2Z00A

Crystal structure of dihydroorotase from thermus thermophilus
Total Genus 153
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
153
sequence length
426
structure length
426
Chain Sequence
MILIRNVRLVDARGERGPADVLIGEGRILSLEGGEAKQVVDGTGCFLAPGFLDLHAHLREPGEEVKEDLFSGLLAAVRGGYTDLVSMPNTKPPVDTPEAVRALKEKAKALGLARLHPAAALTEKQEGKTLTPAGLLREAGAVLLTDDGRTNEDAGVLAAGLLMAAPLGLPVAVHAEDAGLRRNGVMNDGPLADLLGLPGNPPEAEAARIARDLEVLRYALRRSPATPRLHVQHLSTKRGLELVREAKRAGLPVTAEATPHHLTLTEEALRTFDPLFKVAPPLRGEEDREALLEGLLDGTLDAIATDHAPHTLAEKEKDLLRAPFGIPSLEVAFPLLYTELHLKRGFPLQRLVELFTDGPRRVLGLPPLHLEEGAEASLVLLSPKERPVDPSAFASKARYSPWAGWVLGGWPVLTLVAGRIVHEALK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Dihydroorotase
publication title Crystal structure of dihydroorotase from Thermus thermophilus
rcsb
source organism Thermus thermophilus
molecule tags Hydrolase
total genus 153
structure length 426
sequence length 426
ec nomenclature ec 3.5.2.3: Dihydroorotase.
pdb deposition date 2007-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01979 Amidohydro_1 Amidohydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.40.10 Mainly Beta Roll Urease, subunit C; domain 1 Urease, subunit C, domain 1 2z00A01
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 2z00A02
2Z2AA 2VC7A 3IPWA 2XIOA 2Z25A 1WXZA 1POKA 4MUPA 4LFYA 4P5UA 3NEHA 4AC7C 1NDVA 1A5NC 3MVIA 4H9ZA 1R9ZA 2Q09A 4F0RA 3PNUA 1YBQA 1V79A 4GY7A 1P6CA 3UR5A 2ANUA 1K6WA 4BY3A 1EZ2A 1XRFA 3GTFA 4C6JA 1GKRA 4B3ZA 4NI8A 4RE0A 4F0LA 4LAOA 4EPBC 3OODA 2F6KA 1XRTA 3IRSA 3E74A 3GTIA 4IFOA 3A4JA 4CNUA 1J5SA 3MSRA 4IGNA 3D6NA 2FVKA 2FFIA 4LALA 4LAMA 2R1MA 2Q01A 3DUGA 3MJMA 2D2GA 4PCNA 4H00A 3QY8A 4RZBA 3MPGA 4KQNA 4L6DA 2PAJA 1UIPA 1KRCC 1V51A 1ONWA 3F4CA 4C6KA 1EYWA 3GTXA 4QROA 1M7JA 1BF6A 4QTGA 5A6TC 4CNSA 3F4DA 1PB0A 2UBPC 4M51A 3RCMA 3GTHA 3URNA 1M65A 1ITUA 4GOAA 4RDVA 4C6QA 1RK5A 4DNMA 3E0LA 2YB1A 4XAYA 4R88A 4C60A 3PANA 3LS9A 3CAKA 3PBMA 4C6MA 2PGRA 1FWFC 4C6PA 4XD6A 2HBXA 2E25A 3LSBA 4XAGA 2OGJA 4CQDA 3UR2A 2DVUA 1KRBC 2GWGA 3PNZA 2VR2A 3G77A 3EWCA 1QW7A 1RA0A 1V7AA 4C65A 1YMYA 1GKQA 4J5NA 3C86A 1FWCC 1KRAC 4QSFA 4IFKB 4PCPA 4C6EA 4HA0A 1EJTC 4BJHA 2D2JA 3E0FA 4HK6A 3MKVA 3LGGA 3UF9A 3K5XA 4INFA 3S2LA 1E9ZB 3K2GA 3RN6A 2GSEA 3CS2A 2Z29A 3A3WA 3GG7A 4H9XA 1NDYA 3F2CA 2O4QA 3OU8A 3K4WA 4KETA 2YB4A 3T1GA 4DO7A 3QY7A 3IACA 3EWDA 4DI8A 4OFCA 4GXWA 2I9UA 4GZ7A 3WYZA 4E3TA 3UPMA 5G4HC 3E3HA 1A4LA 1FWHC 2Z26A 4TQTA 3GGMA 2EG8A 4C5ZA 1K1DA 1J79A 2PGFA 3E2VA 4RDWA 3GU9A 1A4MA 4YIWA 4IG2B 1EJRC 1FKWA 4G7EB 2YZ5A 3TN4A 4H01A 1R9YA 1GKPA 3IARA 2W9MA 3GU1A 3O7UA 2OB3A 4B91A 1EJVC 3GIQA 4XD5A 4B92A 3MDWA 3BE7A 4GY1A 1EJSC 2DVXA 4C6BA 3FEQA 1V4YA 4EP8C 4H9TA 3S4TA 1ITQA 4CQBA 3IJ6A 2GWNA 1EJXC 1WXYA 4GBDA 3S2JA 2FTYA 3QGKC 4LAKA 2P53A 2HPIA 1YRRA 2DVTA 4CQCA 4IFKA 1PTAA 4GX9A 5HMDA 3WZ0E 4C6CA 4Z42C 4C5YA 4GX8A 2E1WA 1UBPC 3LU2A 3NURA 4KIRA 4ZSUA 4DZIA 4HJWA 4DI9A 4IF2A 4EPEC 2Y1HA 3RYSA 4ICMA 2HQAA 2R1LA 4UB9A 3WMLA 4G2DA 4NG3A 5E5CA 1XGEA 3T8LA 4ZSTA 3SO7A 4XD3A 4I6VA 4J2MA 3TN6A 4CEUC 1HZYA 2UZ9A 4JOMA 4I6KA 4C6OA 4LCQA 1UIOA 2I5GA 4IGMA 3GIPA 2R1KA 2RAGA 3ORWA 3OQEA 4L9XA 4KF1A 4IG2A 3ISIX 4GYFA 3F2BA 3UBPC 4G7EA 3QY6A 5AKQA 1O5RA 3OOQA 3QGAC 5HMFA 2G3FA 2R1NA 3JZEA 2R1PA 1ADDA 1XWYA 1J6PA 1A5KC 1RK6A 2A3LA 3B0YA 4DLMA 1RJQA 1A5LC 4EPDC 1FWBC 3MTWA 2VUNA 4XAZA 2VHLA 4HK7A 2GOKA 2QVNA 2WM1A 3HPAA 3B40A 1K70A 2QT3A 1RJRA 3A3XA 2WJFA 1E9YB 1EJUC 4UBPC 1IE7C 3F2DA 1ZZMA 2AQOA 2P9BA 4NP7A 2BGNE 4H9VA 4RDYA 1ONXA 4KEUA 2Z27A 1FWAC 4GK8A 3IGHX 3B0XA 1P1MA 3LY0A 4RDZA 2HNHA 4J35A 1FWDC 2WJDA 3KM8A 3SFWA 1EF2A 3N2CA 2Z28A 2OQLA 5FSEC 3RHGA 2PLMA 4DZHA 1YIXA 2GZXA 3HM7A 1RAKA 4KEVA 4WVXA 2KAUC 4ERIA 2BB0A 3EGJA 3TNBA 4WGXA 2VM8A 1UMLA 1I0DA 1POJA 1VFLA 3ICJA 4ERAA 3AU6A 3LGDA 4C6FA 2ICSA 3AU2A 1FWJC 5HMEA 2ZC1A 3IV8A 1O12A 4C6NA 1EJWC 2EG7A 3DC8A 3PAOA 3OVGA 4LEFA 5CH9A 4DLFA 2AMXA 4PE8A 3NQBA 2YXOA 2HPMA 2QS8A 1P6BA 1I0BA 4WHBA 4DYKA 2PUZA 5FSDC 4BKNA 2O4MA 1W1IE 3T81A 2QPXA 2Z24A 1DPMA 4C6LA 1FWIC 4EPKA 2HBVA 1J6OA 3GU2A 1KCXA 3HTWA 1NDZA 1FWEC 2D2HA 2OODA 4GC3A 4C6DA 3GRIA 2P50A 4ERGA 2IMRA 2Z2BA 2AQVA 2Z4GA 4KEZA 4H9YA 3AUOA 2OOFA 3URBA 1NDWA 1PSCA 4PBEA 4PBFA 3R0DA 3LA4A 4R7WA 4QRNA 3V7PA 3S2NA 1RA5A 1FWGC 3MVTA 1YBQB 1V77A 2WJEA 4LCSA 4XAFA 2FVMA 4D8LA 1QXLA 4HK5A 1R9XA 3OJGA 4H9UA 4XD4A 1S3TC 2VC5A 4LH8A 4CNTA 1M68A 2FTWA 2Z7GA 4AQLA 1YNYA 4IFRA 4F0SA 2CZVA 1PO9A 4KERA 3DCPA 2ADAA 4V1XA 4QS6A 3URQA 1FKXA 3ID7A 3S2MA 4IQJA 4KESA 4CEXC 1JGMA 4V1YA 4C6IA 3FDGA 4B90A 4GY0A 4QS5A 3O0FA 1RJPA 1A5OC 3LNPA 3FDKA 3TN5A 5LXXA 3MDUA 3ITCA 3E38A 1A5MC 1NFGA 1KRMA 2Z00A 3LSCA 4R85A 2EG6A 3TN3A 3URAA 4IH3A 4LCRA 4DIAA 4H9MA 3CJPA 3GUWA 4LANA
chains in the Genus database with same CATH superfamily
1V02E 5G1YA 2DZBA 3WDPP 1OF8A 5KFBA 1ADSA 3M0LA 5CG0A 4ALDA 3IVTA 2MNRA 2X40A 3W7GA 3HQOA 4GLEA 1I8JA 3UZZA 4TVUA 4DYJA 5BROA 1ZY9A 3UYIA 5AHLA 3PJXA 2V2DA 3W74A 4MLJA 4PRTA 3CL7A 3CT7A 1Q7QA 3HQ1A 3H2AA 4A2SA 3WF1A 5KG1A 1XLJA 2ZUVA 3MSRA 1TRIA 2FVKA 3CV1A 4RNNA 3MKKA 2NVAA 2I56A 2ISVA 5D33A 3JW7A 2V4RA 4X63A 3VGBA 5B80A 2PAJA 2NX3A 3V75A 3SY8A 2ACUA 1H0IA 3W22A 1KM4A 5IBXC 4TVCA 4F2UA 1R5YA 4QTGA 3TSMA 3H26A 5EY5A 1GT8A 3FYOA 5MKGA 4JTKA 2X7VA 1ME9A 2NZLA 3FK4A 3AWOA 4Y6GA 3BLDA 2OMAA 2DZXA 1L6GA 2BOFX 4QG9A 4XZ9A 1Q66A 3CYVA 3QTGA 3CUHA 4AD0A 3VVGA 1BKSA 3VGEA 4K7YA 5AYIA 1Z48A 4DUWA 1BGAA 3IS4A 1X6NA 2VUYA 4Y2WA 3QYQA 2XFWA 3TQKA 1HJVA 3LHWA 5KFIA 5EBAA 1YW1A 1UYQA 1QW7A 2YPIA 2Z0IA 3EB2A 4DB7A 1YMYA 1WKDA 4YLWA 3P5YA 3KEHA 3DAQA 1KRAC 4QSFA 5AC5A 1A5UA 4GACA 1B31A 1TPWA 3VGHA 4IMEA 3M47A 3U2EA 1HJSA 4HMDA 3GE7A 3K2GA 1YDNA 3VD5A 5K4XA 3K4DA 1CGYA 4O3QA 3E9AA 1KA9F 1A0EA 1FA2A 1VPQA 4BEQA 1S5MA 1RPXA 2YB4A 1I60A 1FDZA 5A2AA 3NQCA 4D2JA 1Q6CA 3CV7A 4RV3A 5KFXA 1A5SA 1A4LA 5KFGA 5FEXA 3E2VA 1VJSA 3TW6A 4IG2B 2Y63A 2AAAA 2YZ5A 1GKPA 1M3UA 2W9MA 3BLLA 4PUEA 2BVYA 1HL8A 3TFCA 3TK7A 2VQUA 2G3MA 4GMEA 3JUGA 3AIWA 2UVRA 4FNSA 1SGJA 1I2RA 1Q3NA 2W0UA 2D23A 1CGVA 4FLOA 5E0KA 3KOXA 2C13A 2OZTA 4PGLA 3QYSA 3QFWA 1ICQA 1UD4A 1CENA 1V6WA 3UCCA 2DU2A 5L1KA 2DH3A 3U7BA 4NUWA 3W3OA 1WKYA 3GV8B 2HQAA 3WIJA 1SR0A 4TTUA 2PWEA 1GEHA 1PKLA 3SBFA 2IKGA 3FHQA 4FB7A 2Q3RA 1MUWA 3UWQA 3WMBA 1Y5XA 2XM2A 1DQWA 2B7PA 5EFDA 2EQDA 2G4JA 3MR5A 1V02A 3HO8A 3MCNA 1KXTA 3UGVA 1CXHA 1EJ7L 2QVHA 2CLEA 5F4SA 3OOQA 2R1PA 3NTYA 2OT1A 2V3GA 2ZX5A 4FP1A 1OG6A 1PWMA 3GZAA 1TQXA 2ZFAA 3N12A 2GVJA 4Q3MA 3R8GA 1IGSA 4ECUA 3M0KA 1KXVA 3W84A 3UZJA 3UP8A 3RB0A 3W23A 4LUTB 3FA3A 3GB6A 2V30A 1LT7A 1EYEA 4WSKA 4JNMA 1FHUA 1BG4A 1HG3A 4MFDA 4MG4A 4FBTA 2PDFA 1J0ZA 4FXJA 3NCOA 5FF2A 3M7SA 2JEGA 1VGAA 1Z7AA 2PU1A 1LTDA 1ISXA 2P5NA 1XHGA 4CU8A 1A0DA 5FEWA 4QJ3B 1HX0A 3DYPA 3T07A 3W27A 3SRDA 2BB0A 5CSRA 5LGXA 4EYHB 4LF2A 3WEOA 3TNBA 1ZETA 1XYMA 2XIBA 3U2ZA 1GORA 3DG7A 4IR1A 1NJJA 2CITA 2ZXAA 2OEMA 2ZC1A 2RHGA 2J62A 4W88A 1UH4A 3M46A 4RNFA 6TIMA 4NRSA 4CUCA 1JG9A 2WK2A 1QWGA 2NW0A 3ZWTA 4LEFA 2AMXA 3O8AA 1H7NA 2P76A 1ONEA 3DOPA 1LLWA 1XH1A 4TX9A 2V5BA 1YPXA 2QJJA 1W1IE 4KRTA 3D0CA 3NM1A 3GU2A 2QKFA 1L8NA 1NDZA 2HVMA 3S1WA 2ZX6A 2OODA 4EXAA 3O63A 3T0CA 3TTSA 9XIMA 4HNOA 5H8PA 5F1UA 4O17A 1G7UA 1U5HA 4QSHA 1QPKA 3CBWA 1K3UA 3AIVA 3CWOX 4L9YA 1Q4WA 1ZTVA 3LLDA 1JIBA 4PBEA 3LI1A 1XCWA 4Z1BA 5AC8A 1V77A 3ERPA 3SUVA 1PCWA 2VRQA 3L68A 3QGVA 4QFUA 4UUIA 4DO5A 2DSVA 1BLIA 4OQVA 1U22A 3P6LA 3KBNA 2G3NA 2VNCA 2Y7DA 3M16A 4LBUA 1T99A 4FNUA 4LVDA 3BARA 1TWIA 4DL2A 3QXBA 4R9OA 1W3TA 1XRSA 4QXIA 4K1WA 1J93A 4QS5A 3OHIA 3BJFA 2G8ZA 5H8MA 1VZWA 3K8KA 2O9OA 2IPGA 1Q13A 1NFGA 4Q8PA 5HINA 3ITGA 4IWWA 3BGJA 1XLHA 2VGFA 5AC7A 1IHIA 1S38A 1C29A 4P61A 2X7WA 4P5UA 1NDVA 3R4IA 4LUJA 3RRXA 3SCSA 1A5NC 3WF4A 1V79A 2WZHA 1TPH1 2FB3A 1F4AA 1G67A 3T0AA 4B3ZA 1ZBWA 4HU4A 3MA8A 4EPBC 1XRTA 4XO6A 4R7JA 4NYUA 4RK8A 1VFOA 1XYCA 4E4FA 1KGWA 2A7NA 1XC4A 2JK2A 1X1NA 3FIGA 2XFRA 4QEHA 1PCKA 4WSHA 5DFAA 5BU6A 2XN1A 3W2LA 1PE1A 4L7ZA 3WBEA 1OWQA 4M51A 3NQAA 3GTHA 1ZLPA 4GOAA 5AECA 3IJLA 2OLAA 3QZ6A 3AHYA 1TTPA 3L4TA 4XBJA 4MPQA 4D9PA 3HOJA 2GGGA 3WJSA 4HN8A 4ED0A 1NOFA 1EBGA 2Q8LA 1OINA 4XD6A 3WX7A 5CBJA 5MF5A 5M03A 4DQWA 1XG4A 3E02A 1UMYA 1ZRQA 3STEA 3DH7A 3VNKA 4C65A 1MQPA 3THDA 2WXDM 4WK9A 1W5OA 3IJ9A 1R86A 4S3CA 2VP8A 1T5AA 3RILA 1DTUA 1QASA 3WF3A 1BVWA 1ZAJA 3H2EA 1E5NA 5HK4A 1JYXA 1F3TA 2WVVB 5LIKX 4BQ2A 5JIWA 3HPFA 2VDGA 3THCA 1U30A 4B16A 5CLWA 2DZPA 3WO8A 3OVPA 3WKZA 4UZUA 4GC6A 3KCOA 1XW8A 4GZ7A 1W3JA 4HD5A 1W56A 3PC0A 5H2ZA 1CDGA 3UJSA 3L12A 4RDWA 1OGSA 1A4MA 1P0BA 1H60A 4H6KA 1TWWA 1FKWA 4G7EB 8A3HA 1LORA 1EJVC 3GIQA 1B3YA 4KWWA 4S3FA 1OIMA 1W1PA 2ALZA 3PZQA 4YQWA 1D8WA 1XUZA 4EP8C 2QUNA 1KBIA 4AY8A 1WXYA 5I78A 1IT0A 8CGTA 1NWUA 2VD8A 2PLKA 3CWHA 4NJHA 4IQLA 3M0JA 3U3HA 1DJQA 7ENLA 2XVNA 5T26A 2C7FA 1W3NA 4HN4A 1GJWA 1OHLA 4Z1DA 5TNVA 4ICMA 3WMLA 4JHOA 2CLFA 3LLFA 3MP5A 4B9YA 4DJEC 4PODA 2VC6A 4R8UA 4MJ4A 3NAVA 5IDIA 4FX7A 3NQDA 3GAKA 4B3KA 4EOUA 5HOSA 4C91A 5GVJA 2X0YA 1WBJA 3CEPA 3XINA 5CZ0A 3GTNA 1ZHAA 2VX7A 1F9CA 1KFBA 4U10A 5AKQA 5E6ZA 2WNNA 2R1NA 5I02A 1T7LA 4PUMA 3TA6A 3WQ4A 3G5EA 2XH4A 3MUZ1 1HTIA 1FWBC 1ZBKA 3WK2A 1JDAA 3JS3A 2D20A 3NUKA 3SGZA 5CZKA 2VHLA 3S2CA 3ZMRA 4PMQA 1VFTA 1XYLA 3GNOA 1KFWA 3RO8A 4UQDA 2P3ZA 3BC9A 3WD4A 3GVGA 5AYXA 2P9BA 2Z1VA 1EDQA 4AZ5A 4RDYA 5LNSA 3FSUA 2O7QA 2TRSA 3WF2A 4GK8A 4PCSA 3N2TA 3F7JA 3WK0A 3PBVA 2DW6A 3VOFA 2VCCA 2YIHA 3IIVA 4HKPA 4PMXA 2REQB 1TQJA 3EOUA 4H8VA 1ME7A 3DECA 3VIOA 4GXMA 4DWSC 4G56A 2W27A 2V5CA 3VNIA 1A53A 1MXSA 2YOCA 3NQVA 4US6A 4A6GA 2XZ7A 3T2QA 1ITCA 2HJPA 3SW6A 3TUUA 2PDGA 2UY5A 1VC4A 3GKFA 3PUOA 4C1KA 3AU6A 3A9IA 3FDSA 4TXEA 4W7WA 2WHLA 3PZNA 3QR0A 1XH0A 4UTWA 2QR6A 5HQMA 1XS2A 3RJYA 4QGCA 4NAFA 4MY8A 1XLBA 3BAJA 2Z1XA 1OY0A 1R8LA 4AHQA 2V68A 1U1UA 1H50A 3M0ZA 2HDJA 3AALA 4Q4PA 1RLDA 1J6OA 1RBAA 1UUMA 4CQ8A 1QMLA 1HL9A 2PDYA 4KWOA 3ZR4A 3LTYA 2J6VA 1ZQ5A 2WKLA 3MKCA 4TX6A 3ARQA 3TOYA 1XPYA 2HRWA 1PYFA 2BP1A 3DHFA 4HMNA 1SFLA 3AXHA 1Q6RA 2CC0A 1BYAA 3KS6A 4U2YA 5DGAA 4PBFA 3PB2A 3M4HA 1OF6A 3N34A 2VRJA 2PF8A 3NQMA 4AYSA 2QJIA 1SU5A 1K7EA 2Y85A 4MSSA 4ZOEA 3WUGA 2OO0A 4PUDA 1QOQA 1KW1A 2WSYA 1TUXA 1PO9A 3WLIA 3WL1A 1XG3A 4TMBA 4KH2A 4O52A 4UFLA 1CXLA 3UPBA 4CEXC 2RJGA 5CSUA 3CL6A 5ABHA 1RJPA 3R0KA 4K8HA 1E0TA 1TV8A 4S3DA 3E38A 5FF4A 1K8ZA 2QXWA 4JX6A 4A3YA 1P7TB 3PW2A 4J3TA 3W2JA 2DUZA 3A4XA 4LOCA 3U57A 3CJPA 1S1RA 1R7AA 3TMLA 3WQ5A 2QCMA 5GNXA 2CYGA 5I3JA 2J6UA 3CWNA 5ENLA 3SCQA 3BLKA 1LUCA 3IV3A 3G6XA 3HURA 4B2DD 3PUDA 1EUNA 1UWTA 4PTXA 1RCOB 3C0JA 1KQYA 1OYBA 4G5DA 4CD8A 3OODA 2X2YA 2BXZA 4A8IA 3E74A 1NQKA 3SI8A 2P1FA 2R82A 5HAOA 3FFSA 4YL2A 1C8VA 5DBUA 4ZTYA 1U5JA 4RZRA 2R1MA 4HA3A 1W5PA 4YHEA 1RYSA 4HSNA 4L9ZA 3BQ5A 1V6TA 1OT2A 2PE4A 4I8YA 3UVIA 2HE8A 5K3VA 2FVLA 2ZX8A 3U6WA 1W9BM 1QNPA 4MY1A 1QI3A 4QROA 4K39A 4DBDA 4UTMA 1KTCA 1QJWA 4K8EA 5DQHA 3L23A 2WSQA 4LWWA 2DZTA 3LM7A 4W93A 3TYAA 1ZL1A 2XTKA 4QISA 4I9TA 2VGIA 3WDJA 1LRQA 1GEQA 3WCZA 3PF3A 4JV2A 2PSNA 5KG4A 2GK1A 1BQGA 2O9RA 3C6CA 2CBJA 3UXDA 5GJMA 2ZDRA 3UR2A 1M7XA 3I3EA 4GUIA 3PNZA 3QVQA 1TV7A 2AQWA 2XIMA 5DN1A 4RNJA 1VS1A 4MNLA 3ZYZA 4IR9A 4AX7A 4UNIA 1H7WA 4XZNX 5DY3A 1AMYA 5C5YA 1H62A 1VFFA 1E9ZB 3EZ4A 2OT0A 3R1ZA 1GVEA 2WC3A 1VPYA 3RBDA 3LCFA 4GE8A 5EL1A 2YR1A 1SO6A 3VABA 4GXWA 3QR1A 4DF2A 2ZZ1A 1L6SA 3EWZA 1TWDA 1BWKA 4UQAA 3KCLA 3WQWA 4WXYA 2AGQA 3RX4A 2VXNA 2DIEA 1S2CA 4B91A 5G1TA 4L4MA 6A3HA 3S1XA 3WNNA 2Y7EA 1Q6EA 2V5LA 4QM1A 2PMQA 4JFSA 4QX4A 1WOBA 1XDMA 3PTQA 3PR2A 3YPIA 5BRBA 1LWHA 4LPCA 3HPXA 1WKEA 3DENA 2JEQA 3SGGA 1ADOA 4H6EA 4C6CA 4U2ZA 3BO9A 2PTWA 2P0IA 4IRDA 3GUGA 1QK2A 4JIRA 2INZA 2ZWZA 3W86A 2CLHA 3G24A 2EO7A 2W7OA 3GH5A 1SZNA 2NLYA 4RZ6A 2OJPA 3MSGA 3TOPA 4GI4A 4CEUC 2PGWA 3PAJA 4X3ZA 4R27A 3IVSA 3W7NA 5AOUA 2XFYA 1KXHA 3DN5A 4FSAA 4H04A 1BKHA 4M19A 1B30A 3CHCA 1H7XA 5FD0A 2QAPA 3SEPA 5CC3A 3B0YA 3W2UA 4O18A 4HYKA 2ZXDA 3QBUA 4JR5A 4B15A 1ZFJA 4HK7A 2PPGA 4QG6A 3STFA 4QLJA 4Z1CA 2BHZA 3E2SA 1CB7B 4RU9A 3FAWA 2DT0A 4GVIA 1MRAA 2YLLA 4U6PA 2X1UA 2C2DA 2F6XA 3ATYA 1NF7A 4WKHA 1P1MA 3P81A 1ZSXA 1E4LA 4A3QA 1EF3A 3VPLA 3RF9A 1CNVA 5KFRA 3KTXA 1VIWA 2PD5A 4S3KA 3T08A 2JEIA 1AH3A 4Q8QA 3K30A 4I9AA 1UMLA 3I7QA 1OJXA 3L5AA 3GG0A 2R8WA 2ICSA 4D72A 2FZDA 4IIFA 5KEZA 1KFCA 1J10A 1KGUA 4ZQMA 2GOUA 2OPJA 1C93A 3ARWA 3OVGA 1JJKA 3HIJA 1J0HA 3B0UX 2V82A 2FLIA 1OG0A 2FLNA 1S2UA 1SUXA 3CH9A 1XLEA 3SRKA 4TUFA 1DPMA 3WJZA 3K13A 2HBVA 4QE5A 2A0NA 1XBVA 4JQAA 4C6DA 1H61A 3RX3A 2YXXA 3R8HA 4ES4A 3ABRA 1AFSA 3WQGA 1P0KA 1X1ZA 5M5DA 1IYXA 3LD5A 2YA2A 2DSWA 1T6MA 3DDMA 2X0HA 4NIRA 2XZ9A 1XLMA 3BCJA 2GGHA 1Q6QA 1LOQA 2ESCA 1GVQA 3EDEA 1XD1A 3G1DA 2XFFA 4F4YA 2C18A 4P2VA 3SRHA 3EEZA 4MWAE 4TVDA 2ABAA 2QMKA 4F50A 3GFZA 4P7RA 2J9ZA 2FTWA 3TTEA 1GPWA 3G1AA 4GH3A 1J9YA 1UJPA 3N2XA 4AIUA 1GUVA 2J24A 1W5NA 1TX2A 1W1VA 4OUIA 1XGDA 3WLKX 3FDGA 3CV2A 3T42A 4UIOA 1W8SA 4QAWA 1TZ9A 4O12A 4WLCA 2UV8G 1EXBA 5KFSA 1SJCA 1G1YA 3SR7A 3ZT7A 3BMWA 4IRCA 3OB8A 3IAPA 1HGYA 3TJ4A 1K4HA 4A3RA 4LV9A 4Q4OA 4IMCA 1FWRA 1TO3A 1YPIA 4ZL1A 1WXZA 3HG4A 4W7UA 2Y62A 3MZNA 2RFGA 2ZE0A 3FV9A 3FYYA 4WY0F 4Z2LA 5L1JA 5LXEA 2D3NA 2DT1A 1R9ZA 4QIUA 5FOOA 5I77A 1EZ2A 5FAJA 1JXJA 4FBUA 3SIMA 3VD9A 1GVSA 4DEFA 2ACRA 2VVNA 3VIIA 3RB6A 2DH2A 2C1GA 1SFTA 1B0IA 3GS6A 5AZ0A 1O5XA 3WFLA 1MNZA 1FCVA 1UCWA 1LROA 2D2GA 1TPC1 5KFHA 3O05A 1W1ZA 1ISVA 4ZO9A 2NWSA 3K4AA 1KRCC 1E6NA 4ZR8A 4PN2A 3L4UA 4F4WA 2G95A 4P8VA 2ZZ4A 1VENA 4M6UA 4LTSA 4ACYA 3WNLA 3GDLA 3RPDA 1KO0A 1X7FA 3RCMA 2PWUA 4BWLA 3CH0A 3D5HA 4QHRA 2A3AA 3M0XA 2YB1A 3LZ3A 1M01A 3Q37A 1AVAA 2AL2B 4HCHA 3M9NB 2CW6A 2QCGA 2IKJA 5KFUA 1AW5A 3CPRA 2PDNA 3B0VC 1E1EA 1KTBA 4XAGA 1W9VA 3G8EA 3G77A 2QDHA 3R58A 1ZU8A 3RMJA 1E4IA 4V27A 2JGYA 2QGYA 4JTIA 1XQKA 4IXXA 1ZCCA 1JL8A 4N2YA 4LAZA 2X41A 1E71M 1UQYA 3MI6A 3TXVA 1W0MA 4O1BA 2R6OA 3GXIA 3OHMB 3QH2A 1DOSA 5FL1A 1MZHA 2Y70A 3L0NA 3C52A 4Z2JA 1GVOA 1KBKA 3EOOA 3F2CA 3L66A 3T4WA 2OFJA 4JEJA 4X9SA 2D0FA 2QF8A 3SY1A 3KBMA 1U83A 1A3WA 3OLIA 3QZ8A 4NY2A 1AZ2A 2EG8A 2OSXA 2PGFA 1VJZA 5LHEA 1NF0A 1V03A 3GU1A 2UVVA 3MDWA 1NWRA 3GBDA 1SM9A 1XP3A 3TA9A 5A1AA 1WYIA 2GWNA 3IJDA 4MWAA 3BCDA 3VCCA 2ZXBA 3O6AA 5AYBA 5KSWA 2DIKA 1PTAA 2BG5A 4GC4A 1OGBA 5D32A 3WZ0E 1E6SM 4MHBA 4Z42C 4S3AA 2XGQA 2IKHA 3MSYA 1IV8A 3VOJA 1WV2A 2H9AA 4BF7A 1EGMA 2G97A 4OT7A 4AMCA 4CN4A 3NSXA 4AWSA 5CJMA 4E2DA 3SO7A 1SFSA 2C14A 4J2MA 3HJZA 1AUSL 3BANA 4ZCWA 3LMZA 1Q6LA 3LPFA 1UIOA 1JPMA 4PB5A 4LBRA 2PWHA 1A3XA 4M6PA 1DIEA 4O3SA 1UZ1A 2W62A 3PPCA 3BLPX 3P0WA 2F2KA 4O19A 5HMFA 4GQBA 2XJ7A 3QFEA 1UC5A 4AZ7A 3AMCA 4Z17A 3VIHA 3IK2A 3WUEA 2Z1KA 2P88A 1JYWA 3HPAA 2GUYA 3FXGA 4L1GA 4PMZA 2YX0A 1GVYA 2GJNA 1DP0A 1UR2A 4REQA 2GJXA 4RUBA 4A3HA 2TODA 5LNRA 1FWAC 3WBXA 1IGWA 3SECA 3GC4A 1EB3A 4RDZA 2Z1SA 3CC1A 4IMAA 3WK3A 5CSYA 1KCKA 4M1RA 4IZGA 1Z69A 1EP1A 1KM3A 3W1QA 2Z28A 4AMAA 5IBXA 3Q45A 4AEOA 4QLLA 2GZXA 1QR7A 2W8LA 7PTDA 5KFTA 2WMHA 3E0VA 4O8AA 5K4ZA 4ZOAA 4AZCB 4NF7A 1VBGA 4U33A 1HUVA 2EG7A 1IXOA 3I3DA 2B7QA 2OR2A 1ZAHA 1V93A 4KS0A 4CCDA 1LRNA 4DUOA 4D71A 3QMRA 4RE3A 1YNPA 1QI4A 1VF8A 1PDZA 1CECA 1NY1A 3M9YA 1YDOA 1ZGDA 4UR9A 4DAFA 3VU2A 1F61A 2ASJA 1L2QA 4P7NA 1D3HA 1K9TA 1TSIA 5KFEA 4C1NB 4AIOA 1S3HA 2JKAA 2ZUMA 3BQ0A 5DLFA 2J7DA 3UGRA 2HNEA 3DXIA 1RYRA 2YBVA 2QUMA 3HMJG 4LC6A 2CETA 2C2RA 1C92A 4WJXA 5HUPA 3WBAA 1UUOA 1YBQB 1QO2A 4CVUA 4HP5A 2XUCA 3T0TA 5A95A 4XKYB 1EXPA 1WA3A 1KR1A 2IA6A 1EFZA 3G1YA 1DKWA 5CLTA 1KKRA 1XBXA 1ZBCA 3PG8A 2V2CA 3H2CA 4FNTA 2OZ8A 2QPSA 3WLNA 3QHMA 1NOUA 1VBJA 4NZFA 2PEVA 5LKYA 3G1SA 4JHZA 1KCZA 1RZMA 2Z7KA 4PMUA 4Y9MA 1JQXA 2WVTA 4XVEA 3FXYA 4QLKA 5BXRA 1CXFA 3OPSA 5L6UA 3MUXA 2ATMA 5L1LA 2Z2AA 4BCEA 4QR6A 1J8VA 2WPBA 4LFYA 2XDFA 2XH7A 4AC7C 1Q8JA 3HA1A 3SQSA 4AEFA 4PMOA 4GY7A 4OHQA 4H6RA 3KLLA 4OU1A 4DM1A 3CHVA 5CG7A 3W1AA 4IJRA 3GTIA 4M1BA 1UKTA 3PJUA 3REQB 5KFAA 1TPDA 2JKEA 4ZBCA 1F73A 3N04A 4N0RA 1XLCA 5EB8A 1Z89A 2ZOXA 1PIIA 3GFXA 4FR6A 3H55A 2E4TA 4HTBA 4BS0A 1MW2A 4DBEA 2QAFA 3SUWA 4JTSA 4MKVA 2GJPA 3H22A 4U7CA 2NT1A 1KM0A 1JZ3A 4RDVA 3MWCA 2XVKA 2F8QA 2W63A 3LCXA 3VX1A 1HJUA 4EX4A 1FRBA 1XDJA 3H6OA 3AXKA 3F5LA 4O1FA 2WMJA 4W8AA 2PRHA 4AY7A 1TTJA 4X0VA 1BYDA 4UR8A 3PPGA 3W25A 1XX1A 2PI6A 4ADTA 3KS5A 1RA0A 1JPKA 3USZA 5DCEA 4R34A 2J7FA 3HJEA 4J9MA 3QM3A 3AROA 4PSRA 1SW3A 2I17A 5C5JA 3GY1A 1EPXA 1TPEA 3TV8A 4AFYA 1IIHA 2I57A 3VO0A 1PIGA 5H8UA 1F6PA 2BSLA 5HQEA 3M44A 4DWSB 4QDMA 1UP2A 3T1GA 3QY7A 3AYTA 1RY0A 4OBRA 4JXCA 1LG1A 2YCIX 1XLGA 4MKNA 5DMMA 5G4HC 3E3HA 3I4KA 1KM1A 4QWEA 1H2JA 4NASA 1EJRC 1JCNA 2PLCA 3AYSA 2OX1A 4CNOA 4N02A 4H01A 1QO5A 3NQ6A 5HWMA 3HF3A 1EJSC 3V16A 4ADSA 1T96A 4HNNA 4JTFA 5LNUA 1QPQA 3I68A 3MMTA 3O6YX 6ALDA 3RUBL 1QU4A 3QGKC 3MC5A 4LAKA 2VFFA 3NEVA 1YRRA 2RDUA 1OCQA 5TD4A 3W00A 1FBAA 3W24A 2WYSA 1EX5A 3W87A 3RPMA 2D1ZA 4WGHA 5DXXA 3FNDA 4DL3A 3P84A 2WTFA 4NU7A 4AZGA 4ORIA 4UB9A 4MTVA 3TWBA 1EEPA 4NL1A 4XD3A 3ZXWA 1X98A 3W7OA 1GQJA 4ONVA 2PDKA 2H6RA 3WEZA 3B4YA 1D7FA 1Q6GA 2R1KA 3E5BA 4NZCA 4PMVA 4L9XA 5FA5A 2RGMA 1DJWA 5HR7A 3QGAC 4DELA 3BVJA 3NPUA 3P7YA 3MV11 2A3HA 5HR6A 3ITOA 1ZENA 4E6MA 7TIMA 3L2MA 1UH3A 3R13A 1XCXA 3GDBA 5DBTA 1H4PA 2BR0A 1ZCOA 4WSJA 7CGTA 3AHVA 4B4FA 4O11A 1EP3A 2VZUA 4NLGA 2PDHA 3ZJ7A 1AG1O 1ZJHA 4EE9A 4AXNA 2XGZA 1LM1A 3ZS4A 1WDSA 3KOWA 2WNWA 2NT0A 4LUSB 3QC0A 1XLIA 1N8IA 3WD0A 3A21A 2E0PA 5G2IA 1P0NA 3IUIA 4KFNA 2DY3A 3WLJA 4YP3A 2VOTA 4GISA 2AU0A 4KEVA 1HP4A 3FS2A 1B57A 3V6JA 1CZ1A 1EQCA 1CPUA 1VFLA 4KCTA 2WBGA 1BWLA 1RD6A 3QF0A 3UQNA 5T9BG 3SCPA 3QV9A 1CEOA 3LX9A 1QAPA 1KR0A 3VE9A 4Z0SA 4FLRA 3LHTA 3KOFA 5EYWA 4C1LA 1W9PA 3CLMA 1AD4A 4RZ4A 2QS8A 1YX1A 2J8GA 1OX4B 3PZTA 5FF3A 1P0DA 2G4FA 4HCDA 5KFPA 4X61A 5CJNA 1P5BA 2D73A 3IIPA 2O56A 3U2CA 1KNWA 1I2QA 3O9NA 3RM9A 4CCCA 4EBEA 1GOMA 1HJQA 3OG2A 4J28A 4IJCA 1KBJA 5D37A 3IN5A 2DGAA 3RAXA 2E68A 4I9JA 1CCWB 2OEJA 2OOFA 3BW4A 4Q8MA 3WQFA 3JZUA 4S3JA 1QHZA 4GZEA 3XISA 3R2GA 4CKQA 5KZMA 3TROA 2WJEA 1EC9A 2VURA 2EF9A 5KT6A 2EGZA 3MHGA 3N14A 4HK5A 4L56A 1R9XA 3O0KA 3U7VA 3TJXA 4O13A 2A6LA 4UTWC 5C2GA 1G4TA 4E8GA 1UWIA 3KBSA 4N4QA 3RBEA 4ZQNA 3CHFA 5AHEA 4U31A 4UFKA 5E0CA 3BAYA 2GDVA 1JGMA 4P7OA 3W83A 3BAWA 2XHYA 3CIWA 3REQA 3S5NA 5DGBA 1OFRA 1E40A 1TVLA 3BJSA 4Z2HA 5KFOA 2G50A 5I3DA 1KRMA 3NNTA 3GFYA 1OYAA 2XC9A 1JYNA 2EBNA 3TN3A 3A24A 3VOIA 1IXNA 1XSKA 1X8CA 3GUWA 4E38A 1YE6A 1A80A 3QSRA 5FAGA 5D04C 3W6LA 2ATSA 2Z25A 3JRKA 4DJEA 5A6BA 1HKJA 4ASTA 2CEQA 3R8RA 6REQB 4E2OA 5KG2A 1LL6A 3DYOA 1K1SA 1VLIA 3R43A 4BZYA 2QZRA 4Q8FA 1LG2A 2HE5A 5KFDA 2QJGA 1UR8A 4JY8A 5A8MA 3MU7A 1E6XM 2A3EA 5LA2A 3WLPA 1KQZA 4QQUA 2OU4A 4AIBA 2VFIA 2W67A 3AHZA 4D6EA 1FH7A 3QY8A 3AZSA 5FL0A 3W76A 4YTSA 3ONBA 1UG6A 1GK8A 3UWYA 3F4CA 1N2VA 5E9AA 1EX1A 3TQ0A 1TA3B 2OYLA 4CNSA 4YR0A 4NVTA 3S3GA 2WO5A 1J18A 1HNYA 2NQZA 1ODUA 4BI6A 1MFVA 4IXHA 3R5EA 1IWBA 2PDCA 1WBHA 4J3ZA 1Y8BA 4AD2A 4X22A 3SCUA 1UKQA 2WOQA 1WDPA 1UWRA 3N2BA 3LS9A 1JAEA 3PBMA 1PTGA 4YCOA 2WKGA 2ACSA 3IUDA 3SCTA 1VP5A 3FJNA 3STGA 4DBSA 1O6IA 2OGJA 4IL0A 2DVUA 1TPVA 3EWCA 4MYAA 3PK7A 1F05A 1R3WA 4MDOA 1GKQA 1FWCC 3ARSA 3KBWA 4C6EA 1U1HA 3DHDA 3EXTA 1TR1A 1DWFM 4RUCA 3W01A 5EWGA 5XIAA 2XVGA 4HPGA 5CQ1A 4FOUA 4PYSA 3QPEA 1EGZA 1DWIM 3THQA 4HNUA 4DO7A 2CFFA 2VO5A 3CMFA 3UT0A 5F2MA 4GIEA 1BXNA 4AD1A 1V08A 1A0CA 4ECLA 2QJMA 3SUUA 3TW9A 4DBUA 4MY9A 4IIBA 3MYPA 3ES7A 3WH8A 3FEMA 3IARA 3LDVA 4MB1A 4AU0A 2W4XA 3CLWA 4H2HA 4RL3A 3FEQA 4ZO8A 1XIBA 3S4TA 3DFTA 5HANA 1WE5A 2Y8VA 1OFOA 3WDRA 2BDQA 1CI1A 2DVTA 4CQCA 2C0AA 2QNEA 5CPOA 1MWOA 4C5YA 5T91A 1MO0A 3MYOA 1X1OA 5D4YA 2PBGA 2FPTA 3BL3A 3LU2A 3NURA 4HJWA 1CLXA 2YCLA 3A4WA 4IF2A 5G2HA 2WZMA 2Y1HA 1XIJA 2QLYA 2QHAA 3NDOA 2WNZA 1BHGA 5GJNA 2W9AA 3EAUA 4PMNA 2X09A 2E28A 1T94A 3M1ZA 3VIPA 1BAGA 1TTQA 5HJYA 2FKPA 6ENLA 1Q7ZA 4WD0A 4IIGA 4H7ZA 2YL5A 3C3NA 4FLQA 4MNKA 1M6JA 2A3LA 4AUBA 3SI9A 3UWEA 4XAZA 1R38A 1XYZA 2WM1A 3BMVA 4KWUA 4O3NA 1LCOA 1VFHA 1LT8A 2CNCA 2GVYA 3BOXA 5LNWA 4IM4A 3CUGA 1Q63A 1EA0A 5EFFA 4KEUA 5FCZA 1MUMA 3D47A 4ED2A 4JN6A 1DJIA 1F76A 4LXFA 3ZVHB 1Y0EA 3BCFA 4MNJA 3UA4A 3LPGA 1ICSA 4BQ5A 4JHMA 1VRDA 4EXBA 1X97A 1GYNA 1YADA 1EWDA 4KEMA 4FK9A 4ERIA 3UA3A 3TC6A 3QSTA 4O57A 4P8UA 3U9IA 1LQ2A 4PTDA 3H7VA 3VA8A 2A21A 3B8IA 4AX6A 2FHBA 4JX5A 3DI0A 1MMFA 2OKTA 5HA7A 3AU2A 1LOLA 1FWJC 1TREA 5HMEA 3VE7A 4W89A 1W17A 7A3HA 3T5KA 1Q6OA 3GW0A 3DC8A 2PZNA 1S2TA 4FS2A 1B4EA 2F38A 3NQBA 2JBMA 2DSKA 2E6FA 3UNDA 1P6BA 2CPUA 3AS2A 5E70A 2POTA 2WZEA 1MW0A 4HJFA 4IUGA 1I4NA 2QPXA 3ZZ1A 3NOYA 1PDYA 4XB3A 4F0MA 4HHLA 1KCXA 2YBTA 3TSDA 4QITA 4D8AA 2D2HA 3QJAA 1E4NA 1QRQA 4K36A 3OVRA 4GFIA 5E93A 3GXMA 3TQ1A 1GOKA 2AQVA 4RUAA 5FKYA 1MXGA 1FFQA 4PL1A 2PDMA 2YYTA 2E5BA 1ISYA 2NUXA 5TQLA 2OQYA 2DUXA 5B7YA 4QRNA 2C16A 4Q7IA 3S9ZA 2QCHA 2BS9A 4EKJA 1V0KA 2DJXA 2PDLA 4KCUA 1FUYA 4UQCA 1PBGA 4BF9A 2X30A 5KFVA 1JUBA 1A5AA 4EWJA 2ZZ5A 1G6CA 4AZIA 1OFPA 2CERA 5JH1A 1IIGA 3U4AA 4KESA 3A4AA 5IFTA 1EH9A 2ZRVA 4UQEA 4QDWA 2VOMA 2ZRUA 3LV5A 3HG3A 2XCPA 5J04A 1BEUA 3KUMA 4O0ZA 5MKGB 1XSIA 4I7UA 4YHGA 1MEWA 4PEEA 2P0OA 2JIWA 4FS9A 4PMRA 1LWJA 2QV5A 3ITLA 3URAA 2QULA 1J01A 3W1LA 1G4EA 4RKAA 4QCFA 1AW1A 2WBKA 2IKIA 3OBAA 4GKTA 1SO5A 3LRMA 5ABFA 3BJYA 3P8IA 4IIDA 4WY0A 4H9ZA 4F0RA 3CMJA 3HV9A 4MPKA 3M5YA 1T8XA 1BVZA 2W91A 2GFTA 3RU8X 1D3CA 4HNTA 3GC5A 2CLMA 1JI2A 3IRSA 1GJPA 1CGTA 3VMOA 2BHUA 2OYMA 3M0YA 3VXGA 2WMIA 3DFYA 4O53A 1JXLA 1BRLA 1E56A 2A85A 1GVIA 3TJIA 1TR9A 3TU9A 1QDSA 1HP5A 3CEUA 4LB3A 4JX4A 4RZBA 2XVLA 1I9CB 3VKJA 2GQ8A 4ENLA 1XFBA 4OOUA 1YYAA 2HVOA 3WQCA 5CGQA 3AMLA 1IEWA 1K9DA 1M65A 1UWUA 1QNVA 1GVFA 3LERA 1G01A 5I3HA 1I2OA 2VEFA 1RK5A 4D1IA 4JTLA 4UFIA 3HPSA 1A3HA 1DJNA 3KTCA 5HPOA 4LYRA 2G0WA 2X1IA 3IEBA 4HNCA 4R9XA 3KBJA 4PSPA 1J12A 1KLYA 3KHGA 3MMDA 2X42A 4QE1A 3V18A 3FVDA 3V0UA 3ATZA 4HPHA 3AXXA 1DWHM 3C86A 3S0CA 3LGEA 4PCPA 5JUMA 4BJHA 5EDWA 3L4YA 1GYMA 4ZQOA 2VR4A 2VWTA 3G6YA 3OBKA 1FP9A 2R8GA 4HYVA 2OLSA 4W8LA 1NDYA 5HULA 2ZTKA 4KRUA 3KXQA 4EAMA 1F3EA 5DG8A 4O54A 4GYJA 5JXQA 3D3FA 3KWXA 3GAYA 3I6TA 2NSOA 2BY2A 1S2VA 5A94A 2G3JA 2J7CA 2D0GA 3XIMA 1W9UA 3PPHA 4NYYA 1J79A 3QQ0A 4L4OA 1V6VA 5CPSA 3TN4A 5D9MA 4IISA 4H4IA 4AWEA 3N6QA 3PSVA 4TIMA 3BE7A 4GY1A 3WQVA 4A8NA 3H54A 2FJKA 1EWEA 3IJ6A 5C7VA 1K77A 1NTHA 3S1UA 2P53A 1RQEA 2AAMA 4E5TA 3HN3A 3LBMA 4IFKA 3RLGA 4GHRA 1MUCA 4S1FA 2QPUA 3AIBA 5IFPA 2R91A 1PAMA 5CGMA 2QCDA 4DZIA 4WOZA 5FF0A 5DANA 2R8IA 3FYPA 5AYZA 1R3RA 3CZEA 4ECXA 4J4KA 4CQAA 4IUOA 7ODCA 2CU0A 5KFZA 4I6VA 3II1A 1OBAA 2F9RA 2WJZA 4F2TA 3LCLA 4G1KA 4XO7A 1EC7A 1LLZA 5AHFA 5BXPA 3PW5A 3V0SA 5I6SA 4F8XA 1S5TA 1ZB5A 1M04A 3PZVA 4KFOA 3S1GA 2QEZA 3G8RA 4PTVA 4WX2A 2I7GA 2IPFA 3JZEA 2J9YA 3KOYA 3GHUA 2ALDA 5KT5A 3TONA 4B3LA 3RAQA 4KCVA 5F1VA 3NZRA 1DORA 4MWAC 2R8KA 4PCTA 1YNQA 1F8IA 3VDBA 1W2VA 3RO6A 4ICNA 1SMDA 4YVVA 1LOSA 4L1WA 4WJ8A 1IE7C 2A3BA 2NV2A 3RK8A 1U33A 2TAAA 3NZGA 2PDJA 1GG0A 2TPSA 5EMMA 1XM3A 4J3XA 4CCEA 3LMYA 2V9WA 3BV7A 3GG8A 1RCQA 1OC6A 1JI1A 2PLMA 2CZFA 1YIXA 5EMJA 1PKNA 1ZJAA 4MJ2A 4GQRA 5F2GA 4JTCA 4MB3A 4LUIA 4WGXA 3F4NA 5BMWA 4FAMA 1WZKA 3PZIA 4TQSA 3OHBA 3WDIA 2I9EA 1TCMA 1A50A 2HVNA 3IV8A 1O12A 4ECWA 1WZMA 3AS3A 4DL7A 2TYSA 1NOWA 2PC4A 4AF0A 1GCYA 2ISFA 3V4BA 2NV9A 5GJPA 5ABTA 2YXOA 2OKOA 7REQA 5REQA 3PWGA 1ISWA 2VEGA 4JYDA 1ONRA 3ECQA 4V15A 3LUTA 1GQIA 5CC7A 2IUZA 3EA3A 1HKMA 2OSYA 3AQUA 1EZWA 3O3RA 5DELA 3QZ7A 3W7JA 1C3FA 2HK1A 1HGWA 1SO4A 1FWNA 2G37A 4HPXA 4AWTA 5H91A 3APYA 3MFHA 4QNWA 4NJGA 3SY5A 3RXZA 8TIMA 3AZRA 2O92A 3M6DA 4Q44A 1J11A 3NJ3A 5ECUA 5U7SA 1JFXA 4I3GA 3VGDA 4AYGA 1US2A 1F6YA 2ZRYA 4MMWA 4D8LA 2X8RA 4ZFCA 3UVAA 1HIZA 5EBUA 2ISWA 4LEQA 3G3MA 4GIYA 2OO6A 1SO3A 4EF8A 2G5WA 1M68A 4RR4A 3LBOA 3HPZA 3AJXA 3N6HA 1DXFA 3DCPA 4Z0JA 2ADAA 3LQLA 3AMKA 3T78A 5A6AA 1OK6A 4Z08A 4B5TA 2OZ3A 3MUY1 3EX3A 3HGRA 5A2BA 2HSAA 4A8LA 3KHLA 5A8QA 3GDTA 1X8FA 3MDUA 3ITCA 2GLKA 1SW0A 2F84A 1AW2A 1YQ2A 2DPIA 1DIDA 2ISSA 5FJUA 3EMCA 4YR2A 2HK0A 3W29A 1PUDA 1WUFA 3UG5A 1XGZA 2BXVA 3EDDA 3C2FA 4TU1A 4B4HA 3NEHA 1S97A 1C8YA 2W79A 3L4XA 1F5ZA 5KFQA 1K6WA 3HV8A 1T0OA 3WJYA 3GZ3A 3MS8A 1RALA 4KCWA 1REQB 1OZQA 2AGTA 3FAXA 4L6OA 1VEOA 1F4HA 4AAJA 3D6NA 2GVLA 1R85A 4XSLA 4DYEA 3DUGA 1UWSA 4M56A 2J88A 3P60A 3BG3A 2YJQA 2PB1A 1L0PA 4C7DA 3VNMA 3R10A 3DI1A 5CSSA 1UD5A 3BAKA 4HBKA 2I16A 1WP6A 3F4DA 3AICA 2UBPC 2A7PA 1OX5A 1E1CA 1LQAA 3GXPA 4GGHA 5C6MA 2YCJA 3CUXA 3PANA 4RZ5A 4YPJA 3VZZA 4CD5A 1CT5A 4BI5A 1UPPA 2YW3A 1RQBA 3WNOA 1DXEA 1CIUA 4CQDA 2W9CA 1DJZA 3BWWA 1LZOA 1FWTA 3GDKA 2CZ5A 4HA0A 3ITYA 4ZZ9A 4DX3A 3L9CA 4AISA 2YDQA 2C0HA 3LGGA 4HK6A 3GIMA 4KFPA 5CCZA 2FZ9A 3AXIA 3W81A 1ZP4A 3UCQA 1E15A 2GSEA 4NZJA 1G5AA 3QLDA 4WIWA 2QMJA 4R7OA 1M5WA 1HJWA 3ZWSA 1CW2A 2QCCA 3TVAA 5D9PA 4R8UB 2QV4A 1UP0A 2PDUA 2W9BA 3WD2A 3VI2A 3ZOAA 4AHOA 5BMXA 3LLXA 1AQFA 1XI3A 2C28A 3L4WA 1Z6KA 4WF7A 1HKIA 2EKCA 3MT1A 3NQFA 3GHSA 2FGLA 4C7GA 2PD9A 1XQLA 3SN0A 1OFBA 1TMLA 1B3OA 3ARZA 3VK5A 3WLMA 1V4YA 4H9TA 1ITQA 4RLIA 4JIPA 5M17A 2C3ZA 1GZGA 3E6EA 1SR9A 3SJ3A 4UWMA 1J4EA 4EF9A 1TRDA 4J9SA 1JQVA 5DQIA 3MCOA 4CGTA 4NQ1A 3QQ1A 2VKZG 5GNYA 4RX0A 3W53A 5CPTA 1EBHA 2E1WA 1UBPC 4ZSUA 4EPEC 1W5QA 3ANVA 4JTDA 3IGSA 4ED1A 1HW6A 1K9EA 5KETA 4XVDA 1QPRA 4JN7A 4NG3A 3QPZA 2VC9A 2XSBA 4Q8UA 3VCNA 3GVQA 4Y8EA 1EHAA 4D6CA 3WN6A 3W1TA 4LCQA 2I5GA 2Y8KA 3GIPA 5IXEA 1E0UA 2OTDA 4ZE4A 4Y7EA 1TELA 3SCRA 4J9NA 4AB4A 5KFJA 1E55A 3VIFA 1CB2A 2HTMA 2JEJA 3AOFA 3GM8A 1BXBA 2V2HA 4ED6A 4YR3A 1XIFA 2C1HA 4NAFB 4MM1A 3TWAA 2C19A 1A5LC 3UZXA 3MTWA 1VHCA 4TOQA 1V6UA 2V0TA 4YNGA 4DJDC 2W7PA 1H63A 1QI5A 5BRQA 2VI0A 3UCDA 4G9PA 2CZDA 1S5WA 4RW5A 3LOTA 5DO8A 2WNQA 3OLDA 4J40A 1JCYA 2AMGA 1FWDC 4S39A 1RCXB 5GPRA 4QQ3A 3GKAA 1H5VA 1IWPA 3SFWA 3DFSA 1JYVA 2OQLA 4ED8A 4DZHA 4DPQA 2AGOA 1AJZA 4G6CA 4Q32A 4QWDA 3CPGA 2VM8A 4PR4A 3AMGA 3T0DA 2ZZ3A 4ERAA 3HG5A 4C6FA 1IXPA 2OEKA 1O1HA 3MCMA 1E5JA 2PWGA 2ZDSA 3TAKA 3L0GA 2FHFA 2L5HA 3RNDA 3BAIA 5D2YA 3H23A 4J3SA 2ON3A 2PUZA 3GVVA 3WDHA 3EWXA 4FX6M 3BSGA 4FO4A 2Z24A 3FLUA 2YDRA 1KFLA 3SFKA 4ATDA 3ENLA 3VNDA 1A5CA 1GOIA 1RPKA 5CEWA 5HATA 4DZ5A 3RITA 3AUOA 4D1JA 4FEZA 3G0XA 3URBA 1QPNA 2QIWA 4K7VA 3W2KA 1WDWA 2F6UA 3DGBA 4OIFA 1JCTA 3R0DA 1IR2A 2OWXA 2ATLA 1FWGC 3MVTA 3DC0A 2OELA 1LUCB 3P3BA 3QMSA 5IRPA 4LRSA 3WQ6A 4GYPC 4XD4A 4N9CA 4L6HA 1S3TC 2Y89A 3KHJA 4IPPA 4PMYA 4YTTA 2HMCA 3ELFA 1KWKA 2YYUA 4UNKA 3T7VA 2BY0A 1GJUA 4Q22A 1REQA 3UU0A 1EQPA 2XG9A 5E6YA 3QW3A 5C7HA 1RBLA 1A5OC 3NYZA 3FDKA 2BHYA 3LZ5A 4X60A 3UR8A 3NPXA 1W3LA 3VGGA 4HSOA 1TWZA 3AHXA 3I6RA 3UXIA 4Q7BA 4M29A 3E5PA 2DQWA 3L4ZA 1UC4A 4NNBA 2A5HA 3H24A 4EIVA 2FQIA 3RR1A 1XINA 2OG9A 3ABQA 3IUHA 1GTEA 3N6JA 3AUJA 1UBSA 2FDMA 2HCVA 4JYFA 3LCHA 1UB3A 4J9KA 2GDUA 3BW3A 2VYOA 2BY1A 2GK1B 2WAGA 3NA8A 4PMJA 3PB0A 3UR5A 3V5FA 1MW1A 1HO4A 1W1A1 3VKKA 1S39A 3THUA 5EMKA 3TZNA 1TPB1 3GTFA 2INEA 3MJYA 4PB4A 1JDFA 4B2DA 4JFUA 3VILA 2WLZA 3NFUA 2QDGA 2QQ6A 3QR3A 5T9CE 4PCNA 3MPGA 4J9OA 1D8CA 3AI0A 3WLHA 3UZWA 3AIUA 1HO1A 3C56A 2E9BA 4NX5A 4AD5A 4GI9A 1M7JA 1M41A 4FOKA 3S47A 2PP0A 2ZX9A 3EMZA 3M0VA 2DW7A 4JTEA 3E49A 1G69A 1CGXA 1ITUA 4UCFA 1TIMA 4LBSA 3SADA 1IEQA 2YBUA 3WQDA 4YTRA 3WD1A 3CQHA 3BICA 2A6NA 3N11A 5MHBA 3NPWA 4MZ1A 3MB9A 4J7RA 3TYDA 4YCPA 2XISA 3EYPA 3ZR5A 3UETA 4AW7A 3GXFA 3GYEA 2PBOA 2WVUA 3OTRA 3KHDA 3GR4A 2PC8A 1TV5A 1V7AA 4DXVA 1T3NA 1UROA 3AXMA 3WFAA 1UD8A 3AIEA 4AZBA 3L5LA 4P8WA 3WMCA 4OOZA 1DWJM 1V5XA 4GZJA 3NO3A 3F4WA 3Q4DA 4NILA 1BSLA 1KFKA 1MQRA 1U1JA 1W1B1 3UY7A 2CLIA 3VIGA 5I2UA 4XSMA 1V3IA 4JIIX 3VNLA 2J13A 3K8LA 4QNEA 2SFPA 3E2RA 5F2LA 4RNOA 4OZOA 4ROQA 2O4QA 3OU8A 3F03K 4KETA 3GO2A 5L1IA 3D3AA 2POZA 2Y61A 4DI8A 1CTNA 1WAWA 2CBVA 5DLCA 1V3KA 3SM0A 1FWHC 2Z26A 4TQTA 4FALA 1G0CA 3M9MB 1B2YA 1MDRA 5D9OA 3VZXA 2PZ0A 2WSKA 3G1FA 3PZMA 5A5WA 1GHRA 4GUJA 1VEPA 4ECYA 1NAL1 3HFYA 5CZTA 4AIEA 1GNXA 4UR7A 4B5VA 1ESWA 3N18A 1UD3A 2VX5A 5D2WA 2GUBA 2YFOA 3EA1A 4A3UA 5M3WA 4GX9A 2WMGA 1R3VA 4L64A 5A8NA 4QAIA 2Y5JA 2BNJA 4JNZA 1FWSA 5RUBA 1KV8A 4UMAA 3NVTA 1YLVA 4DWSD 4UOZA 1XGEA 4KWVA 5DXYA 1H1YA 2J8FA 1E73M 1JXKA 2W6RA 5KFNA 3L2IA 3G2GA 1K4GA 1YXYA 3CNYA 1DJXA 2VENA 3G22A 5M1TA 1RY8A 1KD0A 1LL4A 3T0BA 3VD4A 4Q7NA 2ZUUA 3UG8A 3WNPA 1M7PA 1UHVA 3TTOA 4DLMA 4WDXA 4GXPA 5CC5A 4W7VA 5AHMA 3T2OA 1ME8A 1Q8AA 5A6LA 1UP3A 4O3RA 3PW4A 3WJWA 2P8CA 2H8ZA 3AMDA 3DBPA 3UY8A 3QTPA 4OBTA 4AG0A 1EIBA 1XYAA 3AS1A 5C54A 4JIEA 1OGGA 4LV4A 3N4AA 4ZXOA 2WJDA 1W9DM 3W26A 1S2WA 2CESA 4F66A 3EX1A 1D7KA 1FCBA 3KOZA 3OBEA 3S9IA 1WDRA 1ZALA 4J9LA 1NM9A 3WD3A 4Y9NA 3WLOA 1VH7A 4RV8A 4ZFMA 3LRLA 4JTHA 3B3DA 1S1PA 1PXGA 3PBYA 1CXIA 1PEZA 4JTTA 4E2VA 2V3EA 1W9XA 4HSHA 1D3GA 5BXSA 3BH4A 2WVSA 4NZ5A 3QLLA 3M5VA 3W1NA 4L65A 2E5DA 1V0LA 2W66A 3ZQ9A 5I00A 5KG0A 4TV5A 2IS7A 4QW9A 2V4QA 1I0BA 1Y5VA 1EC8A 4A4AA 4A29A 4BKNA 3RJXA 2VDHA 4LY8A 1WDQA 3TJLA 1BYBA 4MKSA 4K37A 4RPPA 1CXKA 1W5MA 5CPNA 4UZSA 2BGSA 1F8MA 3MBFA 3N3MA 1RBOB 4J9PA 4HOZA 1NP0A 2AOSA 4LX4A 5BYWA 4LUYA 2ZUWA 3GYCA 1V8EA 2NUYA 4ZOBA 2F7FA 4H7VA 1BVNP 1DJHA 2OGYA 4I5UA 2FZNA 4M7SA 1YXDA 1TMQA 2ZX7A 2PP3A 1KC7A 4GNJA 3GNRA 4ATLA 1H5YA 5IM51 3UR7A 2ZRXA 3ABZA 5GNZA 3WLQA 3RB3A 5A6SA 1JF6A 4QDPA 2J79A 1F6KA 1O5QA 2QW5A 5KFCA 3KVKA 1SZEA 3QOMA 4AQLA 3V6KA 1FCQA 5A8GA 2DIJA 4F0SA 3KW3A 4FMVA 5HPCA 3EWYA 2ASHA 1UD6A 3WLLA 3R25A 1W3HA 2Y7GA 3W7CA 1VBHA 1UZ4A 4CNPA 4GY0A 1E6PA 3B06A 3OZOA 4HNVA 1K8CA 1UW9A 5HDRA 3SJNA 4EXQA 3O06A 1W31A 2XN0A 2OYKA 3EOEA 4GWEA 1TPFA 3SSZA 4YVPA 2CZEA 1VB9A 3W7LA 5EA9A 2FB2A 4YWSA 4DPPA 5FJIA 2VC7A 4MDPA 3C2YA 1R47A 4M24A 4M0XA 5FJRA 3RDKA 1JR1A 1WZAA 3CU2A 4BFAA 5KFMA 2FPVA 4U28A 5E09A 3I3BA 1R30A 1OD8A 3CHDA 1SYTA 2ANUA 3MFIA 4BY3A 1TPUA 2ZIDA 1RVKA 4ZTXA 2XPKA 2Y24A 3CQIA 4YJ5A 3ZSSA 3QQWA 4MOZA 4RE0A 3AHTA 2H3DA 6XIAA 4F0LA 2YL8A 3KL3A 2H8XA 1ISZA 3OQ8A 3A4JA 4CNUA 3NSMA 4IGNA 5C8BB 1TJ0A 4W85A 5DG7A 3PVFA 5I79A 1YDYA 4H00A 1US0A 4OTKA 2QIIA 3HB9A 3PR5B 2HISA 2WSPA 2WV8A 1M9HA 1DTNA 1FXQA 2GQ3A 5CKSA 3DFPA 4C6KA 3CAWA 4PUJA 1KWGA 2G3IA 1SW7A 3IIZA 3GWQA 4NAEA 3FVMA 4JZ5A 1G94A 1XC6A 2XN2A 3VMNA 1W3KA 1RHCA 3BGGA 1DV7A 1EDGA 3N3TA 1B9ZA 4HU3A 2WPGA 4ZE5A 5AFDA 1DQXA 2OVLA 3BG5A 5K9CA 1JRBA 2J4GA 5KMYA 3V1HA 4DL4A 4HU8A 3DU0A 2ALRA 2E25A 5GQBA 1PWLA 3DX5A 1DIOA 3U5UA 3S5OA 5M2FX 4MWAB 1XSJA 4BQ4A 5JIPA 3W82A 5DLGA 4JICA 3UEQA 3O6CA 1YHTA 1TWSA 3K8MA 2CBUA 2Q71A 3MKVA 1ENUA 3VUSA 4GCXA 2H9AB 2BY3A 4HU0A 3UW6A 3U8GA 4YTQA 3AJ7A 3W7MA 5KZ6A 1PIFA 4UOQA 2O55A 3PM6A 3NXFA 4UTHA 3LPPA 4DJFD 2GJRA 3NO1A 3K4WA 3P74A 1PVNA 4H2CA 1E51A 1TFVA 4US5D 4KRZA 2WKJA 3WYZA 1B9BA 1KM5A 4E3TA 3UPMA 3WSUA 4KGJA 4RJEA 4ZXLA 3GGMA 3GU9A 1PV8A 3EXRA 4JN8A 2GPTA 3QHNA 4PTNA 3SUTA 3WY1A 2V5JA 5KFLA 4C6BA 1WX0A 3R11A 3BSMA 1EJXC 3SCVA 3ARXA 5I3GA 4HZ7A 4M82A 1EOMA 4LYKA 1GOQA 3EA2A 4REQB 2BVWA 2E6DA 2GJXB 2EAWA 2CWXA 4H3DA 4OUEA 1N7KA 4GX8A 3SN4A 1R2RA 4DI9A 4B5SA 1QVBA 3UJEA 2ACQA 2I5IA 3GDRA 3W07A 3SQMA 4G2DA 1NELA 2PGEA 3EDFA 1PKYA 3O07A 4PL2A 3CQKA 3CIVA 4G7FA 1RH9A 4C6OA 4LNCA 3VC6A 3IJIA 4IMFA 3W7DA 2C15A 1JZ5A 3T9PA 4EANA 2RAGA 1D9EA 1AL7A 3OQEA 2DZWA 5F2IA 1WO2A 4NJKA 1O5RA 4XBSA 3R79A 3MANA 1ADDA 4GJ1A 4LU0A 2E09A 2WCAA 2VUNA 4GVHA 4S38A 4ZVJA 2IQDA 2PDXA 3B40A 1QI0A 4UMBA 3C2RA 4S2BA 1H49A 3A3HA 4UBPC 3MP4A 1UKOA 1TVPA 5F7UA 3V6HA 4XISA 2PLJA 1LDCA 3RAOA 3LK6A 1TG7A 4JV1A 1V0MA 3FKKA 4Q4RA 1X6LA 2Z27A 2EJAA 3MUAA 3UNTA 3M0MA 5A6MA 4ZOCA 3H4WA 1O60A 1DWAM 1VLWA 1UA7A 2NV1A 2HZGA 2FMOA 1WDDA 1A49A 3MR6A 2JEFA 1IM4A 1HKWA 4O4VA 3ITVA 1C8QA 1J0YA 4JEQA 2D2OA 1ECQA 5KG3A 1H41A 4W4QA 5D2XA 3FA4A 4MZ8A 1XH2A 4JIQA 5HWJA 3PAOA 4QJ5B 4LVBA 2PWVA 4Q8EA 4H6QA 2CHOA 1PL9A 4W84A 3TDFA 3VZYA 3APGA 2UY4A 5LA1A 2QCNA 3UJRA 5TIMA 2O7SA 2PU0A 2EPMX 4DYKA 4J3UA 3POCA 3DKLA 4H8NA 1KFJA 4ECZA 3N9KA 1JNDA 3ZSTA 3MUIA 4UTKA 4H7CA 4CLMA 2Z4GA 3COTA 4OKDA 4DO4A 3DFHA 3W7KA 3GV5B 4S3BA 4XZMX 2VCBA 5BCAA 1XUUA 2Q02A 3W6YA 3I4EA 1PSCA 2B31A 4XZBA 3FJLA 3BQ1A 4LNYA 4V33A 4XAFA 3NVDA 5LIXX 2PS2A 2J25A 3S1VA 1R7OA 1FXPA 3QPYA 1MI3A 1W54A 1H09A 2GUUA 3F5JA 4DL5A 4Y9PA 5FI8A 1PHWA 1E6RA 3IANA 2W92A 4V1XA 3BQ6A 3JR2A 4U5KA 4AEEA 4UQBA 5AZ1A 3ID7A 4ZO7A 2OLHA 4A05A 4D6JA 4OV9A 4UMCA 2DZAA 4FZIA 3I6EA 1GOOA 4HIBA 3LNPA 2VFDA 3O6DA 4F9DA 1QTWA 3KLKA 3LN3A 3E96A 2DPEA 2GQ9A 2JEPA 3CZGA 4RE4A 3N4EA 1WZLA 1EA9C 2CLOA 4JFWA 1B3XA 4JDBA 4X2RA 3C4UA 4D6FA 1W3IA 5EMUA 2PTDA 5C9RA 3CGTA 4UXDA 4Q6JA 5L9FA 1UJQA 2INFA 3BOLA 2IBKA 3L7RA 2YSWA 1UQZA 2G96A 1JD7A 1XJBA 3LNMA 3VAVA 2VD9A 1WUEA 4MLRA 2AGKA 1FP8A 4NI8A 3P67A 1KLZA 3ZT6A 3DESA 3ARPA 1BTCA 1R2TA 4GIAA 2ZZ7A 4XZHA 2W3ZA 2VFEA 5CZSA 5F9NA 1Z8AA 2C1IA 1PX3A 3LHVA 1UR3M 3LM3A 2ASDA 1P43A 1NP2A 1JX4A 3EWUA 4UTJA 4HMCA 1IF2A 5F4XA 4X2PA 3ZLFA 1BF6A 4RNHA 3LXBA 1GQLA 4XQ6A 5DCBA 2QUVA 3H7RA 1GOXA 2V5KA 1MXDA 4W9TA 2RGLA 3FGCA 3OLEA 5KFYA 4C6QA 3CO8A 1J0IA 3MQTA 2B0MA 5LGZA 4PRRA 3QV6A 2Z1WA 5D03A 1EHNA 1W91A 5I23A 1CXEA 1ZNNA 2E67A 3TYZA 3KZSA 1UA3A 2UVWA 4JD4A 1QPOA 1PX4A 1FH9A 2EXOA 2FZ8A 4ORMA 3EOLA 5A6JA 3VOHA 2VWSA 3IGUA 1O1ZA 4GG9A 2DFAA 3C2OA 4M7TA 1R3YA 4HZ8A 2DORA 3N19B 3KAOA 2IXUA 3VOGA 4MYXA 4HPJA 3AZTA 2IPWA 1R3SA 1SSDA 2FZMA 3N25A 3W28A 4AD3A 2F61A 1P6WA 4L4PA 2KX9A 1SPQA 1W6TA 3N17A 3GXNA 3VNYA 1FTXA 4H19A 2CKRA 2WSRA 2BMBA 4A35A 3ARYA 5CPMA 3TXZA 1LP6A 3CS2A 2YL9A 3IVUA 4PBGA 4UTIA 3E0WA 3G0UA 4KIEA 2PP1A 3HGJA 2XSAA 4FXRA 3EXSA 4UOJA 2D24A 2GSJA 2YA1A 1UOZA 3OGSA 2Y7FA 1QW9A 2V38A 3R6IA 1E0VA 3M6YA 1VFUA 3PULA 4WQ6A 3O7UA 2OB3A 3KVLA 4RNIA 5CPQA 3TFXA 4I7WA 5K9XA 5K9DA 1W32A 3LB0A 4K8GA 2PODA 3FA5A 3CB3A 4JKMA 4S2CA 5CPLA 3KL5A 4LRTA 1E70M 2ZBTA 3W38A 3G1HA 3QC3A 3G0SA 3MR2A 1O5KA 2A4AA 1Z3NA 4EVZA 4LB4A 4XIAA 5B7ZA 4NNCA 4NXSA 5F4WA 4JTRA 4PRWA 3H8AA 1PZ3A 1AQHA 4E0CA 4JTJA 4KIRA 1PZ2A 3EWWA 3F5KA 3OVQA 1O95A 5DEZA 3T8LA 6TAAA 4MJZA 3J7HA 4ICCX 5EGRA 3TSBA 5I09A 4URIA 5I3FA 2DZSA 1OT1A 4JOMA 4QCEA 3W1XA 3APTA 4NI3A 1E6ZA 4KMQA 2BOEX 2ZUSA 3PBGA 4JTUA 3VIMA 4IG2A 1V6XA 4QJ4B 3TLQA 5E0FA 3B03A 2NVDA 1J6PA 5U4NA 4GJJA 5D8ZA 4EPDC 3NG3A 1RXOB 4AH7A 2J9XA 3W2NA 5HXMA 3V0TA 3GG1A 5F9LA 1C91A 4PULA 4OVXA 2DSUA 3AYVA 2B4GA 1M03A 3W85A 3BQ2A 5AVNA 2NSXA 2VDIA 3IGHX 1OSEA 1RUSA 3TAOA 3LQGA 4JIHA 3LY0A 4MGGA 1BFNA 1VBRA 3DHPA 3S6OA 2GJLA 2PURA 5I06A 1E0WA 1GGOA 3W2MA 4JUZA 4DN1A 3S46A 2GGJA 5FSEC 2GL5A 3TMQA 4CNNA 1E4MM 1JEZA 2FZBA 4IIHA 4M81A 5IOBA 4CCZA 1S46A 1UR0A 4H83A 1PKMA 3VDGA 3EPOA 4UNLA 4HOXA 2P3EA 3P0XA 2DZUA 3SCWA 2QJNA 4ED7A 3W37A 3ICJA 1ICPA 3LGDA 2ZA3A 1IZKA 1Y5WA 5LZLA 3THAA 2ZVIA 3ITTA 1F74A 3KRZA 3VD3A 3VIKA 3ZIZA 4PE8A 1OD0A 5CXPA 3A23A 1RP9A 1QNSA 3LRKA 5BOFA 1US3A 3WF0A 3W88A 2JF6A 2C22A 1ZPTA 5FF7A 3T81A 3N9RA 3TC7A 3OW1A 2BASA 1TUFA 3CYJA 3GNPA 3NQ7A 3K1DA 4FXFA 1B3ZA 4LUTA 3M41A 3QKZA 1S9FA 2P50A 2B81A 2X2GA 2EKGA 1N8FA 1XYFA 4XG1A 3MR3A 3OO2A 1H51A 2ZA1A 1VQTA 4LS0A 4NJJA 3R12A 4NX0A 5G2WA 1E3XA 3QV8A 3LA4A 4R7WA 1QI2A 3B8DA 3V7PA 3GIKA 3PW7A 2ZKMX 4LCSA 4HVXA 3PSWA 3TH6A 2R14A 1B90A 4XX6A 1FY6A 2WANA 3OJGA 4GRSA 3WQOA 4CNTA 2NQ9A 5DMYA 4ZQPA 3OIXA 1KV5A 5BXTA 4DNHA 4ZENA 4KERA 4U4MA 1UOKA 3N2OA 3BJTA 3CO4A 3NYDA 5G4WA 4B90A 2VELA 4MZYA 2D69A 2XU2A 4DXKA 1DBTA 3ZR6A 5LXXA 5C2CA 3LV6A 2CIPA 3L4VA 4Y9OA 2XVPA 1NIUA 3LXCA 3LSCA 4WDWA 3VFCA 4J2PA 4FIQA 1RLCL 5FJTA 2BFGA 1QT1A 4YWIA 4IH3A 4LCRA 4H9MA 4IOTA 4O10A 4LANA 3WQ8A 1E43A 1JULA 1XCFA 1I1XA 3MI2A 4I8DA 3IPWA 2XIOA 4FNRA 4KGLA 1CGWA 1DVJA 5EKYA 1CWYA 1ZP3A 2Q09A 2ZICA 2C79A 4F79A 2J6SA 3FJ4A 1OFQA 4B5NA 4C6JA 4POCA 2ZZ6A 1XFCA 6XIMA 2F6KA 4I5RA 4IFOA 4HHHA 3PFRA 1MDLA 1PJ9A 3RCYA 4WDUA 4LALA 4LAMA 1QOPA 1EUAA 1PPIA 3OGVA 4GA8A 4DJDA 4J9RA 2A3CA 3T09A 1UWQA 2ODOA 4K68A 3BOFA 3EPMA 4I9MA 2NLIA 1P0EA 3PZPA 3L65A 1JNEA 5BWFA 4F3HA 1M53A 4FLSA 5A6TC 5BWAA 3SIZA 1IZCA 3TNOA 4YTUA 4PH6A 2Z6JA 4O3OA 1NEYA 3GQYA 4DXXA 7XIMA 3KTSA 2RDTA 3TX9A 2WCGA 3UERA 5JBDA 2NXIA 3I10A 1DWGM 3NQ8A 3CAKA 3TE9A 4C6MA 2NVCA 1JCXA 3G1XA 3NPVA 3A9BA 2AKZA 5JUVA 2HBXA 1HL2A 4AC1X 2FHCA 3WFZA 2XGIA 2VR2A 2WM0A 3WNKA 4M3PA 2HEJA 1GHSA 3MBDA 4ECRA 4RCXA 2EHHA 3QV7A 3S42A 3H7UA 2PTZA 1OQFA 1MQQA 1S0OA 3GBEA 3WL0A 4O1AA 3B9AA 2DDXA 1NARA 3TCEA 2YCLB 4INFA 1JRCA 4NSBA 4J27A 3TC3A 2Z29A 1K8YA 4ZA0A 3TIMA 3LG3A 2RJHA 2UWFA 4LS2A 1GVRA 2E1DA 1W37A 3NO5A 1XIIA 1A47A 3CZJA 1IZJA 4R53A 3IACA 2BV9A 4E4UA 5HJXA 2EPHA 4GO8A 2ZWYA 3QEZA 3WENA 3RM4A 1BQCA 3MP3A 3RLUA 1QNRA 1C7TA 1R9YA 3FN9A 3T40A 4QWAA 4IP7A 5FACA 1ZAIA 4GJIA 1IEIA 3WMSA 4GUGA 5IDZA 1SJAA 5C0QA 1RVGA 4GYPA 3KZPA 1JVNA 2P8BA 2QGHA 4EEYA 1V7YA 4U3AA 3CT2A 1ECEA 1TMHA 3OG3A 3GIIA 3EDKA 5HNUA 4FF5A 2A7RA 2WVVA 1I2PA 3CQJA 3FOKA 4MIMA 1TV3A 5EMYA 4UTTC 4JQ3A 2Y2WA 4WR3A 4BA0A 1H7PA 1GONA 3MMWA 3TP4A 4JCMA 2XH2A 5KFKA 3P2VA 4YU1A 1SFJA 3RRAA 3GD6A 4ZQRA 3FCPA 3S5SA 1UD2A 4BHYA 4P7LA 5D30A 1VRXA 3EX4A 3VTRA 1AH0A 4IP5A 4LS1A 4G7EA 2ZC8A 3RMEA 3UD6A 1OCBA 2MANA 2G41A 5I07A 1TYGA 2E6YA 4FNPA 3RIKA 5I7GA 2QVNA 2VEMA 2QT3A 4Q4SA 1FQ0A 3WLRA 1Z32X 1L6YA 3A3XA 2WJFA 3GVRA 1OABA 1EJUC 1QHPA 3IK4A 4IX2A 5DT5A 1OM0A 1WCGA 4UCGA 2Y4SA 2BGNE 5D9NA 1T41A 5FIPA 1PYMA 1Q5MA 4XWUA 2RH9A 3I7RA 2QCFA 2Q3OA 2HNHA 4J35A 4LVGA 3KRSA 1EO5A 3ARUA 5J5RA 3GNXA 2R24A 3WJXA 1VFSA 4TQRA 1H11A 1MSSA 2GYIA 4DUXA 4F0HA 3VDAA 4QW8A 3BW2A 4DZAA 1YXCA 3EGJA 4E8CA 3T05A 3VD7A 4ZB0A 3FHAA 3PN8A 1B3WA 5DT7A 3VX0A 4NXKA 1IEVA 4RXGA 2C71A 1UZHA 1EJWC 1YPFA 2VX6A 5G4EA 3MSDA 2YXGA 1F07A 3Q8PB 3UWVA 1MW3A 3N29A 2HPMA 2J7GA 4YN5A 4PB3A 2BQ3A 4N42A 1XISA 2VFGA 2WMKA 4GPNA 4NJIA 1R3TA 3BDKA 4WHBA 5FSDC 1LBLA 3VCRA 2V3DA 9RUBA 3NQ2A 4AZ6A 2NQJA 2QYGA 1W1YA 4Z1AA 4GC3A 4PTWA 4MB5A 1B4KA 4GYKA 2IMRA 2Z2BA 4KEZA 4H9YA 4DJFC 4XUGA 3Q94A 1L6WA 3FW6A 2REQA 3AISA 4AZHA 5ABFB 2YW4A 3IJQA 2QUUA 3A6OA 3L21A 3KRBA 4KW2A 4WY0B 3S2NA 2DUAA 1RA5A 3H2OA 1I75A 2V67A 2FFCA 1AQ0A 2DSZA 4ZMGA 3TKFA 3B97A 1XIEA 4JS3A 4LH8A 3ALGA 2E3ZA 4O3PA 4PUWA 1OADA 5I24A 4L1XA 2WMIB 1JZ6A 3PTKA 3M7WA 1GOWA 1BRLB 1IT7A 3Q8RB 1FCUA 4D6GA 4B9ZA 1GPFA 3S9YA 2Q8ZA 3P82A 4M8UA 3PG9A 3USBA 4V1YA 2ZTJA 3B8UA 3B0PA 4JTAA 4LAUA 4HHMA 3M9OB 1SSGA 3V35A 2Z2UA 1N82A 3GV7B 4FA3A 1M1BA 1LF1A 1EDTA 2BODX 3NQEA 4OJYA 3M0IA 4EYIB 3S83A 4Q8NA 3IAQA 1TJ2A 4UTFA 4DHGA 1QNOA 1OFAA 4FX8A 4Y8FA 3HFTA 5KT3A 3RLVA 2BVTA 4IP4A 1T40A 1KM2A 4GZIA 5HNTA 4Q8OA 4NZ3A 4JV0A 3W7PA 1J0KA 2FH8A 2CWNA 2WMFA 3W1MA 5I3IA 4CU7A 4EAYA 4R33A 1GKRA 1SJBA 4LAOA 1AH4A 4AHPA 3LYEA 3C61A 2UY2A 3NDZA 1BSIA 1EEXA 4WRHA 5I0DA 4W8BA 1MNSA 1ZS2A 5AHIA 1VCFA 4KQNA 3MI3A 3CMGA 3TR2A 1GQKA 2EPLX 4TO8A 3UXAA 3SRFA 3NSNA 1D2KA 4UTLA 1BPLB 2VZSA 1B3VA 4HA4A 1IQ8A 3CUIA 4ZQCA 1R46A 4GVGA 4AXKA 1JCLA 2P10A 2OWWA 1P7TA 4EWND 2R94A 2PTXA 4D6HA 1OFDA 1JCJA 1K9FA 1PS9A 3CAQA 4JL1A 4A2RA 1S5NA 2VVSA 3RB4A 4F2BA 4G3IA 3A5FA 4MVAA 1NQ6A 2EPOA 3WUBA 1XIMA 5FESA 4C60A 1TZ7A 2OXNA 3DG6A 3E2QA 1TE6A 3HQPA 5BRPA 4IGHA 1K7FA 4CN6A 8XIMA 2NWRA 1S10A 3TQVA 4QWCA 2V6AA 1KTNA 3PWIA 2VGGA 3WEMA 5C9WA 1XBYA 2IW0A 5SWUA 1V6YA 5FJJA 3CAVA 4J5NA 4O14A 4IFKB 3SQLA 3B8SA 1W2PA 5G1MA 1EJTC 1P48A 1XKJA 5LA0A 1IEXA 3K5XA 5BOOA 1TTIA 2QCDB 1YE4A 1Y7VA 4Q33A 1FVPA 4HB7A 3BV4A 1NFPA 2O9TA 3KFTA 5L9XA 5K7JA 2PDIA 3TR9A 5AHNA 4XUYA 3TW7A 3TYUA 3U2OA 3OIHA 4H9XA 4L5ZA 3SSJA 4HCLA 5H1WA 5LIYX 4G1NA 3OSNA 4L61A 4YMZA 2I9UA 3I65A 3DHUA 2EPKX 4NZ1A 3CQ0A 1HKVA 5D02A 3PWAA 4AD4A 1JZ7A 1LBMA 4WJEA 1XR2A 3POHA 1WQ5A 3DIPA 2HROA 1DEDA 3BZJA 3B4UA 1VKFA 3OYXA 1J5TA 2R9RA 3BLEA 3UJ2A 4MJMA 4B92A 2QCEA 5JH2A 3C8NA 2A79A 3CIXA 4F4XA 2GGEA 4V28A 4WDTA 2Z6IA 2XYLA 2GSHA 5DF0A 3UXKA 4GUHA 2HPIA 5A8OA 3EX6A 1EOKA 1HVXA 2ZYFA 4GVFA 2D22A 1DE6A 3NZPA 4K2SA 3IIXA 4IJBA 3TQPA 2JKPA 3RX2A 1VEMA 4UFMA 2VQTA 3BURA 3RCNA 6PTDA 4PUUA 2E6AA 3S5YA 3SCNA 1XLDA 1WNOA 1G4PA 4JTQA 5JU6A 2IQTA 5E5CA 3PZUA 1AZ1A 1E9LA 1R0MA 3HGSA 3WUFA 3LEPA 3G3DA 4IL2A 5JQ9A 1QUMA 1BF2A 2ZCGA 2QDEA 1C90A 1GTHA 2J7EA 1Q85A 4IGMA 2UVUA 3OEXA 3C0LA 3VKCA 1FHVA 1FH8A 3ORWA 1GW1A 1K02A 1R3QA 1SJDA 3N4FA 3F2BA 2HS8A 3UWUA 4FHAA 4DO6A 4YS1A 4AF0B 3NL2A 2G3FA 4IX0A 1FDJA 4O28A 1XWYA 4ROPA 1RK6A 2HXUA 1NWTA 3NL6A 7REQB 5REQB 3V5CA 3NZ1A 2ZE3A 2E8ZA 3VKBA 3IWPA 2VL4A 4HT3A 1K70A 4XIMA 4PEKA 1Z44A 4L4LA 3NXLA 8RUCA 4NT0A 1E9YB 2YGYA 3PBWA 1ZZMA 3TYEA 3WNMA 4NP7A 4H9VA 4S3GA 2E77A 2XIJA 1AA1B 2ZVRA 3BLIA 4Q8WA 1O7AA 1B5TA 2BLEA 5DMLA 1FDYA 3Q2DA 1Q6FA 1SVDA 3ANYA 1JUEA 1K6AA 3CXOA 1C9DA 4OWGA 2EJ1A 3FJ6A 1W1TA 1TVNA 1UR1A 4F9JA 3HGOA 3ZO9A 4FS1A 5E9XA 1PZ1A 1E3ZA 4WVXA 2KAUC 3P8JA 4W87A 2CCRA 5AC4A 2PDPA 4W5ZA 3ABOA 4BEUA 3CL8A 3H21A 5T8GA 1AL8A 1E72M 5DG9A 1H1NA 4Q43A 3ABXA 2V5DA 1LWIA 1FOBA 4ECTA 1VPXA 3M5XA 5KT2A 3O15A 4ILSA 3WH6A 3PZGA 3MZ2A 2Y8UA 3PFMA 4WXZA 3VIJA 4DLFA 1ODZA 5DY2A 4U5IA 3LHZA 3GHRA 3BLOA 1XIDA 4OV4A 3SZ8A 2VRKA 1AD1A 4GQGA 5FEPA 1FWIC 1KFEA 3CUFA 4PCFA 4YXGA 1ALDA 2DP3A 3HTWA 3T5JA 2Z1BA 4GI6A 1JFHA 1DJGA 3DFNA 2AKMA 4D6IA 4UTUA 4ERGA 3B9EA 5DQGA 3VNJA 1LRTA 3NL3A 4LGXA 2DJLA 3H4BA 1NDWA 3QN3A 4QBXA 4M5PA 1VJIA 3B05A 4Z2KA 3WK1A 4BI7A 2GVEA 4V2XA 9CGTA 3B8WA 4GFSA 1O4UA 2DT3A 4S3EA 2FVMA 4MB4A 3MW7A 3T55A 2RDWA 2A2IA 4G8TA 1JDCA 2PA6A 3PBUA 2BTMA 3TYCA 4CD7A 1SQ7A 3LCGA 3LCWA 4LYPA 3O1NA 2NQLA 2PDQA 1O94A 4I5XA 3EB3A 1B54A 5LIWX 2FIQA 3VYLA 3KWSA 3URQA 3W73A 4FNQA 3ZT5A 3DEQA 4C6IA 1QNQA 4BF5A 2WZIA 3BPWA 2FMNA 1RD5A 4NNAA 8XIAA 1SMAA 1HKKA 3BMXA 4MFEA 1GG1A 1JDDA 1JPHA 3ARRA 5JVLA 4KWSA 1AJ2A 3KVJA 3PPFA 5KG5A 3U5YA 3AIQA 1E1CB 5AY7A 4DIAA 3V1PA 3KX6A 2RKXA 3ZM8A 3OA3A 4ZO6A 1L9WA 3BTNA 4TV6A 3G6LA 4O1DA 4CQ9A 2PTYA 2QUTA 3MVIA 3M64A 1NFBA 1HQTA 3RGTA 3CZKA 4YYFA 2W9CB 1XRFA 4JQ1A 2CLKA 2BVDA 2I5QA 3Q58A 3EKGA 5PTDA 1X96A 4HA1A 2YDAA 4H8HA 2WCSA 2VEIA 4GINA 5I3KA 1A5BA 5AYYA 1Q2SA 1TX0A 3IRDA 3OP2A 5BZAA 1XLFA 2BXYA 1UR4A 4XK2A 1JIHA 1AK5A 2V63A 3P62A 4O0QA 1QW8A