA 1ADCA 3TKYA 3KZNA 1ZY2A 3AJAA 2BMDA 1EZ1A 4P93A 3UW1A 2JJ1A 3MR5A 3LD9A 5LCXA 4X94A 2EBWA 1WJGA 3OP4A 3W6NA 4FFPA 3DDZX 3GT0A 2DHQA 4FGJA 5AKHA 1KSGA 4KXXA 5D3ZA 1YS6A 2H00A 1Y34E 1SY7A 2X1LA 1EFTA 1PR6A 2QL7A 4CC6A 2E7ZA 2ZULA 1T0BA 2PXHA 5EP3A 4O4LF 1PIWA 4BRUA 2H1RA 2XVXA 4E07A 3PD0A 3O8NA 2WVAA 4R1UA 2XB4A 3S28A 4FEYA 2IYZA 2YRXA 3DHYA 4CLEA 4WHXA 3G8YA 1KHHA 5CVDA 2CT8A 1HSZA 3G0CA 2TMGA 3LO5A 2YZMA 2BHRA 4UKDA 2ZKIA 3KJIA 2QP4A 3VR6D 2I6QA 3FHCB 1ODTC 3K3VA 1KSHA 1C1DB 4AKTA 1VRWA 1KO8A 4KFRA 2BWJA 1UPBA 5AHOA 4O2AA 1U3TA 5DH9A 4MS1A 2O3UA 5CPBA 3Q9LA 3EWNA 5L4NA 4OYYA 2BF4A 1S03G 4N6NA 3SSMA 2J85A 3ZHYA 5K09A 2ZBVA 3N42B 3K6KA 4C0XA 1KDOA 5G2OA 2Y92A 3OOYA 4PO9A 3ZNOA 4INAA 2GF0A 2PANA 3LRXA 4R98A 4FEAA 4FCTA 1NUHA 3IODA 3NUGA 3L07A 1TYBE 3QVWA 3SN6A 4RNOA 1P5ZB 3WLJA 3RE1A 4DVGA 1UBCA 3L02A 1V6CA 1L8AA 2CSUA 2PBRA 2NUAB 4EJ0A 4P31A 3MWMA 4K9NA 2H8GA 4H7PA 5EXTA 1BHSA 1E9VA 2NQ2C 1WSDA 5T67A 4WNIA 1QWOA 3I32A 1UFKA 3PUZA 2W2TA 4NU0A 4BMPB 4N0PA 3CVJA 2DQ4A 4CKWA 3AQ4A 4MYSA 1P8LA 5BWTA 2PLFA 5EKUA 4UHHA 2IA6A 3KR0A 5LMUB 4OP2A 1PJLA 1VECA 2OLKA 4N5MA 4BX8A 4HDNA 5BYJA 5AW8A 1KBQA 1LZLA 5KC8A 4IGKA 1SUAA 3SHWA 1A0IA 4QWDA 1RBZA 2O8CA 1FNNA 2BQUA 2AMFA 5MN5A 1KIFA 4EO4A 1I7PA 5BNZA 2OGSA 3E9CA 3FIUA 2DUNA 4EVIA 3T7TA 4AJKA 2L69A 4YYZA 3NHPA 2R7AA 2R6AA 1HO3A 4B4VA 3O90A 4D9KA 3H6GA 1YTLA 3VNQA 2ODWA 1UMDB 2VTBA 1JA0A 2H29A 2VYND 2GZAA 4HOYA 2BBSA 4ZT2A 4GG1A 4B3BA 2HIGA 1X7HA 4HMOA 4NJEB 1N34B 5F76A 1X77A 3STHA 2IQIA 4GC5A 1JMYA 4NDNE 3F7TA 5DHFA 4RULA 3ZWVA 2RK3A 4PM4A 4OI1A 4EYQA 3WGKA 4DG5A 3ADCA 1LXCA 1ODFA 3OPQA 5DIZA 3QWAA 2VZ8A 1RC0A 4JN6B 3AW8A 1TIKA 1PBTA 3B3QA 1ZGBA 4KB5A 1E6CA 1EIWA 1ICEA 4Q4CA 1Z8NA 4FJ2A 4QRIA 3CMMA 1ZA2A 1DT5A 1S2NA 2XUHA 1DOHA 4PVDA 3X1JA 1FRZA 1NN0A 4LBZA 2AEJA 3IPCA 3QYFA 3VDRA 2M1XA 1ZCBA 1JILA 1B6RA 2IXFA 2GN4A 5F33A 2QVXX 3K4QA 3I42A 3SBOA 1DC6A 2Q1TA 2FRDC 1GWNA 3N87A 2YDXA 4QPCA 2CLMB 2J4DA 1PJAA 5ALNA 4MIOA 2HREA 3GX1A 2LIVA 5T4HA 1KAOA 1VIVA 3IXMA 3IA2A 4MYHA 4AY6A 5DWDA 3MIIA 2WTUA 5A3VA 4F1JA 3QU7A 2JCVA 4F9GA 2FWIA 3JRNA 3GPDG 4BB5A 2I6UA 1MVNA 5LD2B 4NQZA 4ZXPA 2IPXA 3EZXA 4BXOB 3KB8A 3UWKA 5COAA 4D3YA 2VLIA 2E87A 3M6VA 3ESCA 2EVWX 1NRJB 1NRXA 1ZVKA 5IK2A 3L5OA 1QUFA 4B3HA 3VKVA 3TLBA 3THXA 2I7TA 4ECRA 1RM3A 3V4ZA 3GFBA 2WUDA 2VSNA 1J56A 4QO7A 1MD9A 1MHPA 3ZXIA 2FE4A 3ZQ4A 2YXBA 1QH9A 1JZTA 1JDSA 2XODA 2OYRA 5A02A 4A36A 1H4QA 1Y8AA 2GLTA 4Z4EA 2EJBA 1KDRA 3WLTA 5LP6B 3FI0A 2H54A 2CV0A 2HSWA 2G8NA 1RJ9B 4G0OA 1JMVA 3IEVA 2R00C 3U13A 2X0NA 1GLVA 1XZJA 1GVHA 4BGEA 4E6PA 3B7GA 1P45A 3CJQA 1Z6XA 5C5CA 3OQJA 1MA3A 2EKPA 2X8LA 5EPUA 2E5LH 5AVZA 4DCPA 5CFLA 1YONA 3ZGZA 5C32A 4K6NA 1Z0DA 3EG9B 5CH8A 1UAGA 5JNSA 2R8OA 1KQNA 3EEFA 4LYEA 4CQMB 4BE7B 1G1AA 1YOVA 1U7HA 1WB9A 4IH4A 4F46A 4F4XA 4IQGA 4UFZA 1P33A 3ENKA 4RLSA 6Q21A 1P1RA 1FSFA 1LJ8A 4Q18A 3BWCA 1DIHA 4BO6A 1GYFA 4LJ4A 2Q8QA 1E1DA 5E6UA 2YJ3A 2O5EA 4YUZA 1CJUC 4A9AA 3H1PA 3HR8A 5L3QB 2P4EA 1VPTA 2ZR7A 4JVMA 1U1EA 4PLZA 4DV6B 1EFHA 3GUCA 3AHFA 1ENYA 1Q6YA 5IAGA 2Z6QA 2D7JA 1EAYA 3SHOA 3CVWA 5LL6b 5JJKA 4AM8A 2ORVA 3ANSA 3P9KA 3EDOA 2V6FA 2J9FA 1NP6A 1Q7GA 2XDYA 1RKQA 4HTFA 4CLRA 2AQHA 3OI7A 4NZNA 4BVFA 2ASJA 4EBFA 1B8OA 1NGSA 3QSGA 3JAKA 4FFBB 2WFLB 5CA1B 2QRLA 5FJJA 2O8EB 2HO5A 4OM8A 5A05A 2Y4OA 3TIFA 1Z82A 3GUYA 5JAZA 4DUGD 5KBYA 1QG0A 3O26A 1SUSA 3EC7A 2X23A 1E6EA 2RHGB 3L7YA 2I4TA 2A59A 3PI7A 5BRJA 1DU4A 1XAIA 1JV2B 2W2VA 2FFQA 3PXGA 2QL6A 1ISMA 4RKEA 3QFFA 2EYQA 4MULA 5AR1A 3AVUA 2DAPA 4QDJA 2OWOA 1CLEA 4OK6A 2OEPA 3R7AA 1RZ3A 1G21E 1L5SA 4M76B 5EIBD 2EEPA 3IR5A 1ZR4A 4A3IG 4A5OA 1LBQA 2JBAB 4POAA 3S24A 4HH3C 4EJSB 4LZJA 3KQTA 3RM3A 3PKZA 5JRDS 4CM3A 3W5SA 1T5LA 4BO8A 2WYOA 1TCVA 1KEKA 3B9PA 5JDIC 1H5UA 2NU7A 1RTKA 3A26A 2A0KA 2QRNA 4E08A 1JSZA 4RACA 3AINA 4V0NA 1G8GA 3U40A 2MSKA 3QIAA 3K7EA 1CUHA 2B5OA 2AXNA 2PNFA 1K98A 2O4UX 4OSOA 3DR5A 4RFLA 1PN3A 2VXCA 1HYHA 3A1NA 4UHBA 3ERCA 1YL5A 2FQYA 3V8RA 1JLHA 5C4IA 5H02A 3GCZA 2AQIA 1A9PA 3R7LA 4AYTA 3KUCA 3C8UA 1U9CA 4OFXA 5LBIA 5F52A 1Z0ZA 3L4JA 2Y68A 3PP8A 1WR8A 2A5FA 1FQKA 1QQ5A 1X7XB 2GO1A 3C6QA 3N9IA 3WO0A 3AB3A 3OJXA 3TEKA 2J0UA 1JXOA 2Q9AA 2CNNA 4FQ8A 5LMZA 3PR4A 4Z7NB 2HW8A 2ZRHA 3MS2A 1CUFA 3NEAA 1GO3E 1EK5A 3ABSB 3H1BA 1A9QA 1EA5A 2JH8A 5D86A 4HX5A 3GLSA 1FVFA 2PAFA 4CC5A 1CRLA 2OORC 1MPTA 1R27A 3ENNA 4U2BA 3K70D 5JH7F 4OHFA 1D4AA 4TV8A 4YJ3F 2P9YA 4ND3A 3TTYA 3FCOA 5HE8A 2PGLA 5HQ3B 2KWIA 3ZWMA 4NYMQ 2XEXA 4RTPA 4ZHSA 3W04A 3EXHC 1J99A 3KYBA 1AV6A 4JXKA 4JA0A 4RCZA 1KYIA 3HYNA 3SQLA 3U48A 2IEAA 4HJRA 1ZNXA 2XBLA 4CZ2A 3JZIA 3CZMA 4JWTA 2VBIA 2GWHA 1CJKC 3FCCA 4LTMA 1QVZA 2R751 2WJZB 3LVFO 3INRA 3QVGB 1JHDA 3ND5A 4R8VA 2YKGA 1YRHA 1E9EA 3QYPA 1M2VA 4LJ7A 4B7UA 5IH3A 3AIKA 3W3AH 4PZAA 1BOFA 3G7UA 4QU8A 2JHAA 2Q6VA 4BJ6A 3HKCA 2VJBA 3MYRA 3FWZA 1XDDA 4HVAA 3DDOA 1RPTA 1VKZA 1L8LA 2FZGA 3QMWA 4CQMD 2CHEA 5FD5A 5J1SB 1QJ4A 3HDHA 4R0VA 4BKPA 2PVCA 4CM4A 4PAQA 5AW0A 3SZLA 3HNPA 5KG0A 1T0HB 1XMOH 5HS4A 3O4IA 2ZI9A 5MN6A 3M4IA 1L2TA 4DNQA 4UTOA 5EE0A 2D59A 5WRFA 1NJ8A 5KS8A 2ZRPA 2XY4A 3WV5A 3NHYA 4HATA 1NXVA 3TBHA 3H1TA 4S3MA 3EQ7A 2W9XA 3VNVA 4B2YA 3OY7A 2ZJ4A 3ITDA 1K75A 4G41A 3G2MA 1WUJS 2FKNA 2GN8A 4UCUA 4CKBB 4NATA 2VH1A 4OB8A 3WMWA 1IC6A 3TIGA 1BWSA 3L8YA 4QPNA 2DPHA 2WSBA 3O8QB 2HA0A 1P6QA 4V2UA 2DHRA 1D8AA 4Z0NA 3JPYA 2GZMA 3CTMA 4C21A 3IEXA 3EX7C 1NKVA 3ER8A 1A2BA 1OR8A 1DIRA 5A1TA 2WIAA 2YXDA 4KC0A 3W6UA 2X5KO 3KCNA 1I1KA 2HK9A 3STWA 2GN2A 4XXHA 1B8PA 4OFWA 4R9NA 4XVCA 3ENZA 4KPUB 4HB2A 2JFPA 1SNYA 5CHYA 5DLDA 1JBQA 2MYNA 2OT3B 4WKOA 5EFOA 3IAUA 1L4FA 4JB0A 1NJ1A 2X2PA 4LJ5A 4Z0PA 3V8MA 3H0CA 2WZDA 4U6NA 1KVUA 7REQA 4UAGA 5ELXA 2V8OA 1OVGA 1E3IA 3CT4A 4M9ZA 4DLSA 1NMZA 1DJPA 3I8OA 1WH2A 4C04A 4PTYA 1QLHA 3IUMA 1CFJA 3AP1A 2DJIA 3WHIA 2OXTA 3SF8B 3L8CA 1N2GA 3DHWC 4XGQA 2J87A 1K8RA 4FOTA 4L85A 5IKXA 1RI5A 4J9QA 1UFOA 3HOWG 1VMKA 2H8KA 3O75A 1U4OA 3KQMA 5J58A 2ZI4A 3ODPA 2TMDA 4DNFA 4CDGA 1U2ZA 3LHSA 3NYRA 3EGXA 1UPCA 4PN3A 4PC3A 2FAXA 4ZDWA 1S5PA 3KTAB 4HAIA 1W85A 1NTOA 3IP6A 1E79D 2VT2A 2QRHA 2A2ZA 4RXMA 3VTAA 4JSRA 3ZIAA 3WB2A 1XU7A 1M10A 4PYIA 4ZYTA 5G0SA 3J81W 4OQYA 5CA0B 4IV0A 1XZBA 1XCBA 4KW7A 3B5EA 3K0SA 4JJEA 4B5KA 3GDEA 3UAWA 2IEZA 1QAOA 3LX6A 3PD1A 2F48A 3NKLA 3G88A 1QQ7A 3OCVA 1KF0A 5LIRA 4D42A 5JCZA 1KOLA 1XKLA 2I33A 5CCDA 4WH0A 5KAPA 2AZMA 2GN1A 4PZCA 1Q83A 1IM2A 3LT2A 1N2HA 1SVNA 4MIKA 1LQUA 3AYZB 3A3NA 2HT6A 5K8TA 1QU2A 2XECA 5AI0A 3GHYA 1SHJA 2B63A 4UM7A 2BMAA 4ZN6A 2GCEA 2LW7A 5A06A 1V8BA 3CH5A 4E03A 1L7BA 3GJ8A 3PNSA 5CVJA 2H7XA 3U7QB 1L5GB 4O3RA 4ZTUB 2LZ0A 4BO3A 5KHAA 3OLZA 4O2LA 2WDTA 3COPA 2LGJA 1N9KA 3QJGA 4MZDA 1VPVA 2HQ1A 1Z2EA 1E9RA 2C7BA 2KMLA 4E4RA 1SK9A 2HJVA 3ILSA 2YRFA 5CD1A 2E1RA 3UJBA 3FG9A 5JD3A 4M3NA 1SIUA 4DWJA 1FTYA 1NYTA 3U55A 1ZA1A 2IZ1A 1N5KA 2C20A 3QPWA 2O2IA 4NBNA 2IOQA 3KD2A 2NP6A 1FUKA 5U9CA 4W82A 1AF7A 2VT3A 4IRMA 4JHLA 5FCDA 1EH5A 2Z2ZA 4QNNA 4E3ZA 4L7VA 1X2EA 4QFMA 4M1SA 3I4CA 4DMLA 1GT6A 3F8TA 4RTRA 3KT3A 2WHPB 2ZFUA 4O4HF 1NF2A 2CNWD 1T3NA 2PS1A 1H3NA 3O9VA 3BH6A 1ZHQA 4BFTA 4RZSA 3H87A 4MUMA 2HV9A 3FBGA 5AVVA 1F3LA 1B41A 3RHFA 4YRPA 2O8FB 4L0QA 4JI4H 4CGYA 4M7WA 1J1UA 1NW5A 2H7CA 1E1QD 1Y48E 5ICCA 4HTAA 4D4JA 3LG2A 4YRRA 1Y6ZA 3RT7A 3Q3VA 5KQRA 3WA6A 3NP9A 1SHTX 1QK3A 2ID7A 5CB4F 4RPCA 1HQDA 2FXVA 3GLIA 2PPLA 1JJFA 4INJA 1NBIA 3NIGB 2C97A 4FMCF 3ONWA 4AYWA 4MHSA 3S81A 1ENPA 2W2LA 3U3KA 4DV4B 4ED1A 2H4FA 1ABFA 2OCYC 3ZDXB 1LC0A 4A91A 2ZLBA 4EBCA 5C8YA 3SYRA 3FAKA 3GLVA 3MD0A 3PXBA 2VYFA 4QGGA 3EGIA 1AHHA 3O4FA 4K9KA 1O4VA 4LNAA 1E1CB 3EXEA 2X9LA 2Q2UA 1JDPA 5ALUA 5EERA 4D5EA 3S44A 4FS2A 1AS3A 3GBSA 4YUAA 2IP2A 5IC4A 5BMVB 3D6NB 5IVPA 3UA4A 4MWZA 3I1FA 4NOMA 1N0VC 2DBYA 4L4SA 2ZJBA 2WNIA 3LT0A 1XG5A 1C0EA 2C5FA 2OHJA 2XWQA 3NYIA 5IU6A 1N6RA 4RU9A 1X9HA 4Y2RA 2Q7OE 4QOEA 1G64A 1B33N 2B78A 4D9HA 2XNCA 1JE0A 2DFDA 3GVIA 3UUWA 4IV8A 1T2FA 1EIZA 3BC1A 1H4SA 1S10A 4MQEA 1FNSA 4YRMA 3LK7A 4WCDA 3F7MA 3RIYA 3PEFA 2SKDA 3BF8A 4CQLA 2JLXA 4R8SA 2P7IA 4EYKA 3PO3G 3ZDRA 5CDGA 4INOA 5K0FA 2VK8A 1FLVA 5KSYA 5HRAA 4K6MA 4C6RA 3IIJA 4DSTA 2REXB 5JI2E 1OOEA 2XA1A 3B6KA 1CQIB 2GPSA 1POXA 3RYIB 4DC1A 2ZU6A 2BUCA 5CFPA 1J20A 1XMQB 5H9VA 1KTVA 4MEJA 1BKDR 3ZZNA 3A9VA 2H11A 4BV8A 1Z8DA 1FDUA 3F8WA 3HBFA 1V5WA 1AQIA 1XE3A 4AY2A 3GPBA 1MNAA 4H0FA 3EGDB 4I7HA 4ECXA 2ODPA 1KOFA 3U54A 5DFAA 1HR0H 2QR2A 1ENOA 5CU7A 1RJWA 4H7IA 3HLKA 1TXGA 1CKOA 1NOJA 5CNIA 3E3NA 3COZA 3RSHA 3LDUA 5KSZA 3PHLA 5KX5B 2A86A 2HCJB 3VISA 4XLLA 4DLZA 2CVQA 4RJ2A 3BSYA 2JC3A 1XA0A 3SC6A 5AVOA 1NWCA 2QNBA 1F7VA 1CD5A 4AROA 2YMMA 2P6PA 1M5RA 1N8NA 3EXIB 4TMTA 1BD4A 2YVKA 3WOHA 1BRTA 4B6RA 1D0VA 3CV3A 1O08A 4ECTA 2J6SA 2N47A 1JKFA 2ODAA 4NEQA 3CG4A 2R86A 1B4DA 3LFTA 3LU1A 4AVYA 2WHEA 1IXSB 4XJVA 4N8EA 1U9YA 3LT4A 1T2EA 1ZM4A 4Y1EA 4NOLA 3WBBA 1OVMA 3H65A 2BLNA 3IA7A 2WAYA 10MHA 2FZWA 1V7QA 1DQPA 3HXOA 2R7LA 5DCYA 3I92A 4ENTA 2RBGA 4OQDA 3EVZA 3U2QA 3TTUA 1LPOA 3G89A 1PGJA 3DM5A 5DW3A 1ZOPA 3ZHQA 2NMVA 4YBRA 3MBIA 5IXYA 2MSEB 3UYLA 1JEJA 1QYXA 3Q12A 5SZIA 1GEGA 4K26A 2YZKA 4LRYA 2YWXA 1BZYA 3T4UA 3VPSA 5DIFA 2DUMA 4Q0YA 3LH5A 3AR3A 4ANFA 2P0EA 2G6BA 1LWNA 2V74B 4LAFA 3RYCB 3IBGA 1KI9A 1W47A 2XTAA 3Q0IA 5BOVA 1YC5A 4Q6WA 1OGIA 1H42A 1JXLA 8LDHA 2J5KA 4PPNA 3LLSA 3ZH9B 2OAGA 2JGIA 1UXGA 4RVUA 3WXBA 4C7OA 4BAUA 1G19A 4DXAA 3I6MA 4YH1A 1ZH4A 1ZMRA 2WJ6A 1FMJA 1DRUA 4F2PA 4R1LA 1QVWA 4GPZA 3DZKA 4B3FX 1UZMA 3PUKA 4U6QA 2PBLA 4XM2A 4TYMA 4G0UA 4Q1AA 5HNKA 4G0ZA 5DJ5A 5TQJA 3C3WA 2ZB7A 3JWEA 4L8WB 4LKOA 3K20A 3EHEA 2R9VA 1JWLA 3GTPA 3D3NA 4KWTA 3RSSA 1MAAA 4IFEA 4BNLA 3KFXA 4KFTA 1NM5C 1SC1A 2HRRA 4ED3A 2IODA 2CYAA 1A7AA 5KFBA 2OBYA 4DDKA 5E1BA 4UCFA 1B2LA 4PG6A 5FJ8G 1YNSA 4X92A 3BGDA 1JIXA 3PCTA 2CNBA 2QL9A 1KH2A 2KS6A 5LZ2A 4FWTA 2H4JA 3OIFA 4OFZA 3T5CA 1P4JA 3N86A 2ALJA 4GQBA 3WWYA 4M0EA 2X9NA 4RZUA 3DDWA 3ACCA 4FGSA 4B83A 1O6ZA 1TF7A 4IDPA 3KDPA 1O94A 2HRZA 3U26A 1E89A 2GASA 1VG0B 1ISPA 3CLRD 4UHKA 1HE3A 1OLOA 1CVIA 4OGLA 3TJRA 3IHLA 2ZANA 4TKMA 3MM4A 4U00A 4XGIA 4IMRA 3DTVD 4NBRA 1KMNA 3JD2A 2OTCA 3LQSA 3OTOB 1T36A 4DR7B 1N6PA 4EW6A 3AJDA 1IJKA 3EF0A 1OAOC 5IT9W 3BMCB 3FOAA 5L1IA 4ECVA 3D8HA 4C2AA 4XWYA 1SKAA 5IP5A 5LUAA 4TRMA 5JNUA 3PUWA 1Y98A 1AXGA 1G5QA 1HGXA 4MRSA 3FHTA 1RLUA 1WXGA 3JYQA 5J2TA 3AVOA 3U6KA 1XPOA 4L0DA 4PSUA 3L0IB 4LVNA 3T5KA 2WJ3A 2NLOA 4H08A 1JHUA 5C52B 1M7BA 1O97D 1P0IA 2BP7B 4MKXA 4YO8A 5IJ0B 1TYEB 4CV2A 2GPNA 4E1AA 3S2YA 4GPTA 3UV6A 1M1YA 3V3KA 5M2QA 3IP1A 1T94A 2FGKA 2IOFK 2GN6A 1UDBA 3O9ZA 3JQDA 1V16B 1YU9A 2YVLA 2C2EA 4ZOCA 2VKTA 3F47A 1H6AA 1DWPA 1H2XA 3WYDA 3VHRA 3P9XA 3T1VA 3O1LA 3OSNA 1RI3A 2QX6A 4Y18A 3CVVA 1RPNA 2OECA 2ZTVA 1A72A 1KRXA 4YV0A 1L0BA 3JQ8A 2Z5LA 3X1YA 2B6NA 2B94A 4B3RB 3SZRA 4Q4DA 1E0DA 2BRUA 3U5TA 1THTA 4LRTB 3R8XA 1QRTA 5T14A 3PU6A 2VEOA 3UOAB 2XD4A 3OSUA 3DKKA 4X1IA 4D0LB 3BJYA 2WFAA 1T26A 4AJIA 2R8IA 1CUIA 4K6FA 3GZJA 3B8HA 3DAPA 3T0GA 3FPSA 1PR3A 3WK6A 5JZSA 1DXOA 2GR9A 5JFOA 1ECLA 1P62B 1NMQA 4KQJA 3HGQA 4K5QA 4KZPA 4M1YA 5G4KB 4YJFA 4ISCA 5KFSA 2I2AA 3T4PA 4ED2A 4X3PA 1C9KA 1ZKDA 2HLHA 2CBZA 1WZEA 3L0CA 4A0GA 1NJ5A 3ENVA 2RIRA 2QX4A 2WG1A 1H8EA 3GEBA 1RQPA 2OENG 3OE7D 5D5QA 5AH0A 2QJRA 4QXPA 2QBYB 5AJYA 4ZKDA 2H5IA 1Z2PX 1GHTA 5BXQC 1LCIA 3I39X 4ACBA 1QFYA 4LQDA 2LDBA 2AN5A 3V2GA 2F8SA 4B7AA 1BS9A 1OX5A 3KZOA 1SC4A 5EPEA 1E9AA 2CF5A 1WXIA 2JEOA 1FEZA 2C2YA 5DKFA 4AQYH 4IXDA 1MN6A 2B36A 3ZX5A 1PS8A 3KQUA 5DN6A 4GP6A 3SYNA 3IN5A 4EWLA 2P8SA 2XQIA 4E0BA 6ABPA 3ANYB 4KK4A 1U6JA 1CR2A 4KH1A 4ZVNA 3LP6A 3W8RA 5FLMG 1ZJ5A 4NZMA 1IATA 1RHRA 1S96A 4MKIA 3GRFA 4MRNA 3CF4G 2A30A 4YJKA 4RGBA 4CL3A 2WG0A 3K72B 3PEYA 3JATA 3GRKA 3WLSA 3IR7A 1Q11A 4IDHA 3VPGA 1YRYE 1I5EA 1KXZA 2P1RA 4CM9A 2P5YA 1QYIA 1S0MA 4NK5A 2H1OA 1JDBC 2B35A 3P96A 4LGCA 1YR6A 2QSUA 2XTMA 4I2VA 3RVNA 1JWAB 4RD4A 3LULA 2DT5A 1A97A 3OJOA 1KS2A 3LS2A 3W9BA 4G8JA 4MB2A 2Y2VA 1CUSA 3K9HA 4DJEC 1LS6A 4L08A 2VNSA 2HWKA 4LECA 3BCRA 4K0KB 1YRLA 2VS1A 3LOUA 4AB1A 5GM1A 4IPTA 4AQ7A 4PZ6A 4E6EA 3N44B 2OP0A 5CXXA 1LLDA 3WMFA 3A7DA 3SP1A 4CM5A 1FSPA 1Z0KA 1PZHA 3FKIA 3T1HB 5DN9A 2I2WA 3FPHA 2FGJA 1C3OB 5HG0A 1U0FA 4IAJA 4OUDA 3BMOA 4C6TB 1Z17A 2VRCA 2W2XA 3USES 3AEYA 3BRSA 1P2VA 4KDFA 3THSA 1KVQA 5FWDA 4Q00A 1VI6A 2IWRA 3QVOA 3UXMA 4FB5A 1FNDA 4NMLA 1EDOA 2QNRA 2IDJA 1QU3A 1BWPA 3HKEA 4WVLA 4D97A 1RYHA 2XXAB 4XA8A 5EKTA 4XDZA 1I3NA 2FX3A 1UM9B 1O96A 5CDTA 4AMYA 4V0LA 1W35A 4EL5A 3PYLA 4WD3A 1C41A 4BVAA 1U2SA 4UHFA 4B09A 1FXWA 3SZMA 2BKLA 2V5AA 2QR5A 2EFCB 3E5NA 3EJWA 2W6JA 3OOEA 1AVTA 5CLLA 5A9SA 4MQ5A 3FM9A 1Z16A 5T6MA 4MW0A 1QBKC 4TLCA 4OI0A 1EXVA 1U0NA 3DC2A 4GOJA 2JARA 1QJCA 4B31A 2JBWA 4IJVA 2CLEB 3K1YA 2JJQA 4J6EA 3DKIA 4AJJA 1PEAA 2J0SA 1XNJA 2DCUA 3ZW8A 4RQUA 1SQGA 3NHUA 4HC4A 3Q2KA 4BECA 1JIVA 3PHHA 1XN4A 1GZ4A 4URZR 3VYSB 3OE1A 5JSQA 1G59A 4QJ3A 5T4EA 4PIMA 3ELYA 4HYYA 3F96A 1ZX1A 2RH5A 3ESBA 4NHOA 4Q3LA 4GH5A 5AKJA 3DZGA 5E0KB 4EGJA 1VYUA 5AJVB 1WZNA 3I8SA 4RJJA 2ZKLA 4PCVA 4Z1MA 4TMFA 1KARA 3FI9A 5LZ7A 3ICQB 1GARA 3OX4A 3JSAA 5SZKB 3LPCA 5A71A 1JIUA 4LWZA 2GXQA 3FKJA 3QLVA 3UENA 4G01B 5B1SA 1TO1E 3K96A 1PVDA 3PX3A 1CERA 5JO0A 2Y6VA 3GRVA 2R93G 1NDHA 1WTAA 3ZDBA 4JI1H 1ZU4A 2HL6A 2IS2A 1RRMA 2NSJA 4MEBA 3JWJA 2HR1A 5F78A 3UV7A 2MHCA 2IZ7A 2YXEA 4KITB 4PHTA 2H4ZA 1TL7C 3QE4A 5B7NA 1WCV1 4GXQA 4DR2H 3R9WA 2CUKA 3HNRA 1ZVVA 5T5QA 3AUFA 3EIQA 3BMXA 4ZVPA 5HJ2A 5LYJF 1QVRA 3U16A 1O5TA 4K3VA 4AJ1A 2OXFA 5IYZB 2NO5A 4IXNA 3NT2A 3V1YA 3LKZA 3PJFA 4G5FA 4JOCA 4KGZA 5GZ6A 1ULTA 2IZZA 4ZQFA 3K8QA 1V1MB 2PFKA 4EVQA 4D4KA 1IVSA 1MRSA 2V3VA 5KHLB 4FYYA 4HB4A 1KFEB 1VDMA 1G21B 2FW7A 3DFZA 2R6GA 1N5OX 4X3CA 4BCDA 3I9KA 2ZWOA 5A2GA 1KPGA 4AFNA 3ADOA 1G6KA 2QLLA 4YP1A 1E7WA 4I8IA 2R97A 2UVRA 1Y5LA 3HXQA 4EG1A 4DJFC 5E2IA 5AI6A 3U3RA 1YZLA 3WYGA 5AVSA 1NNLA 5E38A 4CMIA 1LVGA 3NQ41 1UK6A 3TQTA 3BWEA 2QJWA 5IDXA 1IVNA 4K6OA 3GFQA 1Z6ZA 5I9IA 3CRW1 1YH3A 2FMHA 2CNDA 3U3JA 4JV5B 4MRMA 3OMLA 3A6PC 1C1HA 3QOFA 3UH1A 1UH5A 4DW8A 4JOSA 1POWA 5LQSA 3OMWA 2HY7A 1HOXA 2O3TA 1QDLB 4UW9A 4PAGA 4ZMSA 1QV9A 1XD9A 4OVKA 1XRPA 2Q4OA 4A15A 3CM0A 1B76A 4TWBA 1K7XB 1YRWA 4TLAA 4M6WB 4DVJA 4I5DA 1BJTA 2C59A 3O3NB 3GJSA 3H11B 4Z7OB 1YR9A 4DCOA 1XF1A 3ZY3A 3LFHA 2NTYC 3K15A 3GGJA 2FN4A 5ENVA 3U44A 2DH6A 2VUTA 1LI5A 5C51B 2ZTLA 5AVKA 4TUYF 4U3JA 1PWXA 5H68A 4NU8X 1GQYA 1YCFA 1Y81A 1R5OA 3TB6A 3TOCA 1Y1VA 3IHWA 4UMFA 3TIIA 2VF2A 1OMOA 2O48X 2HMWA 3L40A 3IIIA 5L3SA 1OI2A 5BSKA 3FCXA 3O73A 2C8KA 1G0NA 2D06A 1XTUA 2B61A 1AKVA 4FZ5A 1A69A 1L3CA 1L7MA 1I3CA 2HG8A 4HRYA 1CJBA 3DFUA 4CMEA 4CLXA 4BYGA 3A6GA 4GX0A 4C3VA 1PO7A 5HQTA 1TNDA 4PF1A 2P9GA 2PAAA 1QIKA 5NLLA 3IAEA 3ML1A 4P34A 5DSXA 1JFSA 3FHOA 1OASA 4P2GA 2PMCA 1K63A 1JIIA 4UEJA 3IP5A 4DCUA 1YVPA 4N82A 3NONA 5FB3A 3T5LA 1YB2A 4YLGA 1WXFA 3DE4X 2F64A 1CS4C 2GEJA 4JLSA 1LH0A 3V4OA 3EQ2A 4X61A 3LCMA 4OJNA 3QKRB 3RVPA 3KYHC 4UHCA 3G2NA 1SBNE 1H2HA 3KM0A 3ZD6A 1UC9A 1CU1A 3OE4A 2XGPA 4D9GA 3GW8A 4IMJB 4P4SB 1P8JA 3GARA 1N8TA 1NJ2A 3KUXA 4HPWA 4EW2A 2NUPB 5I45A 4BFLA 1ISRA 4NLGA 2WC1A 1Y5IA 1U2QA 3U3DA 3RLFA 1M1UA 5DP1A 3SYKA 4GR4A 1X92A 1NC1A 5K0GA 4QC2A 4WZZA 3N7AA 1CRPA 3S7ZA 3PL5A 4HKTA 3KU1A 3JSLA 3OX1A 4EHBA 5H70A 1W6RA 3CU5A 3HPQA 3L4BA 5EJGA 2PMKA 3CMCO 3ADPA 1A9XA 3AF1A 4RVHA 2KPOA 1X7YA 3CXRA 1ZD9A 3GUZA 4L5AA 2P5TB 1RK6A 1TFUA 5HCUA 1TQHA 2XSZD 2CKZB 1T9HA 4GXTA 3JAMA 4MYUA 1X13A 2ZZKA 3ND6A 3WR5A 2VH5R 4LXYA 1JVSA 4DR4H 2R84A 3WLQA 4PZYA 2AZ4A 4AICA 2N42A 1PTKA 2O23A 5D01A 4CUZA 2FMKA 4CL0A 1OLSA 4ZI5A 4LYHA 1JP7A 4OXYA 1GA6A 4RUCA 2D1RA 4XX1A 2OOKA 4M1KA 2C7PA 2GK4A 3N2YA 3NANA 3IDAA 1YK0A 4HBZA 2YCBA 5C5JA 1OBFO 1T2AA 1P73A 2FPIA 5K5EA 1TVCA 2HVQA 1U3VA 2UYOA 3ZKWB 1LGYA 2M6SA 1E8NA 1CQPA 4H3VA 1PJTA 3BQ9A 2OGUA 1JDNA 3VZCA 4K81B 2G70A 3KJHA 4FXOA 3JYNA 2VDOB 4UCWA 4AJ2A 3D8BA 3MW8A 4ZWNA 4EHJA 3SZUA 1XTTA 1DJNA 4MUEA 2WA2A 3SXUA 4JB8A 1TA0A 3VQTA 3FFTA 3UZUA 5H3LA 3Q8PB 1ORHA 1CWUA 4MYRA 1T4GA 1Z7YA 2WPNA 3EEYA 1EKXA 3P94A 1EK0A 2J67A 3HJFA 4DUZB 4FX5A 3DEYX 2NADA 3SQDA 1FMTA 4KO2S 2KHZA 1PQYA 1R0LA 1NMYA 4Y6SA 3A2LA 4JI0B 2QG6A 4CG0A 4PS1A 5JSFA 1Y5RA 1GDTA 3RD5A 5GOTA 1U9JA 3FHJA 4M36A 1DKNA 5AFSA 1N6LA 4YCNA 2Q28A 4B87A 1T3ZA 4ZCRA 3ZIUA 4ZICA 5CXSA 1JX6A 2C2DA 4M7EA 4QTYA 3HHPA 3OQMA 3TYXA 5K8LA 1VBHA 4U2EA 4PLGA 3SLRA 1U2GA 5LXTB 3MWFA 1Y63A 3OIYA 4U2FA 4AKEA 2YS6A 3I73A 3LBIA 2W8BB 4KLNA 1WS6A 1SCAA 4IOMA 4AO8A 3MZ0A 3QVSA 3RCBA 4P0QB 1APBA 4FBGA 2H85A 3C5WP 4K6KA 5JY1A 3MTDA 3EVFA 5BW6B 4ARZA 1NXXA 3D4PA 3GDFA 3OUTA 4S2UA 4UE3S 5I9TA 4TQSA 2OPHA 1RWQA 4EB0A 4ECEA 2AQ8A 5EJIA 1Q1EA 2HJSA 1U0GA 1WLYA 3HB0A 5DHSA 1UZLA 2VQFH 3SWWA 2DPJA 1V11B 1WD7A 2C4KA 5DYGA 2UXDH 2VUMG 4J9PA 3M34A 4HSEA 2ATCA 2RSLA 1G8YA 5G53C 4Y6GB 2YRWA 3TY9A 3F3YA 3DLPX 4I55B 4CMDA 2IYNA 2W2PA 2JAQA 3OURA 2FEPA 3M6MD 1MX5A 4LYDA 3EHDA 3Q5EA 4A1OA 4ZO9A 1PQ4A 3ASVA 4TS1A 1S2DA 1GCUA 2F59A 1ONBA 2BELA 1Q91A 4TLDA 5LOVA 1SQ5A 2IYRA 1A5BB 2Z6AA 4HWGA 2JVJA 1X1SA 4OKSA 3KCQA 1EB9A 2ZQYA 1SC9A 1ZIPA 1P2TA 4QXAA 5E1DA 1YF3A 5B1DA 3S1AA 1VXRA 4WGFA 3T5PA 1Q1NA 2YNMA 4KQ6A 3W6OA 2QYTA 3SYTA 1PG0A 5FA8A 3MOSA 3F7OA 2YCHA 1N2CA 3WVNA 4OX9H 2NAPA 1ML3A 3L0YA 1GADO 1F7UA 3R4VA 3ICCA 3CLUD 4DDWA 5IAEA 3D3EA 5KFFA 3H4BA 3QFCA 1VA5A 3DZHA 2ZEJA 1E2JA 3UMVA 1TZJA 3SFZA 3IJ5A 4RHTA 4EQ6B 3K05A 3PS9A 5CGZA 1H4TA 3FUCA 1PR2A 1R9JA 2XT6A 4YRZA 2VP9A 3I5AA 1W75A 3QF4B 2DT8A 3CHYA 3GFRA 2C28A 4ITUA 3I9LA 1OKKA 1H1LB 3I62A 4TZTA 1JSRA 3MGKA 5CLQA 5IJ9B 5D84A 1A7UA 5SY4A 2IIQA 1ZP6A 2D00A 4RE6A 4EB6A 3KDAA 1DCFA 1F12A 1UBKS 4HUJA 3OP1A 4N5DA 3C43A 3OQPA 2K7FA 2WYWA 1N3IA 3GQBB 2Z3ZA 2ZWPA 3UGQA 1RQ7A 4WOJA 4FYXA 4CIDA 4IF6A 1LBTA 1HNXH 1EJBA 3K9BA 1JQEA 3QNMA 2A9FA 2CVZA 1MZPA 1YHYA 2PS9A 5F7ZA 1G5TA 3FPJA 3O31A 5AM4A 3TFQA 4G0VA 1F5SA 1G8HA 3EXAA 3RUHA 1FRQA 1NFRA 4W5RA 1K83A 1M2FA 3GNSA 3AUXA 4CLDA 3CNHA 2ACKA 2RHTA 2R87A 4DADA 1K06A 1N8KA 5DBHX 3I45A 3GILA 1XKXA 3D4LA 3W79A 2EEZA 1BIFA 3NWPA 4GI1A 3QTBA 1PFGA 1KERA 4OHWA 3H2BA 5ADWA 1A9RA 4FFDA 1M8FA 4PGAA 3FTEA 4EF5A 3FE2A 1FL9A 1ZWKA 2XHZA 2Q6KA 4QPDA 3GN2A 2WTFA 5KKAA 1MZVA 2O2CA 5K7SA 3VYRB 4RA9B 4JJGA 3WYEA 3JAWA 4OHRA 5F23A 5I6DA 1GKKA 5UKDA 1E4OA 4X1YA 2WW8A 4AAYA 4PWYA 1XZIA 1YQ9A 3K0CC 1KOJA 1T13A 1ODSA 2P68A 4FOLA 3VVCA 3ZZTA 1E1KA 2JIOA 1XVLA 5IANA 3VR6A 3A1EA 2IUFA 1NBHA 1JVBA 4WOPA 4F8JA 5HVNA 4L4YA 2OO5C 2NU9A 3GLHE 4GKVA 3DHVA 4F97A 2B98A 4Q43A 4XUCA 5L1LA 3DBRB 1SOWA 1PL6A 3H0GG 2PUFA 5EJMA 1SEVA 2YJTD 3RREA 5JMTA 2Q1YA 1UODA 1KA9H 4FE7A 5B3JC 3EBOA 2XB6A 4PAMA 3DMTA 3ND7A 3FNFA 3QPCA 2XLCA 3X1XA 2I9PA 3QZ8A 1HYGA 3KQQA 3MLBA 2ZRCA 2O2GA 4RX1A 4CM6A 2FWJA 3SKYA 4HNHA 4EW3A 4XEUA 4EOGA 3GAMA 1AGXA 1DS6A 5A6SA 4NK4A 4QTTB 4G89A 5LNK1 4XCXA 4ALJA 1L1FA 2VPZA 1W93A 4JP1A 4AW9A 2FZ5A 5F98A 4P3KA 4EFLA 1FJXA 1H2AS 1N6IA 1YK1A 2ZXEA 3GLGE 3B60A 5EWGA 2FFJA 4JJAA 4ZOEA 1HMYA 4GEGA 1Y1QA 4LXGA 3TWOA 2AXPA 3TM4A 2I2XB 4ZIRA 3CSWA 3U3MA 4MTEA 3H4MA 3HBMA 1PX2A 1U3UA 2O2YA 1XPRA 1IJFA 5K8IA 1W5BA 2YCLA 4HLCA 4F86A 4D6XA 2G8LA 4X8LA 4BNXA 4HHEA 4AP9A 4BNNA 4IDGA 2EJCA 2BGGA 2VYNA 1FDTA 4A6XA 1G3UA 4WNAA 2HPAA 4WFIA 3FKQA 2J3MA 421PA 3NCTA 4PZZA 2XCPA 1G38A 1JIHA 1PWEA 2PE5A 3BILA 5MFZA 1ABBA 4X93A 1SOUA 1OXUA 1AZLA 1ECJA 4KQ9A 5GZ1A 4JUAA 4WN3A 4ZK2A 2Y0EA 1C4OA 4LBVA 3WDKA 3MQ4A 3LA8A 4M9SA 2W6OA 1CHDA 1H85A 2FPWA 2JAXA 1RCTE 2DUJA 3FSEA 3MTEA 4D8XA 1TIPA 4ZEMA 3AEQB 3KOMA 4G0WA 5CLGA 1Z39A 4LJYA 1OREA 3GP5A 3CF0A 4F7DA 5F1PA 4BFXA 3H2KA 3QEOA 3WO1A 3IT1A 2B4TO 5KQGA 2QIPA 1USVA 5B7PA 1KKMA 4LGMA 4RORA 2H1FA 5E95A 3GN1A 1Q50A 1OE0A 4O0LA 2BCJQ 2HF8A 2PTGA 3TQSA 2PCLA 3L0ZA 5KINB 3THYA 1JQKA 1FU4A 3UY4A 4ZVVA 2WK1A 3A9WA 1IN4A 2REQA 3AOEA 1V96A 5JCJD 1FDVA 1F2DA 1C50A 2ZRJA 1R8SA 3NRJA 2GNPA 3WTBA 1JB1A 1JEDA 4IIFA 3V2IA 2B3TA 2ZXFA 3OZFA 5KYTA 3C3AA 3GCDA 1Z07A 2HA3A 1BNCA 3JVIA 5FDFA 5J2UF 5JFGA 2H9IA 1WU7A 3NYWA 4YO7A 1BH6A 3R0VA 1J7KA 3U4QB 3OT1A 3BXHA 5KYUB 3GTOA 4MPDA 3MR6A 3SLGA 2FPGA 2I2CA 4M0MA 1T8SA 4Y1RB 1ORVA 1NG1A 5C7IO 5J43A 2BSQA 3BABA 2J6TA 5DGXA 2ZIXB 4QDTA 3QI2A 3S40A 3CH7A 1R5BA 2ZS8A 2BH2A 3DZDA 2H2IA 2NV6A 1WSBA 2AFIE 4JQSA 2BI8A 4L4ZA 4CIWA 2E4WA 3SBEA 3A0UA 3EMVA 1FFHA 2OK8A 4E5VA 1G42A 1R00A 3UAYA 1SCKA 4N3CA 2I99A 2Y05A 4F3CA 1PYOA 3WFZA 2QTNA 1E63A 2Z2IA 2W48A 1SXJE 2D4HA 1VJ1A 1HEYA 3D4NA 3FIJA 1R4AA 4I9GA 3VHLB 4IFIA 3I01A 3LF2A 4FDMA 3Q0TA 2BR3A 4KHPH 3PC6A 5KFJA 3RWBA 2BONA 1NUAA 1TKBA 1XGKA 1WP4A 3HY6A 1L7AA 3DMFA 3O8BA 2VP2A 1UM8A 5JXWA 3GI1A 2CFTA 2ZUBA 4LE0A 1AKYA 4KIJA 4MR8A 1XAGA 1UDAA 1HWYA 4OLFA 2HQBA 1DEOA 1QIHA 3FROA 4L8YA 4KOEC 3L93A 1MU0A 3HHEA 4JA2A 3FR8A 2IDZA 1EKVA 3KALA 5EIOA 1T1SA 5CDHA 1F1BA 3DUFB 3TW8B 3AGPA 5D1HA 1JPJA 2QYSA 3T35A 3M83A 1XAHA 2NUAA 4P86A 2A9QA 3LHIA 3B9BA 4W9RA 3FPCA 3GVHA 3KQSA 1Z26A 3CKLA 3N76A 1O75A 1P44A 1A2QA 4QDOA 4BFSA 3TD6A 4PANA 4RF5A 2F3QA 3PRYA 1DKLA 3PR3A 3FMFA 4ECWA 2XRYA 4M4SA 4EHLA 1TCBA 3FMPB 1ND6A 2V58A 4Y1FA 1IRIA 3QU9A 2W98A 2VDVE 2MSCB 4BMNA 1VLZA 4LYAA 1L4NA 1MAUA 1RMQA 1PW7A 2OK7A 4DUGA 2BE9A 4JXXA 2FV8A 3EQ9A 3ZVKA 4WBNA 2JG3A 3AQIA 3HB1A 1YR1A 1JIKA 1JG7A 4RVFA 3PNPA 2AMJA 2R1ZA 1D6JA 3A9RA 2AKYA 1TO2E 4MO9A 3PEWA 1E96A 4UCTA 1JRLA 4ZTBA 2D0PB 3JX9A 3N2ZB 3REQB 3AF6A 3C4VA 2JATA 2Y1XA 2QUBA 2VPTA 4MI6A 2Z57A 3FH0A 1TA9A 3M7IA 5HKBA 2B0JA 3WA7A 4DL5A 4DY4A 2O4CA 2XYGA 3O8DA 4WOBA 2XUGA 3TRHA 4GMHA 2QPTA 5DM60 4HR7A 2W0SA 1Q84A 4JJ7A 3NB0A 4NJEA 2BM9A 4F8YA 1GTSA 1PWYE 2WF8A 5JNWA 1BDHA 2E18A 5EKDA 1AN0A 3KO8A 3ONFA 1H9AA 3ABQB 4C06A 1EZZA 3AEKA 3ZCSA 3OJ0A 1J07A 3IPLA 1HL7A 3W90A 3FVQA 4L3OA 3FUUA 5EMMA 4M60A 1L5WA 1IWOA 2DPGA 2ZWIA 4IDNA 2VYVD 4MGHA 3ORQA 3OFND 5L6LB 3KXLA 4QQNA 3KKMA 1W4AA 5FXMA 4JI5B 3QFSA 5FWNA 3ZWWA 1UQRA 5EJFA 4R7RA 2OVBA 2AC7A 1US8A 4DV3H 4L3VA 1E2FA 1G4HA 4A2WA 4KR6A 4B1FA 3RB3A 4FI3F 4NNOA 3JALA 1VMIA 5K6AA 3ONEA 2D1TA 5CNMA 1JU9A 1KI2A 3EZNA 3MT0A 5TF0A 2C29D 4D5GA 1BA3A 4BP9A 4HH0A 1SGWA 2YJ6A 1KOGA 2HN9A 3HV0A 4GPEA 1TF2A 4BVHA 4CM7A 2V9PA 3D1LA 1W34A 4XWWA 1QRDA 4JJZA 3NU1A 1DXQA 4K9RA 2I7XA 4JLOA 5ALHA 3FDSA 2WG2A 4D56A 2DOKA 4QQRA 5IC5A 4ZV9A 4B33A 2G0AA 4LH7A 3ZZ0A 2QM0A 3QXJA 1X19A 4MWEA 3D3JA 1ISFA 4CEIA 1KYVA 2IU6A 1ZLYA 4R2JA 3NC0B 3FJOA 3QXCA 1L5HA 4BQEA 3V8BA 1UPAA 1DEAA 2ECFA 4MWSA 4YALA 1YJQA 2OC9A 2YQZA 1D1SA 3DM9B 3RFFA 4JYCA 3EN0A 2JI6A 3SR4A 5DNDA 2JI9A 4B3IA 2A8YA 4TM8A 4A3MG 4HP8A 4J6FA 2I67A 2HCTA 1VC2A 2OILA 1OSNA 4ZPXA 2ZTMA 5BR7A 2DHEA 1T6XA 5KFIA 3ZNPA 5KTKA 3I2HA 3QXXA 4G5SA 4V0OA 3Q6IA 3IJEB 3FVVA 2BEUA 5DLFA 1FX0A 2R8RA 3HJRA 1KWKA 4CIVA 3EG9A 1W0JD 4O4LB 3SQXA 1QC5B 2QN8A 1LQ2A 2J48A 1Z7WA 2QENA 4CQMA 1RI4A 1UFQA 5H4HA 3LBAA 4KQ2A 4NXMB 2CLSA 3PEVA 1HDOA 2SECE 4W8GA 1KC1A 1WF6A 1QWSA 4TLBA 1GZ5A 4LE2A 5L3QA 4EVRA 1IJBA 1P6XA 1XZCA 1NVEA 5CIWA 4AUNA 3DL2A 1PT5A 3EW9A 2VUUA 2CJYA 4QYXA 1HE8B 2D54A 1ZM7A 4KVGA 3CKMA 4MQLA 2V65A 3UAZA 1GZUA 2IKSA 3NEYA 2W90A 4E7OA 2A3RA 2D62A 3O2SB 1RWVA 1OBVA 3AF3A 3O6VA 4XIFA 4JROA 2VSYA 3M1YA 1CFZA 1N5IA 3FJ1A 3TW4A 5M5BA 2RHLA 4M8KA 3U1VA 3KOXA 4JBYA 3SBXA 1R74A 2DABA 4XX0A 5JQWA 3CUTA 3MRTA 4MNTA 3NBYC 1G16A 5JAPA 5AUNB 4LMBA 1VKNA 3P32A 1N5JA 4KUHA 4LKRA 1N78A 2ZS9A 2VXYA 2GPTA 2RARA 4IRDA 2JAUA 2FDRA 5ALWA 3SDZA 1M0WA 2QL5A 4BMSA 2B9VA 4EZIA 5HWSA 5IH7A 2HPHA 3LQFA 2YOHA 3LQ4A 4FFVA 4KNW