2YZNA

Crystal structure of d-alanine:d-alanine ligase with amppnp from thermus thermophilus hb8.
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
319
structure length
317
Chain Sequence
b'MRVLLIAGGVSPEHEVSLLSAEGVLRHIPFPTDLAVIAQDGRWLLGEKALTALEAKAAPEGEHPFPPPLSWERYDVVFPLLHGRFGEDGTVQGFLELLGKPYVGAGVAASALCMDKDLSKRVLAQAGVPVVPWVAVRKGEPPVVPFDPPFFVKPANTSVGISRVERFQDLEAALALAFRYDEKAVVEKALSPVRELEVGVLGNVFGEASPVGEVRYEAPFYDYETKYTPGRAELLIPAPLDPGTQETVQELALKAYKVLGVRGMARVDFFLAEGELYLNELNTIPGFTPTSMYPRLFEAGGVAYPELLRRLVELALT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-alanine-D-alanine ligase
publication title Crystal structure of D-alanine:D-Alanine Ligase with AMPPNP from Thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Ligase
total genus 80
structure length 317
sequence length 319
chains with identical sequence B, C
ec nomenclature ec 6.3.2.4: D-alanine--D-alanine ligase.
pdb deposition date 2007-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01820 Dala_Dala_lig_N D-ala D-ala ligase N-terminus
A PF07478 Dala_Dala_lig_C D-ala D-ala ligase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 2yznA02
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 2yznA03
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2yznA01
2GLTA 1VBGA 1M0WA 3AX6A 4M9UA 1VBHA 4ZI7F 2W70A 1KJ8A 3LP8A 3Q1KA 2J9GA 1OBGA 5C8YF 2W6MA 3N8DA 4MA0A 2GQSA 2PVPA 1KBLA 5DMXA 2FPIB 3K3PA 1B6RA 4FFMA 2YYAA 2R87A 1C3OA 2R7NA 2GPSA 3RV3A 1DV2A 2W6OA 4FFOA 1JKJB 4HNUA 3OUZA 4O7NA 4M99A 2YS7A 3R5XA 3WNZA 4YAKB 2CNQA 2DLNA 4EA8A 2YRXA 5HBRB 4XYMB 3ORRA 4WD3A 4YJ3F 5FNVF 1KUTA 5JH7F 4EAAA 3RV4A 2X0SA 4O7RA 3KREA 1EHIA 4TV8F 3BFPA 2YZMA 2P0AA 3GLKA 1IOWA 4EGJA 4MA5A 1KJQA 2FP4B 3RFCA 4IHJF 2R86A 3MJFA 4IIJF 5GONF 1BXRA 1KEEA 2CNUA 4EA9A 3BSWA 4O4IF 1CQIB 2YZNA 1CQJB 4ZHQF 4O84A 3TIGA 4YB8B 3G8CA 5KX5F 2W6QA 1A9XA 4ZQIA 2I87A 3ORQA 2HGSA 2CNVA 5C1OA 3HO8A 4I4TF 1GSHA 4O7SA 3VPDA 1IOVA 3KALA 1GGOA 4HNVA 2R7LA 2SCUB 4O82A 3AW8A 2R7KA 3N6RA 2W6PA 4C5AA 4EABA 3VA7A 5IYZF 3G8DA 4FFPA 3GIDA 3R5HA 4I55F 4O2AF 3JRWA 4L1KA 4EG0A 4MV3A 5K2MA 3VPBA 5C1PA 4TUYF 1DIKA 3OUUA 4WBNF 2DIKA 2VQDA 1WR2A 4E4TA 1I7LA 1Z2PX 2R7MA 4DIMA 2W6NA 4MV9A 1EUCB 1GSAA 4O7VA 4MV8A 1KC7A 1DV1A 4O7YA 1E4EB 3ETHA 3HB9A 2ZDQA 1KJJA 1M6VA 2PBZA 2YZGA 3R23A 1GLVA 1CE8A 2I80A 5BMVF 3R5FA 3R9RA 1A48A 5LP6F 3ETJA 3VMMA 2CZGA 1Z2NX 3U9SA 4HR7A 4O7WA 4QSHA 4MAMA 3VPCA 1JLLB 4YBZB 2QK4A 4J6EA 3SE7A 1UC8A 2VHEA 3TQTA 4XX0B 4MV1A 3QFFA 5JQWA 3HBLA 5CAEB 2R82A 3LWBA 4XZ3B 2C00A 3V4ZA 2OLSA 2GQRA 1OBDA 1W93A 4IZOA 1EYZA 2VR1A 2DWCA 1KJIA 4O4JF 1PK8A 4O83A 3NUAA 3DF7A 3JRXA 5J2UF 1UC9A 4MV4A 4O7ZA 4ZOLF 3KAJA 2Z02A 5EZYF 1W96A 3VOTA 4C5BA 1T36A 5I47A 4XYLB 1PX2A 2YL2A 2NU6B 3V4SA 4Y8VB 3TINA 2XCLA 4HQ6A 3BSSA 2NPOA 2W6ZA 4O81A 4O2BF 5BPHA 5J2TF 2V58A 5JVDF 3KAKA 2R6FA 3Q2OA 1BNCA 3TW6A 2QF7A 5CA0F 1ULZA 4M98A 4O7LA 5LXTF 5CB4F 4C5CA 3K5HA 4O7TA 2NU9B 2DZDA 5KKNB 1JDBB 3WO0A 4FFLA 2YW2A 3K5IA 4MV7A 4EGQA 2NU8B 1AUVA 4IWYA 2VPQA 3JZIA 2FPPB 3U54A 2NU7B 4YJ2F 2R85A 2FB9A 3MWEA 4FU0A 5LOVF 2ZDGA 5HV6A 4NYEA 2GPWA 5D8DA 4FGRA 2W71A 1KJ9A 5H80A 4O4LF 3WO1A 3TIIA 4I50F 3U9TA 2ZDHA 4GGMX 4FE2A 2FPGB 4EA7A 3U55A 2YZLA 3MWDA 2IP4A 2NUAB 2XD4A 4M9CA 1M0TA 4FFRA 1C30A 4O86A 1B6SA 4ME6A 2CQYA 1VKZA 1GSOA 3BG5A 3UFXB 5CA1F 2WYOA 4FFNA 1EZ1A 1E4EA 3BSYA 2HJWA 5JVLA 4IWXA 1AUXA 4TV9F 5LYJF 2V59A 5LA6F 1JDEA 1SCUB 4YAJB 4HNTA 3E5NA 2I8CA 1EUDB 2YWVA 4O4HF 2R84A 2V5AA 3JZFA 1Z2OX 4MV6A 3RUPA 1CS0A 1I7NA 2PN1A 5BPFA 4DLKA 2YRWA 3I12A 2Z04A 5JQGF 4RZQA 2YS6A
chains in the Genus database with same CATH superfamily
3PCXA 1B6TA 2SHKA 3HKDB 3RSLA 3GTLA 2C3YA 3EODA 3RW9A 2HCJB 4Q7JB 3M4IA 3U5TA 1MTZA 1Z37A 4IV8A 3ADKA 3H7AA 4PXSA 3OF5A 1IM8A 2A1UB 3OCVA 4EA8A 2HI0A 1P74A 4MPJA 3VR3A 3GLIE 2VJMA 2V8OA 1S2MA 3HXLA 3AB3A 4BIMA 3P0IA 3QOYA 4J43A 4W9NA 4ZVPA 1M33A 2QD5A 4FKBA 4EG5A 2RHRA 1Y5MA 2R8OA 3BQ9A 2ZK7A 3HR8A 2NM0A 2JFXA 3VSCA 3IEIA 1P7PA 2XB6A 2P9TA 3WL6A 4JFRA 3TFWA 4KN9S 2O5EA 3IELA 1XZPA 2WJWA 4KXXA 5GONF 1MN6A 3Q8KA 3CJQA 3TO5A 3COVA 3V2UA 1RFLA 4E4YA 1BGVA 2Q49A 3DXZA 2WM9B 2OZVA 1FU8A 3K2QA 3TMKA 4D7AA 3LF1A 1SBCA 4LJSA 1DGSA 3KEQA 2RARA 3M4ZA 1H4SA 5CFZA 3SYLA 3ZY4A 5L40A 4QUEA 4IIHA 2CC2A 3CRVA 4XEHA 5AVXA 4DUYH 4F4ZA 1Q1BA 3MW8A 2FK8A 3CLUC 5INTA 3C3YA 2QP4A 1RHUA 1IYDA 3BRWD 4HXFB 1KP3A 3FI9A 3FKQA 4Y2HA 4ID3A 3FDZB 3T52A 4OK6A 2UVQA 1WR2A 4HRVA 2XBUA 4IVNA 1DJQA 3P0FA 2BFAA 4G67A 3R75A 4K6FA 3TLGB 3V6JA 3AVVA 4RB3C 2RAVA 3IUMA 4C0QC 2UUBH 1Z8DA 3IESA 4UVIA 1VP9A 3WP0A 1A1VA 1E3QA 3BE4A 5HE8A 1GLGA 1W85A 4MVJG 2ZJ1A 1Z0UA 2A86A 2CFRA 5EMJA 2CVZA 2OLKA 2K4MA 5PNTA 1CJUC 1IBMH 1DIOB 1SU7A 2PH7A 2X2OA 2ZVQX 3VQTA 4ZREA 5EJMA 3QVWA 2JFBA 1LDEA 1CUWA 3DAOA 1MAAA 1RC1A 1RT9A 5G3YA 2ZI4A 3UN1A 2QLMA 2IHTA 5KIAA 4RSMA 3I9OA 4CDGA 1YVPA 1IBCA 4ZI2A 4BFSA 1KFKB 1K0FA 4D8XA 3N05A 4QUKA 4NICA 4MAFA 1TK2A 4YCJA 3QELA 3EEQA 2R4UA 1ORWA 2EZTA 3NORA 2AC4A 1NG9A 4ED6A 5M3BA 3OFKA 3EA5A 3FKSD 4GKBA 5A5DA 3UATA 3CEPB 2VDWB 3ACCA 1MW8X 1UC4B 4FD3A 4JQYA 4IILA 1GA1A 3DV0A 2I29A 3RFTA 2EXXA 1Z88A 4OM7A 1IMJA 4I1UA 5LQJA 5IAOA 2VWQA 2IYVA 1SXGA 3PR5B 3UPDA 2OZLB 3CVZA 1GPJA 4W8GA 2CL7X 5IC4A 2X9QA 4QTTB 2ZU6A 2YWBA 1M0SA 3QA3E 2QQFA 3O5AA 4AICA 3UPTA 2F9LA 3ZI0A 3I42A 4FCCA 1YR7A 4AS2A 2FUKA 2WM3A 2PZJA 5ALIA 3EH1A 1M0TA 1JAHA 4G1MB 3I23A 3VZQA 4OHOA 1D3AA 3GVHA 3QKRA 2SBTA 4H4CA 5IF3A 3VHQA 2JEYA 3A2LA 3V1KA 1FS5A 1Z2CA 1Z4OA 4ASUD 4HNQA 3H4IA 4GE0A 4HK4A 2AGQA 1LKZA 4O2AB 3T5TA 2CB0A 5BYBA 1A3CA 3M6WA 3C8UA 4M6WA 1S0MA 3COZA 4QDZA 3EGXB 2HM7A 3O90A 4ARZB 1VJRA 4E30A 3H83A 1L7OA 5BYKA 2VT2A 2FE3A 1N5DA 1MKYA 4DLYA 3VNBA 1K66A 5JXGA 1R0SA 3IILA 3K09A 2RK4A 2NVWA 4F84A 2WMOB 4GPD1 1ZITA 1ZMXA 2D0OB 2P6MA 1JBEA 5LLDA 1N4AA 3MN1A 5L4LA 4X1YB 2ECPA 4K9LA 1O4WA 4PYIA 2Y4OA 3ZIAA 3JR7A 2DH6A 5AQ1A 1RLTA 1XDGA 5ECDA 3N7AA 1CY2A 2MR5A 2HA3A 1GQFA 2JLAA 3ZNQA 4R01A 1JMVA 4CU2A 1Q2XA 5JS1A 4P2GA 1FUKA 1S8NA 2HIHA 2NU7A 1ESNA 5I5EA 2FJPA 4K9PA 3AK4A 2WHXA 2I4IA 1ZQ7A 2JGEA 3FPEA 3L84A 5FLEX 1E5TA 3UG7A 3MWGA 3GJTA 1XOIA 3P8ZA 1QE3A 4PCUA 3HCRA 3VDQA 2D1SA 3ND7A 1XZMA 3V8VA 4EG4A 2Q5OA 4HNVA 2VDOB 3GIPA 3TDKA 1V2HE 2FP4A 3ZWCA 4V3BA 4OOEA 2IYPA 3B78A 2NX2A 2WKSA 2E4YA 1KJYA 4OAQA 4U9IS 1P62B 5AW8A 1A5ZA 4HFJA 3HPRA 4JGGA 1DKOA 3B3JA 4P3NA 1I94H 4AG6A 3FYUC 5EIXA 2Y1OA 3MGGA 2CXHA 2XOKA 4AMGA 2P77A 2XLCA 2FHPA 3VO2A 3EVAA 3SIRA 4EENA 3MOIA 1C0EA 1VC2A 2UVRA 3HHPA 2HHAA 4R7TA 1SCBA 3M6FA 3RSHA 1SRQA 1C7ZA 4NFLA 3X1JA 4QTYA 4Z53A 5LP6A 5CU7A 2AN3A 4DIUA 4BC0A 5F23A 1SVMA 4RTSA 4UU8A 3KTDA 3OEHA 3HB0A 3KXDA 5G0SA 1E1YA 4YRPA 1PFKA 4BV8A 2ACKA 2SKDA 4X66H 3LT0A 4RA6A 1AZSC 4EB6A 3HJGA 1SWWA 1RWPA 2V6BA 4BFYA 4OLBA 1L4NA 2NTNA 1QHYA 3SC2A 3Q8WA 4GDMA 1DAKA 3W8RA 4UTRA 3R41A 4UMEA 3TINA 4RFLA 3F4BA 1O95C 2EFEB 3JAKB 3MD0A 2YN2A 4Q3AA 3EF0A 2QYTA 2FUEA 2GK3A 2A35A 4D3YA 1B93A 2CBZA 1TVMA 4AJ1A 2IV2X 3BYZA 2ZJTA 5JSZB 2FCRA 1RKUA 3KXKA 2ZJBA 1OZHA 3C3CA 4IJKA 1PEAA 5KG1A 1Y6RA 2B69A 3H19A 4DEVA 3LE8A 1BEEA 3K92A 3AFMA 4OFWA 1M3SA 1L3IA 3HLYA 1V4NA 1OKKD 1TRKA 1E2NA 2XOEA 4DR1H 4DADA 2FZGA 3ZDFA 3PFBA 5LKAA 4ZHQB 4AJ2A 1GP2A 1IUPA 4Z9XA 1JSZA 2RB4A 2H8GA 5FWAA 3OHAA 1KY2A 1EBBA 2QX7A 2XUQA 5LVAA 5BWXA 4W5TA 4TYQA 1UM8A 3VU3A 1SXQA 1YIDA 3KTFA 2EJ2A 4G26A 1QS0B 2QIPA 3OT4A 1NSYA 2ZT8A 3SOZA 5IJZA 4GSKA 1FFXB 4JWKA 5CG2A 4E2XA 2NZYA 1RLOA 2MCTA 1BN6A 1OTXA 2W8BA 2VA2A 1FMFA 2RH5A 2VUUA 4A8JB 3BBPA 3QOFA 1MZVA 3KJXA 4MR9B 1QIFA 1Z2DA 1VSQA 5JQGF 4K2HA 1LSJA 3DDNA 3L05A 3IQEA 2JEIA 4B48A 3K0CA 2GLTA 3CR7A 1G8GA 1SVUA 3WWHA 1SQ0A 2BFFA 4FZRA 1H94A 2FVYA 5C8YF 3JQPA 4EJSB 4FWBA 4A6EA 2B2XA 1YC5A 5J23A 2QVGA 2HQ1A 3DBLB 1YL5A 1POXA 2EZ8A 1JKJB 4EGSA 1PR0A 1PIWA 2GO7A 1WXDA 3EZXA 3GHHA 2VHYA 3RTDA 2XT9A 5E6SB 4TV8F 2J7KA 5H1YA 3H5TA 4F60A 4DCCA 1IONA 5IT9A 1SFOA 1W52X 4HP8A 3DZ8A 5GPBA 1YGYA 1P5HA 5FADA 2ABJA 1NMSA 4QA9A 2O2CA 5THKA 2AH5A 3FOWA 4COKA 3Q3GE 2ZWVA 1UP4A 1PDVA 3R7NA 3EWSA 2J5RA 1B26A 1M2OA 1J7JA 2VIIA 5DHSA 2QZ4A 2IZ6A 4I5DA 4QAQA 3RS2A 3U4AA 1E8DA 4IDEA 4LFBH 3OFSA 1D0SA 5FJ8G 1K27A 4KACA 1GUFA 3WNVA 3AVXA 2RGEA 2DGDA 3GV7B 4V0LA 1S03G 2GN1A 4JV5H 4W4TA 3CF4G 3G9XA 2OO5A 2DBQA 3GC6A 3U3XA 5DBIA 5DK4A 2ZJOA 1MOPA 3IKVA 2WFAA 2J9ZB 1PL7A 5BW5A 2W6NA 2ZT6A 3TZEA 1F4PA 2H0RA 2Z2XA 1BROA 3LG2A 1XRRA 1DKNA 1QHFA 4BQQA 4OV6B 1IWOA 1J8FA 4HL6A 1CNEA 4HB3A 3ENQA 4YI5A 1CZKA 2JKYA 5KFJA 1CJBA 3T12A 3DBHA 4HLNA 1SEPA 4Q1FA 1MAUA 2YV1A 1W2HA 4C6SA 1RPJA 4BLTA 4IFEA 1JAYA 4Q9LA 3G68A 3U7QB 3BCRA 2QBYB 1QQTA 4PZ0A 5CPBA 4RNNA 1RAAA 2Q5CA 2IL1A 1JILA 4UUPA 5BQ3A 1QHXA 2ZS7A 4E6PA 3Q8MA 1Y5IA 3TDNA 4H7DA 5TPWA 1HRDA 3THOA 3Q0TA 1EUYA 2W0MA 3QIVA 1T4CA 1XSEA 2V3WA 2KI5A 1OVMA 4ZXFA 4HZIA 4A2WA 1USGA 1CDOA 3REFA 5I5UA 4B4OA 4FOLA 4YMVA 1YVDA 3QU9A 4MULA 4O81A 3GIIA 4FDUA 1FCJA 1BCRB 2H2DA 4OLFA 2ZS9A 2GJKA 4A1OA 2Q99A 3T5BA 4TS9A 3TW6A 5TR9A 4YEDA 1NJSA 4FILA 2ZYUX 2H7CA 4WUTA 3QBTA 5C81A 4RJLA 2XRZA 1UAAA 1NU6A 4ZYUA 4PSVA 2ZYVX 1HPLA 4WNAB 4L5BA 1JKFA 3MJEA 1U31A 2YASA 3A0RB 2KHZA 2BELA 5JIBA 2ZJAA 2NQ8A 2W7PA 1XZKA 5KYYA 4QXAA 1D07A 3WGOA 1BYIA 4QWMA 1VSVA 4XCXA 1JUDA 1XP8A 3OJ0A 3W5OA 4F12A 1X1AA 1MCZA 1Q17A 4WKBA 1C4OA 1HE3A 3KZNA 2DE0X 2I6SA 1PTJC 2WW8A 3TRHA 3ZU5A 4TS3A 1F6BA 3TX2A 4FYHA 3WMFA 2FMKA 5BUQA 1FYDA 2NYUA 3N8HA 1DC6A 2C3PA 4G5SA 1EFVB 4L85A 2WILA 1GQQA 1Z2AA 2EIYA 1T2CA 1FQKA 1SCUB 4C0SA 3SYRA 4RD2A 4GP6A 1NBOA 3VNUA 1CY1A 5JRDS 1GZUA 4DV5B 1AB6A 1WMSA 4TMZA 5HM8A 1U94A 4R6WA 1O5IA 4B80A 3S1SA 3RI3A 4NG5A 2QLTA 2GGSA 4CM8B 3SMVA 2ZWAA 3R3WA 3ED1A 2WZDA 1YHNA 1Y5LA 4JK3A 4IRUB 1AKQA 1P44A 5JNTA 2W6MA 5BVGA 3HEBA 3RVJA 2ZE8A 4GKJB 2WMYA 3OC6A 4RCNA 4BL5A 3ZE1B 4TL9A 2AB0A 2DSNA 5C7OO 3PE6A 1BDIA 4GSYA 4TM8A 2WHRA 5HBRB 2XXJA 2RD2A 1T3ZA 1OI3A 3VR6D 4KXVA 5ICCA 2Q1SA 1XQWA 4AK9A 4BQIA 3O83A 4UE3S 1GPAA 1BXKA 2PQ2A 1WEKA 4D99A 3IIKA 1TWFA 2VQSA 1P5RA 1RRMA 1F1BA 1RQ2A 1DBPA 1KBOA 4OGKA 3STXA 1CF4A 5TQ0B 4UCVA 1ZUWA 2CNLA 4HQ0A 4RSRA 3WIOA 2J85A 4BYGA 1VOTA 3SFTA 3E3NA 2IPMA 1I8TA 1PWXA 4OMUA 3T3HA 3SICE 2P65A 5TPZD 3MOGA 3RFXA 2QPTA 1ZLXA 1QHSA 4EPTA 4IRMA 2ZJ8A 1NUQA 4AS3A 4DM3A 3HXPA 5E7QA 1G41A 2JZCA 5HIKA 3LX4A 3BF7A 3L02A 2C3UA 2Z95A 2ZZKA 2O0HA 3T4UA 2XB9A 3ECCA 5EXDA 4IVPA 4X20A 4ODIA 2Z8ZA 1BMFD 3NJ8A 5DHUA 1VBFA 1MJGA 5KJ6A 2A5LA 5IP7G 3FDIA 5ERYA 2XT6A 1K88A 5KTKA 5ALFA 3K9HA 4XOUA 5I7EA 2A78A 2CYAA 4IIDA 4BMSA 1YRQA 3BIWA 4KX5A 1W4ZA 1FB5A 4CCWA 4II7A 1APBA 1QTQA 1XNQB 2RSLA 4PRZA 4J9OA 1MRZA 4L4RA 1HLPA 1TCBA 1FXSA 3CZ9A 4C07A 1I4WA 5KJFA 4DLSA 1I4LD 4J91A 3UKOA 3L6DA 5L7TA 1T1GA 4MJXA 1JXLA 1WNTA 3RHFA 3WOVA 4CDMA 2XV1A 1Z4NA 4Y2RA 3I6ZA 4C0XA 3O8BA 3CH4B 4NK4A 1L1QA 3I0ZA 1PW7A 1ONBA 3QVXA 3CEMA 3U3DA 4JI4H 2BGRA 5EYPA 4L7VA 1IE3A 1ADFA 4D9IA 1YQEA 4Q9DA 1YDGA 1A8IA 3W5CA 2W9CB 3VZBA 3ILYA 2PT5A 4CUZA 4QDJA 4GOMD 3Q3IA 2EFHB 2FQWA 4QWDA 4MMZB 5A03A 4V2UA 2UYCA 2LPMA 3QFTA 2PQ0A 1FTNA 4DMMA 3FA2A 4OBBA 2CF5A 3A26A 4RZ3A 2QTZA 2J3JA 2FSVA 1ZMTA 1BHO1 3TR5A 1ZDMA 2XMRA 3ZTYA 1NJGA 2Y92A 5BN4A 5C80A 1BDMA 2UUAB 3FIUA 1Z0FA 2IU6A 2C8VA 3UJ3X 4X60A 5GONB 5BV1A 4MMXB 5EUQB 4W1PA 4DLBA 4W7HA 3RSZA 5IT0A 1L9XA 2I5PO 3H0KA 4E46A 3F5FA 2CNBA 1PS0A 5FQOA 3TTVA 3KQVA 2ZRKA 3HQ4O 3IHTA 2V0NA 4UAGA 2HMAA 4NKRA 1IBKB 3UAVA 4ZKDA 2VSYA 5BWOA 2BRUA 3K05A 3K1ZA 3NT4A 3UMMA 2Y1EA 4KAAA 5EHIA 4XLLA 1KI2A 3ND9A 4I5IA 4D0RA 1I0LA 4GGOA 3PLAE 1L5QA 1EX9A 3W2IA 5FFNA 5JI3E 5IBRA 4QO7A 4GR4A 1JT2A 2C7RA 4QNRA 4R1OA 1RJ9A 3WK7A 5K3WA 4MGHA 2H2IA 2F17A 1XTIA 3CUWA 3IP1A 5H59A 4D9EA 2GAAA 1QH1A 3L8GA 2G1PA 1XRSB 1SCIA 4BFVA 4CR6A 2A94A 3DUFA 9LDTA 3H5LA 3A6EA 2H7XA 1HLGA 5EA2A 3EDYA 4WGGA 1F0YA 1JQJC 3EC2A 3STWA 3PFGA 3K6SA 1UADA 1JXQA 3TD6A 3AQIA 1FE8A 1T2VA 2ON6A 1GPWB 3NJ4A 1JFLA 2C5EA 1VPDA 3HSSA 3BMCB 3SQXA 5IN5A 1CUZA 2KX7A 4CT4B 3OLQA 3FFWA 1BWPA 5KOYA 3BK2A 2OXIA 4LPKA 1WDTA 3S27A 4ICIA 3Q7IA 6ADHA 1U0OC 2M98A 1Z18A 3OURA 4QUJA 2RHOA 4DV2B 3L8ZA 4GR5A 4Z0HO 4BNIA 2CLMB 4LXYA 4F8YA 3R6WA 4WFKA 1MQ9A 1DZ3A 3VJKA 3MLBA 4X7RA 4S0ZA 4GRDA 4YHHB 4DR4H 3DWFA 3EZFA 3EMVA 2BKUA 1HDRA 3VH1A 1YU9A 3RSSA 4B4WA 3LQ2A 1BJTA 3KJZA 4K6MA 2E4UA 4ZQBA 2ERXA 1HT0A 1N0WA 2OORC 1FBNA 3CPHA 2OR3A 2V7VA 3TDMA 2FLKA 3D6FA 4DIBA 4GVPA 4ITVA 3BPSA 4C4XA 3B9PA 4BECA 1ZW1A 1FYVA 4FGLA 1S2NA 1T5DX 1KAQA 2H7VA 4IBOA 4KBFA 1JG2A 1DFHA 4MV9A 2VA3A 4BO3A 2DB3A 2BR5A 3THWB 3SXJA 4AJHA 4X8OA 3ZDXB 5HX7A 1NW5A 4CF3A 4BGEA 3CW2A 1XZLA 3EW9A 4O3SA 1M10A 3WSWA 4L5CA 3AVQA 2V4UA 3MJSA 1OV6A 1XAIA 4DTIA 3LBYA 3NBXX 1BE1A 3IPRA 1EG2A 4HSGA 4EUSA 3TIVA 3V4ZA 4KR2A 3HYNA 3MRSA 3THXB 4MQUA 3PK0A 4YJHB 4A1FA 4YRRA 3AR2A 2DERA 5KYTA 2Z9DA 1FYXA 3GJ6A 3D6UA 1PJTA 4AYBA 2EDAA 5DHRA 1NW9B 1CIJA 1A4IA 2WDZA 1NVXQ 2WAMA 2ZJ3A 3HNRA 4EATA 4OHFA 4KE8A 2FRDC 5IJ9B 3GVPA 4L15A 3IMFA 3BD7A 5FAXA 3T3NA 3JAWB 2Q6OA 2J0UA 1AHIA 3WK5A 4N8DA 3RRYA 4UFPA 4D79A 1DEXA 3OFVA 5FPYA 1Y7HA 3LBIA 4I4LA 4H1TA 3GELA 1T9KA 2H92A 3QLJA 4ZVSA 4EP1A 1K3TA 2O3TA 4B79A 2Y9MB 1KAMA 3TRFA 2OAGA 5H80A 3PNQA 4OHUA 4H60A 1DTWB 3KB6A 1I5RA 2FZWA 4IDQA 1IBLH 1QYVA 1E3SA 5LQNA 5KWEA 2FW0A 4HTAA 2G1AA 5THXA 1LDBA 3BMQA 3REOA 1P31A 2FN4A 4L2IA 2JEZA 5IARA 4ZO9A 2GWRA 3O8OB 1HL7A 2H0QA 1N2ZA 2C2GA 2Q1XA 3HB4X 3OM8A 1K2VN 1XMVA 4YR2A 2QYSA 2Z0MA 1RJDA 4C88A 2EC5A 2XUHA 4MWCA 2WZCA 4ZA2A 4L4SA 4GDFA 3ZC3A 1E2MA 2XDQB 5FBWB 1Y34E 4NHEA 3O0TA 2OBMA 4WZBB 2GLXA 3WTCA 3RIZA 2Q0SA 2UZ1B 2BTQA 5EMKA 1OLXA 2BE9A 2YYAA 1VG9B 3RIYA 2H1RA 3NGMA 1ZNXA 1FP4A 3RSOA 2RKOA 1ZOLA 1U4OA 3VR4A 3PUJA 4MEAA 2DP4E 4A7PA 3OQJA 3GO4A 3NHMA 1DQYA 2Y2UA 2HSWA 3TBFA 3W8DA 2X0RA 4C6HA 3LOPA 3RRXA 3D8HA 3GXOA 3AU9A 3KREA 1NXXA 2JEOA 3CRRA 4TKUA 5EGNA 1GV1A 5G0UA 1AXEA 3DC2A 3QLVA 2CLLB 4I9GA 2M2IA 4EYGA 5CRIA 4V1CI 2H9AA 2FMTA 3R3ZA 5EP2A 3E3MA 3NOQA 2HHCA 4BVEA 1WH2A 2ZRPA 2WKPA 3GGPA 5D6OA 1ZJZA 4ND8A 5EJEA 3DW1X 2FPPA 1IZ7A 4QJ4A 1MH9A 4O84A 1NULA 1KHHA 1RJRA 4KL8S 3SLGA 4XB2A 3BDIA 3ONFA 5LBIA 5FTKA 2ZCUA 1F7UA 2DPGA 1T0PA 2WABA 1OLSA 3UYKA 4QU8A 3H4MA 4EUFA 5CEFA 4Z4CA 1JGTA 1G2WA 4O4JA 2R7KA 3TRJA 3TF5A 3IT2A 4KODA 3R76A 1N2IA 3OA0A 2FQ1A 3PV0A 5CGQB 4NBRA 1XU7A 3FPFA 5A4IS 1D7OA 5AJZA 2DSTA 2H1IA 2ZTUA 2UUOA 1E18A 4RPHA 4L72A 3FYSA 1NUAA 1YBAA 2P69A 4JT8A 4PVDA 2PBLA 2WB1E 2XCQA 4MQLA 4HVLA 4X64B 2KPOA 1KK0A 3ETHA 5BSTA 3EDOA 2ZSEA 1YQUA 2ET6A 2BZSA 1ZD9A 5L3QA 3VJLA 3W3AH 1DP4A 2GN6A 4WCFB 3QX7A 1SHJA 1HZJA 2OKCA 4UVGA 1JLLB 1G2IA 4BVLA 1U2TA 5F7XA 5KNBH 3RT9A 3NHKA 4OGWA 5LB4A 1OU4A 3IXQA 1GG9A 1RD4A 1SEIA 1FMLA 3HK2A 3Q41A 4LNAA 5LZ9A 3MPUA 1QLJA 1ZNYA 5JQGB 3T3MB 4KO1S 4X93A 4A16A 4H7HA 4XVHA 4L4UA 1TQ2A 4HYYA 3C87A 4J9MA 3Q0EA 5LQAA 2JGIA 4IO0A 4JR2A 3RU3A 4QTUB 4CV3A 4U7TB 1T36A 5C8YB 1V0JA 3PG5A 4J9KA 3AF3A 1YKSA 1WKBA 2XYHA 4RY0A 3LY7A 3JR3A 3QU7A 4QTZA 5E7IA 4M1MA 1XZCA 4D25A 2BQ3A 5JVDF 3KAKA 5JEEA 4YHBA 1QR6A 3DE3X 3NAQA 4Q4JA 1D4AA 4R2LA 4WCVA 3U44B 3VTAA 1P2GA 3EYAA 2QX9A 3P0HA 4TV8B 3QHQA 3DZKA 4Q9JA 5CDFE 2B99A 2NU8B 4XDYA 4DV3H 3H3XA 2I2DA 4X7PA 1R1DA 5F64A 1I2DA 2Y76A 1FZTA 1RYYA 5EESA 2I3BA 1PT5A 4NBNA 3LK6A 1WHSA 1PNOA 3LSTA 4MX8A 2WBLC 3W8NA 3I83A 4OFBA 2PFSA 1JFSA 1F5NA 3NALA 2R8IA 3OETA 1W29A 3T5DA 1T2UA 1NQVA 5AJXA 3WGJA 1JTFA 3TW4A 2DFNA 1C2TA 2L2QA 3LXMA 2Z1NA 2QUZA 3LLCA 4J9LA 1WQ1R 1BE6A 5C52B 2C4MA 5H4HA 3E8XA 3RJTA 2B0JA 2CV0A 1HNZB 2NV6A 2IYZA 4TTSA 3D2LA 1EQAA 3FBGA 3TSZA 2BBTA 2ZYDA 1ZINA 1K1EA 2VP4A 1I7PA 1M6VB 1P2SA 1KP2A 4Y9DA 1GGHA 4LYJA 3Q40A 1K7EB 1RVDA 1YBFA 3UMFA 5T4BA 4FIDA 1NPDA 5U4QA 3MUFA 4NL4H 1BDJA 1ZFNA 5EHQA 3VRHA 1FX0A 4YMLA 3BD9A 1EFLA 4WVFA 1N5JA 1JFTA 1PBTA 1TC2A 3QV2A 1WQ4A 2CJWB 4X7MA 4TTIA 1D7AA 3AVOA 2ZRDA 3CLTD 5D00A 2HF7A 1IZ9A 2AN4A 1ZRHA 1LBQA 1ORIA 1M34E 4JUDX 1Z36A 2E3JA 4KAXA 4MUFA 5M29A 1PYDA 1UMCA 1H0KA 3SNKA 3MOSA 4ZJPA 4JL5A 4O4IF 3S2ZA 3ZHCA 1WD5A 4D57A 4D9BA 4RHFA 4KYVA 2YBDA 4QX6A 1NOKA 4ZTUB 2W9AA 4P3KA 3SXPA 2WIAA 4DDHA 3GAZA 3CFYA 4H35A 4MTLA 2A1HA 3ZDRA 4WOBA 3OLXA 3HWWA 4C0AC 1GADO 1J07A 1JFFA 5I48A 3M33A 2FPGA 5EJ9A 3WGMA 2ZB3A 1XRNA 4JI8B 4G84A 1YB6A 1DT5A 4RNCA 1XCLA 1OTHA 2UXCH 5CGZA 4OJKA 5SYNA 3R5HA 1UMDB 4QHTA 3PNYA 5K2MA 2XDYA 4QFDA 5FX2A 1P81A 4G9BA 2I71A 1JEDA 4TX1A 2DIKA 4P84A 1B4DA 1ID8A 1QE0A 2XCSB 3KQWA 1VCOA 2C4UA 5IULC 2PO7A 3KSZO 3NTXA 4DMFA 3GRAA 2FMUA 4ED2A 2IDJA 1R0BA 3SC3A 4CLRA 1HNXH 3VSBA 4TVSA 2FFBA 2XXAB 2XTZA 1ODLA 4CU5A 1MR3F 3QZ7A 1UXIA 4OXNA 3W6NA 4MQFB 3H2GA 4BVHA 2IW3A 2R6AA 3QWBA 3FNFA 4P8RA 5JDCC 4N1AA 3NBYB 1OFUX 3CLHA 4NMHA 3SJAA 2NZXA 4ABTA 2PH1A 2OAP1 2AW5A 3GP3A 2HIVA 1C8VB 1EINA 3VVMA 5AW7A 1PV1A 4ZOLA 3T1HB 5HW0A 1IM2A 4V0RA 4IR9A 3UC5A 1A72A 1NJ6A 3E58A 2BBWA 5DN9A 2PX4A 2O03A 1U7PA 2YHBA 1JDBB 3W5VA 4HUJA 1JU3A 3HZRA 1IEXA 2ZCJA 2JCXA 1M5TA 4IWYA 2Y6UA 2V74B 4RAZA 1AY0A 3LS2A 4Q1CA 3LMLA 4OAPA 3OZFA 3S44A 3DDWA 1W0JD 4J4HA 1QG2A 1DG9A 3FOZA 2Y68A 5AK3A 4YJ2A 3WLPA 4BNTA 5KFPA 4TWJA 1DMSA 3A32A 5B5SA 5EIWA 4FSHA 1JQBA 1HE5A 5ICGA 2Y0DA 1T0IA 4AO8A 1AZLA 9ABPA 2DR3A 4KFCA 3DYIA 1VKHA 4H4EA 4B9AA 4KMOA 4E5UA 3I4NG 4HS9A 1C81A 1ESZA 4E0BA 2VG8A 1F3LA 1PLJA 4IZIA 2JS7A 3O6VA 1A5TA 1JDJA 5DV9A 5TRTA 1MRNA 2QL6A 2COIA 2CKZB 1CBUA 3VUFA 1QOZA 3FXAA 2BD0A 5FR2A 1H2ZA 4MVJH 1QP4A 3L8YA 1Z3IX 3TQRA 3TXXA 1VS0A 3OLVA 5JECA 1VPWA 1YS4A 4KSYA 1E2KA 1NBAA 3GRRA 2PMBA 5BW8A 2V9PA 4LF4H 4K28A 3WK9A 4AJIA 2CB9A 2WD7B 5B1YA 4R1UA 4D3XA 4C20A 1LDYA 1D2GA 3ZDEA 1USKA 3X1MA 5FUBA 4XR4A 3OZIA 3ICEA 3LHIA 1Q0LA 1BEUB 4Q0MA 3WBBA 3I1IA 1QG6A 3ZQ4A 3ILXA 1UK7A 4S35A 2P27A 3UFBA 1U3VA 2PZKA 3QVKA 2BEUA 2XNJA 1VL1A 2QRVA 4PTZA 3M1LA 5E2IA 3ZXXA 3KB8A 4L7QA 3AJ9A 4EW2A 4YT5A 3Q85A 1YQGA 4Y30A 1KOGA 2BFCB 2W6QA 1JS1X 3QKWA 3MHTA 3ISVA 3N6VA 2I87A 4EB3A 3MSCA 4DXDA 3H1TA 1OPRA 3VZRA 1XKLA 4U3JB 5ALWA 3T0GA 8GPBA 4Q02A 3TXAA 4PGGA 4L9AA 3T0IA 2UXBB 4S1NA 2AOTA 4LQDA 3TNDA 5DNEA 5T8KA 2BHTA 4Q16A 1XA0A 3G8DA 3G23A 2JA2A 4P92A 4CE6A 1EFCA 1M8KA 4CDRA 1A04A 3KQMA 5AXDA 5IYZA 3G49A 4BNJA 2ZR0A 1ODJA 3WYFA 3MNFA 1C0LA 3CM0A 1EWKA 3PKZA 2I2AA 1G6HA 4XSHA 1F0NA 2PWBA 5CT9A 3E7FA 3LBFA 2BZGA 4B6PA 1YGPA 4BO5A 1SZPA 3SKYA 1U8ZA 1BH6A 1M1NA 2ODNA 3THYA 4GOXA 4PYKA 2HPVA 1V4VA 4HLUC 1HT1E 5IHXA 2G1UA 3EG9B 1JEQB 1F6DA 1L7EA 3ORYA 4O4LA 4H17A 5CCDA 3TTSA 1A1SA 4G24A 3EBOA 5LN1A 5JD3A 4C7OB 1FUYB 3I01M 3UGKA 1BA3A 4H3KB 3G2HA 4G5QA 1I7QB 5KOHB 3I6MA 3GPIA 2M6SA 2XMGA 3PW0A 2WEKA 3NKLA 3LA6A 5AM3A 2DHDA 4HBGA 4ZAVA 5TX7A 4S2EA 1TO1E 1T2FA 4RK1A 1YDFA 7ADHA 4GICA 4ZVVA 1IN1A 1OWMA 4CM5A 1UJMA 4B8ZA 1XA3A 3M83A 3B7WA 3BWMA 2P67A 3DTGA 1LK7A 2VRWA 3A4VA 4FS2A 4YCCA 1A3GA 1W75A 4IDNA 3E35A 4H6WA 4N54A 1E61A 3DEFA 2Z8YA 4F4FA 2WWIA 4JBYA 5KKNB 6LDHA 2R8XA 2DMRA 3QMPA 3UY4A 4GLLA 1JYSA 4LRUA 1YB5A 3P2YA 1Q21A 4TXNA 4JI5B 3QFRA 4TQUS 4P4SA 4DT1A 5GJVC 1P9NA 3FYHA 1ONNA 3ZJVA 2ZE7A 1D1SA 5HKKA 1L5YA 1YZGA 5IKPA 1EP9A 2V7BA 1G98A 2ZQZA 3AESA 3DDUA 4F7DA 1CPYA 4QNNA 2ERCA 2PT9A 2HJHA 2FW1A 2GEDA 4JIMA 5MFZA 2V3VA 2DEUA 2E6KA 2Z4TA 4MUXA 2P4EA 1QJ4A 3AFNA 4LH6A 2EL7A 3UOWA 5KZMB 4EYHB 3DVLA 3MAGA 5CLFA 2ZYRA 4P33A 5K1ZA 4D3FA 4MW2A 3A36A 4LTNA 5D3ZA 1GLNA 1RBQA 3Q11A 4MS1A 4XIJA 3ENKA 1BKYA 4ZTZB 4JBNA 3QY0A 5CAEA 4BB0A 4ZYTA 1IEWA 3A2KA 3HKBB 1BGWA 1VBGA 4Y1FA 3B85A 3T3PB 4EPWA 3IBSA 4R5MA 2Q3MA 3IQZA 4AUNA 3EEFA 2A7XA 1IYZA 4TM5A 4DA8A 4EFDA 1RC8A 1XTBA 4KR7A 5K45A 4GXRA 2X42A 3DFKA 3W3AA 4Q9NA 13PKA 5EWLB 2WZQA 2ZRNA 1Z74A 5KNBA 3LGXA 3BQMB 5ALXA 2RGNC 2VDRB 4ECYA 3TWOA 1IK4A 1MC1A 4M46A 3QE0A 1TUBA 1Q7RA 3BILA 1KQOA 4AMUA 1WJGA 1OFHA 4EUNA 1HEIA 3JZ6A 1XAHA 2NTVA 3AI1A 3LPCA 4N0QA 2SECE 1L6RA 3QRWA 4NDZA 1NF9A 4LQCA 1IULA 1GKIA 4NMLA 2V6GA 2F1KA 3JZAA 4WZAA 2IOYA 2I8LA 1MT3A 3BXOA 2UZIR 4BLQA 2C4KA 2YW9A 3PVSA 3K70B 3IJEB 4L8GA 4WTOA 1EFTA 3ZKWB 3DNFA 1H2FA 3CZPA 1W87A 1YWGO 1T6YA 3UAGA 4KO4S 4ZI7B 2DLCX 3GA7A 1U7ZA 3MRXA 3K70D 3SXUB 4TLAA 1LPBB 4TQSA 4DV6B 5DASA 3T4PA 4J3JA 1IQUA 1MV5A 4IV0A 2D1YA 3PWTA 5JUMA 1ND6A 3C6MA 4KMSA 4RVHA 1Y98A 4X65H 1Z6GA 2HSEA 4ZAGA 3ANXA 5LMNH 2ZTVA 2HSJA 5SZHB 4MQ5A 3D9QX 5LQMA 4CMAA 2XVZA 4P31A 1F12A 4D8YA 1SIUA 1JIQA 2VA9A 4AJPA 1HYQA 1JI0A 1VLZA 4Q01A 5KFXA 1YRYE 4EJ2A 3C48A 2B34A 4TVKA 4LBWA 4BY1G 1OYVA 4O2RA 1ZD1A 1M2FA 3LUHA 4LWPA 4BFTA 4Q4HA 3IRVA 4QU0A 1XL0A 1AUOA 1Y9EA 1L3BA 4ZVOA 3I2KA 2ZIGA 2XDWA 3NHFA 2G7ZA 5C32A 1RPZA 1ZVVA 3ME5A 3QXCA 4Y3UA 3G3EA 3QVVA 3NVDA 1AUQA 1TWCA 1JYFA 2Q6LA 4PWQA 1P17A 4MUIA 4XEUA 1CKNB 4CW7A 3RBDA 3BQ2A 5FBZA 5BQPA 1F8YA 2HY7A 2WVHA 1I3OA 2OBYA 1WETA 5EWMB 5BPHA 4FJ2A 4HZUB 4LJ8A 4B45A 3DDSA 5FUMA 2QLFA 4TTQA 1C41A 4Q48A 4QBHA 1DQPA 2E55A 2AG0A 4I5GA 2QD4A 4KFSA 5B7GA 5JCZA 3CZCA 2OCAA 3W6OA 5ESRA 4FYXA 4MSUA 4M87A 5BT8A 1CLUA 2NPFA 1W88B 3ECAA 1BVRA 3ZCSA 3ZXUB 2QY9A 4NENB 3RUFA 1FXWA 1YK1A 1MXHA 2ZBRA 5DLFA 3RE1A 2QKYA 4RJ2A 3AGPA 4POOA 1SIWA 2XB4A 5DNWA 4EF4A 4OPMA 3BIOA 2QM7A 2IYRA 4PZEA 1AGNA 4B3GA 2E6UX 3DO8A 1S96A 4DR5B 3KWJA 4JV1A 3OZEA 1AKYA 3BL6A 3DEZA 5BWWA 3LKBA 1RJFA 4W6ZA 2Y1CA 3OM9A 1DXYA 4F06A 3QX8A 4OK3A 2C9YA 1B8PA 4OKIA 5BUSA 2I7TA 4BO4A 1FYFA 3WDSA 4GP9A 4A0SA 5ISMA 1GGNA 3RUPA 4Z6KA 2WU8A 2AFIA 5LYJA 1DIRA 1ZJ4A 2Q3JA 3CVVA 1EPUA 5DXFA 5A9SB 2PRSA 3DBOB 5KFWA 3WQSB 5I5YA 5F9NA 4Y6QA 1LLUA 4NAHA 3LUCA 3K5WA 3FH0A 2GVNA 4DM7A 3CG4A 3QPDA 4MEBA 3NXKA 3IXLA 3Q8RB 4INPA 2ECFA 1RQPA 4WLUA 2R6HA 4DBLE 4FYPA 1C29B 3C6XA 2QU7A 4ZGWA 2VOEA 3E22A 4G4GA 4INJA 1WCWA 1NJ2A 3ODGA 4JVOA 4LY6A 5CIQA 1N2OA 2OYRA 1C8BA 3IXMA 2HCBA 4AW9A 3NQ41 1FDTA 1YB4A 4WBNA 1LS1A 3S6JA 4I3GA 4JI2B 2O3UA 3L3BA 4AO6A 1E2JA 1DKLA 3LQ4A 3BHMA 2H1FA 5HJ7A 3IJ5A 5AHKA 4NEGA 2CEKA 3R8FA 5JHGB 3H4TA 3PQEA 3RFCA 2AQ4A 3X44A 3FUTA 4EGAA 5F5LA 2QNIA 2AUTA 1YJXA 4RJKA 3Q8LA 3LK7A 4MWZA 1YFJA 2D6FA 1CQJB 3PCRB 1E7YA 4HFRA 4RESA 2IY7A 2XCPA 2QXUA 5FLXW 1NHGA 1XC7A 1Z4QA 1IY8A 1YNSA 5EWEA 5JVDB 1O03A 1G8SA 3L7MA 4ETNA 4G2NA 1PX0A 4FKZA 1Q7TA 4IGFA 3RHTA 4RW0A 1T5SA 1J0AA 4YECA 3AKDA 3BWVA 3OMLA 4JNCA 3HEAA 3VA7A 4J7UA 1BE8A 4ZT3A 4O3FA 1ZYUA 3DBIA 4KPGA 1L7PA 221PA 3SHQA 3CWCA 1UR5A 1WX1A 4CF5A 2CLCX 2WJPA 3OE7D 2PLNA 4HAUA 3G85A 5EKTA 1KZ7B 4COOA 3B7PA 2WF7A 3QWAA 4U2DA 1Y8AA 5J4LA 4DG5A 3DVRX 1H2HA 4HPXB 4CIAA 2GBPA 2F59A 1PWYE 2DQSA 2GSDA 5I9TA 1Y8RA 2II6A 3DDOA 5A3VA 4KE6A 3OTOB 3KZMA 2WJHA 4A6PA 4ZOCA 5L3SB 1NJ8A 4F5DA 2ZRHA 5FWXB 3WISA 4CXMA 4GXNA 3JD2A 1W6RA 4NXNB 1FRNA 3ZK9A 4OF4A 4XZ3B 5DLGA 2B30A 2EIXA 4JC0A 4MVJA 1C3JA 1XDNA 5JMWA 1LBIA 3SBDA 3GV8B 3MT9A 1D4ZA 4YAGA 2Y0PA 1HNWH 3VPXA 3P2MA 1G5RA 1ZGCA 4BN0A 3NV9A 3KWMA 4DB2A 4CMIB 2EHDA 1E99A 3TKLA 1RQLA 2AJCA 3NP9A 1B42A 4MWSA 4F5ZA 3KO8A 3A04A 1GUBA 1OX4A 4PO1A 2X8JB 4CM4B 1N34H 1OLUA 1E98A 4RH3A 3QOWA 3ZWXA 1PYOA 3AH8A 3K2EA 1PVOA 2GCGA 4TXMA 3CNNA 3E7XA 2CLHB 3FDXA 5EXXA 4CV1A 1MJFA 2FN3A 2RGWA 2M6KA 1Z2EA 4PQRA 1OT3A 4A3DG 1C0KA 2Y0SA 4BX0A 4H18A 3HU5A 1ZXLA 3RASA 1NAIA 2OUIA 4DV4H 1KYQA 4DR7B 3VZPA 4NAVA 4XDHA 5AI5A 1K3FA 4UM8B 1NNLA 3BCUA 3TR0A 3MTJA 1K5GA 4OQZA 4H0CA 1K5DA 4OREX 3F6SA 3C3JA 2QRQA 4KYIB 5ECGC 4O4IB 2H1OA 2F6RA 4FQ5A 4LNHA 3WDKA 1XZBA 3FMGA 5M34A 3PNMA 1Q20A 5EE0A 1YOBA 1YCFA 3LQSA 4EFNA 1JWAB 5FL7D 3NHBA 2AZTA 1B76A 1DCKA 2PSSA 3CO0S 5CJJA 2P3SA 2LDBA 3ANYB 3L82B 3VGJA 2QXTA 4LIPD 1XTUA 3PC2A 3WQHA 5KFKA 4KEAA 3L0BA 4PHCA 2FK3A 1GITA 1DWQA 4LVUA 1RHJA 3T95A 5DOVA 3DLPX 4P36A 1XBTA 4YALA 5LA6A 1H6DA 2ZJZA 1XQXA 1NN1A 2YHAA 2O8NA 3ERCA 5A4DA 3KYCA 4DMKA 1QDLB 3JALB 3ETNA 2VT6A 5IZCC 1OHHA 4DR3B 3LZDA 1GZ6A 3N87A 4KZKA 4I1SA 4MCHA 2WTBA 1R5OA 2VDMB 3KSAC 2H9YA 2XDAA 1AK2A 5JALA 1OZAA 2CL5A 1NTOA 2ZSIA 4AKIA 3C45A 2X8BA 3KV1A 3NBFA 4KV9A 1H9BA 3HXTA 4HEJA 3HVRA 2PRKA 1HQYE 4NZOA 2NUTA 2XY4A 5H68A 5BVHA 4CG2A 2XCAA 4NULA 3KHTA 3A1CA 4GMHA 5CJ2A 4YV0A 5EIHA 4PE5B 1Y1VG 5GVRA 4N3AA 5GAJA 3ZJ4A 4M8NE 2CVOA 4GS5A 1BXRA 1XE3A 4XD7D 4MI6A 3STUA 4X00A 1YI8A 3LXRA 4QYWA 1DJPA 4XX1A 3PITA 4MRMB 3L46A 3F5QA 4LE0A 1GRQA 3ZHBA 3V55A 3ORQA 4HD8A 3TIXB 3RIEA 1FFYA 4DL5A 1W76A 3BCSA 4G65A 3G9TA 4GZ5A 2H65A 3WJ7A 5EXSA 2O1WA 2FFQA 4ZQEA 2W6PA 1Z5ZA 1T8PA 5I9IA 3QNMA 3DHYA 3WJAA 4WECA 3BREA 2CFIA 2WKQA 3E9CA 3ZBTA 2F3UA 4JI1H 3ZQ6A 4E3WA 4G9GA 2P6PA 1P5JA 1EVJA 2PWPA 4KPUB 4LBYA 1CY4A 3KYBA 3UYLA 4DIFA 4KPFC 1X1SA 4W99A 4XOIA 2GH1A 2NLOA 5GY7A 4AUEA 3OX4A 2O2HA 2D8MA 5JEDA 5KT4A 4I2VA 2OH2A 4M9ZA 2P2CA 2O7QA 4LZOA 1I4EB 3N8KA 4JP8A 5AKKA 2D2IA 5DCYA 1TKRA 1EUCB 3ZPXA 1WSAA 4LWOA 4BJHB 1R88A 2IH4A 2B3TA 4C7JA 1MT0A 3IYLW 4D0GA 4US1R 2JJ1A 1EZZA 2VHCA 3JV7A 1OWTA 8AT1A 4LK3A 1GU7A 2PUHA 3B6MA 4MAMA 4X62H 2AT1A 1XQ6A 3DMPA 2I4TA 1QV9A 3W0LB 2J3QA 1ZXXA 4AZ0A 1QK3A 4CF4A 4QW9A 5HUJA 1G8JA 3GCXA 2IZ7A 4WK6A 3GPDG 3S40A 5KREA 1JJBA 1G17A 1MJ5A 1RKQA 2GFQA 3JQDA 2UZ4A 1KZ6A 3RJ5A 1GOTA 3FPHA 3GCWA 3RAJA 3MIZA 4MUBA 4D1YA 2XMPA 2DFVA 3REQB 4AJJA 2SKEA 2VPYA 4DPKA 4BZWA 4TYWA 4C4AA 2B7BA 4I08A 1TKBA 3QQ5A 3OJXA 2GM4A 3LFHA 4J75A 3UPUA 3IT3A 4M1KA 3LUJA 1EXNA 3VYTB 2JGAA 3N53A 3D6TB 4ERNA 4LHSA 4L8VA 4RJIA 2O7NA 1P7CA 4S0XA 4LF6H 3NM5A 3MGBA 4EARA 5JYDA 3PR1A 3UBMA 1GSIA 2XMBA 3PJGA 3EXG1 1ID1A 2EJ3A 3N44B 3K0SA 1NBME 3PXGA 3VKWA 5L1IA 5HEKA 2P8JA 1YR1A 3K6KA 4XA8A 4IG4A 4URZR 5C4GB 1WUJS 4MQEA 3QEKA 1MABA 3ON5A 1Y9DA 3GU3A 4ZI3A 1AH2A 4ZRNA 3HVJA 4CCSA 2IOFA 4NS4A 3DD1A 1TECE 3ZR4B 4MCJA 2OCIA 4JIGA 5ELXA 3DYVA 4ROSA 1OFGA 2PL1A 1WBBA 5E1BA 3TTWA 1X1BA 5DT9A 3BHJA 3H04A 2BFEB 4H1HA 4XJTA 3MT0A 5K8TA 3L92A 3HM9A 1Y8CA 2VYVA 3ZWOA 1TA4A 2I7DA 4PTLA 4E94A 1PK9A 3LUPA 5JRZA 2HJSA 4DGSA 3OQNA 4B44A 2VUSA 1JR3D 5FL3A 3KM0A 3FDJA 4K6GA 3A9VA 1SOAA 1L9KA 2MOKA 1RRCA 1G19A 1UBFA 2XGMA 3IKJA 4NDAA 4ZHSA 2VP9A 4PZZA 3T5GA 4NONA 3O93A 4WXPA 2FMIA 2HTFA 5E7MA 1S3IA 3L43A 2HLPA 1WB5A 3NAMA 5A6SB 3T4XA 3LPLA 4BQFA 2EOAA 3HO1A 1Z17A 3EIFA 2I6TA 1C1XB 4Q3KA 4JXZA 4R41A 2XIJA 2C5HA 3HJFA 1EA7A 2MCFA 1RCTE 1NIPA 3G0BA 3RWBA 4GE3A 1SK8A 4MA5A 1ZPDA 3K35A 4GQBA 2IYEA 3DMNA 3Q98A 4PSAA 1XVIA 3QM1A 2B92A 4LF8H 3ZHUA 4Z5XA 3DE6X 2HPAA 2LCFA 2IXDA 5DWQA 2Q2TA 1U6IA 2EF1A 5TV2A 2YV5A 2YZNA 4ER0A 2WF8A 5L3ZA 6PFKA 5AKXA 2YV2A 3I73A 4KQCA 3SOPA 3TM4A 1YL7A 1NMYA 4NVRA 4PGMA 1Z28A 5FI5A 4BB9A 5JCOC 4H4DA 1YE3A 3FMAA 1E3TA 1BX0A 1WR8A 3ZWBA 5AT1A 5K0FA 2D5LA 4LV8B 1JLSA 1IJEA 4ED8A 3A7DA 3FYCA 5KFGA 3LKZA 2C1ZA 4G5GA 4MB0A 3BACA 1PGJA 2DFLA 2EYQA 4AWAA 4MW6A 3NBZB 2WVJA 2QL9A 4RB2C 1SUDA 4WADA 4NZPA 3KYHC 4X44A 3EGIA 1K97A 2NYAA 4WK2B 1DO2A 4J0FA 1SHTX 1XWFA 2ATCA 3ZWNA 2WTMA 4UNNA 1CE8A 3G2JA 1I9CA 2A0YA 3VC2A 2VBGA 3E1GA 2ZLBA 1RJQA 3L6UA 1UKBA 2ACVA 2ZS8A 1G6Q1 4DCMA 3AETB 4ZK2A 4GL2A 2O1XA 3AUFA 2VBFA 3O21A 1N77A 2Q5LA 5BORA 1ES9A 1FFDA 1T2EA 2ZETA 1SZCA 5DN6A 3A4YA 3OZDA 1U7XA 4GBJA 4QVKA 4JI7H 5DGXA 2O3QA 1DI0A 4GF5A 4EQ6B 5IVPA 1SU8A 4XWAA 2H6EA 2IQIA 5JWHA 4HWGA 4WESB 4Z7NB 1HYHA 3K9QO 3OZSA 4BU1A 1N2GA 2O05A 2O8DB 3GBVA 4LYEA 1YAJA 5LMZA 3D1JA 3FWKA 2Q07A 3QVGA 1YF3A 5ALYA 2R79A 3HLKA 5DTJA 4Z51A 5HDQA 4GPTA 2VP2A 1U0RA 3MJTA 1BNCA 2ZYAA 5A4KA 2GM5A 2XI4A 2Q8NA 3E2PA 1C30B 3DM9B 4O2BA 3S99A 3C7TA 1YB1A 5K0CA 4JBXA 1KAGA 2WWYA 1X9NA 1KMHA 1WP9A 3D6NB 3NHUA 2JIZA 1EVZA 1A9XB 1TF5A 3KZXA 3DWGA 3WYNA 4Y6PA 2O8VA 3I5XA 4DBVO 3N76A 2AVNA 2PYZA 4GKKH 1GCIA 1QO7A 2IHVA 4NE2A 2HA5A 1XJ5A 1D2RA 3MWDA 3TLZA 2P41A 3RS0A 4I6GA 4KI7A 1SCDA 2J3KA 3HDJA 1DS6A 3X0DA 5CA1F 2ZCVA 1QM5A 3UCEA 4MOWA 2RONA 3S1AB 3L6BA 3V4VB 1LJUA 4DV7H 5EPEA 4JXJA 5L6LB 1EE1A 2ZI9A 4W63A 3AEUB 1J1IA 3WL4A 2OGSA 4TVBA 4DSNA 1KIFA 2JBAA 5BPFA 2RDMA 3GA0A 1O95A 4ECSA 1QB7A 1K7FB 4ENRA 1QKKA 4RFVA 2BONA 5AH0A 5E3IA 3KPUA 1NXVA 1Q95A 1JHYA 4X3CA 1VJCA 2RHTA 4QDTA 3AV0B 1NQOA 2H5JA 5CFPA 1JW9B 1R0KA 4J16C 4O08A 1Z6ZA 5F2OA 2PVCA 2D00A 4RM2A 3K71B 4LN1A 4A0FA 3GN2A 3L7KA 5K20A 2RKBA 2P2SA 3HCCA 3P9XA 4RYDA 4MYRA 1KYZA 4PZPA 3D6VA 1XRMA 1LPPA 3DYBA 1HDCA 2O8BB 3I72A 3HRIA 3ZVKA 2I4LA 1CZOA 3V7NA 3A6ZA 4I9FA 2BMAA 2VYNA 1OTYA 1KQGA 4YT8A 3OEYA 3C8ZA 2OFOA 4Z86A 2F3SA 3M9NB 4PHFA 2AK3A 2VPSA 1MVLA 2ONKA 3ZHZA 3MMNA 4FLEA 1N9GA 1HA3A 3FVQA 1VE6A 5C1OA 5KJCA 1ZA1A 6REQA 3U7FB 3BKWA 3MZ0A 1ETHA 3S29A 2QJOA 2IHJA 4P0TA 2VBIA 2EYUA 4XH9B 1JR6A 1N8TA 4FTWA 3EY4A 1V11B 4QYSA 4N3BA 4JJ6A 3VU9B 4BVKA 4JBLA 2R4QA 4TT3D 4B7XA 2AX4A 4E31A 3HKZE 3TE7A 4DQXA 3GJ8A 1NFFA 3RT1A 3E9QA 4R8MA 1U5AA 2MSCB 3LSYA 3COYA 2UYQA 4DL2A 4QASA 1XNRB 2G40A 2E4WA 2I2XB 4EYSA 3PIRA 1AE1A 2JFHA 1RQRA 3AVPA 2O23A 1M72A 3JATA 1Q77A 2IYUA 4R2IA 3FHLA 4CQMB 2Q5HA 3DVAB 1Z7GA 1MO2A 4P80A 3A0UA 2PRIA 1KT8A 4JJIA 2WG1A 4NE7A 4QSHA 4Y7CA 3QH4A 4J0GA 3BXPA 3KZOA 3VC1A 4Z2AA 2YMPA 1G5HA 1Z4JA 2OV3A 1NW6A 4CQMD 3RRNA 2IHNA 3U0GA 4ZT2A 3QXJA 3E3LA 4BTVA 4IZ6A 3C5WP 4JOBA 5I3ZA 3EVNA 2YWRA 3JQQA 2GEJA 3W9YA 3OVMA 2EZUA 1DCTA 1IWPB 2BFNA 2WI8A 1X87A 4HQKA 4DV1B 2VN8A 4XDZA 4C4ZA 2HJVA 4DIEA 1KIMA 5ELMA 2F67A 3TSOA 5CVJA 1EFRA 4Y7DA 4BMXA 5MFPA 2FQXA 3KPVA 5CB6A 2QVBA 4ZWNA 5KTPA 4BQOA 3G0OA 2PMWB 4H6VA 3QY9A 2NO5A 1B1AA 1DGQA 2G0TA 1QIMA 3LP6A 3FTQA 3VYSB 5IT4A 3PL5A 3EYYA 5JWOA 1TEVA 3ORSA 3OIUA 3O7WA 2IWRA 2E5LB 4LKRA 5G4LA 4X1IA 5JU6A 4XM2A 3S55A 4RZHA 2ZM6H 2O4CA 2OV1A 4BO0A 1IUNA 1PS9A 2XJ9A 3C1TA 4GZMA 4UFOA 3U54A 2BM0A 1VBKA 2WAQE 4RPCA 4EHIA 2V4RA 1UFOA 2D06A 3N3AC 1HDGO 3MWLA 4YFVA 3IPYA 3OI7A 2RJNA 2FEMA 3OCJA 2IOHA 4I50F 1NGSA 1R66A 1S7CA 2GNAA 3CPSA 3GV5B 3GL9A 4YASA 1QP8A 2VTVA 2QMQA 4N5NA 4I1OA 3Q3JB 4W5OA 2W4QA 5CNMA 1H85A 4LFCB 1FP7A 2A0XA 1G1AA 2PKXA 3A4LA 2EFGA 1A4XA 2A1TS 3LXXA 4FWTA 2NSYA 3RVDA 4R0VA 3ESBA 5E7JA 2FEXA 1SM4A 2DQZA 4X7BA 4O59O 2EQBA 3SX4A 4CM9A 2R84A 3E4DA 2FETA 3O2JA 2XWSA 2W43A 4H3HB 4LHXA 2ZSJA 2DUUA 3GILA 3B5EA 3WOHA 3IQXA 3S8EA 5LQDA 1RYHA 1NVFA 5HIIA 3I2GA 3LY9A 2RCNA 3GAFA 3E9MA 3EDRA 3D54D 3ITNA 2IV3A 1HBJA 4MA0A 4N9QA 4BO7A 3SZMA 2FKLA 4R16A 1WKVA 1XQ9A 4WACA 5DMXA 5IBQA 3RU9A 2IYFA 1JA9A 4HGRA 1COWA 3B1KA 1TFUA 3S0JA 2X6RA 3GDOA 1L1EA 1RPNA 3CSUA 3U13A 5C8VA 1R0ZA 2EWWA 3E0QA 4YS6A 2HRBA 4M8LA 2WTEA 1LZLA 3ADCA 4OJMX 4Z2YA 1AKMA 5F76A 4D9JA 2BH9A 3C15C 4YT2A 1ZM3A 1EWTA 5AI4A 1H8HA 2HV8A 2PGLA 2P0AA 3UAWA 4OL9A 4JLKA 1XEFA 3WKBA 3ZGVA 5BQFA 2MYPA 3MBIA 3F3KA 4CKXA 2EEPA 2FN7A 3UJPA 3KPJA 1OVGA 2C7QA 1KAOA 1L5LA 2JFOA 1T2NA 2Q3HA 3FSGA 1GTL1 1G9TA 1U1CA 1B2RA 2PMZE 1QG0A 2NVXA 3MTEA 1P3DA 4AJ9A 3KUXA 4EG7A 3OIDA 1JJFA 2HWKA 5DLPA 1SKBA 1UXJA 1DAIA 1A2OA 1XZNA 4J94A 1Y1WG 3DHEA 3W5SA 1XO1A 3BIJA 4UDXX 4LBVA 1N2CA 4QIWA 4F4JA 1IVNA 1I3KA 1PD1A 1KSJA 5HF8A 5EIAA 4LOKA 2PJUA 2VRCD 4UFZA 3KXLA 5KYUB 4JBGA 4MR7A 1YR3A 2X3FA 4WXYB 4OI0A 4FBTA 2HC9A 4J1NA 3I58A 3U4QA 4LXUA 2NP7A 1YJAA 3WK6A 5CH3A 2OFXA 1F17A 5MF6A 1NV9A 1KH2A 9MHTA 4CE5A 1W5TA 1AVTA 3L7AA 3VDXA 1P1HA 1KYXA 1H69A 4K40A 1IUKA 5KTNA 4AWBA 4B3RH 3FMPB 5JJCA 4MIOA 3K1JA 4BMZA 4GPZA 5LOVA 4Q3OA 4BVGA 5K3SA 1KEKA 1TAQA 1E1RA 1TYBE 3BL5A 2BMJA 1RI3A 2IYLD 4J2TA 3RAXA 2GAFA 4TOIA 5DYIA 2YXDA 4YRAA 4IDDA 1L7AA 1PBNA 2ZQ5A 3L7LA 3UJHA 1RR6A 3IEMA 1Q0UA 3UUFA 4XJSA 3JRXA 5ESXA 1UMBB 4YDRA 4N7MA 2WSSD 2VYQA 4IHQA 1MNAA 3AL0C 1N6RA 1V7PC 5T4FA 4BN5A 3EQZA 4UZFA 2BM1A 3SZRA 5DG9A 4EPVA 1E2LA 2KJQA 1NJFA 1SU6A 5KTMA 1XTJA 1KO4A 4I6JA 1OOEA 4ABYA 3KKOA 5GP1A 3ZV3A 1UPCA 4BWFB 2FJZA 4M2LA 2IEBA 1PZGA 3FSJX 4DCTA 2Q9UA 1G2QA 3WICA 3L40A 1R16A 1N6OA 5AVYA 1WB9A 1KEEB 3MTAA 4JEUA 5EZ6B 3VZCA 2BTOA 1A2BA 2AN1A 5B6PA 2J45A 2R85A 4TS1A 2F8LA 5BWNA 1Q0RA 1YCGA 4FX5A 4BGUA 4KRFA 1A0GA 4IH1A 1JT9A 1FEZA 2VXYA 3JPWA 1MO3A 2WRZA 1SUBA 4A3JG 3ZLJA 3L41A 1ZN7A 2ZJFA 1XRJA 2HUNA 2J6TA 5JO0A 4GKAA 1WKCA 1D03A 1R3DA 3A6PC 4HOYA 3PFHA 2AQHA 3PU6A 2WYOA 3BE6A 3ENZA 4C21A 3QP9A 3T1YH 3VSAA 1MUUA 4FUQA 3QLUC 4JYZA 1PT9A 3F9RA 4XYBA 1NW4A 2PJRA 4TVIA 1PYGA 3AIIA 3IBFA 3SR0A 1UFVA 2A92A 4REQA 4MR8A 3IA7A 3UTCA 3A1SA 5KC8A 3AFOA 1NQUA 3VH2A 2PGXA 3NC1C 3PDJA 3CZ5A 4LF7B 2PH5A 2GZDA 3Q87B 5JY6A 4MUGA 3WTBA 3D1LA 3QZ8A 1W8IA 2AE2A 2OD9A 4UCXA 5HFJA 3VYVA 1CQZA 3H1FA 3V2GA 5GJWC 1JDVA 2H1LA 4RDCA 1XALA 4PZ6A 2O7SA 2TMKA 3OSPA 3DBVO 3VU1A 5AVRA 2XX3A 4GPBA 2P9ZA 1W94A 1NLMA 1ILEA 3WAKA 3FCXA 1IG0A 4Q1EA 4EHBA 4B3XA 1SCKA 4LC9A 2TYSB 5DGCA 1XEXA 3D7MA 3TR6A 2VI5A 3ZCXA 3U4CA 2ZYHA 5B6JA 3DCNA 1B2LA 2SICE 3ZYCA 4Y0AA 4WFJA 3IEVA 3V6KA 3LXUX 4UZEA 1RQGA 4ER6A 3C6YA 2R7ZG 4R3NA 4QVIA 2WHPA 1F7VA 1O9GA 2BEVA 1LTQA 2C04A 4LSWA 3GG2A 3MS7A 1B41A 4LNUA 3ZDDA 4W1QA 1BWQA 2R93G 2XYGA 3VR2A 1MEEA 4R1TA 4XQ0A 3UH1A 3E48A 4BNHA 1J42A 3OOSA 1T1IA 3IIJA 4MVYA 3KJFA 2OVBA 4UCUA 1RIIA 5JI2E 4LYDA 3DVQX 4TL8A 4KQXA 1YRAA 1KRHA 1RLIA 3N9IA 3OQ1A 1SOUA 1YXMA 2ODTX 5KFLA 4L3WA 1CY0A 3I04M 2ONZA 4KNWA 5CXSA 2O4UX 3IQHX 5BSEA 3W04A 4ARBA 1WXGA 1Y1QA 3N2KB 4UXHA 2HLDD 4WIAA 3HO6A 2SCUA 5IDWA 2C92A 2WV7A 3H3FA 2QTTA 3TQIA 3D5QA 2IU4A 2EJVA 2CHEA 4XUDA 5BWLA 4YREA 3FPAA 2C84A 3GMDA 3O4GA 3KQLA 3NC0B 4MEJA 1TWGA 4CCYB 3AONB 3LWZA 4MPPA 5IW8A 4NR0A 3DKPA 1BO6A 1MJNA 4IIBA 4XYMA 3LMKA 1S68A 4EJFA 4FUTA 2DHCA 4D74A 5KWSA 3D2CA 2XGSA 5JPIA 1KXJA 2GEBA 3CSSA 1FNCA 3P0RA 1A9ZA 4MVWA 4LOHA 3THRA 4H59A 2CNKA 2OORA 5JNLA 3EVTA 4BQEA 1P18A 2JVKA 2P90A 5HKLA 4AYTA 4NJEB 1ZUD1 1NI4B 5I7OA 1FQOA 4MVCA 2M32A 2HN9A 2QORA 4GUDA 5K3DA 1KS2A 4F56A 3LLUA 2IIVA 4JA0A 4P5EA 2IUUA 4BJ6A 1Y33E 1WPQA 4DMLA 1F2TB 4PZUA 4DZTA 5KFNA 4NESA 3VV2A 1TZJA 2W8KA 1DQNA 3HB1A 5F3WB 4HLCA 4BRUA 3FWNA 4FYKA 5GGYA 3K9LA 4YV2A 2ZJ4A 4C2TA 1TIBA 3G02A 4RVUA 7AT1A 4NMMA 1ZM2A 5EOVA 1PT8A 5I9MA 2QT1A 5FUVA 3N28A 4HTFA 4GQIA 1QQBA 2FU5C 2I1QA 1G3UA 1U28C 3PDIA 3QFSA 2W6JD 5T64A 3FFBA 5FPOA 2ZTHA 1B3RA 2R97A 3PP8A 1ZZEA 3PXXA 3PJRA 3IAXA 4WAUA 4BNGA 1T9AA 3ZGXA 5KYWB 2AMJA 1AK9A 4OUKX 3VHLB 3FETA 5CFRA 2R2AA 3TTTA 2NN3C 1Z2OX 1P39A 4NE9A 2PSEA 3NMUF 1KZHA 2EW2A 2KE5A 5IVIA 2HXYA 4Z9YA 5KT6A 1XI2A 1KI4A 3Q1KA 2CMKA 3N8DA 3MCUA 3W7BA 4FYJA 3LPDA 1U4SA 3T3DA 4KIGA 4MP3A 3ZDCA 4Q7EA 2I3ZA 2UU9B 3E3AA 3ZEIA 4O7NA 3A28A 1C4XA 5E4FA 3R7WB 5LB2A 3T9AA 4LFAB 2R751 4Y8VA 1H4QA 2BTEA 1TA9A 2XYPA 3GLFA 3FMVA 4BBZA 1VL2A 3B8HA 1B0AA 2JEFA 1KKLA 4OATA 4CQJA 3W2HA 1A98A 3T38A 1P8LA 2AXEA 1KVSA 2PD4A 1EIWA 1VMIA 3IBCA 3LVFO 5COQA 4MS3A 1L4MA 2F4NA 4DIDA 3KZ1E 4OK5A 5SYAA 4KN8A 4ZVUA 3L1IA 2IRWA 4PU0A 3R0VA 3TCKA 4QGSA 1P1KA 3W1WA 1YR2A 4ZQIA 2ASLA 3PPIA 1UZAA 2HIMA 4PR3A 3H8WA 4QQFA 3PZRA 2NACA 3GFFA 4EL0A 3M6VA 2GMWA 4F9EA 4G8DA 3BOSA 5CVEA 1S9FA 5JSQA 2XYRA 1J23A 2AJBA 3BF8A 1MV8A 1G5FA 1O7JA 4B3SB 4EYQA 4AURA 2OUKA 4KLCA 2E4AA 5DYGA 3NT5A 2XEXA 5K3EA 1E1NA 3P0EA 3IAFA 5AKIA 1FKAH 2YHIA 2EG5A 2CV2A 1EKPA 4ZEWA 3OTQA 3KV3O 1TLLA 2CYCA 2JK0A 3FWPA 4PLCA 1QYDA 4FJ1A 1H42A 3GFRA 5EZQA 3VKFA 5AW3A 1SNYA 4C0BA 3PT5A 3CVJA 2PX2A 4OU5A 2CCGA 2QYHA 1A48A 5CA1B 3UXYA 1G20A 1EP1B 4LCJA 3W9BA 1JV2B 5JCJA 5LZ5A 1RMYA 3UJ8A 2Y0BA 3W2TA 1MPTA 3HGTA 3JQAB 3LRXA 2HCTA 3DCYA 1WY7A 1MA0A 3FHCB 2ZIUB 5A0VA 3I61A 6GPBA 5FWYA 2K87A 3KAQA 1PQWA 1A77A 5GMOA 3KKQA 2HK8A 2GBLA 1V43A 5F2KA 4OUDB 2J3LA 1QBGA 1IC6A 1RTKA 3VU0A 1RDFA 3Q7SA 3JQAD 3LT4A 2CD9A 2Q0HA 1I6WA 4I8IA 1RI1A 4UW9A 1G291 2QN9A 1NDUA 2QW0X 2X9LA 3G8AA 3RC2A 4IMIB 4QARA 1NRWA 3AYXB 3HWRA 4PY2A 4OQYA 4LZPA 5EQFA 3KJHA 3QXGA 4BQRA 4ZZ3A 5F7ZA 1PLKA 2D7JA 5JRJA 4O7LA 3GTOA 3U7HB 2FEOA 3WWZA 1X38A 4XQEA 4DW8A 1F8FA 4LKOA 1CRLA 3BICA 4ACAA 4B6SA 3GTMA 4ES6A 1U0FA 5T6MA 2OCXA 2VJDA 3PRYA 5AYVA 2W9BA 2A57A 4UTXA 1YRBA 3G8YA 1ZJ6A 5EWJA 4IGEA 2W71A 3ROXA 3AYZB 1DEKA 4DQKA 2IEAA 3FPLA 4YP0A 1P7VA 4R0MA 2PS9A 5LD2B 1X1QA 2OV4A 4RHUA 4C6RA 3ICCA 2VKQA 3AUAA 4XVCA 2V54A 3C5VA 3HUUA 4JU8A 3UAYA 3UV3A 1NQAO 3L6CA 4Q5IA 1YFKA 2W98A 2VDNB 2CHVA 1Y63A 1XG5A 2MMCA 1AXRA 1LTHR 3VR1A 3RF6A 4MV0A 1OIVA 1H3EA 2R2GA 5DW0A 1ECJA 4R1LA 4A03A 4RKYA 2IY8A 2ZJ7A 1O5OA 4K9OA 5H02A 4IXTA 1OX6A 2EEZA 1P2VA 1F4VA 4QOFA 4H7FA 3BMXA 3M34A 3IOMA 3KVYA 2JNWA 5BXQC 1DX6A 1J8YF 2GPJA 2H1VA 4UCSA 4GI5A 1ISPA 4KC0A 5AI8A 2ANCA 5C31A 1BG6A 4AJNA 3UGJA 1GN9A 4QREA 1R0WA 3RYIB 5ESWA 1A97A 1IHOA 4M0CA 3CIFA 4MVXA 1GYFA 1UZUA 2HRZA 1DBVO 1FFAA 2FUG6 3CLRD 2R00A 4QD3A 2X5XA 1LDGA 1T8WA 5BWMA 2ZUBA 1COZA 3UMSA 4QEZA 3D64A 1ZNWA 3CZAA 2G4CA 3KPWA 3U6KA 2QV0A 3P71T 4Q03A 1QGOA 3WC4A 4W8OA 1XKTA 3U6BA 1T0JB 2FFAA 4ZXPA 2BL4A 3RBEA 4WW0A 3RYCA 3MUOA 2PV0A 2NQ2C 2Y9PB 3HKEA 1TZBA 3MS2A 3D0KA 2QTVA 1KYIA 3LBAA 3ZH9B 2OYSA 3FSEA 3VPSA 3CVUA 1FRVA 1DOAA 3HYTA 4NC9A 3TKYA 3NPMA 1W0KD 3L4JA 4E32A 5C5IA 4IGIA 2LIVA 4F4IA 1S9HA 1DB3A 3WWDA 4ZARA 1GPLA 2G9VA 3Q8QB 2IS4A 4O3QA 3TW8B 3TUZC 5IM4F 4ZYYA 3DT6A 3HJCA 3COWA 4WN9B 3CX4A 1F5SA 1G8HA 3GZTB 4I50B 2D4HA 1TQ6A 3CC8A 1X7YB 2JGMA 4FDTA 3L01A 2AZMA 1JQ3A 1LJLA 3OY7A 3B1FA 3R5FA 2ZAMA 5KFYA 1G0OA 3QPBA 5F98A 2H18A 2GJAA 1DHTA 1Q91A 5D86A 1T13A 4EA6A 3T9CA 1CQPA 3TNFA 1I2KA 3A1WA 1CUCA 1X1CA 8LDHA 2CHGA 2UUCB 2H0AA 5DSXA 5E6RA 3DXYA 1JKMA 5IP5A 1Z4IA 2C9DA 4YT4A 1ECBA 2LR0A 1QGZA 1WHTA 1Y9AA 3SHFA 1OASA 3EMBA 2K6GA 2BFBA 5LUBA 3CZRA 1BXGB 4EYEA 3VR0A 1P60A 2P2GA 1LPAB 5JAMA 3MXOA 1NN5A 4JSYA 3FJYA 3B6IA 2HBQA 1NTRA 5CBPB 3KYDA 5AVSA 2AJTA 1QH0A 3OU2A 1I01A 3BSSA 1W35A 2A4MA 3DA8A 1TYCA 1UT6A 3B38A 2Q3BA 1FC0A 4D6PA 1YS9A 1N7JA 5KQMA 4YROA 5DG7A 1BU8A 1GGEA 4NU6A 1THMA 2RH8A 1U99A 2JLZA 4IIXA 2VTKA 4D44A 2YYYA 121PA 1N56A 3A6GA 3FVVA 2BV3A 3SY8A 3DUWA 1FUIA 3HCPA 2IIQA 1SXJB 2CXRA 4B6JA 3T5PA 1QBKC 2ZFUA 1US8B 4DLPA 3HA5A 3PGLA 1UOPA 1N2XA 4IS2A 1RIFA 4PQYA 5E25A 4ZAYA 3D3WA 1SOVA 4GGMX 2XMCA 5G4KB 3PFIA 3K4HA 2YZLA 2OBBA 1UXHA 5FV7A 1I36A 1SXJD 3MTQA 1VJDA 2G4LA 3FCUB 4N0DA 3G6WA 5KO2A 3IQGX 3AR8A 3VZDA 1WAMA 2PZLA 5JDCA 4C4RA 4U2CA 2W9XA 1OXMA 2O2EA 3NWJA 3QTBA 3UAZA 3ZHXA 5DGBA 4MTEA 3VISA 1X9GA 2CBXA 3P4YA 3UZBA 1NUTA 3AEQA 1VECA 2INGX 2FSSA 4N01A 4V0ME 1NJ5A 3EAGA 1XLUA 3EFBA 1PJSA 5EWGA 2Y05A 2LBPA 4O4HA 1WDWB 1RXSA 4KDEA 4ZYWA 5K9ZA 4KN5A 2AL7A 4UCRA 2IMWP 2H29A 1O6GA 1GL7A 3OWHA 4ZVLA 2ENWA 2R7NA 4HGPA 1QVAA 1JLKA 3FCEA 5D3KA 4DBLC 1P9RA 4IUCS 2ZTMA 4U7PB 1LBEA 3NGLA 4YRGA 4HI0E 2AN5A 4XQCA 4XWYA 5KKCA 4BEBA 3OU7A 1XMIA 4EAAA 1YV9A 1MHPA 1UDBA 3OQOA 3EN0A 3ZQKA 3IKMB 3L4EA 3TNLA 1IWBB 3TAHA 3GGDA 2CW5A 4RACA 1UAGA 1CIPA 4X1KA 2DCUA 3IDQA 4RU1A 5IVHA 2QB5A 4AZ3B 1HC7A 3F96A 2WHEA 5I7SA 3DXFA 1SAYA 4Y2JA 2MIIA 1JG7A 4UOZA 1E2FA 1SC6A 1E1CB 3QKIA 1E77A 4WN3A 4XJVA 3ZK7A 3KUDA 2R8BA 4E88A 2IZ0A 1KH3A 3NOXA 1FLVA 2YWDA 3LT2A 1Z33A 4LJRA 4X0EA 3UOAB 3WKDA 2Q9AA 1U8YA 5C5JA 1RWWA 2ZEJA 4E2WA 2B37A 3O4JA 4PG8A 5JZMA 1V16A 1TWAA 3TLXA 1LDMA 1FDRA 1NX9A 2B21A 5I5TA 2ZT7A 4P81A 1T4BA 3W90A 4G0PA 4JB3A 1P2DA 2FMFA 4DAOA 3BH0A 4LISA 4W1SA 3BH6A 3RYFA 4KK3A 2W22A 3DEYX 2RDIA 2VHWA 4RENA 1M1YB 1Q1AA 5EMMA 1I32A 1YBVA 1QF7A 2DETA 3BE5A 4GZ3A 1K7SN 2WFLA 1N3YA 2PUBA 3UK0A 1EVLA 2NXJA 2O2XA 2GVDC 2A5DA 2P1DA 3I3SR 4M0FA 3EIWA 1UBOS 2EGHA 2X9NA 4TWAA 5HZHA 3IE0A 821PA 2EKQA 5EHNA 3R24A 1VJ1A 2QUHA 3F6PA 4KO2S 3K6RA 3FZYA 4JKOA 3KXIA 3KT6A 1PZEA 3CF0A 4E3ZA 1WSWA 2C31A 4OHBA 4C5BA 2O6LA 5KQGA 3RB6A 3FNBA 4LV5B 1DBIA 4UU0A 2IYXA 4TV9A 4JUZA 2KSWA 4YRTA 1KR2A 3FNEA 4XARA 2ERYA 3NETA 4PG5A 3FUCA 5FLXA 1BFKA 4ZOQI 3RJ0A 4OBWA 1CVIA 5JW6A 1ZGZA 1T8TA 1UPTA 1GXSB 4M53A 4OQQA 5J2TA 1WL8A 5ALTA 5H70A 2DZDA 4JY7A 1XMOH 2IBMA 1OUMA 2HVQA 4FFLA 2ASEA 1JF8A 2XQFA 5K4HA 1UWCA 5L8VA 2NUPA 1I24A 2P75A 2VJBA 5CB4A 1FFBA 3TCNA 1THZA 3EISA 2F43A 4GAEA 4D9NA 3CVOA 1U8FO 4HNAA 4QGHA 3DEIA 4RZXA 1NVBA 2BDUA 2ID8A 1DWPA 2BR3A 1JVNA 3NBUA 4CT0A 5SV2A 4IWNA 2D8AA 1RRKA 4UTPA 2YUIA 1CSEE 3JQCA 4CJXA 2JFPA 2QRNA 1Z7EA 2F4VH 3A1TA 5B30A 3SVTA 3F0TA 2ONCA 4ECTA 4L8YA 2Q1TA 1J70A 1Q16A 4WUVA 5JVLA 3E53A 4KMRA 4P4TA 1T3LA 1FNMA 5TARA 1ZUNA 3W77A 3U7EB 3GTQA 2FXVA 4RVSA 2ZSBA 4URXR 3P9RA 1DKPA 3H2KA 1CYEA 1KEWA 4QU9A 3JQGA 3TOVA 1STOA 4DXHA 4V2IA 4TYYA 4LUCA 4DSAA 4V3CA 4J9UE 2IT1A 1U0EA 3L4SO 3AKYA 4MHTA 3JASA 3QEBZ 5JISA 4BTLA 1QTRA 4N03A 1XQVA 3F74A 4M1TA 4XPIA 1M2GA 1J06A 3PQ2A 4DUGD 1OYOA 2YJTD 3D2BA 1JTEA 4MRAA 1J97A 4ZODA 1QIEA 3NHZA 3NIBA 2HU5A 1UWKA 1KETA 3VHXB 1ZD4A 2QN2A 3KKZA 2H63A 1BSVA 4GYKA 1G8KA 3ZCPA 4UUGA 3ISTA 4TMFA 3SF8B 3CF4A 1P0FA 1E5QA 3BRSA 1KDPA 1OI7A 4MS4B 4PR0A 5L9AA 3H4VA 2RHWA 3R9KA 4BAGA 4M0PA 4ECWA 3HMQA 4FPXA 3LT1A 4HJRA 2I3AA 2HMUA 1UIRA 4YMSA 2A58A 3L7JA 4ML3A 2JGDB 1XXHA 2HDNB 1L7RA 2ZTLA 5CTAA 4NPCA 1URPA 2YRFA 4BASA 4ZP1A 5G0VA 4XYEA 4JD5A 3TLYA 3DLHA 2CFCA 5EEHA 2Z43A 4CKBA 3O4VA 1ZMRA 3UMYA 2VAWA 4N49A 3TBKA 1N5LA 4FLMA 2A1TR 3BEOA 4HO1X 4MI1A 2W2KB 1HMPA 4DDTA 3KALA 3N2LA 3V1YA 4TWZA 2Q8QA 1V4BA 3TSAA 4YCLA 1H2EA 1PJ8A 3QNWA 1AMUA 2OYCA 4M54A 1LRKA 5TF4A 5D3MB 3IALA 2ID7A 4EG6A 3CXRA 3DFIA 1WXEA 5HZGA 1S4QA 3FYUA 3W6UA 2GUWA 4QLOA 4NBWA 3PFNA 4Q0YA 2VL7A 4Q1DA 1JZTA 3CSWA 3FFTA 2J41A 3DDZX 4PX9A 2CNOA 3B82A 4J9VA 2PLWA 3GLIA 2FPRA 3ZHSA 1UEJA 3PQ5A 1I80A 2A1IA 1GLVA 2I80A 1T9ZA 3H9EO 1V51A 3O8QB 3PR3A 2BT4A 2NSJA 2CWWA 3D4IA 2HLNA 4FB5A 2JD1A 3EGCA 4AZVA 4U00A 2PUCA 4QECA 1OJ7A 5C8DA 4FR5A 3W9SA 1M6NA 4TQAA 2ODAA 5DCUA 3VAAA 3KSMA 4QWCA 3K1YA 1G3QA 3DLAA 2HHHH 1TCVA 3RBVA 3MJCA 3L1HA 2GA9A 2Q62A 2WWGA 2BFOA 4X8HA 3IHKA 5BO5A 2OBLA 1JXOA 2ZTSA 1Q0SA 4ZV9A 2ID9A 2H4JA 5T5QA 3W5BA 4LDRA 2DBYA 4FBUA 2GBFA 3X2SA 4HWTA 4JB0A 4U2KA 4YIHA 5J59A 621PA 1QRRA 5C46F 1QAOA 2F1HA 1AUPA 1GKLA 4G09A 1L4EA 4J03A 1RWNA 1SGWA 4BO8A 1ETUA 2X0JA 2JJYA 1QGED 2B0CA 3AUSA 3EIUA 4KBYA 2R96A 3HCOA 2VK2A 5EVJA 2Q45A 3G2PA 4XD2A 5K0ZA 2X8LA 4QYIA 3BZUA 1AKVA 3TOXA 2GPYA 4I6EA 2VZ0A 4MI9A 1F51E 4MKHA 4RZUA 1XYYA 4EHKA 1H9AA 4PFSA 2OY0A 3EDMA 4OLHA 4AKSA 4HDMB 4MUNA 1PJZA 1DKRA 2A88A 1NX6A 2FPSA 2I91A 3KLPX 4GIBA 4UHDA 4UXIA 4QFMA 2COKA 5HZKA 4UZSA 1M8PA 2MINA 4XIGS 2X14A 5CM0A 2OSBA 1E1MA 3G5AA 1YTUA 4D3DA 2X4LA 3GLGA 4OXYA 1NFRA 1YZ3A 2G1JA 4ZICA 1EUDB 3D3NA 1F2DA 3T99A 2OC4A 1WABA 4R98A 4KXUA 4EI8A 3A1DA 4QM6A 1XEAA 4L02A 1HTTA 2X19A 1X14A 1X7XA 3JYPA 2OCBA 3J7AC 1LV8A 1MX3A 1H4TA 4OXQA 4UATA 1O87A 1VBHA 4UARA 3OKCA 4YR7A 2QRZA 1TJ4A 3W1VA 1ZWLA 1J49A 5CURA