2YZNA

Crystal structure of d-alanine:d-alanine ligase with amppnp from thermus thermophilus hb8.
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
319
structure length
317
Chain Sequence
MRVLLIAGGVSPEHEVSLLSAEGVLRHIPFPTDLAVIAQDGRWLLGEKALTALEAKAAPEGEHPFPPPLSWERYDVVFPLLHGRFGEDGTVQGFLELLGKPYVGAGVAASALCMDKDLSKRVLAQAGVPVVPWVAVRKGEPPVVPFDPPFFVKPANTSVGISRVERFQDLEAALALAFRYDEKAVVEKALSPVRELEVGVLGNVFGEASPVGEVRYEAPFYDYETKYTPGRAELLIPAPLDPGTQETVQELALKAYKVLGVRGMARVDFFLAEGELYLNELNTIPGFTPTSMYPRLFEAGGVAYPELLRRLVELALT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of D-alanine:D-Alanine Ligase with AMPPNP from Thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Ligase
molecule keywords D-alanine-D-alanine ligase
total genus 80
structure length 317
sequence length 319
chains with identical sequence B, C
ec nomenclature ec 6.3.2.4: D-alanine--D-alanine ligase.
pdb deposition date 2007-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01820 Dala_Dala_lig_N D-ala D-ala ligase N-terminus
A PF07478 Dala_Dala_lig_C D-ala D-ala ligase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 2yznA02
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 2yznA03
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2yznA01
1CE8A 5CAEB 3MWDA 4QSHA 2YRXA 1JDEA 2R82A 4O7VA 3MJFA 3BSYA 2CNVA 2YYAA 1GLVA 2NUAB 2V5AA 1KUTA 1GSOA 3V4SA 4DIMA 3K3PA 3N6RA 1A48A 1T36A 3RUPA 5HBRB 2YWVA 4IIJF 2V58A 5CB4F 2R87A 3RV3A 1BXRA 2VR1A 2NPOA 3V4ZA 1AUXA 5DMXA 3BFPA 3DF7A 4O83A 4IHJF 4EGQA 4EABA 1ULZA 4O7RA 1CQJB 5JQGF 1M6VA 1Z2PX 4GGMX 2YS7A 4E4TA 4HNVA 3R9RA 4NYEA 2GQRA 4XZ3B 3RV4A 3WO1A 1Z2NX 1B6SA 4O82A 2YS6A 1DV1A 4MV9A 4O2BF 1DIKA 1GSHA 2ZDGA 3K5IA 2GQSA 5C8YF 3MWEA 3G8DA 3GIDA 3AW8A 2CQYA 4HQ6A 4IZOA 2NU6B 4O7SA 4ZHQF 4MV7A 4ZI7F 1VBGA 1VKZA 2GPSA 3Q2OA 2FPIB 1GSAA 3R5XA 4FU0A 5FNVF 3JRXA 3WO0A 2NU8B 5K2MA 4M99A 3SE7A 4TV8F 1CS0A 1I7NA 2XD4A 3U9SA 5JVLA 1EYZA 4FE2A 4M98A 2FPGB 5GONF 4FFOA 3KAJA 4FFMA 2NU7B 4FFRA 4C5BA 4FFPA 4IWXA 5BMVF 2R7KA 1IOWA 4HR7A 1EZ1A 4O4JF 3OUZA 1GGOA 3OUUA 3R5FA 3HB9A 1M0TA 4O4IF 1KJIA 4FFLA 4YBZB 1A9XA 2I8CA 4ZQIA 2R6FA 1UC8A 4EA9A 3KAKA 1KJ9A 5LXTF 2W6OA 2W6QA 5I47A 1JKJB 2FP4B 4I55F 2J9GA 4EG0A 5J2UF 4YJ3F 4C5CA 1W93A 1CQIB 5IYZF 2VQDA 5JH7F 4M9CA 2IP4A 4ME6A 2X0SA 3HBLA 3U54A 2DZDA 5LA6F 3JZIA 2Z04A 4O86A 3Q1KA 4EA7A 4EGJA 1PK8A 4MV3A 3TIIA 1PX2A 2QK4A 3JRWA 2OLSA 4J6EA 4O7NA 3KALA 2W6ZA 3E5NA 3NUAA 3N8DA 4I4TF 1UC9A 3G8CA 2V59A 2YZLA 1EUDB 2I80A 5C1OA 4YAKB 2R86A 5HV6A 3U55A 2XCLA 2HJWA 2YW2A 4I50F 2SCUB 5KX5F 1Z2OX 2HGSA 1OBGA 2W70A 2QF7A 1B6RA 3TINA 4YJ2F 3VA7A 2R85A 4O81A 5BPHA 2GLTA 5J2TF 3U9TA 1WR2A 4L1KA 4WD3A 1KEEA 1KBLA 4EA8A 3TW6A 4HNUA 2FPPB 4O7ZA 3UFXB 3GLKA 4HNTA 5LP6F 1DV2A 4RZQA 2Z02A 1KJJA 5JVDF 3BG5A 5BPFA 1BNCA 3WNZA 2FB9A 1M0WA 3R23A 3ETHA 3VMMA 4O84A 4MV1A 2GPWA 4C5AA 4XX0B 2PN1A 4DLKA 5CA1F 4O7YA 4IWYA 1IOVA 2W71A 4MV8A 2YZGA 1VBHA 3VPDA 2ZDHA 3BSWA 1C3OA 1E4EA 1KJ8A 4O4LF 5H80A 4M9UA 2W6NA 2DIKA 3TIGA 3BSSA 2R7LA 4TV9F 3ETJA 2WYOA 1EHIA 3QFFA 1W96A 3I12A 1E4EB 1SCUB 2YZMA 4YAJB 5EZYF 3VOTA 2DLNA 4O7WA 5D8DA 3AX6A 4FGRA 2R7MA 2CZGA 3ORRA 3LWBA 2P0AA 1OBDA 3VPBA 1KJQA 4MA5A 2YL2A 3KREA 4MV6A 5LYJF 2W6PA 4ZOLF 2VPQA 2CNUA 3HO8A 2R84A 2YZNA 3VPCA 4XYLB 4WBNF 2PBZA 4O2AF 2VHEA 2I87A 3ORQA 3LP8A 2R7NA 4TUYF 5CA0F 1EUCB 2W6MA 5C1PA 4MA0A 4O4HF 3JZFA 2DWCA 2PVPA 4XYMB 2CNQA 3RFCA 4EAAA 3R5HA 2ZDQA 2C00A 2NU9B 1JDBB 4O7TA 1AUVA 1C30A 1JLLB 4O7LA 5KKNB 4MV4A 1I7LA 5JQWA 4YB8B 4MAMA 4FFNA 5LOVF 4Y8VB 3TQTA 1KC7A 3K5HA 2YRWA
chains in the Genus database with same CATH superfamily
3WK4A 1RYMA 3UHFA 2P2LA 5LLSA 3MOSA 4QHSA 3KT0A 2CC2A 4LSZA 5F64A 1CR1A 3CTPA 3T7RA 1Y3BE 2BY4A 2CY0A 2F17A 2GJ4A 4FZVA 3SI8A 2OXEA 5D5QA 5L1KA 4P4TA 1M8GA 3HM2A 3QKIA 2R7ZA 2HBRA 3BJRA 3H9UA 4R2MA 1YSCA 4B47A 4ETNA 1DOAA 1J5XA 3FCCA 1P2SA 2MR5A 4OHCA 2WYUA 4S2EA 3MTQA 2WWIA 1OWPA 3Q6IA 1BVRA 1WW3A 2B7BA 2BHNA 2H1WA 1KVUA 1QIGA 2NNWB 2RI6A 3CO0S 2ZUTA 2H85A 1DRJA 2Z09A 3AZOA 5HM8A 1CD5A 3B48A 5AXCA 2AG6A 2WUGA 1QYDA 4Q9LA 4D9JA 4F2PA 1Z56C 1GYFA 4IOKA 4R1LA 1E5QA 3AHDA 5EZYA 4IYRA 2Y66A 4OVKA 3NNNA 4H18A 4ANFA 3WYEA 5HYVA 1BGXT 1XT6A 5M29A 3E15A 2V3VA 3SIXA 4U6PA 2PX0A 5LB4A 4CV0A 3UPTA 4IIJF 1YHYA 2QVYX 3HB0A 1L4GA 2VA8A 2O6LA 2VK8A 3I42A 1T10A 1PJSA 4FYHA 4HAOA 4JJ8A 4XPIA 5JDCC 1MJHA 1TJ5A 1ZI6A 3K1AA 2ZB4A 4MLCA 3RV3A 2E3JA 1G20B 1GUDA 2LBPA 3A26A 1G8SA 1KO8A 1LJLA 2B4YA 4Q3LA 1NZFA 3VSBA 2G08A 2OPHA 2Z56A 5AW1A 4YR3A 2JA7A 5LQKA 4F4ZA 2UUCH 1DX9A 2O8VA 5LQUA 1TGYA 1UOOA 4G9BA 3TUIC 1G16A 3M6AA 3I4MG 3JVEA 3QE4A 3EFBA 2RE8A 3GLTA 4INAA 5ENDA 1FNMA 1IDN1 2AZXA 1BXZA 3CLKA 1FLNA 1AY0A 2B8TA 3ZWNA 3L7LA 4Z0NA 1V1RA 5E4JA 4BAZA 1NXSA 2XKAA 3EARA 4RIIA 1G9SA 4RESA 1CR0A 5T6MA 3VR1A 4W9MC 1N2CA 4E5SA 1C0EA 2FW0A 3JS5A 4EG3A 1ES9A 2XITA 5JQGF 4J43A 5A05A 6ABPA 4U0JA 4CQLA 5E9AA 1U63A 2FK1A 4HZGA 2UXDH 1JEQA 3V33A 2QU8A 4QIWE 3CHYA 5KFQA 4CCSA 5KVVA 3QYJA 4JMLA 5F21A 1N1EA 1T3ZA 3S2ZA 4R2KA 3OQIB 2XNHA 1C29B 4FBMA 3MRSA 2YS7A 5A9TA 3CLHA 1C0KA 3WB2A 3E3AA 1O5OA 4MLPA 1J00A 3MAAC 4H9GA 4XD7A 4KXQA 4EYSA 1LCIA 5C8DA 5J23A 4TKUA 5FPQA 2ID7A 2ZTUA 3OIFA 5JPCA 1T2CA 3IUEA 3NU1A 3MM4A 3T5BA 5IYCG 4RUAA 2PUCA 1OX5A 2O52A 1I9CA 1TZKA 1FDUA 2J0UA 5E9QA 2QP3A 5FF9A 2IV2X 1K9VF 1L5OA 3ENZA 4IL5A 1GRNA 4K1XA 3PUKA 4F5ZA 4YV2A 2Q1UA 1U4SA 1V8DA 2MSDB 5DNYB 3BIXA 4CIDA 2NMVA 1MEJA 2I62A 3O75A 4B4WA 3LP5A 4R41A 2G1UA 1YVRA 4BMDA 2LPMA 3E5MA 1XZBA 1YBMA 3BOSA 3CPSA 1C81A 3ELUA 1M1UA 4A73A 3GPIA 2EDAA 4WBXC 4O1IA 3IKJA 3NBUA 3VZPA 1XRRA 2GZ1A 3KQVA 3OTHA 3PD1A 2PL9A 1GQYA 4UQOA 1W581 4R2WA 1K68A 3PJDA 4D2IA 3VH1A 2HB6A 3FTNA 3DCNA 2CHGA 2NAPA 1J0XO 4LF9H 1IPHA 1W76A 2WIAA 1A0OA 1DEHA 3E8XA 1YVPA 3ABOB 1AKEA 2E1PA 4GW3A 2IGBA 4TX1A 1XTJA 3TL6A 5K0BA 4M4SA 2ZREA 1JIIA 2OCPA 2R6R1 3EBOA 4G9GA 1KAQA 2CNWD 3IIMA 4JMPA 4W6QA 5ERXA 5KYKA 1MC5A 1IDOA 1DQNA 1KAGA 2XUGA 4WOCA 3A10A 3MSCA 1P16A 4R8UA 1JEOA 4QGSA 1U7XA 1IRXA 1TYAE 3KYCA 4QWMA 4YH1A 3WISA 3UJHA 3GW8A 4J1SA 4DABA 3UY4A 3ZV7A 4AZTA 2FK2A 6CHYA 5KHOC 4PPGA 3N0XA 2D2XA 5HFAA 1T3SA 3W5BA 3UM9A 2NXNA 4EARA 1UXHA 2VAWA 5JAUA 2BFNA 3E7PA 1YE5A 2GVNA 4Q24A 4QA9A 2QW8A 4P7BA 1DIGA 5HBGA 4FDLA 2Y67A 2E85A 3SIWA 3SHFA 3TQCA 3WYFA 4C0SA 1QGOA 3AEZA 3MMZA 1JKFA 4XIGS 3FKIG 5GONF 5KDDA 1GCIA 2GEVA 3QXGA 5B1HA 3C2QA 3UZOA 3TOZA 1P7ZA 4UFZA 4S1WA 4UMVA 4OLJA 4WLEA 4Z49A 4JT8A 1RJ9B 2GASA 3HE3A 5DCUA 5LKRA 4CIXA 3KYBA 2F4VH 1E9EA 3O3NB 5AKZA 4ER7A 4NH0A 1O97D 4WCFA 2W6JA 4HNRA 3AINA 4N12A 3E35A 3J81W 3NKVA 3VMFA 1VBNA 4CM6A 1S3GA 3QX3A 5IAAA 1C9DB 1LY1A 1T8PA 1K98A 2DPIA 4M2LA 1MB9A 1A9ZA 1QRDA 1TVCA 2GSWA 3IE2A 3IPAA 3RS3A 4DYVA 4B73A 3Q3GE 1IBLB 2XF2A 1U8AA 1GO3E 2PS1A 2R1TB 1ZONA 3WXMA 3PJFA 2CCGA 3IAUA 2AH5A 1UODA 2IE8A 5KQSA 1IY0A 5IK2A 3FOEC 1F3OA 2B4TO 5H82A 1XXHE 4E1AA 5FD5A 1EP2B 3R5SA 1PP4A 2RHLA 2VS1A 3AUSA 4TQ9A 1RDFA 2Q6TA 2R1VB 4MITA 3UGKA 1M7JA 4EB6A 2XXAB 2DGDA 5H59A 3TTSA 2C5FA 4DBLC 4DB4A 1IUKA 5T8KC 3LGAA 4B6RA 4C0LA 4NBLA 3RFXA 1D2CA 1OYWA 3BMNB 3H84A 3U17A 2WILA 2ZYWX 4PIPA 5BQXA 1AZSC 1DHTA 1H5NA 2FPPA 5LNK1 5ADVA 3FMIA 1XHFA 2FP3A 4LV6A 4OMCA 3V8EA 4BUZA 1LX7A 1RPAA 3O4FA 3HYTA 3SC3A 3COYA 4K0RA 2JLWA 1X9IA 4Q4HA 4HV4A 2NT4A 1R6BX 2FQ1A 2FPWA 3ZY5A 1QYXA 4C7XA 3KAKA 1W1WA 2W42A 1NOJA 3ITEA 5LXTF 3BEDA 4TTRA 5K3WA 2PH3A 5G0UA 4NVRA 4LXUA 1ARZA 4EF6A 2PYIA 5KSZA 2TMYA 4CN8A 3AHGA 4RF3A 3U3MA 2XQIA 5CXXA 4UUGA 5J2UF 2XHZA 3OLXA 3BTOA 1SXQA 3CG0A 4DGSA 3JVDA 4WBNB 4WESB 1SIWA 3LX5A 1L4KA 1U3VA 3I61A 4H3KB 1PFUA 2IYQA 5A4JA 5G40A 2IXTA 2DR2A 4OI0A 5AVTA 4AF6A 4JJKA 2AJ8A 2ISSD 4LDNA 1KERA 2JFBA 5B3JC 2HVQA 3AYXB 3QVXA 1YRLA 2ZJ6A 2P67A 1VPVA 4UBJA 3KEQA 1ICEA 1OAKA 1SCIA 3DPIA 4YRGA 5K05A 4LFBB 3RU2A 1S3IA 1ZH6A 3K0KA 2OOKA 5I5EA 4M6WA 1A2QA 4V0LA 1PQ4A 3VZBA 1QTQA 2I33A 3VX3A 5JBNA 4P3KA 3AUJB 4H4EA 3T3GA 1XTVA 4O3MA 4NBKA 5C1DA 2Z6QA 3ID6C 4FHCA 2W8ZA 2QVXX 4BBJA 4EIWA 4YNBA 1JYSA 2PUWA 2FPGA 2YMLA 4B2IA 3QE9Y 2HK6A 3NO4A 3NAQA 4A27A 3DM9B 4DIEA 1Z45A 3MEQA 3HO1A 4K0KB 3FFTA 4RLSA 5JMWA 1GCOA 4LHYA 3IUBA 1J90A 4N6NA 2J5RA 1HGXA 4OFWA 4OP1A 3WLLA 5EJ6A 1TMGE 2CLSA 3MBOA 4GUDA 4IUCS 4AULA 4MI1A 4UZEA 1EK2A 3L9WA 4ZCRA 3ON5A 5IAKA 1UC9A 3G8CA 1JLLA 4LJ8A 1SPXA 5IAGA 1D8TA 3ADKA 2EBUA 3LHSA 5CM0A 2D13A 3P97A 4HG2A 3AOEA 4NU8X 4BBRG 4GYKA 4BIMA 1GU7A 3LY8A 1EVZA 2PT6A 3BQ9A 4J7UA 1DKMA 4DF3A 1PQYA 5KYXB 1GQSA 1II8B 1QGUB 2JFZA 2ZBQA 5DBEX 3QBDA 2NZYA 4GDFA 3KB1A 1Z2EA 2ZBFA 4MPTA 4NJMA 4H7KA 1L0BA 1P5HA 1GGJA 3JWEA 3MJTA 1X1TA 3HM9A 3V42A 2C9BA 4MUEA 3Q9LA 4Q18A 5DBFA 3BN3A 2ZIVB 3PG5A 4PZLA 2J85A 4WZBB 3KQPA 2R5WA 5FTMA 1H93A 4QU0A 4IJWA 1R4NA 1WQ4A 2CMGA 3CJRA 1CZHA 3ENNA 3PBKA 1BN7A 1N7JA 1HNZB 5L3SB 1WHTB 3U1TA 1BEZA 1YB2A 4J9RA 4FR5A 3T1YB 1XTQA 5BR8H 1DIBA 1LQ2A 2WQ6A 3FLMA 1KZ9A 4YO8A 3VI3B 4BHTA 3MTEA 4ZN6A 6PFKA 2IS6A 2HSJA 1IB0A 1Z25A 2FZVA 4UHJA 2PGXA 5LU8A 3HCPA 1NE7A 3LDAA 5EKUA 5FLXW 5K6RA 1CY8A 4XARA 1O58A 1SZPA 3LX6A 3UQYS 1VJRA 5KFOA 1IXSB 4J7XA 4WKCA 5F9HA 1S4MA 1JAIA 1NG1A 2JLCA 4PG5A 1NAIA 3F4KA 1JR3A 4K26A 1EWRA 5BT8A 3Q11A 2IWHA 2OKGA 5BVHB 1B2RA 2WKRA 1GIAA 2ZIAA 4DDHA 4EAQA 1DDOA 1SZDA 3IXQA 3QVGA 3INYA 3DW1X 5C9ZA 2H0QA 3GEIA 4YAOA 4P38A 4NDAA 3H5AA 1BW9B 5FL3A 2B61A 3BQMB 4EB3A 5THQA 1NVTA 2JLVA 4K9SA 1QRRA 3EH2A 1WUTA 1LDYA 2M05A 4HXEB 3UHPA 2AX4A 3EGOA 4ER0A 2XJ9A 3DVSX 4KYIB 1FUIA 2WWYA 3CEBA 3WNZA 3ZZ0A 3H87A 2FB9A 4R6XA 3OTWA 2GM3A 1IN1A 2YWHA 1HE5A 2W37A 3ETHA 1U7HA 2PT9A 1KQNA 4BP1A 2B20A 4EHFA 4ZGBA 5JEDA 1XZFA 5EJ4A 3UA3A 1JZQA 5B7PA 2EJCA 3JQAA 3DAHA 3HVJA 2QVCA 3A3NA 3T41A 3FA2A 2QXYA 3EWSA 5CGZA 4YT8A 1DU4A 4YRTA 3FM9A 1IXYA 4O4JA 3RIHA 3DLTA 4YRZA 3P2IA 5IVIA 3MILA 3F47A 2GD6A 4A8JC 4X7BA 1KSHA 1GAJA 3EZNA 3THXB 3LGSA 1GHTA 2Z95A 3K4HA 1U28C 3ZCRA 1WETA 5IM4A 2A9PA 2YN0A 5HM6A 2P4SA 4NK4A 1ND6A 1RYYA 3GZJA 4FB5A 2HSZA 2G1KA 2QSZA 3WWYA 3QLUA 4MTCA 4EO7A 3W5VA 4OX9H 4ZVKA 2RB5A 4L0QA 1G0NA 3N2IA 2X2PA 3H2ZA 1LW6E 1W5FA 1DZ3A 4K0KH 1CQWA 1XZDA 1AHNA 2VJQA 1ZP6A 4M55A 5FNZA 5C4GB 3UN1A 2G9RA 2V7VA 3VTAA 3ZU6A 1F06A 2ET6A 4DV2H 4KIGA 3I8XA 4KBYA 2VNHA 2Y1CA 2IW1A 1VLVA 1K7XB 2E82A 2IH5A 1JJAA 3PKIA 4O3FA 1OAOC 4ILEA 4JU9A 5GOTA 3EPGA 1TAUA 2AB0A 4WK0B 3LOPA 2XAUA 1OLXB 2FPXA 4ODIA 1SQ0A 3TMYA 4E5UA 4EUKA 5AW8A 1MVOA 4HGYA 2QZ4A 3HVUA 3DBVO 4LE1A 3U40A 1GKIA 1RMTA 1L1FA 3ED1A 4X54A 2VPZA 2G0AA 4UBKA 2HDHA 3MGBA 4CCYB 1X7HA 5JSYA 5TGDA 3GMDA 3WGLA 4BGDA 2J8ZA 1BQ4A 3CGGA 3D0KA 3HOZG 1JYFA 2Q2TA 2GHTA 3GEMA 2UYOA 1DAAA 2BCEA 3QVGB 3RCBA 1NLUA 4IHJB 1XPOA 1D2GA 3CN7A 4ESHA 4OREX 4WA7A 3RIGA 5LA6A 2QVBA 4B5KA 1B0ZA 1V2GA 3PRYA 4TWZA 2GK6A 1HWYA 3KTDA 5J43A 3JQFC 3FHOA 1ECBA 3IDAA 2FFRA 3M7IA 4LTNA 5JNSA 1CJCA 1EQAA 5I9MA 2LUOA 2RI0A 1FFSA 1ZK2A 2BKXA 1PFWA 3M82A 1DX4A 2V6JA 4DSUA 2QR2A 3ORFA 3EW7A 1W36D 4BGEA 1LNZA 3IODA 1KI6B 1U0FA 1RWOA 1U2EA 2X2FA 5CH8A 3P26A 4IDDA 3A2LA 4QGHA 3GRVA 4OA8A 1ISRA 1X2BA 2QLJA 2YHUA 3WY9A 4G5YA 3ORQA 1JBEA 1L9KA 3JQEA 2R7NA 3FOBA 3NI2A 2A5DA 4GKAA 1PR3A 4MGZR 4ROTA 5BN5A 2QM0A 1CEEA 2NM0A 3EXIB 2P91A 2A2ZA 1J39A 3PHGA 3UKJA 1G7SA 1ML3A 1QZXA 4Y2QA 1TE2A 1DSSG 2VYVD 4J3NA 4DM7A 3VRHA 4QD3A 1YBAA 2NSJA 1L7MA 2Y1WA 1NFFA 2G88A 4BNTA 2FE3A 1CDOA 5LMUB 2H63A 1FJGH 1QO0A 4O2BB 2CYBA 5FR9A 5AJTA 5DBGA 6NULA 4B3DA 5JDCA 3EOZA 3TBHA 3CPHA 1P45A 5CUQA 1DTWB 5FEUA 1E8NA 4N5DA 4N3BA 1E6LA 1YJBA 1K7FB 1QP8A 2PMKA 2YIVX 1DXYA 1HOTA 1NKTA 3V4LA 3SZGA 5FWXB 4EPYA 4MYRA 2IHNA 3JYNA 4GD3Q 3PFBA 2UYGA 3AESB 2PZGA 4UM9D 2KBEA 3E8SA 5HFNA 3T38A 4F71A 1SKYE 2BR5A 1OYVA 3OX1A 1JSXA 2GN2A 4AJHA 3NAMA 4Q3KA 4Q34A 4DOMA 3BB1A 1C0LA 2JGEA 4ZJPA 3GLGE 4QM6A 2C3UA 2V74B 3GC6A 2X8JA 3KYDB 4WNAB 2BEVA 3TLAA 1HTBA 5EWJA 2UZ0A 3H13A 1MO2A 5SV2A 5I7UA 4RF4A 2OV1A 4QSHA 2ZWVA 5JE8A 1Q3KA 3HCRA 3M5PA 4Q03A 2XHEA 4ARZB 2WZDA 4LBWA 4IV8A 4JI5H 4IH9A 3DE0X 4J76A 1PJBA 4ZOAA 2CNVA 1QUEA 2VRCD 1P72A 3RJMA 3SIPA 1VCNA 4DQVA 4KFCA 4KWEA 2YYAA 1TF2A 3BGVA 4KX3A 2EZ4A 5DM1A 4BB0A 3HJRA 2HLPA 2PGNA 2VSXA 3A1UA 3ZJUA 1ORIA 2OR3A 3EGIA 3NBMA 4KBGA 3ELWA 3RFVA 3TQSA 1ILEA 3V4VB 3CX8A 4EG6A 5NLLA 1BMDA 5ESDA 3VTKA 1ORHA 2YDXA 3V4SA 1RM5A 2IVZA 1W0JA 5DNAA 3H86A 1D03A 2Q6LA 4GMHA 4FMDB 4Q39A 2VNJA 2WU3A 3IULA 1CUUA 3V8MA 1V1RB 2XCQA 4QOIA 3TOVA 1FXSA 2Q5QA 1GNPA 2YV4A 3PXBA 4WDRA 4AG6A 4B43A 4BDSA 3UYKA 1BXRA 1V5EA 4I3GA 2HF8A 1BMFA 3ABRB 4TVBA 4XYBA 2ZYSA 3GIIA 4MRMB 3BGSA 4DKJA 3TTTA 1GLGA 4ECEA 1J8DA 1N57A 1NBEA 2J1LA 3DXZA 5JJLA 1JJIA 3QVTA 3NHFA 4I55A 4AZ3B 2NZ8A 3BFPA 4WFQA 3RIYA 2ZIEA 5EE3A 2AK3A 2ZIUB 3IRUA 1ND5A 5NULA 5KNCA 2ENWA 1D2HA 1DNPA 4UXHA 4EHJA 2X0IA 4Q1DA 1A9XB 1WSCA 4PO8A 4S04A 4O7RA 3ZLUA 4PLCA 4JSTA 3S7ZA 5ICGA 2QI9F 3KYIB 3MG9A 2C8JA 3RABA 4GM0A 4MNTA 1X7XB 4U8HA 2W6CX 4I1SA 1L5NA 2WIDA 1YMVA 4WKPA 5DYTA 2QQGA 5LSAA 2Q3DA 3JZMA 1Z88A 3SXPA 5ERYA 4KC0A 2FRDA 5TGTA 1ZCBA 5J40A 1IJEA 2BUBA 3CLRD 3JQBA 3H2BA 2QTCA 4J75A 2TSYB 1QVZA 4GL4A 2Y0SE 2OO5C 1U99A 2ODNA 1SEPA 4IFIA 5FL7A 3WMXA 3ROPA 2D00A 3F9CA 3T7IA 4WN9A 1F7UA 2ZETA 5KG4A 1S4QA 2NXJA 1TU4A 2VF7A 2FPLA 1T0IA 4IGFA 1L6RA 4Y67A 5KYUA 2QXTA 5JC8A 4TRRA 1IE3A 4O2BF 3MR6A 1HT3A 2WPDD 3TE7A 2CFRA 1ONNA 3WWDA 4R7ZA 3FZYA 5CJ2A 1V1JA 4N3NA 2CNNA 5CTAA 4EBCA 3TOCA 2X1MA 4ZVSA 3AW8A 1SXJB 3MUOA 5BQPA 5T5QA 3TFWA 4Q37A 2NVOA 3ONFA 4ZO4A 1U1EA 1W8DA 1WP4A 2H59A 2O2JA 4FKZA 3COVA 5A0TA 4TVOA 1BAPA 2ZRHA 3GA0A 5JJ5A 3NVAA 5CLHA 1O5TA 1PT7A 4HQ6A 3CB4A 3EY4A 3AV0B 2DT8A 2DHDA 4R40A 3UK2A 1Y3AA 4EPTA 1ZR4A 3BAFA 2ETVA 4G84A 1N48A 5IP9G 3FDFA 4D8VA 3DNMA 2D5BA 4RGYA 2LD4A 4MV7A 1XJ0A 5FBWB 4AURA 4ZEOA 1JH9A 1B73A 4PX3A 3H19A 2BFDA 3GN2A 5A9RA 1CW2B 1Z4MA 1AGYA 1NPTO 3V2HA 1IM2A 3C24A 2GCOB 4NEHB 2PVCA 3O4IA 4GWLA 5AOVA 1IXKA 3OZWA 4US2R 3H9EO 5CLLA 1H2XA 8GPBA 1J33A 4WK4B 1OCEA 2BCGY 3ENVA 2CUTA 3S2UA 3WO0A 1F7VA 4JAVC 4BP8A 3AT1A 4JI4B 3EODA 3K2QA 3M1YA 5FOSA 3SBEA 4ZYTA 3KZOA 5I7HA 4Y2HA 1COZA 2P4UA 3KHSA 1G5IA 2JK0A 4RD1A 3B1WA 1AGRA 2CXXA 2ID4A 2E4YA 2QL6A 3B78A 4HEQA 4HQFA 2ZRPA 4IEEA 2CCKA 2G63A 3LQ4A 4P32A 4OATA 2WNSA 4PYKA 4XUDA 3E70C 8LDHA 1XLTA 3DBLA 4B3BA 5IVPA 3JD4A 3UT5B 4D6PA 4I36A 4MI6A 2AR9A 4XR4A 1E96A 3T6KA 5EJGA 2FPGB 1NVBA 1S7GA 3RVPA 2J3JA 3TZLA 4RGBA 4WLNA 1VIYA 1PBNA 3KVNA 1OVMA 5DHRA 3KAJA 2EYUA 2GBCA 2JAQA 3WA6A 5L95A 3BERA 2Q5EA 4JV5H 2GZ2A 4FFRA 4EWLA 1M5RA 4C5BA 4AJOA 3TW7A 5EHGA 5CIYA 1KMIY 2ATCA 3CZ4A 2WRZA 3KE8A 1DHRA 1K8QA 4JX8A 4LG1A 5F2NA 3M3HA 1KDOA 2B30A 5EZ6B 3L07A 4R5MA 4YP5A 5EGSA 4DMHA 3PUIA 4PU0A 4CKCB 1T8YA 2WKWA 4MICA 3ZE2B 2EIHA 3T1NA 1CP3A 1IPFA 3QYPA 4HNSA 1Z4LA 1CIVA 1E2BA 3RYHB 2DPXA 1AQNA 4G1FA 5T41A 4URUR 4B3JA 4HB0A 3F2IA 2VQFB 1NWCA 1A7UA 4MVJM 4ALJA 2O2ZA 2E7ZA 1QDEA 3GARA 5ELMA 1WXIA 3FOZA 2VDLB 3A3KA 2OOSA 3G1UA 4QTZA 3QU4A 1L5MA 2GKSA 3RTXA 1CZOA 2Q99A 4O29A 4ARAA 5ITZB 2FLKA 5H7XA 1WSDA 4R8RA 1E2QA 3T3EA 3SKVA 4P0PB 1XK5A 4M37A 5HQ3A 1EFDN 5E3JA 1V71A 4A0QA 2XT9A 4KUEA 1GU0A 4YRAA 5KQMA 4HLUC 5FEMA 3WJ7A 3KQHA 1G5RA 2ZIXA 1G3MA 2C4TA 1S2OA 3Q40A 3IAM6 4DGQA 2UVVA 3NC0C 4MI3A 2P5SA 3VR2A 5IJ0B 2QN7A 3RS0A 4JI1H 1Y3DE 5HIIA 1PHPA 2P9JA 4BCDA 3VJRA 1ADYA 3U3RA 3E22B 1NVFA 3P2OA 4HDRB 4BO9A 4O3PA 2GFQA 3KHHA 5LWHA 1XRLA 2VWHA 3PHHA 1HE2A 2NG1A 3TMKA 5C5EA 4EH1A 4EGSA 2QPLA 4A2CA 2J09A 3VKVA 3AVOA 2IYAA 2ZAYA 3A4VA 3GH1A 5U9CA 3JQ8B 4FNMA 3QZ8A 1H3NA 1ZVQA 1EE1A 1DFIA 1MFPA 2R25B 1X1QA 3WJAA 3JTEA 2LKDA 2PTHA 3PR5B 2GARA 4IHAA 1HUQA 1QYWA 4LHZA 3NX4A 3ZHBA 3BXGA 4J49A 4IUYA 4DMMA 4OD0A 4EY4A 1DUVG 1HYHA 2Q1TA 3ZZUA 3QM1A 1QR2A 3K6JA 3CEAA 4DV5B 2BF4A 1ZOLA 1VJCA 1JDVA 3A0RB 4WUVA 2WG2A 2N1BA 2WMYA 3CUUA 4JYMA 4LNAA 4PVCA 1C7IA 2P2YA 4OQFA 3S6JA 4H6XA 3N59A 4DLVA 3K0CA 9LDTA 1GM5A 2F4NA 1PK8A 4P3PA 3A7DA 1BDJA 3TIIA 3KKEA 1W35A 1XL1A 3EULA 1M2JA 1RWXA 1Y89A 2VDWB 2VPPA 1JAZA 5ADHA 5FOWA 1FRNA 2JANA 2QDKA 4GP6A 1MGPA 3GH3A 4Q4HB 2WT9A 4LCEA 2W8LA 1D4ZA 4UHHA 4OHYA 1JHPA 1ZESA 3ONVA 4HDCA 3NOVA 5EMNA 1TU3A 2YUIA 4G4IA 5A4DA 4C4TA 1LD3A 2C3MA 2PZKA 2VJMA 1RHJA 4M46A 2QL9A 4GXTA 1G3IA 2VT7A 4RSRA 3RJ0A 1GG9A 4I9GA 2VJYA 4JN6B 4LDPA 3ICOA 3WHLA 4BFVA 1U0TA 4GSLA 1DLJA 4PONA 4OHBA 4BXOB 2FH5B 3WYNA 4HB4A 4R84A 1CY2A 1S2LA 4DEXA 1KSFX 3RKRA 5IU6A 1B8PA 2OFOA 1P8JA 2WHYA 2FZ4A 2O5RA 2PIAA 2YQ4A 3CINA 3DQZA 4KFTA 5FQOA 4BZZA 2ENUA 2PLNA 3BRCA 5F5NA 1SQFA 3U0BA 2O2EA 4JLVA 4MW4A 5GP1A 5H4GA 3PLAE 2R92A 3SHTA 3B52X 3QFTA 1A5BB 3MTAA 4UUOA 4LY0A 4PZPA 2J5QA 2CUNA 3DZGA 4LSWA 1P61B 4ALLA 2CXOA 3GJYA 3S8MA 4I4TB 3O8LA 4RNOA 2BM0A 3BULA 3FIJA 2QX4A 3P20A 3QQPA 4OBWA 2QYHA 4QQRA 1GWNA 5EUCA 1Z6YA 1H1LB 2KE5A 1I1LA 1WPGA 3CH7A 4CR7A 3W3AA 2YY6A 3GJ3A 4Q02A 3OSUA 4CCWA 3CLSC 2P2CA 4JC8A 3H99A 4CQLB 2Z8YM 2AGOA 3HVRA 3KM0A 3NUZA 4WBSA 4YV7A 5KG7A 1AQ6A 1FF9A 1HFKA 3B6IA 3QOFA 4CFSA 4Q66C 4M1KA 4YJ2F 2X6RA 2C28A 1CS4C 1WXWA 1Y1QA 1D6SA 2W57A 3GFFA 1Y1VG 5AK0A 4QG3A 3OE4A 5AOBA 4IM7A 3RUDA 1UNNC 4GLBA 4M1QA 2AZDA 1FNBA 2V6BA 4R1QA 5HUJA 4PCUA 4OMDA 3O84A 4FM9A 1QHGA 4WD3A 1XAHA 2OM6A 2JVIA 3MWYW 3JALA 4B3SH 2KM1A 3N7UA 2JGJA 4QULA 1IULA 1UPCA 2RIRA 2H52A 2ODAA 2R5FA 3N05A 4UARA 1UFQA 2HRCA 3KDAA 5KI6A 3N3BC 1EXVA 1DMSA 3GP3A 4Y6PA 4KLRA 4MW0A 3PDIA 3R3VA 2NYRA 4LNHA 4R1OA 3ANXA 4W8OA 4X1KB 3OD5A 3BM5A 4EYGA 4C3ZA 4I5EA 3FSRA 3AETB 3T1YH 3TTUA 1E63A 3W5JA 5JQGB 1Q92A 1PWEA 4K9OA 2Q07A 2CXPA 2Z02A 4EYIB 4MJXA 3ZS8A 2EFJA 3WNDA 4YQFA 2ASEA 4CIWA 1MA0A 4ED1A 3GRKA 2NAFA 3QE2A 4YT2A 1HURA 4UHFA 5AK6A 3BIWA 3DOEA 4ZPJA 4E03A 2N1MA 3CRZA 1YBFA 1ZM9A 2JD1A 1TA0A 3LDUA 5AI9A 3ZVLA 3BJMA 2GPWA 1G5TA 2CW8A 4LMYA 4QUJA 2ZWOA 5LOVA 2WF9A 1S3FA 2PE5A 3JSNA 3KTMA 3MFQA 1QQBA 3BJZA 4JI0B 1PDVA 2IK8A 4RB1A 4KPFC 1ECFA 4B74A 3UWDA 1L5QA 3R9IA 4BBPA 4BWYA 2Z5VA 3K1AB 3G6YA 1ZA1A 3GTKA 2DUUA 3QSYA 4MV8A 3W6ZA 2IMWP 3GLGA 1QH0A 2R68A 2G07A 2QG6A 3DWGA 5D01A 3EA5A 3OEYA 1P0QA 2IYUA 1GVHA 2MSWA 3BK1A 3VZRA 3IQFA 5KYNA 1YAJA 1YBHA 1H8EA 3TKYA 1RFLA 1RI1A 2AJTA 4MKRA 2OCDA 1AKRA 2WIKA 4MWGA 1ZEMA 2F6RA 3A9WA 1CF9A 4M9UA 2FGKA 2XUAA 2KBFA 1Z29A 4QWCA 2DIKA 1BN6A 2E49A 3IOCA 3LLUA 4PG6A 5ALTA 4V0SA 5DN6A 2AG0A 2AOWA 3S27A 2PMWB 3UH0A 1XNJA 4CMIB 3RVDA 5AHRA 1CKNB 3QTLA 4XXHA 2H31A 4INOA 1MR3F 3NOQA 4NECA 5FPOA 1Y9DA 1TIKA 1DC8A 1P29A 3AHHA 4KQIA 4C7OA 1N33H 1KBQA 2WFAA 3JZ6A 1I2CA 2FPUA 1NUPA 4LVUA 4LYYA 1HNNA 4Y98A 3W8DA 1EBUA 2NVXA 2RFLA 4X1IA 4EX7A 4HSGA 3T3DA 4PLFA 4I14A 5EKTA 4OM7A 3GD5A 4KO2S 1WSWA 1WDMA 4H7JA 5F1OA 4KV7A 2Y1FA 4RK5A 3REGA 1NA5A 1YL5A 1V37A 3LBFA 2A9OA 2WU4A 4DAOA 2I4OA 1AGXA 1E2DA 3VNQA 4EI7A 2LR0A 3FI9A 2VLBA 5DIFA 3NOXA 3CLTD 3FPGA 4C4YA 4EUEA 4R2HA 2D54A 1PVVA 3LULA 3KP1A 3HB5X 3R7FA 1OBDA 2F67A 1ZY2A 1ULSA 2I0FA 4J90A 2SCUA 3GLHA 3BREA 5KX5A 3T7AA 3EIXA 4B7ZA 5IBRA 3ENKA 3M33A 4M36A 5KVQA 4QXQA 4DJDC 5A1JA 1QRTA 1NLFA 4B79A 2IKSA 2O7VA 4JQCA 3RIXA 4NDNE 4FLMA 4YUVA 3OOEA 4CPDA 2W6PA 2O7SA 3JYHA 3I9KA 3ZU5A 3UG7A 1PVDA 4ZYUA 3EDMA 5C4IA 3T99A 2REBA 3NG1A 4XFDA 2OAEA 4NCBA 2WMOB 3ESCA 2QD4A 1K08A 5LBUA 1ACMA 4QM7A 4YY3H 1CULC 2CUZA 4Y1RA 1OYYA 1PJRA 1HMYA 2GMWA 1D7OA 3AJ9A 1NYQA 3HI4A 4O0MA 5CNKA 1R4ZA 3ZTWA 2BMWA 1ZRNA 3LP8A 1XZEA 4RXTA 3E2PA 4P35A 5HXAA 1Y8ZA 3NDBB 4EHDA 2H16A 2PD3A 4RH0A 2EU8A 2ANCA 5JCPA 3AL0C 2F4VB 1DZIA 3T4UA 3QF7A 2C22A 4E14A 1Z6XA 4JUZA 3B6MA 2LTAA 3I8SA 2PVPA 1CUZA 3PGXA 3QEJA 4G5XA 4AN0A 2NSHA 1ODFA 2CNQA 1WF3A 2EJBA 3LBAA 3WAGA 2XUQA 1BX0A 4C1NA 3UAGA 1JHYA 1FU7A 3AF4A 1W5EA 2JFUA 2PG3A 1SY7A 4XWTA 2GXSA 2XNCA 5BV0A 1L4YA 4CMBA 5IUNC 1TVKA 4NFLA 3T7TA 4DR3H 1NUQA 5CB8A 5BUSA 3Q7EA 1Y8QB 1LVGA 1RC8A 1PFGA 1AA6A 3P45A 3JWIA 1DXOA 2FEPA 1S8AA 1XYYA 1BE1A 1AUVA 3R3ZA 1AHIA 3GCGA 1JQ5A 1ZJYA 3CX4A 4KXVA 1HYBA 4RPJA 2C5EA 3S0JA 3L84A 2IBTA 2IDZA 3F3MA 4EO4A 1LX6A 3DOHA 1UBGA 1POWA 1UDBA 4J9OA 1FFGA 2NLOA 2PUJA 4ND4A 1SELA 4FR2A 2QZ9A 3BDAA 2BFWA 3JSXA 5AUNB 3IMKA 3T3HA 3VAYA 3C3BA 3QTBA 3OQOA 1R10A 4P84A 4RVSA 2O0KA 4BN0A 2BE9A 1CU1A 4KREA 1XN1A 1EFLA 2NPFA 1KEWA 2JIDA 4EDFA 4RMGA 1CUEA 3SEQA 1YNOA 1YR3A 4KQKA 1PUJA 1D2NA 2EG5A 3AQ4A 4O7VA 4I2VA 4ZKEA 2ZSAA 1PYDA 3MWKA 3BSYA 5AM1A 4LF9B 1VCOA 1UJBA 1T6BY 2P7HA 4LQCA 2A5LA 2CXQA 1K8ZB 3AIIA 4EMUA 5LYJA 1Z3IX 4DR1H 3KDPA 4XQCA 1EFCA 3K0FA 3K6SB 2DPJA 1SCQA 1OIXA 3QWAA 3PC4A 5CA1A 2G9NA 4MTLA 1H0KA 4UXJA 1XCBA 3LUPA 4WAUA 5U1PA 2HSWA 4IINA 4XCXA 1E9RA 2V1XA 3DKVA 3OSZA 5GIPE 3IJ5A 1JF8A 3RUPA 4L4ZA 2QV0A 4YCBA 1OH5A 1DRUA 3OZUA 1KTIA 2ISQA 4YJGB 4ILKA 5CT6A 2OWEA 1CVRA 3GXOA 2YZKA 2W2KA 2PV0A 4S2UA 2DMRA 2ZCUA 3I39X 2J59A 1E3IA 3OQNA 2EIXA 2AEEA 3QUSA 1WS6A 5JALA 1S97A 4IQFA 2NX2A 2ZTLA 1BXGA 4OYLA 2FOIA 5KU7A 1XQWA 5LL6b 3HWX1 3IT0A 3SHWA 3FTPA 5KSWB 1EBFA 2NPOA 2QMHA 3HUTA 2WOJA 4LJ4A 2E87A 2Z3WA 1J5PA 2NTNA 3B8HA 3DBLB 2OHGA 3H3FA 5JXJA 1E2PA 2VRNA 1ZYUA 1EJBA 1OA1A 1MFZA 4QBFA 4RY0A 4RCNA 4NPAA 4IHJF 2OP0A 2PBFA 5F1YA 4AP5A 3RSLA 1RYBA 1K7CA 1ICIA 2VF5X 3A1TA 3AH8A 4GVLA 2XOKA 1ULZA 4YBZA 3IERA 4LVCA 2O8CB 5KQRA 1PJAA 1M1ZA 2H48A 3D3NA 5K8IA 2QTHA 4CM7A 3L0ZA 5LLDA 3LHDA 3VHRA 1N8NA 4S0XA 3SF0A 2WB1E 3QVOA 2AZTA 2CSUA 4KV9A 1GQ2A 4A36A 3UWKA 2D1SA 4I1RA 2MJLA 2COGA 3PPVA 4JI6B 3KPVA 1I3QA 3GJXB 1P80A 1DELA 2G25A 3O4VA 5AOAA 2V7BA 5JO9A 4QW9A 3OIWA 3I8OA 1UT8A 2QJOA 4UQPA 1U9ZA 3C8HA 2XNKA 2P9GA 2HC9A 4N8DA 5L7TA 3WO1A 4FUTA 5IZCA 1OXSC 2JHAA 2ZGVA 5JCJA 1NVMB 1UDWA 1ZITA 3MQFA 5THKA 1QWSA 2P69A 4FW9A 5CAEA 5IJ9B 1ZU5A 2NVWA 4FKMA 3SJ7A 4OGFA 3WLKX 1JNYA 2P5UA 3KAQA 2PQMA 1QFXA 2ETXA 1N2SA 3DPSA 1ST2A 2VHTA 2TMKA 1Y5RA 4OI4A 1ENPA 2O8BA 1WKCA 2BLLA 3OBBA 1SU4A 2X2OA 4O33A 1UBMS 2H8GA 4JELA 2Y4OA 4ZTZB 1NXWA 5KFFA 2QD1A 2FZ5A 4BNDB 3SYRA 5HTKA 4NAHA 1P2GA 1HDCA 1ZK3A 2I4LA 5IHXA 2JA5G 2C94A 4IGKA 2BP7B 3L6BA 4YBRA 1SFRA 2XE6A 3O4JA 1OB2A 1CT9A 3FOFC 3IQGX 1A1SA 4NV0A 3GTPA 2WINI 3Q6NA 4BV9A 4ZI7F 4DCNA 4ID3A 5IG2A 1LQTA 4JUBA 4LFAH 4YJGA 4DCPA 2FPOA 4LZWA 3VSDA 1NOIA 4FIDA 4D9IA 5J5CA 3UZUA 1PR5A 5B30A 4W5NA 1FFXA 4GMXA 1RQ7A 4DJAA 1QBKC 121PA 1OQAA 1P62B 4F97A 5HJ7A 4IOJA 3EZ9A 4OH1A 4XLLA 1H23A 5KS2A 1CEXA 4ED9A 4OH7A 4QYXA 2ZB2A 2VBIA 3FDZA 3ETDA 5DCLA 1EMDA 3HP1A 1JEEA 3RSFA 4Y2JA 4X64H 3ZKWB 4C0BA 1MJ5A 4TV9A 1NYLA 2FG7C 1C9MA 3DAOA 3TLKA 3W9BA 2DH5A 4F8YA 2GXUA 2P4EA 5KFLA 5EJ5A 4J0QA 3G0BA 4D9KA 3OZEA 1A3GA 1P6UA 1WV1A 2XYQA 1YQEA 2CWWA 3AHFA 4FMCB 3TD6A 4BVLA 3WWHA 2FJUA 4F4WA 4RHFA 3CVVA 2XC9A 1ADGA 4DQDA 2JD0A 2AOVA 1EK1A 2ZAIA 4A10A 2X86A 1WCWA 3AR2A 3H1FA 2XNSA 1OV6A 4WINA 4HEA1 1XCMA 2NU7B 4EJSA 2CFCA 2C35B 5IC6A 1OWNA 4WNAA 4CKWB 3IXLA 1QB8A 3JWJA 4KL8S 1QGZA 1C8KA 2EJVA 3MTBA 3OOWA 4XJTA 3R7SA 4YR9A 3QE0A 3MT7A 5JC1A 4OQYA 2PFSA 4DCUA 1KJNA 2A9RA 3PX2A 2OH2A 1FB5A 1O03A 4HPXB 5DGXA 5AUOB 3A1VA 1WSAA 5LQNA 4ZTUB 1J9ZA 3OUZA 5LMZA 3FLAA 1W0JD 3Q8KA 3PKJA 1KDRA 1Y4ZA 2OBXA 3UPDA 4I4LA 1QQAA 1JRLA 4TWAA 1PO7A 5F33A 3G0HA 3TTWA 4G0UA 1T4DA 2Q8PA 1IEVA 1W9MA 3D4LA 4KQ6A 1NN5A 3HB9A 1MBZA 3GFVA 5EESA 5C3UA 1GSIA 3ZQKA 1VCMA 2OBFA 1V16A 4DCJA 2JGRA 4OHRA 2HK7A 5BWVA 2GUWA 1YQUA 2GD2A 4L08A 4JZKA 4EUNA 5LDDC 3UW1A 2KSWA 2XMSA 3DDWA 1R8SA 2WSYB 3BDIA 4G23A 1CS0B 1BWQA 2ADOA 2GN8A 1PZMA 1C14A 2RHBA 5AOCA 1PSWA 4EY7A 4NAVA 2I7VA 3O8QA 2PFKA 5I4BA 1WUYA 2OILA 3GUCA 1LNSA 2G5PA 2NNLD 4W5WA 2ZIFA 5G0VA 4RFSB 4D96A 3A1WA 4J8PA 1OBVA 3ZS9A 1QGDA 3OFSA 1E9FA 1ZLXA 2CD7A 4HQRA 2A5JA 4TKZA 4MKGA 1VIAA 2J07A 2YJTD 1YRQA 3HDYA 3LQQA 1EHYA 1X42A 2CVPA 3QLVC 3E9DA 4GEKA 5ECWA 3SSOA 2FSHA 1AMNA 4BNUA 5KWSA 3B2QA 3VOAA 1UPFA 1VG8A 4XQ9A 2ORVA 1N9GB 4KRFA 4RMIA 4WKNA 7YASA 1QV7A 2PH7A 3ASVA 1RYHA 2HBQA 2FPMA 4K87A 4DL2A 1AKMA 2V0CA 2RHMA 3G0CA 3HGTA 5HG0A 5A04A 1VRVA 5E7MA 3N58A 1DJOA 5KSPA 1MRSA 1JPJA 1PBTA 3SHOA 4DMKA 2HHFA 3QPWA 4NQZA 1FYWA 4LDRA 3I2HA 6Q21A 4IJKA 4K9KA 5C5CA 2GAAA 1YQQA 2AMFA 2QXUA 3E9MA 4Q15A 2ORIA 3Q1KA 1JG3A 2GVDC 4XUGB 1O54A 1QP4A 4L0CA 1ZN7A 3KJEA 3GFTA 4RVOA 2A14A 3FTDA 4GWGA 1NNEA 2JLQA 5BRNA 4X90A 2H4ZA 3KL4A 4J1QA 3VO1A 4DPMA 4RW0A 4ZALA 2M1XA 3I01M 3O31A 3I04A 4L74A 2D0PB 4Z4QA 1XDWA 1MC8A 1O8BA 2JJ2D 3EMVA 4U4AA 3EB9A 1NBMA 4C9BA 1N6LA 3ZHZA 1Q95A 2A6PA 4MINA 2RGUA 3F78A 3OSNA 5DHTA 1IU9A 1O5IA 4QXMA 3HC7A 5K2OA 3KXIA 4WZAE 4JBYA 2ZKIA 4LSXA 4B4UA 1Z16A 3KJGA 3PR3A 1UQRA 2JKZA 3CW9A 1J42A 4GRIA 2EW1A 3D4PA 1H1LA 4C1BA 4NE2A 4FE4A 1W5BA 1M1NA 2VXOA 4E1BA 1JL3A 3N7TA 4J0HA 1L5HB 3K5WA 5JNUA 4HLQB 3DYIA 5DF1A 3FCUB 1JT9A 4ZAWA 3QEAZ 2I80A 1H4TA 1HETA 1JR3E 3QEOA 1ADBA 4IH1A 2F00A 4Z86A 5HV6A 3ABQB 4OUDA 3ZXUB 2BFDB 3FGPA 1Y48E 4J3FA 2WTEA 4L9SA 5IYDG 4RD2A 3BA1A 4IDBA 4LIPD 3RTBA 3KUCA 3IR5A 4W99A 3IVAA 1P7VA 3MGGA 1NNSA 5ETJA 5JISA 2XRMA 1FW6A 3L05A 3NBKA 5FULA 3Q0IA 1DC7A 4QJ4A 3EIUA 5KFCA 4HZUB 1XKTA 1XL0A 2G71A 1E98A 2PK3A 3MTGA 2R93A 3HXPA 4UM5A 5H81A 1B6RA 2BAGA 2JGKA 4NJMB 2OM2A 2IWRA 4GI1A 1JDJA 1WCIA 3V2IA 2VDOB 3S99A 4KDEA 3TRJA 1K1QA 2VT2A 3FVVA 2L0XA 1GZ3A 3M4JA 4L5IA 3F73A 4YAJA 5KSOA 1QOQB 1YFZA 5K3BA 4B6FA 4D4JA 6AT1A 5E1OA 3IT2A 5IXSA 3RBDA 2I78A 2Y9MB 3PQ3A 3QBEA 5I5YA 2IYVA 4OXIA 4ETSA 1AM4D 3DJFA 1O94D 3PFHA 4ZDIA 1YDFA 4HC4A 1R4MB 4DR4H 4U5QA 3DWFA 4S24A 5FR1A 4DUPA 4F6RA 1FSFA 4ZARA 3KHRA 1GPDG 3JQ7A 4X8MA 1FRVA 2P1ZA 3VTZA 2KHZA 4J2OA 4BWSC 2ASVA 3HU5A 3W4KA 3QU5A 4RAYA 2W6JD 4HNUA 1GNLA 3D1VA 3IUMA 4JROA 5CK4A 1BHJA 4N3AA 1OTHA 2GN6A 3KU4A 3H18A 1XBTA 2DCMA 2J3KA 1G21A 3UF0A 3IA7A 2WUFA 4A2QA 2XB2A 2FMIA 1UC4B 2GEFA 4ARBA 4GU5A 1ZXBA 2DEUA 2XLCA 1EGMB 4JEUA 4J9NA 3O3OB 4JOBA 4K5QA 4HGZA 1BGWA 1ZVVA 1CXZA 3BKXA 1MVLA 4BOYA 4ID9A 1QC5B 3ZD9A 1N5KA 5J5AA 1QNFA 2WJWA 2CL0X 2GETA 2OXRA 2W58A 2ZYDA 3CZCA 3PC7A 4KZPA 1D0SA 4JUAA 1MXHA 1O1YA 4KEAA 1ZXXA 4MWOA 4Q4JA 3WRYA 2AVDA 3X1YA 3LOQA 1A72A 3LTEA 4B3FX 3A27A 4CF6A 4MEJA 5CXQA 3IOYA 3OIUA 5KVCA 3KXPA 1PYOA 2CXTA 1Q2UA 1TCUA 4DLKA 2C2HA 1DS6A 1Z13A 4O7YA 2GSDA 5G3YA 2FUNB 3UKDA 4OQPA 3N2YA 5ELXA 4YN3A 3PGLA 1I4TD 3DKIA 4JI8H 2Y2UA 4CLRA 1RXSA 4A5SA 5JRJA 5KYYB 2WF7A 5I5XA 3R44A 3TX2A 1CSEE 1JHXA 5FWAA 3L3BA 3G7NA 4O4LF 1H8HA 1JMVA 1TIPA 3MBIA 3TJMA 3W04A 4O4JB 4O3NA 1HRKA 1OXTA 3WGJA 2WTMA 3BE4A 4P58A 4C2BA 3DCJA 2E2WA 3F5MA 4NZMA 2ZVJA 3OZGA 5FT9A 3V46A 3GB8B 1NFQA 3ANLA 3HBMA 3PEEA 3LRTA 4G67A 4RMNA 1WCYA 2OY0A 4HHEA 4MHOA 4M1MA 4Y9UA 4OLBA 2FKAA 2YFQA 3R7AA 4BKMA 2PU5A 4TYPA 1NZJA 3DE6X 5DJ5A 4DM4A 3D43A 1Y6JA 1ADCA 1Z12A 2C4UA 3DE3X 3H6GA 3P0FA 1MH1A 4IGEA 4U6SA 2VJKA 1TUIA 2V7QA 3T9DA 5ALIA 2H5EA 3EN0A 4CEJB 2FK7A 5DZSA 1SULA 1K9SA 1R0ZA 2ID9A 2BD0A 3U44A 1YRHA 1DARA 2FFHA 1HT0A 3ANSA 3U81A 1ZQ7A 3A25A 4IXTA 4BL5A 4QX6A 4C0WA 2EEZA 5IKMA 3ODPA 5B6PA 2Z6VA 2VTEA 1HSZA 1E66A 4LF8B 5D8DA 4MRVA 3PKZA 1BZYA 2ERYA 2F3UA 2ZU6A 3ASYA 3G2HA 4KDFA 3MYRA 3PHCA 2E48A 4L5JA 4MOWA 5E3IA 3H5NA 3M3DA 3WWCA 5JAOA 3RAEC 2GPYA 2PRJA 4UJ3A 1P2DA 2OZVA 5AHKA 5EQFA 5GAJA 2BFAA 2CHFA 1KFCB 1X1SA 2ZVQX 3OOHA 4QJ3A 3CUTA 1FFEA 3OPQA 4KTTE 2J87A 3IAS1 4UMEA 1EBBA 5FBKA 7GPBA 1XNQH 3VR0A 1YS9A 3QPUA 1R9TA 4MW5A 1CUBA 1NLYA 2WM2A 1UBCA 2ILTA 4NPHA 4Y9TA 4DXHA 1USWA 1YC5A 3AU8A 2D59A 1EAMA 1KI1A 2QUHA 1ZZGA 3Q9UA 4BC1A 4BZWA 3QW2A 4RBNA 3BB3A 3I64A 3KSAC 1EWKA 1DIAA 2MTBA 4U2EA 3H11A 3NHPA 4LX0A 3CVYA 3S40A 1HT1E 3FZQA 2YZNA 1NIJA 2BKLA 3R4VA 2VQEH 2YUTA 4HLCA 4JJ7A 4LRWA 1ZUHA 4LTDA 4X45A 5IBQA 2BGWA 2W7OA 5BP7A 4QICA 3BRQA 2JI4A 2VAPA 1Y4AE 4DVGA 2C2OA 4R1MA 4MUNA 3R77A 4P22A 4B35A 2BQRA 5LWQA 1H22A 2E4UA 1GZHB 1FSZA 1OOEA 3CZPA 1UDAA 4LRQA 4TMWA 3ILSA 4C43A 2GCGA 4U63A 3CUSA 1DPGA 1E6WA 2CF5A 4JC5A 4ZQFA 1U0SY 4KE7A 4L8VA 3CJTA 2G9VA 2NZ2A 3TAXA 3L4BC 3SJCA 1V7ZA 1IM5A 5FKJA 1M74A 4NC9A 2JGMA 4ZODA 2KYRA 1K3TA 2PRZA 5AQ1A 4X20A 4QQ8A 3GAMA 1K1SA 3DP9A 4ZDJA 3CIOA 3GRFA 4ZHQB 5I6DA 1ID8A 1TWFA 1DMRA 2HO5A 3R0ZA 5E6SB 2D1FA 1EFVB 2OL4A 1WW2A 2R8HA 2EZ8A 1J06A 3G3EA 5DLFA 1E1MA 1Z7WA 2ZE8A 1CJSA 5KFHA 3U7RA 4RABA 4CF5A 4ENPA 3V2GA 3ET5A 3Q3VA 1E5XA 4U3JA 2DBVO 2I2BA 4N7MA 1SXJC 2FZCA 1V5IA 3HBAA 1MB3A 1UK8A 3ZDAA 4LZZA 2J0UB 2DBZA 2Q6IA 2VHUA 2YRXA 1XLVA 2DKOA 1I3MA 1JDEA 1TA9A 3DEYX 1IJBA 2FHPA 3H3JA 3RI3A 4Q1VA 4COOA 5C8ZA 2UV8A 3EBLA 2ZR7A 1MT3A 3MJFA 1NQVA 2AGQA 4FX5A 3D4BA 3FKSA 2Z5FA 4LPKA 3UJCA 1YA8A 1WXFA 1LK5A 4ALIA 1VKJA 1Z26A 1R0WA 5HVNA 4HH3C 2ZUDA 2YOHA 2B5OA 4OJQA 3EPJA 3CKYA 3DSRA 3QUBA 3UJ7A 1CLUA 2VSYA 4BFWA 1VSTA 5A3SA 1DUSA 3D81A 3VC2A 2ZQ5A 1MABA 3ISVA 4QDXA 1SKYB 1QZUA 4EO9A 1ZIYA 4LOKA 4W5OA 1SRRA 3JASB 1L8XA 1G4HA 1O96B 3HSYA 4A93G 1J2RA 3NWPA 4HDQB 4J0JA 2PPVA 3E7WA 4E5VA 3NTLA 4EBFA 3HU1A 4YY3B 1FUUA 2VNIA 5HDBB 1Y63A 2C5GA 1YIOA 3ABIA 4RVGA 4NBNA 4YLGA 3S4YA 1KYIA 2Z2XA 4G41A 4PVDA 4ZO8A 3HJUA 1ZW1A 5ILQA 1XZJA 4BWVA 1VJ5A 2E4XA 3INGA 3BICA 3LS2A 4ZMRA 1TUGA 4BTLA 1JFRA 1SZCA 3PVZA 3H0KA 4L3VA 2EIYA 3DMRA 1K3FA 1FMTA 4QHTA 3REQA 1HNXB 5BQFA 1HO3A 3M4IA 2RGXA 3EMDA 3CWQA 3LU1A 4TLBA 4BVBA 5BUZA 2RG7A 2AOTA 4KSYA 3NT2A 2IL1A 1Y6RA 1PD0A 2V0NA 1QF9A 2MU1A 2XUOA 1I3CA 1QIHA 1R3UA 3CLUD 2L69A 3ED5A 1NE2A 4MS1B 1H6CA 2ZJ2A 1MT0A 1KVTA 4M0EA 1UOEA 3U3ZA 4IDPA 5C35A 2OCIA 1GPMA 4HLNA 3A6GA 4EABA 3QF4B 4R01A 3T5TA 4XW2A 3SKYA 3THYB 2WQZA 3ABSB 4PZAA 2EQAA 1ZUD1 4PC2A 3SAJA 2VUMG 1RRFA 1AK9A 3N2EA 4R8KA 5IDYA 3WK9A 2QGFA 3PDJA 1X13A 4PYRA 4RVUA 3ZNQA 4QGGA 4E31A 2G3YA 1GXSB 3BMCB 1PZEA 4FDUA 4GGMX 1RKBA 2R4TA 2RKOA 4O4IB 4AUNA 4C14A 1XI2A 1WB6A 2DFTA 4EPRA 1OWMA 5E6SA 4TMTA 1KO1A 4CWAA 1NW9B 3ML1A 3GLFE 4BECA 5KJ1A 1MORA 2VQEB 2ZXEA 1FEZA 1R8XA 2Q6OA 4M6WB 2A58A 2GCIA 4RDIA 1YB5A 1RJWA 2GBLC 1DAIA 3AVPA 3IP1A 2VT3A 1P5RA 4KGXA 4UTOA 5IFLA 1Q0QA 1X7YA 3PL1A 4X84A 1P5ZB 1YR6A 5DULA 4HEJA 4QDJA 1UPUA 5JJCA 2PX2A 9ABPA 1C1DA 1JHZA 1KI7A 1HKUA 2BEKA 4I1VA 1DIKA 2IHUA 1EXWA 1TVEA 1D2RA 2FLPA 4OAOA 2I3BA 2F3PA 2A1TR 2D74A 3ZWVA 3LTNC 2W2XA 3FW1A 2CL5A 2O4UX 3C4JA 5DM4A 5LN1A 2O8DB 1Z5UA 3JQAD 5ECDA 3DDZX 3M6VA 3OLWA 4XZ3A 2AVNA 4XEUA 1QPGA 4OCZA 4BXOA 3WP1B 1YV9A 1WEHA 1E69A 1E1NA 1RRMA 1J0CA 1YGPA 3G0IA 5E4YA 4MWEA 1P60A 4KQEA 4C0AC 1A8HA 2Q1SA 1TF7A 1E89A 5DQGA 3B1YA 1GRVA 5JNRA 1UKEA 5KFUA 4LOAA 3EC2A 4UCOA 1JI3A 2AV6A 4MIEA 5GV7A 5IX8A 5JCXA 3FUVA 3PEFA 2UXBH 2PUGA 2X0RA 4ZK6A 2IF2A 4JZYA 4NU0A 3L0SA 4TTSA 4KJZA 3JR3A 1ZKMA 2YIJA 3HACA 3HFRA 4PQFA 4PTYA 2G80A 4UEWA 1IG0A 2VQSA 1QPZA 1MO5A 1IHYA 4IEIA 2FPIB 9GPBA 1J2YA 4CNQA 3FIUA 4BO3A 5IH7A 5DO9A 1IATA 4FYMA 4RVNA 4HQNA 2H0AA 1VS0A 1RWWA 3RS7A 1HR0H 3TXXA 2I1LA 5FNVF 2WU0A 2RGGA 1Z62A 4JLJA 5K2MA 5E7IA 4M99A 5EPUA 5FNVA 5FLEX 2YJ6A 1KFJB 3U9LA 2UXCB 3IQEA 2HV8A 4H7HA 3F6BX 3CEHA 4M60A 3PFWO 5F1PA 3O90A 3EOAI 1GV1A 2JA6A 2YBDA 3D0RA 3W8FA 4BVAA 3SQNA 1Y34E 1SXGA 4TXLA 3LUHA 1SD1A 3H17A 1KH3A 3H1TA 1XLUA 3HXTA 1CQZA 2PMDA 4QBIA 1XROA 4CEIA 2Q5OA 1M9NA 1RZ3A 1UQUA 1ZQ9A 3PV0A 3WBJA 5JUWA 4QAQA 5EWGA 4NI5A 4C89A 1ZS9A 1U2TA 4DZZA 5BW5A 4B46A 2W90A 2BTOA 4U6NA 4DJFC 1E99A 1YB7A 2HCBA 3L1UA 5G3ZA 1GPUA 3GMSA 3J7AK 2SKEA 3ORYA 3X44A 1P33A 5K01A 2EP8A 5MGNA 1J1UA 3R75A 2ATEA 4JUDX 4TUYA 2JCSA 3NFRA 4FHDA 2VA9A 4CEHA 1EX7A 1I1KA 2NV0A 3GGPA 1I30A 1LRKA 3U0GA 2VXYA 5KDOA 3PNMA 5HS4A 1EVJA 4G8CA 1GPJA 2Z08A 4PLHA 3KQLA 1NXXA 2C96A 1RM0A 3LCUA 1ABFA 2WP8J 1IHDA 1KHHA 1USUA 3B51X 4QFMA 4HKTA 4WEQA 1L3BA 5ED4A 1W7AA 3JSLA 1NU8A 2CD9A 4GPAA 4FC7A 2CJYA 1S0NA 2R8RA 4Q9NA 4FOTA 4CLDA 1W34A 2OFWA 1CDDA 4O4IF 2WUWE 3CNEA 2ES4A 2P9QA 2Y71A 3LA6A 1JG6A 4KDRA 4MQ5A 4TLLB 4Q1FA 3G88A 1JE1A 3ZE7A 5KNCD 3W7AA 3V8NA 1A1VA 2NO7A 2C54A 2XH8A 4IOMA 3DDUA 3SD7A 3H8SA 1V6CA 1KP2A 1IHXA 2A4KA 3D7MA 4LXGA 4EUFA 2GVZC 2Y6VA 1TQDA 2AF3C 5I3CA 5KTOA 4TYNA 2J9XB 2P3QA 1BXGB 4U02A 3WDLA 1B16A 5IF3A 1H2BA 5KO2A 5KFIA 2R8GA 5EE0A 5I5WA 2YRFA 2W6OA 3BMOA 3CFYA 3L82B 1JKJB 3BACA 1XD2A 3OFNA 3QPVA 4IJUA 4RFLA 5AQEA 1HY3A 3M9MB 5LL6P 5AVOA 1K8RA 1RVDA 1RABA 3NHWA 3OPNA 4HGRA 4AO6A 4Q4CA 4DT1A 2WD8A 3AUXA 2GYYA 3ZY3A 3G5UA 3ANYB 1WZNA 4PCVA 4LF7B 3DTYA 3FYHA 4PCLA 4CE5A 4HQ0A 2IJGX 4FLFA 4LRTB 4F7DA 5M7EA 2C58A 3BGIA 1E6EA 1YB4A 3R8FA 1H5UA 2IHVA 4NLGA 3X2EA 4F3YA 4LHWA 2R6JA 1KIFA 3FCYA 4YRKA 5SY4A 4GZ6A 5GMOA 2YQ5A 4E6EA 4EA7A 1ZA2A 5KJCA 1EZZA 2JLBA 4RHUA 1AZWA 1PNOA 4ECXA 2C4KA 4MB6A 5A7FA 4GI3A 3OEWA 4HS4A 2WFMA 1QOPB 2BMVA 4ZVPA 1Z82A 4LXYA 3TQIA 4BFLA 2G1AA 3R4CA 1E4GT 3EF1A 5D7NA 2XPCA 1YH3A 2GUGA 3TNFA 2BHTA 4BYMA 5J4HA 1UT5A 4QJ5A 3ZIDA 3GFBA 3UWOA 1YRAA 3EFHA 5KOHB 4JDPA 2BFCA 2AN3A 3EXFB 3NHKA 4XFJA 4PY2A 3EA0A 2JATA 3K3VA 2D2VA 3L9XA 4I50B 2YCBA 4WZBA 3C6MA 4PNEA 5J58A 1KPIA 3EZ2A 4F93B 1G18A 1NQOA 2P3OA 1KP3A 3HDGA 1RJEA 5BN4B 3SC2B 3UANA 1Y1WA 1E1CB 4KGDA 5IRCD 3IT3A 2A57A 2G8LA 1A27A 3JYPA 3BMQB 3ZHYA 5FYDA 4LMAA 2K6GA 2VI5A 2O3UA 5KNBD 3VYVA 2QUAA 3H5RA 2WDZA 1PU2A 4PSCA 3HXOA 1XVLA 4FMBB 5AP9A 4N76A 1T24A 4KQ1A 3B5JA 1I1HA 3U55A 2DOKA 3PC3A 3ESRA 2Q29A 3DV2A 1XU7A 3WYAA 5K45A 2QT1A 3AYZB 4JK3A 4QFCA 1MEOA 4CVNA 2Y68A 1SUAA 4LWOA 4MVJE 4YACA 4B3CA 1PL0A 2QF7A 2R00C 1HFJA 1TAEA 5C7IO 2B4AA 3DEHA 4DCOA 2H1VA 5GINE 3LZDA 3JQ7B 1T0HB 1Z0JA 2HI0A 1XN4A 4FEGA 1P2UA 2IT1A 3I76A 4GQIA 4MVJH 1HDIA 3TK1A 5A03A 3JD2A 4IRCA 3B9RA 4X8LA 2N0SA 3OZDA 1FDRA 1PQUA 4WZ6A 5IJWA 1KEKA 4DV2B 3HFSA 4GOOD 1VG9B 2GLUA 4FFBA 4MA4A 4X6XA 3MR5A 3E82A 3GRCA 3T9CA 4EY5A 5FBVB 4ECYA 3EGDB 4Q5IA 2HA2A 3ES9A 3KSDO 3LKZA 4MSUA 3UK6A 4PZYA 5BSTA 5L3QA 5I5TA 2AU0A 1PNQA 1W52X 3ZPXA 3M8KA 3EXEB 2GCNA 2O2SA 2DWUA 3I5UA 5HF5A 4D5EA 1SUCA 2C42A 4NCHA 3VYUB 4KQGA 1EFRA 4QRIA 5HJEA 2ANBA 4PR3A 2JBWA 3PW7A 4FT4A 4MB2A 3ZZNA 2OCKA 4FP9A 4RADA 3IPYA 1DC5A 3QVUA 5EP4A 3WKCA 5CEJA 5JDIC 3AUYA 1PAUA 3V6LA 4JI4H 1FDWA 4DL7A 1P1KA 4ED2A 2R7AA 2L17A 3CZQA 4J16A 4O59O 2HHJA 1SCNE 2HQ1A 2BL4A 1IEXA 2BISA 1BNCA 2DFDA 4WOPA 3WKEA 3UBTA 2Q3FA 3SBDA 3ZHSA 1MENA 1PUIA 1W88B 2JC3A 4DR2H 1G2OA 3FJ1A 3OCCA 4N40A 4HYKA 5DT2A 4B7XA 3MRXA 4TXHA 1WG8A 4RA6A 4BMYA 3PL5A 1C9NA 1NVDA 2IHKA 4FYIA 1B00A 4XX0B 1P4GA 3I1FA 4DQXA 1P7CA 2NYVA 3E18A 1DWPA 3THSA 3MN1A 2JHGA 3JYOA 2Q0SA 2JA6G 1I3KA 1OX6A 2O2XA 3FPLA 3IIEA 1T8RA 2P0YA 2Q41A 1D4AA 2ZTSA 1IBMB 1X74A 4JI7B 3MQ2A 2P9TA 4D0SA 1V0JA 3AP2A 1FXWF 3HPQA 3ICEA 2I76A 4CQNA 1PFYA 2HF9A 3T7DA 1UL1X 3CLSD 3PT9A 3ZEAA 2ZDHA 3PNPA 5H1YA 4I08A 3K1JA 1QGYA 4XGIA 1B23P 2KPOA 3MJVA 4BLUA 2BGRA 2GZAA 3NIBA 1KJZA 4OI1A 4CF7A 5K0GA 2I4NA 2P6PA 3EYAA 3ONEA 4G97A 1Z2DA 4LMPA 2F62A 3AHCA 3ELYA 3FNGA 2VHXA 3P0EA 2JZCA 2DCUA 4PSKA 1UXIA 1Q0LA 2VDNB 3LCCA 5EJ8A 3ADOA 5I9BA 2C61A 2ID8A 1DFHA 2MR6A 3IJEB 3T1QA 2O07A 4RZUA 4CMGA 4W5QA 2FQXA 3VPHA 3W1VA 4ARVA 5HOEA 4NMHA 5ED0A 4XFKA 1YQWA 2C2RA 1VRCA 2V7PA 2YWDA 5IZCC 2DB3A 3D2AA 3UJ9A 1Z75A 1AQYA 2ADFA 4XLTA 1XC7A 4MUMA 1FXUA 4ER6A 4CIBA 1PIWA 4B2PA 1VPWA 5F73A 3U1VA 1ATZA 1T25A 4XSGA 3ZD7A 3WTCA 4YRRA 1T4CB 5DKFA 5GY7A 3VKUA 1I5OA 1REQA 4PBCA 3NBXX 3SYMA 4B48A 1JPNA 3BFKA 1U5AA 3OICA 1KRHA 2ZRKA 5ALKA 2WAQA 4EQ5A 3KPYA 1H0SA 2ZTVA 4H3HB 3TM5A 5I8WA 4OQDA 2Y05A 4C6HA 1CHNA 4GWKA 4IXMA 4IV5A 2CMDA 4CG2A 1I1MA 5KG3A 1I14A 4G8BA 5JBQA 4MUYA 3I52A 2XBLA 3QBVA 2A9QA 2EW2A 2JGLA 4JP1A 3TQQA 1D1TA 2IH2A 1JEDA 1K27A 2BTEA 2PLFA 4JWTA 2I03A 1MHTA 2C2DA 3FWYA 1F9EA 1RPNA 3HUFA 4Q1AA 3WIDA 3ZDXB 4NCNA 4NARA 2K5UA 5KYYA 5K3EA 2J7PD 3H9GA 1T4CA 4GS5A 4QU9A 4AC9A 3GZNB 2FG5A 2G5CA 1SXJA 4I9FA 1T29A 4JQOA 4TZKA 4CDMA 3QX9A 1ORDA 4YQYA 2EXXA 1W30A 2CDBA 3GA5A 1UPXA 3QA3E 5LYJF 1QFSA 1TM4E 2C8VA 2VP0A 3A1DA 4P82A 4DILA 5HWSA 4HL6A 2ADMA 2QQEA 2Q4OA 2I7CA 2XMCA 3ZX5A 1TNDA 2PUBA 2XNDD 2CNUA 2PXCA 3G0OA 4GT1A 1T2DA 3D7RA 2CLLB 4RJIA 3RNOA 4AJ2A 2VC2B 3OTGA 1EXDA 1Y42X 4M8SA 4IFEA 3WZLA 1X2EA 1ID1A 2J45A 3DKPA 4CF3A 4DG5A 3D6HA 3GN1A 1XQXA 4X1OA 1P0PA 5ALFA 4CL3A 1T2EA 1Y8QA 5KT7A 5C34B 3UXYA 4M22A 1TK2A 3HLYA 4JI6H 4HJXA 2CCJA 3H3XA 4A3MG 1JDSA 1R8JA 1DXHA 1ZG3A 3HBJA 3ILXA 3IOMA 5JJIA 3GD7A 2CFSA 5F5XA 1KDYA 1HZZA 2Z8YA 2ZJ0A 3GZTB 4EFMA 5C8YB 4MIYA 3VHQA 1NV9A 1ZAKA 1NBHA 2B36A 3JZDA 4Q7KA 1L4LA 3S1AA 1UBLS 3PUYA 5DHFA 3L6DA 1UP4A 2HNKA 2ZBPA 5JR3A 4EJSC 1ZISA 2A8YA 3WNBA 3ZI7A 5CFPA 3CWCA 4P7GA 2REOA 4JEMA 3PR4A 3V9PA 5AK5A 2CHQA 4PZZA 3H2KA 3MIZA 4TSFD 4XH9B 4RIEA 4CHTA 2CXNA 4GQAA 2A9KA 3AU9A 1G8AA 3FAKA 3HLTA 4KLNA 2JI9A 4NENA 4DJTA 5JTUA 3PFGA 4BEVA 5C31A 5DGHA 4FFNA 1I51A 1YZ3A 1ZGGA 2WB4A 4WOBA 1PGOA 1KH2A 3ND8A 1M73E 3RYIA 3QMWA 5I7OA 4EGAA 1IC6A 1OLSB 1L3CA 5K0EA 3WGYA 3OT1B 1CE8A 3EXHB 5B53A 2XKKA 2IIVA 1JW9B 3NNSA 1EXNA 2GPNA 2WWHA 3PEYA 3KR1A 2QLMA 1OXBB 2VDPB 2DPLA 4K2AA 4F2WA 3AJEA 3CNBA 3ET4A 5DTIA 2HRBA 3K30A 5I01A 4QVKA 3AILA 1V6SA 1S5PA 5AW9A 5F3WB 2C5BA 1UZNA 1VLMA 1G19A 2QLBA 1MX3A 1OVGA 2VDVE 3DHNA 3HQ4O 4YTEA 2OC9A 5ALHA 4BZXA 2GBLA 3HRHA 4LPSA 1GQQA 3DYVA 3STXA 5BR1A 4A15A 4W9RA 3LHIA 2NUBA 3GT7A 2FN4A 4XDYA 5L3VA 4YUAA 1RYZA 5JECA 1DBQA 2R8EA 2YXNA 2BMFA 4REMA 5FOTA 1QZ3A 3WKDA 4PSVA 2FPIA 1HL3A 1QE3A 2GO7A 2O20A 2PGDA 2TS1A 3JWGA 4ZCSA 4DR7H 4CXMA 5A0VA 2GM9A 3ZWWA 4MJ3A 1G55A 2R93G 4D9BA 2Q0QA 1ST3A 3G13A 5FOQA 1WUIS 2PVSA 3CUYA 1MZVA 2VR1A 2WWRA 3R3WA 2ZRMA 3TZEA 3I9NA 4L28A 5CB0A 1DC4A 3OJFA 1UJ5A 4MKFA 1E2UA 5FWYA 1NZDA 3MJHA 4ESVA 5DMXA 1UWCA 2LIVA 2OHJA 3DBOB 3CQZA 2X6TA 5AFSA 1W0KD 3WL4A 2V4ZA 2QMEA 4Q43A 1PT6A 1QVAA 2ZBRA 4DR5B 5FJ8G 1L7PA 1VE6A 2HPVA 1JA0A 1V8FA 2KI5A 2H1CA 3CTMA 3FETA 2Y1KA 4E88A 2RGNC 3UFBA 2O3QA 1ZUNB 4B0OA 2NO4A 5DHSA 2GEKA 4NCXA 1ULAA 5LDGA 1X9HA 2EBFX 2PZFA 3UENA 1TX4B 3OZ7A 1TZCA 3ITNA 3MJRA 4HD8A 4OKIA 2Y0DA 3EPIA 1Z39A 3OU6A 2P9YA 3F6RA 2KMLA 4H27A 1ZRMA 3SNKA 1TCVA 1XMVA 3S5UA 1SXJE 1HYGA 4DYHA 1FRZA 2B5VA 4LYHA 3BWEA 2YX1A 3FN4A 2XR1A 3K6RA 3FE2A 3V48A 3G2OA 3K94A 3EDCA 4PO3X 1Z6GA 4TTVA 5B1SA 8ADHA 3Q8WA 5LDHA 3B70A 4XZ3B 3L8EA 4RKWA 5ECGC 5F7JA 3GV5B 3FSEA 3BVPA 2GGSA 4M9ZA 1X7ZA 2GEUA 4TRMA 5COQA 1C2TA 2A86A 2ZSJA 4JLOA 1A5TA 2Q5CA 2CXRA 2Z1MA 4A9AA 1P4HA 2VAXA 3GFPA 1G20A 1WH2A 4MQFB 1NU6A 1YR2A 4OY3A 3RS8A 2XXAA 1V4NA 3K5IA 1TIBA 3UMJA 4WKGA 3W0LB 4CLOA 3IA2A 3JATB 3UB4A 4DV4B 2YMQA 4QWBA 4V0NA 1SOVA 2RK4A 4PO1A 4ZAYA 2AI2A 3PXUA 4KMRA 3TEMA 3UOAB 3UOGA 3S8EA 1OXKB 1DGQA 1CJKC 4IVNA 1JSZA 3GYBA 2WJZB 3IBFA 3LHFA 3VDXA 1CTQA 2WYWA 1D2MA 2GBGA 4RLQA 3VUFA 1DOHA 3SC6A 2BR3A 4UD6A 3KELA 1UBKS 5DGCA 3DHWC 4HJRA 3QA9A 3LF2A 4XGNA 3OPMA 1XWFA 2O2IA 1KU6A 2ECFA 1XDZA 1KAHA 3A6JA 4I81A 3J80A 3W5UA 5ALZA 3JATA 1U8UA 2O3SA 1T6ZA 3O8DA 3X1JA 3PTAA 4J03A 3HABA 4H7IA 5K3DA 3IHLA 5J4VA 5AI0A 3U4QA 4N1AA 1NW4A 2R60A 1N2JA 3DFIA 4EW6A 5BNIA 1Q0SA 4X24A 2WY2D 3SS7X 3SZMA 2FMTA 3H2JA 1MU0A 1W4ZA 1D5CA 1EQ2A 1N5RA 2J5XA 2C5LA 2X9QA 4Q4AB 3RB0A 4W8GA 5JVDB 4A2WA 3WIUA 2JCVA 3P71T 4M0PA 1VJ0A 4FZ3A 4US1R 4ZICA 3HR8A 3PFKA 2V6GA 2QM8A 4FSXA 3FZEA 2J31A 4CM9A 1V9SA 3C14C 1N0HA 1LPBB 2C1XA 1VE1A 2OGZA 1WVGA 3LIIA 5GJCA 1JHAA 2GCEA 1AOXA 3FCAA 1RRCA 4ZJZA 3IQIX 2ZJ3A 2D7DA 2XOEA 2A0FA 4HQLA 5B1DA 2P2SA 3FH0A 4LI0A 4ZT2A 3Q0TA 5G1PA 4BNFA 4AY2A 3FOAA 4RH3A 3G2QA 2RDJA 2VL7A 3RU9A 3AKYA 2ONYA 3O4HA 2E0IA 1PS8A 2WJ3A 4P4UA 5FUXA 1PT5A 4YA6A 1TF5A 1CBUA 1Z0DA 5CH5A 1BYIA 1U9YA 2D2EA 1W44A 1IVNA 2ZSHA 2QI9C 3KWJA 1T0PA 4TV9B 1H8HD 2R1VA 3DB2A 1T1GA 2PKWA 3L0DA 4UAUA 2WDTA 4U00A 4GOLD 3EGEA 4HWKA 2BMEA 2P2DA 2VP3A 3EYWA 2OE2A 4EY6A 5AESA 4B3GA 2BYTA 4OXQA 4ZAVA 4BNWA 2TMGA 4R0MA 1QIMA 4RAOA 1XJQA 5EERA 3WR5A 2P62A 1SG6A 1J1ZA 1I5EA 1J24A 1MQ8B 2XB4A 5CX1B 2JJ1A 4LY3A 2WUDA 3I09A 1CUYA 5JFOA 4UCVA 2B1JA 4TRJA 2D7JA 16PKA 3D31A 4HDOB 1RJRA 3PCXA 3QY9A 4BLOA 1OUMA 2VFAA 1VP9A 3O7WA 4NK5A 3AFNA 1KXZA 4IGIA 3O8NA 3Q2KA 4AMZA 3P52A 1GQOA 5CK5A 3EWAA 2YBEA 1JILA 3UMSA 2QRMA 5T4EA 3RBXA 4JYPA 4JJIA 2DAPA 2OYSA 4B4VA 2HGZA 3KOOA 4UCXA 5FIUA 2R9VA 3TCNA 2R8YA 5T67A 5B5SA 2JF0A 2XX3A 2XB6A 4IMPA 3TRFA 2AGPA 2YR0A 4MW6A 1MO4A 2JLZA 1VPLA 4CIYA 2PYZA 3HKEA 3TVYA 2X13A 3EVAA 2YYZA 5ITVA 1RJ9A 2VHZA 2ZB7A 4LF8H 1NGSA 3AKCA 3NBFA 4TL8A 5EIWA 3RT7A 4ALNA 4D4MA 3M5WA 4QXRA 2PSSA 3D3QA 3N40P 3ICPA 4UE6A 2X0NA 3PNQA 5A3RA 1CB7A 2Q5HA 3PNYA 3QPDA 4OJYA 5D6NA 3R5JA 5DE3A 3TTVA 2GCOA 1M34E 2Y4NA 2WABA 4IJMA 2VQDA 3A9RA 4KH1A 3WMRA 2DPGA 2WEKA 1Y9JA 1YU6A 1Z7EA 4X85A 2CVHA 2X0SA 1H2RS 1S2NA 4Z1MD 2H5LA 3QVMA 2HIGA 5BY2A 5GIOE 4FIZA 3IKTA 2DZDA 3G9UA 4R31A 3MHTA 2G67A 2R48A 4MIKA 4R81A 2YW9A 3JVUA 3JZIA 4O86A 2P35A 1JKXA 2R00A 2ZQZA 1RJPA 1R2QA 2HPAA 2VDRB 4G56A 2KSQA 4LY6A 4C78A 3GLFB 1NVVR 2Q2VA 1UZLA 4MI9A 2PD6A 2AKAB 1H0RA 3VJKA 2F8MA 1A76A 1FYVA 3LQSA 1X6VA 2Q7XA 3STHA 1YQTA 4POAA 3IAM1 5CURA 1Q2XA 4GL2A 2BJHA 3ZWPA 1MD9A 5C46F 1QM5A 4P3YA 3RD5A 4A8TA 1FBNA 1ZI8A 2HHLA 4HB2A 1B8NA 4YAKA 1E79D 1Y81A 1DTEA 1QJCA 1CZKA 5JIBA 1COWA 4M0UA 3PI7A 2A1TS 4Y9SA 1IAVA 2VHYA 4ZVUA 1NNI1 3T1HB 3NHRA 4MUXA 2QUKA 1FX0B 4ZQBA 2PL5A 5KHLB 9MHTA 4OIFA 4GX1A 4UVHA 1EKVA 3GLRA 3RTAA 4XA8A 2JEJA 3GTJA 5FWXA 2XEDA 2BE7A 3SJBA 1KE2A 3ZNNA 4GXQA 5HK9A 1NXQA 3Q7RA 3DV0A 1YZHA 4GYYA 1N6KA 4I1IA 5G53C 4A3GG 4IIBA 3G2NA 3IEIA 2PTGA 1HDZA 4BAUA 5E4TA 4Y2RA 1GGNA 2O59A 1ATIA 1TC1A 1VJDA 3SZRA 3UFXA 2WFLB 1O0SA 2OCXA 4UUBA 4EJMA 1FPQA 1TT5A 4F5WA 2E5FA 1ZMXA 2C5HA 4Y1GA 5FBZA 4BLRA 1UEXC 3GZ4A 1QH9A 1Y1VA 1MTZA 1YE8A 2A7QA 3WB0A 3EIEA 3SR4A 1T8SA 4A5OA 1Y6GA 1OZAA 4JV1A 4GAEA 4OP3A 4QDKA 5EOVA 3VSCA 1Z6PA 1NONA 5KT4A 3TVDA 2ZPAA 4P3OA 3AF0A 2GM5A 3X2SA 2QRHA 2WOOA 2HRRA 2R8JA 3OHAA 4YXWD 4IR9A 2Q4TA 3BD8A 3NYWA 3PRHA 4O81A 2J32A 4Y6SA 5HCNA 4DR4B 4ISBA 1ODTC 1DX6A 3RARA 1KR2A 2R96A 2HK8A 4L6AA 1I3OA 2EX4A 4BVHA 1DVRA 2HMAA 1M54A 4Q3OA 2EYQA 2C2BA 3DT9A 1IN4A 1BS9A 3DHYA 3FBWA 4J1TC 2ONKA 1V5GA 4JI2H 2KWIA 2MYPA 5DHPA 5JOQA 4QRDA 4HYYA 3R5KA 3IPXA 4WXPA 5J63A 3UHOA 3T1OA 1VBFA 4RYDA 2C7BA 3OZTA 3D4OA 1GILA 1U3TA 4AG3A 1XP8A 4QJIA 3EASA 3TLYA 4AYXA 4BV3A 3FPFA 4LOJA 1KK1A 2JAOA 3CRMA 1O6CA 1SUFA 2VYVA 3SS9X 1JIHA 4ECTA 4RA9B 2VEDA 4IBOA 3QVJA 4BLVA 3Q3HA 1VSQA 2ZYHA 3REOA 1YS1X 2YNMA 3JTMA 5ALXA 3G9TA 1DQRA 1EM8A 4B84A 1SHLA 3WHIA 5DNWA 1KJJA 4LOHA 2XW6A 3GFOA 1U0OC 4JOQA 5HF8A 4CMCA 3FNRA 3KSRA 3OX2A 5FCDA 1JHDA 1XJWA 4KIUA 1OB5A 4R0NA 1G20E 3O1LA