2Z00A

Crystal structure of dihydroorotase from thermus thermophilus
Total Genus 153
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
153
sequence length
426
structure length
426
Chain Sequence
b'MILIRNVRLVDARGERGPADVLIGEGRILSLEGGEAKQVVDGTGCFLAPGFLDLHAHLREPGEEVKEDLFSGLLAAVRGGYTDLVSMPNTKPPVDTPEAVRALKEKAKALGLARLHPAAALTEKQEGKTLTPAGLLREAGAVLLTDDGRTNEDAGVLAAGLLMAAPLGLPVAVHAEDAGLRRNGVMNDGPLADLLGLPGNPPEAEAARIARDLEVLRYALRRSPATPRLHVQHLSTKRGLELVREAKRAGLPVTAEATPHHLTLTEEALRTFDPLFKVAPPLRGEEDREALLEGLLDGTLDAIATDHAPHTLAEKEKDLLRAPFGIPSLEVAFPLLYTELHLKRGFPLQRLVELFTDGPRRVLGLPPLHLEEGAEASLVLLSPKERPVDPSAFASKARYSPWAGWVLGGWPVLTLVAGRIVHEALK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Dihydroorotase
publication title Crystal structure of dihydroorotase from Thermus thermophilus
rcsb
source organism Thermus thermophilus
molecule tags Hydrolase
total genus 153
structure length 426
sequence length 426
ec nomenclature ec 3.5.2.3: Dihydroorotase.
pdb deposition date 2007-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01979 Amidohydro_1 Amidohydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.40.10 Mainly Beta Roll Urease, subunit C; domain 1 Urease, subunit C, domain 1 2z00A01
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 2z00A02
2WJDA 3E38A 2GSEA 4HA0A 4G2DA 4C6JA 5FSEC 1RJQA 1A4LA 3ICJA 2HPMA 4HK7A 1QXLA 1ONWA 4LALA 2VR2A 2D2GA 2WJEA 4DO7A 4G7EB 4IFRA 3JZEA 4IFOA 3S2JA 1EJRC 4IG2A 1KCXA 1S3TC 4DLFA 1EF2A 4YIWA 3E2VA 3B0XA 3RN6A 3URBA 4C6LA 1GKQA 4C5ZA 4J5NA 1A5KC 1XWYA 3QY7A 3B40A 2OB3A 4R7WA 2EG7A 4GX8A 4LCRA 3SFWA 4IQJA 2XIOA 2OODA 1KRCC 1YMYA 1RK6A 4V1YA 2O4MA 2Z2AA 2P53A 3OJGA 3V7PA 3ITCA 3O0FA 2PLMA 2Z26A 4XD4A 2BGNE 3IV8A 2P9BA 4V1XA 1PSCA 3GGMA 2PGFA 3QGAC 2R1LA 4IFKB 1FWFC 3TN6A 4C6NA 5AKQA 3F4CA 1UMLA 3E0FA 1UBPC 2VUNA 3NQBA 2AMXA 4KEVA 1E9YB 4H00A 3T1GA 4G7EA 5G4HC 3LA4A 4GYFA 1A5LC 2Q09A 3A3XA 3R0DA 4D8LA 2A3LA 4NP7A 3UR2A 3URNA 4RDYA 4XD6A 4C6DA 2O4QA 1FWGC 3K2GA 3HPAA 3CS2A 2GZXA 4F0LA 3OVGA 1KRAC 3RCMA 4QROA 2QT3A 3GU1A 3MPGA 2VC7A 2OQLA 1FWEC 2VC5A 4CNTA 1ZZMA 2QPXA 5A6TC 4PBFA 1RJPA 1M68A 2E1WA 2R1KA 2W9MA 1RK5A 4CQBA 3AUOA 1UIOA 2HBXA 5HMEA 1UIPA 3EGJA 3BE7A 3S2MA 3MVIA 3TNBA 4QS5A 4HK6A 3IGHX 2FVKA 4XAYA 1NDVA 2GWGA 3GG7A 3LSBA 1WXYA 4OFCA 2ADAA 1EJXC 3K5XA 1EJWC 4GY1A 1POKA 3IACA 3QY8A 1EJSC 4GX9A 2PUZA 3GTHA 4DZHA 4NG3A 4XD5A 3GIPA 4CEXC 4PBEA 3AU6A 4IH3A 1J5SA 1R9XA 2WJFA 3GUWA 1PTAA 4QS6A 4QTGA 1DPMA 3LSCA 1ONXA 4KERA 1P1MA 2R1NA 2ICSA 3GU9A 4DZIA 1NDWA 4ICMA 3OOQA 2Q01A 3OODA 4GK8A 4RE0A 2ANUA 2I5GA 1K70A 1ITUA 2KAUC 4RDVA 2I9UA 1BF6A 2Z27A 1FWCC 2FVMA 4L9XA 4P5UA 3IARA 4J35A 4QRNA 4WVXA 2YZ5A 1FKXA 1FWIC 3GTIA 2DVXA 5LXXA 4GOAA 1J79A 4XD3A 5FSDC 3DC8A 5HMFA 3G77A 3CJPA 2FTYA 1YNYA 1EJTC 1QW7A 3UR5A 4L6DA 2Z7GA 4IGNA 2IMRA 4XAZA 2R1MA 1HZYA 4RDWA 4IGMA 2HPIA 1GKPA 4XAFA 3PBMA 3EWDA 4CEUC 4KIRA 2YB4A 2UZ9A 4PCNA 4EP8C 4LAOA 2WM1A 5HMDA 1K6WA 4J2MA 3F2BA 5CH9A 2AQOA 4F0RA 4NI8A 4GZ7A 4LEFA 2HNHA 2QVNA 1POJA 3HM7A 1PO9A 2EG8A 2GWNA 3TN4A 4EPBC 4KQNA 4DI8A 1A5MC 1M7JA 4H9UA 3FDGA 4AC7C 3LGDA 4HJWA 3AU2A 3MDUA 4R85A 1IE7C 3A4JA 3GTFA 1FWAC 3E74A 3TN3A 3SO7A 1I0BA 3FDKA 3URQA 1FKWA 1V51A 3WZ0E 2OGJA 4CQCA 2DVUA 4B90A 4C6FA 3MJMA 1KRMA 4EPKA 1EJUC 1I0DA 4C6PA 1VFLA 4JOMA 1FWBC 3ORWA 2P50A 3IRSA 1RJRA 4C6OA 2GOKA 4F0SA 3PAOA 4KEUA 2Z25A 2Y1HA 4CQDA 4WHBA 4I6KA 1YRRA 4LFYA 4B91A 4GY7A 3IJ6A 3D6NA 1O5RA 4LAMA 1YBQA 1RA0A 4DNMA 4GBDA 4M51A 3B0YA 3F4DA 4MUPA 2Z28A 3UPMA 2G3FA 1K1DA 2VHLA 4PCPA 2RAGA 3UF9A 3RYSA 4B92A 1NFGA 4EPDC 2YB1A 4LCQA 4GXWA 4DLMA 4C6IA 4KF1A 4CNSA 3LU2A 3N2CA 4H01A 3MKVA 2OOFA 1PB0A 3GTXA 1KRBC 1FWHC 2F6KA 4H9VA 3LNPA 2PGRA 4GY0A 4CNUA 4AQLA 1RA5A 3OQEA 3HTWA 1GKRA 1ITQA 2Z00A 3UBPC 2R1PA 3MTWA 4XAGA 1XRFA 2ZC1A 3C86A 3FEQA 1R9YA 3GU2A 3MDWA 3MVTA 3S2NA 1EJVC 3S2LA 3E0LA 1J6PA 3ISIX 4H9ZA 1FWJC 3F2CA 4TQTA 4RZBA 2E25A 2UBPC 4BJHA 4KESA 3EWCA 4DI9A 3PNUA 4ERAA 4H9TA 2AQVA 3K4WA 1M65A 2CZVA 3GIQA 3PANA 1P6BA 3NURA 3PNZA 3CAKA 2HQAA 3MSRA 2YXOA 3GRIA 2Z4GA 2BB0A 3T81A 4R88A 3LGGA 4BKNA 1YBQB 4C60A 3URAA 4I6VA 4GC3A 4UB9A 4LCSA 1ADDA 4C6EA 2EG6A 4E3TA 4Z42C 1A5NC 4BY3A 3OU8A 2D2JA 2Z2BA 3E3HA 1EZ2A 4ZSTA 3F2DA 4UBPC 2Z24A 1E9ZB 1V7AA 1XRTA 3T8LA 4C5YA 2FTWA 3ID7A 1JGMA 3WMLA 2HBVA 3TN5A 4WGXA 4DYKA 4PE8A 3QGKC 1NDZA 1O12A 1RAKA 2PAJA 4H9XA 1A4MA 1WXZA 4IF2A 1EYWA 2VM8A 3O7UA 1P6CA 1R9ZA 1XGEA 4C6KA 2FFIA 2Z29A 4HK5A 4ZSUA 4LANA 5E5CA 4IG2B 1YIXA 4QSFA 1W1IE 4KETA 3IPWA 4ERIA 4IFKA 1V79A 2DVTA 4C6QA 4ERGA 4C6BA 2D2HA 4C65A 3QY6A 4RDZA 3RHGA 3WYZA 4C6MA 1A5OC 3DCPA 4C6CA 4EPEC 3S4TA 3KM8A 1J6OA 4KEZA 4LH8A 3DUGA 1FWDC 3A3WA 3LY0A 3NEHA 4DIAA 4INFA 1NDYA 1V4YA 3LS9A 4B3ZA 1V77A 4H9MA 2QS8A 4H9YA 4LAKA
chains in the Genus database with same CATH superfamily
5L1IA 3M9NB 3G6XA 3HFTA 1GZ1A 3QHNA 4ECQA 4CU6A 3UEQA 2WHKA 2XWEA 2PE4A 4DYEA 1YPXA 3P5ZA 1G9HA 1BYDA 4IFOA 4TV6A 1XCFA 5XIMA 3ZLGA 3UD6A 4GO9A 1S3TC 3GIMA 4IUOA 4DLFA 4HSOA 4YP3A 4ES4A 3URBA 1ZALA 4K7YA 1EIBA 4J9MA 3NVDA 4J5NA 1V3IA 3VNJA 1F61A 3QY7A 5FACA 5D2WA 1VBGA 3EOUA 1NF7A 1OK6A 4EACA 4D9PA 4ECUA 2PLMA 3STFA 4UXDA 3HGOA 1M04A 2PDLA 1ZTVA 3EX6A 4TXEA 3AHTA 4LS0A 2QJJA 1UBPC 4QJ4B 1LOSA 3AWNA 3NQBA 3WQ6A 4IPIA 2YBUA 1TE6A 2XINA 2WK2A 2J27A 1HUVA 4K1WA 4U33A 4U2YA 1QAPA 2GZXA 6TIMA 2ZRYA 2DZSA 2G95A 3GU1A 3RBEA 1KO0A 4N7QA 4K38A 1PZ0A 4RZ5A 1W31A 1EX1A 3MCNA 4QW9A 4JYDA 4BF9A 3PSWA 2IPWA 2QJMA 5IBXA 3S2MA 1WZKA 3WQFA 4M7SA 4MZ8A 2ZX5A 5C70A 1ME7A 3LPGA 1RCXB 4WKAA 2HZGA 2FJKA 1IWAA 3INPA 4HNOA 4Z2JA 2PPGA 2OMAA 3PBGA 3QXBA 1ISWA 2QNEA 4PMXA 5HQMA 4ECRA 1X96A 2GJLA 3W2NA 1I4NA 3VFLA 2ZADA 3I6RA 3VAVA 4PH6A 2Y7GA 3MFHA 2IPJA 3M0ZA 5C55A 1JVNA 1IEXA 2ZX7A 3CV2A 2PDMA 1QHOA 2OZ0A 1EO5A 1RBAA 5HNUA 2OELA 3T2QA 4XD3A 4RXFA 1BGAA 5FSDC 4YVVA 4AVNA 5I0DA 1QNQA 3HV8A 2IKJA 3TXVA 3WQOA 1L6FA 2INZA 2CHRA 4L6DA 4Q7BA 2Z7GA 4OU1A 4JTDA 4Q8OA 4K3ZA 2WW5A 6PTDA 4JPGA 4ALDA 3KTSA 1IV8A 4XBKA 2FTPA 1HZYA 2ZXBA 1BQCA 4MYAA 2PDBA 4B5TA 2J8TA 2V3GA 3STCA 2O55A 5T91A 2QIWA 4J9JA 6XIMA 4AISA 4Z1CA 2JQXA 3CPRA 3F2BA 3GDMA 3NZRA 4GZ7A 2H8XA 3L12A 4J9RA 1RYSA 5DN1A 2GVGA 1UA3A 4EPBC 2QIIA 2J6UA 3H7UA 1Q6EA 1RALA 3MV11 2CLKA 1KKRA 1TCMA 4DL6A 3LGDA 4HJWA 3UFYA 2C0AA 4FNTA 1IE7C 4WDTA 2J24A 1RVGA 3MP4A 3GK0A 2VX4A 3H70A 1N8WA 2OX1A 3GNNA 2AQ4A 2ZUTA 3W85A 2PZNA 1R3VA 1XRSA 6CGTA 4YN5A 1OYCA 2C8NA 2VOTA 4UIOA 1FWRA 1SZGA 3NR0A 3DG3A 3NM3A 4I6KA 1YRRA 4OBSA 3TQKA 4CD4A 1XH1A 3KW3A 4TOQA 4P8UA 3L0KA 3AFBA 3CMFA 3FDSA 3ITLA 2OQHA 3VIJA 7PTDA 4REQA 5G2IA 3R13A 1J8VA 2R6OA 1TTJA 4WJEA 3IEBA 4NJJA 2ISWA 3O15A 3WDQA 3WK2A 5BXPA 4IMDA 3S1GA 4UZUA 5ECVA 2G5WA 2X40A 4F2UA 1JCNA 1VFMA 1A5SA 3N4EA 4C6IA 2PB1A 2OOGA 1R7AA 3ZVHB 4HZ6A 1B4KA 3T5JA 1TPUA 3LPOA 1QHPA 2FHCA 5T26A 1LWJA 6TAAA 3W9ZA 4RNNA 1N2VA 3M43A 5H8PA 1JI1A 3TSMA 4G6CA 2TRSA 1A0EA 3VCNA 5LYRA 2AOSA 2E9LA 3EKZA 2GSJA 1LQ0A 4GVIA 3L4WA 3GAKA 1UPMB 1W3TA 4GUIA 5D4YA 3GU2A 2W27A 2Y0FA 2Z6IA 2JIWA 5FA5A 4GWEA 1XIBA 2X16A 4E38A 1OZQA 4IX0A 3OHIA 3WK3A 1VZWA 3NXLA 2PWEA 5KFQA 3L21A 4UTWA 3GIQA 3WDRA 3RPMA 2XTKA 3ALFA 3TQ0A 3PNZA 2GJRA 1L6WA 1XRVA 2RDIA 2NUXA 5FF3A 5DX7A 2GGJA 1YBQB 1BTMA 4FR6A 4UQAA 2BQ3A 3AC0A 5A6AA 4ADTA 4GVHA 3QR1A 3EWWA 3LNMA 1UR0A 4LNYA 2FLLA 3IAQA 3P61A 3CMGA 2FTWA 5GJNA 5CJNA 3R7MA 3N9RA 5CZSA 1YE6A 5I3IA 4FX7A 1UWSA 3WMCA 1OFAA 5U7SA 3RMEA 1SU5A 3Q8PB 3GAYA 3PFMA 3V4BA 2X1IA 5A3HA 2Z2UA 4O50A 2WNNA 9XIMA 3MR6A 1TKKA 3ITOA 2VDHA 4X0NA 2BY2A 2VRQA 1PAMA 2J7GA 3IPWA 4ERIA 2DVTA 1UZ4A 3W1AA 4RUBA 5HINA 3VMPA 2VEIA 4FXFA 4LRTA 1UJQA 1SFSA 4C6CA 3NM1A 3LYEA 2XZ9A 1ZHAA 2E3ZA 2Y70A 3W1NA 1EWDA 1OGBA 2OZ3A 1IR1A 3TLQA 2W7OA 3W1UA 3S2CA 4A22A 4R8UB 3ZLHA 4G2DA 2VUYA 3L0NA 1I1WA 2ZE0A 1D7FA 4JHMA 5XINA 3L4VA 1K4GA 4GQRA 3EXSA 3WH5A 3FW6A 5PTDA 1NOUA 2PDWA 3LHTA 3SURA 3M41A 2PD9A 3AHYA 3XINA 3OZPA 2QCDB 4B3LA 1BWLA 2D0FA 3V5FA 3SAZA 4DUVA 3W4RA 3GC5A 2BOEX 3NO1A 4JDYA 1DJQA 2TPSA 2XIOA 2OODA 3PJUA 2P53A 3H4GA 2VURA 5EMJA 5M03A 2HS6A 1VEPA 5DBTA 1R7OA 1XLLA 3OA5A 1PSCA 4TX6A 4ZE5A 7TIMA 2PEVA 2W9CA 2PDYA 3RDKA 4JTUA 4RLIA 5M1TA 4CCCA 4UTKA 4JTQA 1FWWA 4I5XA 5EFFA 4WY0B 2C22A 4NT0A 1A47A 5JBDA 3GO2A 3T1GA 5CLWA 3M0YA 3VIIA 1TQJA 3M5ZA 2R8WA 3M9YA 4YHEA 2C1GA 4X9YA 3LXBA 3G3MA 3QH2A 4H8UA 1G7VA 4QWBA 1D3HA 4GPNA 2HK0A 1KBBA 2ABBA 3W7KA 5F4XA 4GVGA 2E1WA 2R1KA 5D02A 1CGUA 4N9DA 4WRHA 1WUFA 3B9NA 3REQA 3K30A 3EGJA 2HVNA 3BL3A 3BQ6A 1GOWA 1PIFA 1T41A 3CO4A 1GHRA 2VDIA 5DY2A 2B0MA 2VXNA 3QSTA 2REQA 1S0MA 1LUCB 3GVQA 2IMWP 1KQYA 1POKA 4JYFA 4O11A 3R79A 3KDOA 5G1MA 3ABQA 1UPPA 1E70M 1QJWA 3UPBA 3VNMA 2FGLA 2QJGA 3GXDA 3CHDA 4K8GA 1O7AA 2FPVA 1NFBA 3MO7A 4LU0A 3DYMA 4UR9A 4QS6A 1DPMA 1UKTA 2G8ZA 1YEYA 3TROA 3N3TA 1NDWA 1F73A 2ZRVA 1OJXA 4HHHA 1K70A 4L1XA 2WC3A 4HTYA 4NXSA 1Z6KA 4LOCA 2NWSA 2ZZ1A 4IGHA 1Z9AA 5CPOA 4DB7A 4J35A 5B7YA 2WLYA 2B7OA 3FK4A 4JNYA 3TOYA 4K37A 2W91A 4XTDA 1EQCA 4A3YA 3P5YA 3W87A 5A1AA 1XBZA 4KCVA 4CQ8A 1OX4A 4FLOA 2X1TA 1VFHA 1YXCA 5CPNA 4JHOA 1X39A 1EOKA 1A80A 5J04A 1I75A 4HN8A 2YCLB 3UZYA 1OGSA 3PB0A 4CEUC 4KIRA 2YB4A 1TZZA 2PODA 5KFPA 4MUZA 3G6VA 3EKGA 5CPQA 3WQ8A 1UQYA 2AQOA 3EX2A 1JDDA 1OGGA 3DZ1A 1O6IA 3KEHA 5BXSA 4US5D 3ABZA 2UVWA 4PZVA 1KGUA 2QAPA 3VXGA 1KFBA 3WIJA 2DZTA 2OLAA 3R0UA 3U2OA 5KFOA 2G3IA 1EA0A 4PMJA 3OVRA 4S3JA 4O57A 3GTFA 3V1PA 4ZQNA 3AIVA 2Q8XA 1UH3A 1QBBA 4AY7A 3FN9A 1S39A 2NQHA 1S5MA 5REQA 2HWGA 2DUZA 2GGIA 4OIFA 4DJDC 1KRMA 4FSAA 5EA9A 3HB9A 2ZUVA 5CSUA 1F8MA 2WXDM 5FF7A 2GOKA 5HPCA 5I2UA 2ABAA 3NCOA 4WZHA 3AI0A 3NYZA 2ZTJA 5G2HA 1AJ0A 1CEOA 2FLIA 1RY8A 3S6TA 3FAWA 3Q67A 4M51A 3PZQA 3W2UA 4WUIA 1AH4A 3LQGA 4NYUA 2A6LA 4XWUA 1E4IA 3GE7A 4IGSA 2OWCA 4JN7A 4QFUA 4E5TA 3MQTA 4JFTA 3G6MA 4QNWA 4F3HA 2GOUA 3KBMA 4ECYA 1SZFA 2HVOA 2FPTA 2WVVB 3GXTA 4BQ4A 3LBMA 3MKVA 2RDUA 5D2VA 5GNXA 7ODCA 4GY0A 3WNMA 3WJSA 4AWSA 2VEPA 4HYVA 3LBCA 1XRFA 3U57A 3VNLA 1M7OA 4NJIA 1PZ2A 5BYWA 1BFNA 1IIGA 3GY1A 4S3AA 5EYWA 1JZ7A 3V6KA 3I4KA 2UBPC 4H8NA 4JAWA 4O54A 2QZRA 3H4WA 1WOBA 4A8IA 1X6LA 3QR0A 4GIAA 1W3IA 1VGAA 3PR2A 3FJNA 1YADA 4KKXA 4IICA 4NZJA 1AFSA 3FYOA 1ZCOA 4YLWA 4R88A 1N48A 4BKNA 2CLPA 4LCSA 1ADDA 1W3KA 1E6QM 4E3TA 2ZRWA 3PBYA 3G1AA 1EZ2A 2XM1A 1LBLA 3TZNA 4UBPC 4IMGA 1V5XA 1IHIA 1V7AA 1KXVA 4Q43A 1B0IA 1PX8A 3KOYA 4FF7A 4PE8A 1UJPA 2OCZA 1NDZA 1UCWA 3CH0A 1SFTA 2VZVA 4HZ8A 1HGYA 1SJAA 4TX8A 4ZEPA 1Y8BA 1XICA 5K4XA 1TELA 1K3UA 1G4TA 4N6EA 1W1IE 4FIQA 4QWCA 1IZJA 1OFOA 4CVUA 2WMIB 2E67A 3ABOA 3DCPA 1LDCA 1Q2RA 1US2A 1S9FA 4HNNA 5ABFB 3OIHA 2J7HA 1H0GA 3BCFA 3LHWA 4S3KA 1XX1A 1R3RA 4DJFA 3MKKA 1W1TA 4ZTXA 4K36A 3VD9A 1L8PA 4ZOEA 1KLZA 1HKWA 3G1VA 2YKKA 5EDWA 4TU1A 2VR2A 4AIEA 2QVHA 5LKYA 3HG3A 2O9OA 1EJRC 3STEA 4IG2A 1CDGA 4PMYA 1BSIA 2RDJA 2PDXA 3QN3A 1OC7A 5E0FA 3BDKA 4PODA 2G3NA 3OSNA 4Q6JA 1K03A 3S42A 4A8LA 1W9VA 4M0XA 3W01A 2PU0A 4RV3A 1L6SA 2J8FA 4GFSA 4JTIA 3ZO9A 3IJQA 3TWAA 2OKTA 1OX5A 2R1LA 4M24A 4MLRA 3C8NA 5KFWA 2J74A 1V6VA 4CLMA 3HF3A 3SZ8A 1ZP4A 1B1YA 2CHOA 4ZMGA 4L1WA 1DQUA 2BG5A 3W70A 1U5JA 3SJ3A 1HVXA 1HW6A 4XG1A 1WDRA 4NU7A 1UR8A 2W63A 3L2IA 2E6FA 5A8NA 4F0LA 1C7SA 1D8WA 1UC4A 4QX4A 1IEVA 4D1IA 1LWHA 1GOOA 1E56A 1Q7ZA 4H83A 1M68A 1VBUA 3UWQA 4PMRA 3DAQA 3QLDA 1UIPA 1CGYA 1TPH1 2SFPA 3PC0A 2O0TA 4CD8A 2OT0A 3BO9A 2VMFA 3GG7A 3LSBA 4WOQA 4O4WA 1WUEA 2C1IA 3EWZA 4NUWA 3QPYA 4NG3A 2DQWA 3LG3A 1SO6A 3AU6A 4IH3A 1G67A 3D5HA 4HHPA 2XIMA 1KFKA 4PRWA 1E6ZA 5FD0A 4BQ5A 1TX2A 1EYEA 2Q01A 3WMSA 1DKWA 1SW0A 3I68A 4RE0A 2ANUA 1KV5A 4A3HA 5D32A 3QV6A 1XUUA 2JALA 2V8ZA 2WHMA 2GYIA 2YZ5A 3HO8A 4GC7A 4DF1A 3H2OA 4RUAA 3L7RA 3QLLA 3KWSA 1A0DA 5C7HA 3VX0A 2FPYA 1ZPTA 2B31A 1NOWA 4AD1A 1WDWA 2WMFA 2JE8A 2VP8A 2XHYA 5K9XA 1CI1A 1TJPA 3N04A 7TAAA 3VKKA 3GSMA 4E2BA 4M7TA 3CIWA 1IT7A 1AJ2A 1IXNA 3MA8A 3AMLA 1DXFA 3R94A 5LHEA 2H6RA 2NQZA 3M0VA 4NI8A 1BYAA 1UROA 3VC5A 5LA2A 2AL1A 3QV9A 2QVNA 1WKYA 5DELA 1K02A 4BK9A 2DP3A 3SSZA 4DXVA 4DJEC 4FX8A 2O7QA 3W1TA 4DAIA 4PTNA 1IXQA 1TQXA 3ARVA 3DESA 4JTRA 4JDBA 2G3MA 4U6PA 4AH7A 1KR0A 2DT1A 3H6OA 3M7SA 1IT8A 4A35A 2BHUA 1C8YA 2XFFA 4AYSA 4IPJA 4UFKA 3D0CA 5CEWA 1A0CA 5KT2A 1MSSA 3A4WA 3PAOA 1TMLA 4HNUA 4KEUA 1JX4A 1FHVA 2DZAA 3WEZA 2X2YA 2DZBA 3KCLA 5HAOA 4LUTB 2E7FA 2DZPA 3NQ8A 4RE2A 3BAJA 3QTGA 1EP3A 4Z17A 1JUEA 4ZOBA 3KTCA 4NZ1A 2WNQA 3WNOA 2D23A 5JXQA 2BXVA 2D22A 1AJZA 4RE3A 4GABA 3CASA 1W6TA 2VZTA 3APGA 1EEXA 5DMMA 2RGMA 1CW2A 4HP5A 3P81A 4MB3A 3N2CA 2BVTA 1IXPA 1DV7A 4J9PA 3BJTA 1RPKA 3H2AA 4O16A 2F6KA 4HPJA 4JYEA 4NJKA 1OF6A 4JIHA 2ZVRA 2F8QA 5DMNA 2ZC1A 2ZA2A 3FEQA 3BG9A 3UR8A 2PDKA 3MVTA 1EDTA 3E0LA 1H7OA 4UMCA 3NFUA 1W5OA 3V0TA 2XDFA 4BJHA 3WELA 1ZGDA 3VCRA 4U3AA 4KWWA 3K4WA 1G4SA 4MSSA 1PIGA 4Q32A 3QKZA 3L66A 2W61A 3M0MA 1UD2A 3ZVHA 3CC1A 2ASJA 4IP4A 3VNZA 3TYEA 4JCLA 3FX4A 3LXCA 1GORA 4MWAC 5E9AA 2A3EA 4LAZA 3WF3A 1SR9A 4JIQA 4MWAB 1GVEA 1JGMA 4ECXA 3P14A 5BCAA 4KCTA 3B8UA 3S5NA 2PAJA 3KTXA 3ZZ1A 1HN1A 4C1NB 3KHHA 5A94A 5H2ZA 9CGTA 4W7UA 4KCUA 3PAJA 1YIXA 2YCJA 3EMCA 3WJYA 4GC4A 3V5CA 4N9CA 4C6BA 1E43A 4RDZA 3SCTA 3RHGA 3VVGA 4DBUA 1HKJA 4L64A 4N4QA 3AROA 2V30A 1VCFA 3TQPA 2ZZ7A 4O10A 2Q8ZA 5KFZA 5C5YA 1J6OA 5C9WA 4U28A 5KFFA 1SFJA 1JYWA 2C18A 3KRSA 4R3UA 3MUIA 1WKEA 1VD6A 2XVGA 4U7CA 4C6JA 3KL3A 4DUWA 1EP1A 2F2HA 3M46A 3JW7A 3NL2A 2XC9A 4BEUA 4LVAA 4D2JA 1VYSX 4Q8WA 3MUXA 4GUJA 4AMAA 3NSXA 4DWSD 4YIWA 3RLVA 3NZPA 4CN6A 1SM9A 2E0PA 3CNYA 4FK9A 2YLLA 4UFIA 3WLQA 5FKYA 3W7JA 3PZMA 3VD7A 3B3DA 4HMEA 3R5EA 3UZJA 1BLIA 3RB3A 3KL5A 3CUXA 2P5NA 1LL7A 3RMJA 2YJQA 3P74A 3GR8A 1NVMA 3ITGA 4FNRA 1HG3A 4L80A 2VCCA 1JQXA 1OINA 4NZ3A 3TYUA 4GI4A 4R8UA 1TPWA 1O94A 4Q7NA 3TW6A 3VABA 4UR8A 1DIOA 4UQCA 1AODA 8A3HA 1M03A 5G4WA 2Q8LA 1P7TB 5C9XA 4FAMA 3TR2A 3LA4A 1CTNA 1AK5A 1EXBA 1JCLA 3BMXA 3R0DA 2WBGA 4JTGA 2QCDA 3UG3A 3EDFA 4AD4A 4E6MA 4FPSA 5TAOA 1QPQA 2A7PA 3R6IA 5A6TC 1TFVA 4W88A 2VQTA 2F6XA 1OCJA 1Q6LA 1GOMA 5BRBA 4QS5A 1XYLA 1FFRA 3EYPA 1TIMA 2P0OA 1J5TA 4WY0A 4WIWA 1EJXC 3AS2A 5DXYA 2BVYA 5CGTA 4WCJA 2W8KA 4GX9A 1FP9A 3GTHA 1U1JA 3UJEA 4PMUA 2DPIA 1C8QA 1GYLA 1OZMA 2IQ0A 2WJFA 1VP5A 1TE1A 5KG7A 2J88A 1X1OA 4E4FA 4J40A 3UXKA 4ICMA 4PTXA 3VFCA 4S2CA 1PEZA 1Q13A 2I5GA 3C5QA 3A3HA 4J3TA 3UQNA 3B0PA 1G7UA 3MHGA 1YW1A 6XIAA 4X3ZA 4OE7A 5DGAA 4AXKA 1M9HA 1SJCA 1A5UA 2ZDSA 5LIUX 3UJRA 5KFIA 5AHMA 3W7RA 4GOAA 3SQMA 3TYAA 3VDAA 3HQOA 3WENA 2ZE3A 3WF4A 4EK7A 4YCOA 1ZUAX 2VFIA 5HNRA 4KMQA 2PRLA 4RDWA 5KFGA 3QFEA 1N56A 2CZEA 3VDHA 2IQDA 3N17A 1TWDA 3G3DA 5KFTA 4WK9A 3M5XA 4JX4A 3QJAA 4M56A 2WV8A 3OBAA 1MMFA 4QJ1A 2HNHA 3CLWA 1YE4A 4ZL1A 1I2NA 2QYGA 1MO0A 2J8GA 4LT9A 1PVNA 1M7JA 1TTPA 4M6PA 1BQGA 3W3OA 5C6MA 4GUGA 4ACYA 1EUNA 4D6GA 1E3ZA 3IIZA 5LGXA 2OEJA 1PWMA 2BV9A 2PDIA 3OHAA 4GLEA 3PULA 4A8RA 1NP2A 1XI3A 1LROA 3QMSA 4ED1A 3N18A 4BQ3A 3UG5A 3MCOA 4H41A 3THDA 3CTTA 4FLRA 3UY8A 2YCLA 3QKEA 4M6QA 4XUGA 2PDHA 3UWEA 5KFNA 1LQ2A 4O1AA 2XIJA 1UKSA 4F0SA 1R2RA 3QOMA 8XIAA 3VNDA 4PTWA 4RPQA 4ENLA 1EDGA 2V63A 1C9WA 1WB0A 1P4CA 4JFSA 1B57A 3L4UA 4I9TA 4B4HA 5I09A 3RG6A 2EPLX 4GFIA 4MPKA 3VD3A 5BU9A 4IMCA 2GQ9A 3MU7A 4O13A 4CD7A 1ZETA 1HKIA 1X6UA 4F0KA 4M29A 3ZLFA 3DG6A 3RUBL 3POCA 3SIZA 1D9EA 1EDQA 2W62A 3LU2A 2FGBA 2TAAA 2V5BA 1U30A 4BCEA 1JULA 5HATA 5F1UA 4DO5A 1AL7A 4Q4PA 4MG4A 3R1ZA 4GRSA 3E1F1 4DJDA 1UZHA 1D2KA 1XYCA 3P2VA 3M4HA 2OU4A 3EXRA 1PWLA 1O5KA 1V7YA 1WNOA 3CAWA 4PEEA 4Y2WA 4GG9A 1DORA 1EJVC 4Q4QA 3P8JA 5KFKA 1SZNA 3WLOA 1ZLPA 3AXKA 5EWEA 4N0RA 3U0HA 1GPFA 5I3GA 3L4TA 4ACZA 3ARWA 4GINA 3NURA 4GNJA 3GQCA 3VD5A 3TA9A 2NX3A 3ANUA 2WVVA 1AD4A 1VPQA 1Y5WA 3G2GA 3OG2A 3MW7A 3P6LA 2XN2A 2X1RA 3TU9A 1EOMA 1GOQA 3M0JA 1GUVA 4IRDA 4ZSTA 2XGQA 1JIBA 4RW5A 3DERA 4TIMA 4FO4A 2GGHA 3A6OA 3WQEA 2YFOA 2YDSA 3SQSA 2NV2A 3MI2A 2C79A 2VENA 1ML1A 3OGVA 3TMQA 3UZZA 2XG9A 1RBLA 2R82A 5KFDA 5EBUA 4I7UA 2GDQA 4H9XA 2VA3A 1WXZA 3CPUA 4IF2A 5FESA 1TZ9A 4JTFA 2IA6A 1EYWA 1JDFA 5ABTA 3RX4A 2PWUA 3DFHA 4AHPA 2BR0A 3KRUA 4ZSUA 1FDZA 4Y9MA 3HBLA 3UCCA 4F79A 5F4WA 1QWGA 4UTMA 2BXZA 2W3ZA 3OVPA 3CHFA 1OC5A 1JRBA 2JEQA 2XH7A 4HNCA 2Y4SA 5I5RA 4JNZA 4INFA 1R86A 2FH6A 3VK5A 4MVAA 2AQWA 3WFLA 1F05A 3VIHA 1QFEA 5E1QA 3CK5A 1XIHA 4NNBA 3QFWA 1R0MA 1GQJA 3CAQA 5DMLA 1XYMA 2D2GA 4B5UA 1DJHA 4O28A 1VRDA 3EDDA 5CC5A 4Q8FA 2CBJA 1EWEA 1ZBCA 2WMIA 3FAXA 1P5BA 4PUJA 2XH2A 2XU2A 3WLPA 1VH7A 4IR1A 1C7TA 2Y24A 1BXBA 3LCGA 4O53A 1NEYA 5CBJA 3SGUA 5F4SA 4MY1A 2O4MA 4FNUA 2HMCA 3CM4A 3T0DA 4IIHA 2ON3A 4JIRA 3J7HA 3TYBA 1ZP3A 4C6NA 4MPQA 1VJZA 3S1WA 3EA3A 2J78A 3W7OA 3IIVA 1H7NA 3UESA 4F66A 1LZOA 2W4XA 4L4OA 3A3XA 3W38A 4NP7A 1GG0A 3N9SA 4RDYA 1XF0A 1OSEA 3IRDA 2PWDA 3T08A 1TYGA 1PYMA 4PUEA 2VCAA 3EXTA 3L4XA 4ECWA 1AH3A 3R11A 1XJBA 4MDPA 4TVDA 3NZQA 1HJUA 3I3EA 4ED2A 3AUOA 3R58A 1ISXA 3PZOA 2IW0A 3ATZA 1I2PA 2XFWA 1ENUA 9XIAA 3CPGA 3N6HA 2CBVA 2PF8A 2VZSA 3CZGA 3WFAA 4OFCA 4OHQA 1I6NA 5TF0A 4C91A 2I16A 2DSUA 5HWMA 2V4RA 4H4IA 5TBOA 2FB3A 4UFJA 3BG3A 4M3PA 4D72A 2GDUA 3WDJA 2WM0A 4QTGA 1V93A 2OEKA 3LRKA 2J7CA 3CGTA 3VMOA 7ENLA 5E0KA 2A3AA 2GVJA 4JTLA 1CBGA 1CPUA 3M0KA 3NQFA 4LF2A 3THAA 2C71A 2YW3A 3RPDA 3M1ZA 3TJLA 5HQEA 4L9XA 4R9OA 5CKSA 3DFOA 1WZMA 4IRCA 1FKXA 3KWXA 4KWOA 1R85A 3LDVA 1LLWA 3P0WA 4GYPC 4S3CA 3DN5A 1B3XA 4FLQA 3UXAA 2FTYA 2F9RA 2G50A 2XVKA 2QF7A 2IMRA 2R1MA 4ZXLA 1LLZA 4IJCA 1W1ZA 3BJFA 4P7QA 5DBUA 6REQA 4GJ1A 5JUVA 4DBWA 2VELA 1R38A 2CFFA 3W28A 5I02A 4GISA 1H09A 3BSGA 3TW7A 3A5VA 5KFHA 4AZ6A 1CIUA 2X42A 4HYRA 2YFNA 2YXXA 1KD0A 5KETA 4MB4A 4LEFA 2C2EA 3EOSA 1U33A 3GXIA 3VILA 4HCDA 2PMQA 3S8HA 2OPJA 5LXEA 5KG1A 4H7ZA 4E4PA 2W7PA 2BDQA 3E49A 2HCVA 2ZX9A 2JKAA 3A4JA 2J75A 3EPOA 2XN0A 2W6RA 4FZIA 1H63A 1J9YA 1TJ1A 2WNZA 1E6RA 1F8IA 5JMUA 3AS0A 3WH8A 3GBEA 3EPIA 3KHJA 1GHSA 1UH2A 3AAMA 4F4RA 2J6SA 4Z2GA 1M41A 3ORWA 3E0WA 3P84A 3XIMA 2V68A 2IXVA 2YYUA 3W7MA 1ISVA 1QNOA 4CQDA 3M16A 2D3NA 3ZWTA 1BG4A 1CB2A 3EPGA 4K68A 5D38A 4HVXA 2H8ZA 1OC6A 3NL6A 4XX6A 3RRXA 2DSZA 1SO3A 2H9AA 3ZXWA 1K1QA 4FBTA 3T0AA 3F4DA 1C90A 4B9YA 3QC3A 4RNJA 4UOQA 2BQRA 4JUZA 3UF9A 4DJEA 4IXXA 1YTKA 4Z1BA 1ZNNA 1F5ZA 1K7FA 5KFJA 4Q44A 2V0TA 3BCJA 1GYNA 2UVVA 3NQVA 2JF7A 4G1NA 3ABXA 2XM2A 1OABA 2CYGA 2HNEA 4PMDA 3T0BA 1V0KA 2J6TA 1QT1A 1FWHC 2V3FA 3WBAA 4PCSA 4B4FA 3W1RA 3LNPA 1C8XA 3EB3A 5KSWA 3T78A 5J5DA 4XAGA 1MW2A 4LUTA 3VZZA 4BWLC 1GJPA 2GUBA 3QZ6A 2WZEA 4WQ6A 1E6XM 2FVLA 2DZUA 3S2LA 3IWPA 1PX4A 1J6PA 1ECQA 4H6EA 4LUYA 5C8BB 3MBFA 1ECEA 1KV8A 1WV2A 4X0VA 5LGZA 4R5EA 3E12A 1M65A 1CYGA 4UTUA 4P7NA 1KR1A 4JGDA 3PZTA 4FBUA 4PTDA 1GW9A 5I00A 1CGTA 3RM4A 1TWWA 3C61A 4O3QA 2V2HA 2V5JA 1Q4NX 4LF1A 2J7DA 3VINA 2EPHA 3DFSA 4G9PA 4OECA 4W86A 4ATLA 1J0YA 4O0ZA 1DVJA 5DANA 3TE9A 2XIBA 5DCDA 3MMTA 3JZUA 5A2AA 3KOZA 3LX9A 4MIMA 2I57A 4F9DA 2DUAA 4W7VA 4DYKA 2DGAA 4NLGA 3HN3A 4NILA 4JD4A 3CB8A 2YOCA 3IJ7A 5I24A 4H7VA 2AL2B 4PGLA 4F4ZA 3W26A 4L6HA 2EKCA 3VDGA 3ANYA 3O7UA 5HANA 2PDUA 3W1LA 4M6UA 4JQAA 2WVTA 4CGTA 4YTQA 4KPLA 1ODZA 3QPEA 4IFKA 4CVWA 3LM3A 4QWEA 1K7XA 4AW7A 3WBYA 1Q2SA 3MO4A 4O1EA 1H1YA 1KFCA 2VKZG 1ZRQA 5DT5A 3KM8A 4ILSA 2ALZA 4MWAA 3MYPA 4CQ9A 1TV3A 1DP0A 2QQ6A 4H9YA 1MQRA 3MT1A 3UGRA 5KEZA 4JFVA 1S1RA 2C15A 4ATWA 1ADSA 1TJ2A 3SCNA 1I60A 1NWUA 1TVPA 1ONWA 3LM7A 4EX4A 2IQTA 3JR2A 4G7EB 4IFRA 3JZEA 4Z2IA 1A49A 2CCRA 5I3DA 1C93A 3WD1A 2BHYA 1SGJA 1EF2A 2CLLA 4JKKA 1QI4A 2DSKA 3VDBA 1UA7A 1DTNA 2E28A 3D3FA 3DHDA 4JL1A 1RH9A 4NZ4A 5KZDA 1XV8A 3SADA 4QHRA 1ONEA 2DIKA 2WCSA 4TX9A 3WJXA 2V81A 2VCBA 1IWBA 1Z44A 4Q45A 3W22A 4W9TA 3AIQA 2XVPA 4EXBA 4H6RA 2EAWA 3FYPA 2AGOA 2ZOXA 5G4HC 4AEOA 1XLAA 2D20A 3BTNA 3T05A 3QBUA 3LCFA 3BG5A 1PE1A 3RAOA 5EU9A 1BKHA 2F7FA 2NZLA 1XDMA 2DT0A 4D1JA 4BFAA 3U2EA 1KCZA 4RUCA 5D04C 1OFQA 1R3WA 1ZZMA 3GW3A 1E0XA 5D33A 3G24A 1RJPA 4ECLA 7XIMA 1ZB5A 3GLCA 3GKAA 3VOJA 5I3KA 1JGIA 1X8CA 3IK4A 4MFDA 4IR9A 3IGHX 3QV8A 1AW2A 3NPUA 1H7WA 2ZVIA 4OQVA 4B2DD 2NQLA 4H1ZA 5C2CA 4WDXA 2XGIA 4WSJA 2J9YA 2NXGA 4XIMA 3QTPA 1P7TA 2YDQA 3SUUA 3RLUA 1EJSC 1BPLB 2PP3A 4J1OA 4DZHA 4PMQA 5BWAA 4MJ4A 3MB9A 3VKJA 3OHMB 3CUJA 1N8FA 3RB0A 2ZZ6A 2RJGA 2HSAA 1YDNA 2J7EA 3AHVA 5T9BG 1F3XA 1QUMA 4LV4A 2J77A 5AZ1A 5A6LA 5BZAA 2G0WA 3KZSA 4JS3A 1JPKA 4EF9A 2Z27A 2OO0A 3DHPA 1NM9A 2PLKA 4US6A 3TAKA 3KLKA 2P3ZA 3C56A 4W8AA 5DRIA 1XS2A 3ABRA 3V1HA 1NARA 4O3SA 1TV7A 2OJPA 1UKOA 3UVAA 4K39A 5DEZA 3AYSA 4YMZA 1W5NA 3SBFA 1FCQA 2TMDA 3DECA 1SZRA 1Q85A 1OG0A 1GG1A 1ISYA 3A9BA 5I78A 3RAQA 3GYCA 4J9KA 3O6DA 1SW3A 4EBDA 3BZGA 1RCOB 3FA5A 4AEEA 3DKJA 3SRHA 3ELFA 1UWIA 5KT5A 1XLBA 3FVDA 3TOPA 1JCXA 2ISFA 3WLIA 5D9NA 3GC4A 5C2GA 1MYRA 3VA8A 5I23A 4CCEA 5F1VA 3PS7A 2GLKA 2WOQA 4AZ7A 2QULA 3UYCA 2X30A 1L6YA 5G1TA 1QI0A 3QM3A 1FWAC 1R46A 1VFOA 3E74A 2ZUNA 4W84A 3LCLA 3FDKA 2RFGA 2VEKA 1V51A 4WXYA 3GTNA 5I3HA 1L8NA 1US3A 2OWXA 1GZJA 1W8GA 2NXIA 1EJUC 4QXIA 3GXFA 5L1LA 1D3GA 5GPRA 1PHWA 2DORA 4C6OA 3A47A 4CN4A 5H8UA 4G8TA 4JL2A 3WNKA 1P0BA 1V6YA 1DIDA 4DXKA 1UR9A 3LGEA 3WF1A 3RJXA 3P7YA 3OYXA 1UWQA 2Y7FA 3F5JA 4MUPA 3UWWA 4JEJA 1DHKA 2ASHA 4UFMA 3BOLA 3HMJG 1EQPA 4D6FA 1LQAA 2YA2A 4B92A 4Y6GA 1RV8A 1DJIA 1K7EA 1RPXA 5A8MA 4KF1A 4NKCA 4RX0A 4AVOA 2DH2A 4H01A 4F48A 1KM1A 3GTXA 4E8DA 1U22A 3IJLA 1X1ZA 5F7UA 2D0GA 4MFEA 2HS8A 5LZLA 3RBDA 2B7PA 1OX6A 3ZJ6A 3GH5A 3IUIA 3QYQA 1GQKA 5AN7A 3R12A 1S2VA 1R9YA 1CB7B 3GNRA 3CQHA 3AIBA 1M7PA 3GVWA 4ERAA 4ORMA 4CN1A 1QPKA 3E2QA 4H2HA 3KOXA 4KEMA 1JYVA 1NQ6A 3IAPA 1H1NA 1LL4A 2XZ7A 3OVQA 3CAKA 4IX2A 4X60A 3UWYA 1OWQA 1E40A 4HU3A 5A8OA 2V69A 3M44A 4JN6A 4HBKA 5CPLA 3T0CA 2D2JA 4ZODA 2Z2BA 1NWSA 2FLNA 1HJVA 4AUBA 2Y8UA 1FXQA 3NEVA 4YPJA 1O1HA 3WLHA 1UKPA 3SCQA 1CXFA 3NUKA 3WEOA 1OFDA 2Y6ZA 4I3GA 1GVSA 4DL7A 1NFPA 1QNRA 4QBXA 3WUBA 3UVIA 4AZCB 3RK8A 1W3NA 3WH7A 1R9ZA 1YDYA 5E6ZA 1B9ZA 4O8AA 1V6TA 1OT2A 3L5MA 1I9CB 3L23A 3LLFA 1ZQ5A 3TTOA 1K77A 1VRXA 1Q6CA 4TMCA 5AB3A 4S2BA 3LV6A 5AHEA 3SI9A 5LNVA 1KXQA 1F6PA 3DUGA 3B8SA 2YL6A 4M19A 2PDFA 3IIXA 2BP1A 1MFVA 1F4AA 1HP5A 1XH0A 5L9XA 3BSHA 1HJQA 1VS1A 2G4JA 3H23A 1HKKA 3I3DA 1YTEA 4DBEA 8RUCA 1H5VA 3TC3A 1JPDX 2WJEA 4CD5A 5EMKA 5K4ZA 4POCA 4S3DA 4BZYA 2WB5A 4DX3A 4D6HA 3VO0A 4DBSA 3B97A 2JEPA 1PYFA 3UP8A 4O1CA 3A64A 2WWCA 2ZXQA 7CGTA 2C91A 2CPUA 1NQKA 3T4WA 5A6MA 3FJLA 2Z1XA 3GYEA 2P9BA 4ED0A 5F2MA 4JV0A 2ALDA 3SCVA 3C2EA 1RBOB 3R8GA 1YXYA 1W2VA 3AJXA 5FEXA 4ZXOA 1UKQA 2BHZA 3ZYZA 5BNKA 1E9YB 4H00A 3DFYA 4H19A 3VIOA 3W86A 4D8LA 2A85A 3VOGA 2PRHA 4UCFA 4Z1YA 1I1XA 1PTDA 2CETA 4KRTA 4OTKA 1TPFA 2O4QA 1M5WA 4GIYA 1UWRA 3GG0A 4CKQA 3GHTA 5AC5A 8XIMA 2YDAA 2ZZ2A 3MYOA 2ZUWA 1RK5A 3B0UX 3CQKA 2JEIA 2WMGA 4GCXA 4DVOA 1A53A 1YHTA 3MVIA 2NUWA 6ENLA 2YCKX 3UWZA 1XINA 4ZZ9A 3GVVA 5AC6A 2JFEX 3VNKA 4I5RA 2BOGX 5HULA 1EJWC 4GY1A 3BLDA 2W92A 4OBTA 1OIMA 4TVUA 1Q6QA 4AU0A 2BLEA 4HU4A 1THFD 4KRZA 1J0JA 3WUGA 1LJYA 3WDPP 2XPKA 3QR3A 5C9RA 4BF7A 2WAGA 3GV7B 4UNKA 4U2ZA 2RH9A 3V35A 2I17A 4E2OA 3CHVA 1FWCC 3GD6A 5AYBA 3TC7A 1FH9A 3H54A 3IARA 1HJWA 2HXUA 3CL6A 2IUZA 4M5PA 3I3BA 4FEZA 2DW7A 1TRIA 2E5DA 2NV1A 3G1SA 2WQDA 3LK6A 1QOQA 2GPTA 1U5HA 4PR4A 2V4QA 2A3HA 2DV0A 1TWIA 3C2OA 4LYPA 5H1WA 1KB3A 4FNQA 3VKBA 1Q7MA 3KVJA 3W7HA 3NYDA 5LNUA 5JVLA 3HPZA 4UQDA 2ASLA 1AUSL 2D24A 1GKPA 4RV8A 1TTQA 3PBMA 3G6LA 3EWDA 2J66A 4FMVA 3VUPA 2UZ9A 3IS4A 1XYBA 4EP8C 4E0CA 4LAOA 3UY7A 1FCVA 2Y7EA 1LYXA 2E9BA 3MI6A 1V3LA 3CHEA 5HJLA 1PO9A 1E5NA 2EG8A 3TN4A 3CH9A 2BY1A 4KQNA 5CZ0A 1A5MC 1JPMA 1PZ1A 1VJSA 4RZRA 1XXXA 1C91A 4GXMA 1C9DA 4DXXA 3CMJA 3QEZA 3HA1A 2CLIA 5T8GA 4GYPA 3E6EA 3PWGA 1O4UA 4XZLX 1KC7A 1RP9A 4NHVA 3LOTA 2DY3A 2VNCA 1GTEA 1T94A 2W79A 3MJMA 2DW6A 3AIWA 3MR2A 3ARXA 3FFSA 2DT3A 1SMAA 1LCOA 3VI2A 4OBRA 2P50A 2KZHA 3GFXA 1LBFA 3AMGA 1Z32X 3IJ6A 3WQWA 1BG9A 5HR7A 3TKFA 3W23A 1REQB 4HNTA 3LQLA 4OT7A 4XZ9A 3O8AA 1E0TA 3KL0A 2Q71A 1K8ZA 1XLHA 3M47A 4IM4A 1SZEA 1CLKA 2XH0A 3BLLA 3RYSA 2XFRA 4L65A 3TYZA 4ZQPA 4ECTA 2YB1A 2GJPA 3T6CA 2JEGA 4LCQA 2IPFA 3IVSA 2V5DA 4Y96A 3Q37A 4DQWA 2NUYA 3FA4A 3AHZA 4GZJA 1KRBC 1F07A 4PCTA 3UPWA 1HNYA 2WO5A 4H9VA 3SCRA 3MJYA 3RR4A 2Z00A 4JNMA 2D69A 3HQ1A 6A3HA 3W02A 1DWHM 4XB3A 3WLTA 3H21A 3KHRA 3T07A 2VFEA 1TSIA 8CGTA 4TQTA 3LLXA 2FMNA 4NZCA 5DF0A 2BTMA 1MW1A 4DRSA 4EKJA 3KRBA 1NELA 1T3NA 2TYSA 3PFRA 2INFA 4CNPA 1EF3A 2G97A 3NXFA 5K3VA 2ESCA 1DWGM 3M0LA 5E6YA 3A24A 1MQQA 2CC0A 2A5HA 5C9UA 3H2MA 1CCWB 5D9MA 4HCHA 1P6WA 1MUCA 4GUFA 3TJXA 1VCGA 3M7WA 3BLFA 3W81A 3WQ4A 4QAWA 1QU4A 5KT3A 3GIKA 2HE8A 4QJ5B 1E9ZB 5AYIA 5BOFA 4QE4A 4ED3A 3NPXA 3ZR4A 2HBVA 4GQ0A 3MV01 1R47A 1MRAA 2OYLA 4QW8A 4QIUA 2F38A 1O12A 1XIGA 3PZNA 3RX2A 5K9DA 1ZL1A 1DWIM 3Q8RB 3C0SA 2QXWA 3FGCB 5JIWA 4AHOA 4GQGA 5KFUA 2VFDA 3SN1A 3GHSA 3RM9A 4QSFA 4AZGA 1UP0A 5JQ9A 1X38A 3AMDA 3W25A 4OV4A 1T99A 3H53A 1E0WA 1QPRA 1FWNA 3HG2A 1GOIA 5J5RA 3AZTA 4X2PA 2EJ1A 3NQGA 2CXEA 3L2MA 4P7OA 4DIAA 3NEHA 4XKMA 4G56A 1VPXA 3S1XA 1NJJA 1XD1A 2R14A 2WLZA 2WJDA 3E38A 5FJUA 3VM5A 1JPHA 3RNDA 2AL2A 5BU6A 4XV0A 3NQ6A 4HSNA 4JZ5A 3DG7A 4X61A 5L1JA 2ZFAA 2XGPA 4DO7A 2IKHA 2RGLA 3S47A 1MUMA 3OO2A 5TIMA 1X8FA 2G3JA 2G4FA 1S5TA 1UC5A 5CLTA 3MMUA 4NF7A 2OB3A 1DHPA 4GX8A 1B3OA 3KVKA 2VVSA 1X1NA 1V0MA 2WC7A 3FYYA 5FF2A 2CNCA 4FXSA 2BGNE 3DGBA 4Q6XA 1UUQA 1SUXA 4V1XA 3IVTA 3GGMA 1UASA 3N6QA 1WDQA 4LVBA 2RDWA 1UMLA 4LYKA 1XYFA 3E0FA 1MRQA 4O18A 2ATLA 5G2WA 4Y9AA 3KBSA 3PP7A 4GZEA 4G7EA 3N2TA 2F84A 3LMZA 4GI8A 4JQ1A 2W9BB 1OM0A 3NPVA 4PB5A 1XG3A 3WBXA 3RCMA 5LHFA 4LBRA 4C1KA 2QT3A 3NQEA 3WNLA 3MPGA 1O60A 2H3BA 3BAXA 3VOHA 1RXOB 4O3OA 4S38A 3D46A 5AC8A 3G0XA 2C7FA 4HKPA 3BGAA 4YTSA 3O3RA 1H3GA 3O05A 4I7VA 2ISSA 1Q66A 2GGGA 4N2YA 2I7GA 3USBA 4EWND 3SUVA 1TWSA 3CB3A 2ZRXA 3M6DA 1CXKA 3KZPA 4HNVA 1S0OA 4S23A 4HD5A 2BBFA 4DO6A 4O0QA 1QW8A 5FL0A 3WBWA 3FJ4A 1M53A 4FS2A 4ZO8A 1X7FA 3TCSA 3BQ5A 1IEWA 3W88A 1XLDA 2Y61A 2ICSA 1V6UA 3RXZA 1QR7A 2FHBA 1ITXA 3W6LA 2AGKA 4GH1A 3EEGA 3U8GA 2QCFA 1ZSXA 4Q4SA 1XIIA 4TVCA 3OZOA 3GXMA 3BLOA 1W5QA 4D71A 2R9RA 1EGMA 2Y7DA 1JCTA 2DSVA 2DVXA 1QNVA 1K8YA 4G1KA 1P0EA 4PCFA 1J79A 1JZ4A 1JDCA 5HMFA 2ZA3A 3KS6A 1UWUA 5D37A 1S2TA 3BAWA 4AD3A 1QOPA 1KFLA 1YNQA 1W0MA 1CXLA 2HK1A 5I6SA 3ARYA 1JXKA 4XAFA 2E68A 3DXIA 3HGJA 3A21A 3T42A 3RX3A 1NWTA 5B7ZA 4IPNB 2WM1A 3TVAA 2X7WA 1XGDA 5DO8A 1WA3A 4H8HA 4M81A 3NQ2A 3MUY1 2OG9A 1P0NA 3HV9A 5FJIA 4RJEA 3NO5A 1TUXA 3FDGA 3T9PA 4QQ3A 4YVXA 2EKGA 3AU2A 3EA1A 1B3WA 1GOXA 3P3BA 3EA2A 5AC7A 2X0SA 4WY0F 4ZBCA 1FQ0A 4GZIA 4PRRA 1T96A 3PW5A 5D9OA 5DLGA 4O52A 4XAPA 2G41A 4CQCA 5KFBA 1C3FA 1H51A 2P10A 3VGGA 1MW3A 3IUHA 1I0DA 2VZOA 1IF2A 3CV1A 4YXGA 2DJLA 3O1NA 4DUXA 4BS0A 1JCYA 1KBKA 2Z25A 5LIWX 4WHBA 4ZB5A 4PMVA 4XZMX 2W8LA 5KT7A 1QCWA 3H26A 3SRFA 2VC9A 2QUVA 1AL8A 1QI2A 5AOUA 3B0YA 4YJ5A 3HIJA 1LBMA 4V33A 1FHUA 5K9CA 3ZR5A 5AVNA 1C92A 1UBSA 3AUJA 1S2CA 2QUUA 1FRBA 3M5VA 2QR6A 2X2GA 3CV7A 2CXGA 4XO6A 1W37A 1Q6DA 3O0KA 2FIQA 3MUZ1 3NDYA 1V8EA 1JYXA 1XKJA 3SW6A 2JKPA 1V02A 4PUWA 3UWUA 2P8BA 3R43A 1FVPA 3JRKA 3QSRA 3M64A 3WNPA 4Q7IA 1CXHA 2WZHA 3SJNA 3QHMA 3U5UA 2W5FA 1DYSA 3BAKA 3PTQA 4GGBA 4K7VA 5ABHA 1TRDA 1V0LA 1UD3A 2J6XA 4U3CA 1FA2A 2AQVA 1QHZA 4IL2A 4NNAA 3DC0A 2GK1B 3PANA 1B5TA 4FOJA 4L4PA 3DENA 4M6VA 3IIPA 4UFHA 4RW3A 3MSRA 3UJSA 2XSBA 3DFNA 4EE9A 3M9OB 2XCAA 4C60A 3V5OA 3URAA 1QTWA 4NAFA 4EWJA 1HJSA 5M3WA 4REQB 3N34A 3KVMA 3OU8A 3E3HA 2XCPA 1Z7AA 5DCEA 2V5CA 4GNVA 3G0SA 2WTFA 1ZU8A 1GOKA 3ID7A 2ZZ5A 2VX6A 3JUGA 4JFWA 2VX5A 2PDQA 2V67A 4WDWA 1EHNA 2JGYA 4OUEA 4R33A 3BLIA 3CT2A 2L5HA 4HA3A 3GC2A 1T40A 2QHAA 1J01A 2FFIA 2RKXA 5E70A 4LANA 2EGZA 3T44A 3VKAA 2V9DA 4U10A 4DJFD 1QNPA 4TMBA 5AHNA 3ONCA 1Q45A 1V3HA 1Q6RA 4C65A 3H24A 1QI5A 1YX1A 3P82A 4H7CA 2PWGA 2FH8A 4HN4A 4GC6A 1XLGA 3UZ5A 1OYBA 4MZ1A 1OCQA 4LXFA 1HIZA 3GR7A 4LTSA 1VENA 4LB4A 1E55A 4CU7A 4JKLA 4EAYA 2OYMA 2WC4A 4HMCA 4Y8FA 1OHLA 1MVYA 1WOAA 4R53A 3NQDA 5KT6A 2PSNA 1UWTA 1GVFA 4AY1A 1EC8A 2HEJA 1RJQA 4AZCA 5HWNA 3NGDA 3H4BA 1K9DA 3MY9A 1KM4A 1VC4A 2D2OA 1FWSA 3HOJA 1H7RA 4C1LA 3BW2A 3TQ1A 4QEEA 4MKVA 3L0GA 1YQ2A 3UU0A 3W27A 3BC9A 4N4PA 2B7QA 4C6LA 3L5AA 3VIFA 5EB8A 3H2FA 1XWYA 3A4XA 3SRKA 1I2OA 3NAVA 4R7WA 3U4FA 4IQJA 5D8WA 1BWKA 3EDEA 1OB0A 4V1YA 5A6BA 2Z2AA 1VBHA 4D8AA 1GVYA 4FP1A 3NL5A 3WKZA 4ZO6A 3WSUA 1JQVA 3TN6A 2WWDA 2GL5A 4BI7A 4PFMA 1VKFA 1W9DM 2R24A 4AF0B 3PPCA 3LCHA 2A3LA 3URNA 1EP2A 2E8YA 3BV4A 4V27A 4PMNA 1P48A 1UMYA 3B0VC 1LP6A 3ITTA 1EO7A 2OQYA 3PPHA 4H3DA 3LI1A 3TK7A 3ZSSA 4RXGA 3CZLA 4GBUA 4MZYA 1WDDA 2YCIX 3CIVA 3IN5A 3SCUA 5IHRA 3CL8A 4JIEA 3M5YA 5KINA 3QZ8A 5T9CE 5KG3A 4RK8A 3B8WA 4Y7EA 3R8HA 1KFWA 3UA3A 4DN1A 2FZBA 2ADAA 4UQBA 1HX0A 1OY0A 4BR1A 1SW7A 3BOXA 3NTYA 1VAHA 3IACA 4K2SA 1FHLA 1LOLA 3H2NA 1O5XA 1MI3A 3NQAA 3H7RA 2QUMA 2C28A 3W24A 1ZJIA 1BWVA 2EBNA 3N11A 3VIPA 4QLJA 5BOEA 4KERA 3VZYA 2W9CB 1TMHA 2CZFA 1IWPA 3AZSA 3OLIA 2MNRA 1TV8A 4YNGA 1XKYA 5KITA 1M6JA 2WHJA 1CGWA 3MBDA 3SB0A 3RM8A 1TVLA 1R3SA 1FX6A 1XIMA 4WVXA 3DH7A 1LG1A 3S5ZA 1UP2A 3JS3A 4M8UA 4Y9PA 2CIPA 2VL4A 4B5WA 1DJXA 1NIUA 1LT7A 3WD4A 3MR3A 1EJ7L 2R94A 3AXMA 3HFYA 5I79A 5A5WA 3L9CA 4RZ6A 1YTDA 1PV8A 5HDRA 4I9MA 1KFJA 3RF9A 1UHVA 3GIIA 3KBNA 2QDEA 4Y9OA 4IQDA 2X41A 3TUUA 1ISZA 3B9EA 2ZXDA 2HE5A 3GM8A 2QKFA 4FHAA 3B4UA 1H50A 4J2MA 3OHBA 2INEA 5LNWA 4Z1DA 5KFCA 1G94A 4LY8A 3USZA 1POJA 4PUNA 4NVTA 4JTHA 3IVUA 3U4AA 3NWRA 1T8QA 1MZHA 3WK1A 3GDBA 1EA9C 1LM1A 4MNLA 1RQHA 1XGZA 5D03A 5D2TA 1HL2A 1RQEA 1F3EA 2PWHA 2BZNA 2PTXA 3URQA 3EMQA 3FHAA 1R2SA 1Q6FA 1RLDA 1MEWA 4KRUA 2NWRA 3WY1A 1F3TA 1EC7A 3FCPA 4JOMA 3IRSA 1RJRA 4H6KA 1KKOA 3QMRA 1OFPA 3II1A 3P67A 3K8MA 3OG3A 5SWUA 2VTFA 1O5RA 4C7FA 2FMOA 3I7QA 4F50A 2J7FA 4HA4A 4DNMA 5MKGB 1WZAA 2WANA 1C29A 3R8RA 1K1DA 3KUMA 3VKCA 3KLLA 1NFGA 4ECZA 4IJBA 3H55A 3UERA 2F2KA 1DQXA 1XSJA 1DL3A 1XIFA 5L6UA 1G0CA 1ZENA 2BODX 3B8VA 3U2CA 2VA2A 2CKRA 3TW9A 3GVGA 2PDGA 1ELSA 2GQAA 4QR6A 1WPCA 4CNUA 3Q4DA 2DJXA 1PJ9A 4LVGA 2PTZA 1O1ZA 2BX7A 4G5DA 2X0YA 1HO4A 5JBEA 1REQA 2ZC8A 1GEHA 4O1BA 3BK0A 3LXAA 5E09A 2Y62A 3ISIX 4GIRA 1AD1A 3GDLA 4RZBA 3H2CA 2UY3A 2AKZA 2ISVA 1E51A 1UYQA 3KP1A 5D09A 3C2VA 4S3FA 1XH2A 2JEJA 1XYAA 1NY1A 3PZ9A 4UNIA 4OVXA 4O0KA 4YYFA 1E4MM 3BOFA 3FNDA 4A3QA 1KGWA 1U83A 3WD0A 3LZ5A 4L56A 1ADOA 2E4TA 3DX5A 4ONVA 3K1GA 3CZKA 3S1UA 3SGGA 2GJXB 1RR2A 4J3WA 2NT1A 2Z24A 5FOOA 3QRHA 4EBCA 2ZKMX 3BV7A 1HTIA 1E72M 3WL0A 2QCMA 2I9EA 4MTVA 4XO7A 3GHRA 1VBRA 1MDRA 5CSYA 1PHQA 3KHLA 4H8VA 3B8TA 3GWQA 4WLCA 3WLSA 1R2TA 5CZJA 2XUCA 3BQ1A 3G8RA 2I5IA 2VM8A 1E5JA 1EB3A 3SFKA 3G22A 3T2PA 2NQ9A 4PL1A 3WUEA 1KGXA 2CLOA 1EX5A 1AQFA 3G1FA 4TQRA 3BQ2A 4HGXA 3OYZA 4EPEC 4HPNA 2IXUA 3C2RA 2Q3RA 2QCNA 3VD4A 1OT1A 3LY0A 5CSSA 4FS9A 4WD0A 1R30A 3GZAA 2ZQ0A 2VVNA 2XSXA 1W1YA 2HDJA 3PWAA 3SY1A 4GNKB 3CUHA 4PTMA 4UCGA 4HA0A 4KBXA 2VEFA 2PGWA 5DQPA 1BXNA 3GNPA 2Y85A 2Y89A 1QXLA 3FGCA 2OYKA 4RNMA 1ZBWA 3H7VA 4QJ3B 1CLXA 3EX3A 4PA8A 5DLFA 4QM1A 1S1PA 4TV5A 3V36A 5IDZA 4O19A 1W17A 1P0DA 1RSCA 3GXPA 4NZ5A 3LTPA 4J7RA 3A5FA 1KRCC 2H3DA 1QATA 3BPWA 3MFIA 4J9SA 1DWAM 4JQ2A 3LRMA 2G37A 4ED8A 3IV8A 2BASA 5HUOA 5DMYA 1XISA 3GBDA 3NA8A 3OEXA 3PZIA 4GD0A 3PR4A 4BI6A 3F4CA 5KFEA 5CCZA 2AMXA 4FR1A 1TJ0A 4XBSA 3WH9A 4BI5A 1PL9A 1FP8A 5IOBA 3TAOA 1Y5VA 4FXRA 3T2OA 3RPTA 4ORIA 3CS2A 4Q8QA 1KRAC 3LERA 3PK7A 1VFSA 3BLEA 5EY5A 2R8HA 2QPXA 4IP7A 2ACUA 2WSPA 5KG6A 1W32A 4XZBA 1GQIA 3V75A 5AECA 2RJHA 3QQ1A 4XVEA 3AYVA 4AZBA 2YL8A 5CG0A 4LUIA 1KM6A 4KH2A 3I6TA 5HR6A 3UWVA 1XC4A 3W2KA 4UTIA 3LD5A 4XQ6A 1EGZA 4DHGA 1J12A 3FSTA 1Q8JA 3QY8A 2PUZA 4MJ2A 2J62A 4XD5A 4AMCA 3GIPA 4CEXC 1KM0A 2D73A 4ASTA 4J9OA 2W9BA 4JCMA 3C2YA 3IJ8A 2DH3A 1H60A 1E1CB 1CT5A 4DZIA 4FF5A 3BGGA 3EPNA 4UQ9A 2W0UA 2YXGA 2I5QA 2BOFX 1P0KA 4MNMA 1OBAA 1SO4A 3ERPA 4KW2A 2WSKA 3K4AA 3VGHA 3EZ4A 2A2IA 3DBNA 1MNZA 4A4AA 3GTIA 3HZ3A 3C4UA 1MXGA 3MI3A 4YR3A 3QZ7A 3G77A 4UNLA 2QDHA 4P8VA 4XAZA 2VT0A 3ZVIA 4PB3A 5I06A 1V3KA 4PULA 5FI8A 3AMKA 1Q6GA 2QUTA 2PU1A 4ECVA 5GQBA 4RPPA 1E3XA 2Z1BA 2GSHA 1XHGA 4A2RA 3LBOA 2E09A 5HMDA 4E8GA 1XCWA 1JZ3A 5CH9A 3C6CA 3TDFA 3IIOA 4ZQMA 1A3XA 1RY0A 1SFLA 4DPQA 5CZTA 1PKYA 2O9RA 1IIHA 1H61A 3RO6A 1AZ1A 3R2GA 5HJYA 5KFYA 1W1A1 1GK8A 3PTKA 4A3UA 3WCZA 3MDUA 1JJKA 1TG7A 1U5VA 1G4EA 4H2CA 3DGRA 2D0HA 3QW3A 4DZ5A 3CIXA 1JG9A 2CLEA 1KW1A 1DBTA 3ECQA 2O9PA 3BSMA 5A6JA 2WSYA 1Z3NA 4M1RA 2FZMA 1BF2A 3AWOA 2BFGA 2PLJA 3RFAA 5MF5A 1VFLA 3STGA 4BQ2A 5FEPA 1A50A 2X8RA 1WKFA 3KAOA 4LFYA 4B91A 3P80A 3UCDA 1YBQA 5FEWA 1B31A 1GVQA 4XK2A 2JIEA 4MAVA 3C3NA 2V5KA 2G3FA 1E6PA 4DJDD 3LCXA 3CL7A 2B7NA 4PUUA 4EPDC 3HG5A 3VOFA 3V6HA 4DEFA 1KTBA 4EYHB 5L9FA 5C9ZA 4QAIA 1UR1A 5ENLA 4F8XA 3ZJ8A 4OWGA 2B4GA 4MAZA 1XPYA 1NAL1 4Z0SA 3LENA 5BRPA 4LSBA 3UZXA 1XIDA 3NO3A 3S2NA 4CNNA 4CUCA 2YL9A 1PKNA 4YTRA 3KOWA 1F74A 3PNUA 1ZJHA 4GVFA 4JBRA 4AC1X 2W9AA 3W7QA 4ROPA 3V18A 4BHYA 3PW2A 2OSXA 1IGSA 4Z08A 2E6AA 2VOMA 2VFGA 4M80A 4RNOA 1R6WA 3NSMA 4I6VA 2DU2A 4JTJA 1L2UA 4W8BA 5B80A 1EHAA 1KTNA 4Z42C 3NZ1A 4EIVA 3GNXA 2NSOA 4DL4A 4KWSA 4W7WA 1LRQA 1JZ8A 3F2DA 2WQPA 1JR1A 1H49A 3FKKA 3AOFA 5LA0A 1A5AA 1AH0A 3DOPA 3MCMA 4AWUA 3TN5A 3DI1A 5HNNA 2Z1VA 2QW5A 4Z0JA 2WCAA 3S9IA 2GK1A 3MUCA 1PUDA 3MZ2A 1JNEA 1S46A 2BQUA 2IS7A 5EGRA 2BNJA 3N14A 3EWYA 2OZ8A 1B3VA 4R27A 4GKTA 1EEPA 3EWUA 4IMFA 2FQIA 3NG3A 4MY9A 4NRRA 3TJ4A 1YNPA 3N2XA 2DZWA 3OGSA 4NX0A 4D8ZA 3KHDA 1SYTA 3W1QA 4B15A 5GVJA 3BCDA 4QLKA 3R89A 4HQVA 3AIRA 3A3WA 4DYJA 4QE5A 1X6NA 4HYKA 3TNOA 2PFHA 4JV1A 3WQCA 1NF0A 5HUPA 3GX9A 1VPYA 3ICJA 1RD6A 3QV7A 4HK7A 2YGYA 2C2RA 2ODOA 3S2JA 1KCXA 3S0CA 4BEQA 1FBAA 4ED7A 4AD2A 4YS1A 1AVAA 3I4EA 4LBSA 1LUCA 3GNOA 2ZUSA 5AY7A 3GG8A 1YPFA 3B40A 3QHOA 2EG7A 4GJIA 3ITYA 1YMYA 5DGBA 2AKMA 9RUBA 3V7PA 3IUDA 3ITCA 2ZX6A 5FIPA 3QZEA 3M07A 1B30A 5HA7A 1OIFA 2QCHA 4MYXA 2G96A 1WZLA 2X0HA 1WDPA 4O15A 4MB5A 4KGJA 3V6JA 4AAJA 3F5LA 1RVKA 4KEVA 1QO5A 3E2SA 4LYRA 4GYFA 4P8XA 3V3WA 3CYJA 4Z2LA 1AA1B 5U4NA 3I7SA 3HMCA 2YA0A 1K6AA 2EF9A 3RCNA 4Q4KA 2CW6A 4GMEA 4NQ1A 3K2GA 3GH4A 3O63A 3MZNA 1M7XA 1BAGA 3O9NA 5HBFA 1FWEC 2P76A 2XVLA 3LI0A 5F9LA 5FJJA 1OQFA 1T6MA 2VR4A 2I1OA 1HXJA 3TNBA 3HQPA 5A8GA 3W76A 4XSMA 4L9ZA 4N42A 3WLRA 4PSRA 3RILA 5LIKX 3NZGA 4AF0A 2WKJA 4N02A 2POZA 4TO8A 4UMBA 3A13A 3PB2A 1H4PA 3FEMA 1RHCA 4IPPA 5KTLA 3DBPA 3KXQA 3OIXA 2NQ5A 1DQWA 1F9CA 5C7VA 5EFDA 3LSCA 4IIGA 3RLGA 4OUIA 1YLVA 3BICA 3GU9A 1ZCCA 4UTHA 1WXJA 2ZTKA 3QOKA 4QNEA 3TC6A 4DY1A 2KAUC 1WAWA 4RDVA 1DIEA 3ZR6A 2C16A 3FKRA 3L65A 4V15A 2FVMA 4DZAA 3PZGA 4XTIA 5KFVA 3B04A 3ZT5A 1XUZA 1R3YA 4I90A 4IXHA 5DFAA 1YYAA 3UXIA 4EAMA 1KFEA 2VO5A 3DFPA 4FA3A 4JICA 2FZNA 2FB2A 3TWBA 4WF7A 4LRSA 2IPGA 4IGNA 3U48A 1ZFJA 2OLSA 4Q8EA 4PUDA 3KP0A 3W6MA 1M1BA 3CTLA 3STPA 4JTSA 3LV5A 4Q8VA 2EJAA 3MHUA 4LV9A 3E02A 1K6WA 2I14A 3C8FA 1BRLB 1BYBA 5D05A 4F0RA 1JNDA 4LAUA 1Z42A 1J96A 5LNSA 4O3NA 5CAKA 4GACA 2PBOA 4DI8A 3V16A 2A7NA 1B3ZA 1ODUA 1TX0A 2EPOA 3R4IA 1H11A 3V0SA 5IDIA 5LIXX 4J3VA 1JDAA 3G8EA 3W6YA 1TMQA 1L2QA 2V82A 1U1HA 1JDEA 3UXLA 5KFSA 1MDLA 3VC6A 1PDZA 2VRKA 5AHFA 5DY3A 1TO3A 3WMBA 5RUBA 1IGWA 1KBJA 2WVUA 5IHSA 3SCOA 4CCZA 4QE1A 1LWIA 4DJED 4UC5A 3EX1A 3HURA 4HZ7A 4UZSA 1Q8AA 4F9JA 1DJYA 3IJ9A 3C0JA 4Y90A 4J27A 4O4VA 4YWIA 4YYCA 4AZIA 5AVHA 1XP3A 3SUWA 1GGOA 3PUDA 1ZBKA 4L61A 2HTMA 1XFCA 2P88A 2Z28A 3FVMA 4GA8A 1WYIA 3PW7A 3T09A 3VZXA 2ZX8A 4IL0A 3IJIA 3PJWA 4E3VA 5M5DA 4DO4A 4B5VA 2D1ZA 3A23A 2BY3A 4L7ZA 3BUVA 4HU8A 1IEIA 3N2MA 2OOFA 2VGIA 2PZ0A 4ZENA 1RYRA 4D6EA 1IYXA 1RA5A 3OQEA 2YW4A 4WGHA 1UZDA 3GH7A 1VBJA 2CERA 5I07A 1LL6A 1W8SA 2XSAA 3LB0A 5MKGA 1G1YA 2E1DA 1FUYA 2PCQA 4UTLA 4P61A 2PA6A 4NRSA 3EWCA 3DHUA 3MSYA 5ABFA 4A29A 1Z48A 1P6BA 2OTDA 3WD3A 4PBGA 2QPUA 1GWJA 1MZRA 1YDOA 4LB3A 2YPIA 1J2BA 1MEIA 3W2MA 2MANA 3TONA 2QMJA 4ZFCA 3KE0A 3TSBA 4W93A 3LGGA 5I3JA 2EXOA 3TSDA 1VLWA 3V0UA 1OFBA 3FJ6A 4C6EA 4XSLA 3S83A 3PG9A 4WSKA 1E9IA 4HIBA 2AAMA 4BA0A 1F4HA 5I7GA 3F4VA 1F76A 2GFTA 4EOUA 4G7FA 3NOEA 4QG9A 3CEUA 1Y5XA 1TZ7A 3WLMA 2DDXA 3CWHA 1C8VA 2VYOA 5JH2A 2A4AA 1E6SM 1QPNA 3C0LA 1A5BA 1P6CA 1XGEA 4JEQA 1BD0A 5DQGA 4MWAD 1UD8A 2CZ5A 4YR2A 2E8ZA 1JF6A 1RD5A 4ERGA 3AALA 3BQ0A 3HG4A 3KX6A 1BVNP 2GJXA 3Q45A 4F2TA 3ARZA 1S5WA 3L68A 1UD4A 3WLNA 4KEZA 4ACZB 3W1XA 5CBBA 4F40A 4DWSC 2XGZA 1FWDC 4WKHA 4AB4A 2BGSA 2YLAA 3YPIA 5KFLA 3C2FA 4X2RA 3K13A 4DWSB 3B9DA 3ZQ9A 1SO5A 1IZKA 4X22A 4KGLA 1RUSA 3GZ3A 3PUGA 3VE7A 2VWTA 1JD7A 3QC0A 1LOQA 3FS2A 3JVAA 4DF2A 3ITXA 3O6AA 3B05A 2PI6A 1XSKA 3UT0A 1KBIA 1R87A 5CGMA 1D8CA 3PUEA 4S3BA 5DXXA 4E2DA 1JXLA 3W83A 2NVAA 3UW6A 3W84A 1S5VA 2WPGA 4IUGA 2JEFA 2E40A 3O06A 1FOBA 1T0OA 1AQMA 4QDMA 2WHLA 3O0FA 4XD4A 3FY1A 3LN3A 2ZBTA 2NVDA 1Z69A 3UJFA 3TFXA 4XKYB 1T8XA 3MP3A 2Y8KA 4JY8A 3PUOA 2VUNA 1VEMA 1W9PA 3Q65A 1XLFA 3FA3A 4NJHA 5HJXA 2PWFA 4RR4A 4YHGA 2CWXA 1E9LA 1HFBA 1D7KA 4XD6A 1QOXA 1DTUA 1TB3A 4IIBA 1A3WA 3G1RA 4L4LA 1JAEA 2W9MA 3ITVA 3E2RA 1UIOA 3EWBX 3GIYA 2HVMA 4L1GA 4XAYA 4O14A 1EPXA 4WXZA 2BWGA 4ZVJA 3I10A 3RB6A 2WBKA 2QV4A 4WSHA 3N4FA 3OTRA 2NX9A 2XGBA 3SR7A 2NVCA 4PBEA 3SCSA 3SN4A 1YXDA 2E6YA 5F2IA 4QLLA 2OZTA 1Q4WA 4DNHA 5KG0A 3MWCA 4TQSA 2XYLA 3O6YX 3HJEA 4O3RA 4GK8A 3ARSA 4PTVA 5D8ZA 1ITUA 4NSBA 3FXGA 3FOKA 2I9UA 2WKLA 2AGTA 4J2PA 2DFAA 2PTYA 4GO8A 4KT2A 3GDKA 3ARQA 1GNXA 3LTYA 3OZMA 2PD5A 1OD8A 2YIHA 4J3SA 5M2FX 2E5BA 1TJRA 3ENLA 4IPLA 1ICSA 1YNYA 3S6OA 3IGUA 3UJ2A 1EJTC 3UR5A 4GJJA 4OZOA 4W8LA 5ABGA 3H12A 1XW8A 3OZYA 4J3ZA 2J6VA 1E1CA 2ZCGA 2WJZA 1QNSA 3WEMA 4EVZA 3AS1A 1O66A 2OKOA 4JQ4A 1TCDA 1OD0A 5E9XA 1JF5A 4OOUA 3S5OA 1B4EA 4QSHA 1EBHA 1J4EA 4FX6M 3L2LA 4QCFA 7REQB 4K1GA 1W91A 2OR2A 3F7JA 4H9UA 4Q8NA 3W71A 3RLHA 4U4MA 2VGBA 3CWOX 3WQDA 4XUYA 3S5YA 3GKFA 4LS2A 3TN3A 3T5LA 1FKWA 4LWWA 1K9EA 2V6AA 5EL1A 4I9JA 3ZT6A 1US0A 1H2JA 4Q8PA 2NV9A 4M82A 3S3GA 4US5A 4G3IA 3EMZA 1W56A 5KMYA 4ZA0A 3ZS4A 1J0KA 1MUWA 5C0QA 3W29A 4JFUA 4Z1AA 4AIBA 3D6NA 6REQB 4GBDA 2GUYA 1UP3A 4RNIA 2QJHA 2VQUA 3B06A 2FLPA 1W5PA 2Y5JA 4IOTA 4QGCA 2W67A 1GZGA 3TJIA 5DQIA 4PN2A 1PDYA 3IV3A 3SM0A 3QPZA 3K4DA 3PW0A 2ZA1A 3ALGA 2DEPA 1PB0A 3TYCA 3TTQA 4XZHA 1W5MA 4J4KA 4C1NA 4GCAA 2XWDA 2WPBA 1ITQA 1GPWA 2R1PA 4PMOA 4UUIA 4LGXA 1OK4A 2YL5A 3MMDA 4I9AA 3KCOA 5EPDA 3NL3A 1XLCA 5DQHA 2UVUA 4D6CA 2E25A 4JX6A 1DE5A 4U5KA 4H9TA 4QG8A 4AY8A 3FV9A 3BJYA 4JIPA 4GKLA 2QCEA 3U2ZA 4Q8TA 2OSYA 3SEPA 1NU5A 3BAIA 1K9FA 3F03K 1X98A 1VCVA 3GRIA 1FY6A 4PL2A 3LHVA 2CESA 5AFDA 4MB1A 2H9AB 1AMKA 5DG7A 1IXOA 1DJWA 1J2WA 4DL2A 3NDOA 4AD5A 2CLMA 1NTHA 4NAEB 2PDJA 3W37A 3M0XA 4S3EA 5E0CA 4AVFA 4JTEA 4Y9NA 1HL9A 1FFQA 2VGFA 5H91A 4C90A 4MGGA 4RE4A 3CUZA 4NNCA 1KA9F 3NIYA 2QF8A 3HQNA 3NGFA 4EEYA 3W00A 1G01A 3IJDA 1KM3A 5BXRA 1LORA 1BXCA 4C6KA 5HNTA 3IGXA 1XC6A 4HK5A 4LBUA 4B5NA 2VGGA 2VZUA 1T7LA 4UQEA 4YL2A 3CQIA 3PTMA 4KETA 1V79A 5A8PA 5E93A 3GXNA 2J47A 1JFHA 4O12A 4ADUA 3SQLA 5EWGA 2D2HA 4D6JA 4IZGA 1UWAA 1Z8AA 2ZXAA 3I65A 3R10A 3TTEA 2Z7KA 2WNWA 3RCYA 3CQ0A 1L9WA 4MMWA 3WK0A 3TA6A 3Q8QB 4MM1A 2BSLA 4JHZA 5CPTA 4B3ZA 3W7LA 4AWEA 2WZMA 3CXOA 2NT0A 3HPFA 1HP4A 1OCNA 3CZEA 5TD4A 1A4LA 2H90A 1ONRA 1SPQA 5KZMA 4TTGA 3N13A 1KBLA 3EOOA 2EPKX 5FJOA 3TXZA 3BWWA 1XLEA 3ZMRA 2VRJA 3N1AA 4QDPA 4OKDA 1UOZA 4FB7A 2Q6ZA 1S5NA 3PPFA 1GKQA 3PHAA 2UY4A 4Z2HA 3EEZA 3E5BA 3H4XA 2YA1A 3W75A 4LVDA 5LIYX 4JIIX 3OJGA 4C7DA 3HPXA 3LLDA 3WD2A 1S97A 2ZUUA 2A6NA 1JZ5A 4IMAA 4GI9A 4IFKB 5F2LA 4LX4A 5AKQA 3MP5A 4GYKA 4EYIB 2XISA 3TLLA 3LEPA 3QGVA 1OVDA 4HMDA 1JCJA 3LPFA 2YBVA 2ZDRA 1DXEA 3MMWA 3HPAA 1W9BM 2C13A 5CG7A 4RZ4A 1GJWA 1XM3A 2A3BA 5KFXA 4JQ3A 2JK2A 1WP6A 4PSPA 1UR2A 3SY8A 4K8HA 2QJNA 1XBVA 2X1UA 1MWOA 3SIMA 3G18A 4UOJA 4L6OA 4B9ZA 3MANA 4DM1A 2R8IA 2V5LA 3A22A 2QMKA 1FTXA 4WKFA 1NDVA 2GWGA 3B8IA 1GVIA 3CUIA 2J9ZA 4EXQA 4P7RA 2O9TA 3UNTA 4LC6A 3TX9A 3M9MB 3G5EA 3RR1A 1R3QA 3H8AA 4QG6A 1B90A 4FALA 1TR1A 3UA4A 3XISA 1T5AA 2O92A 2O56A 2OVLA 1OFRA 4DM2A 1GQLA 5A6SA 3CQJA 2Y63A 5BMWA 1EFZA 4MLJA 4QITA 5C5JA 4ZQRA 1KM2A 4R7OA 2C1HA 3KFTA 4HHLA 4YTTA 2ZWYA 3ARRA 3WG6A 4DUOA 2FDSA 1H1ZA 4YR0A 1DEDA 2OEMA 4V2XA 3UG8A 2DZXA 3CJPA 4R9XA 3NQ7A 2Z1SA 3RO8A 4L4MA 1V0NA 2PP1A 2HRWA 3VYLA 1W3JA 4LQ1A 5T14A 4JTTA 3LTSA 2O7SA 5KFAA 4HPHA 4LJ3A 3VCCA 5IXEA 1BKSA 1ITCA 1VHCA 1VF8A 1JYNA 3BW3A 2XIQA 4Q3MA 3W7GA 1RLCL 2YYTA 3JU2A 5GJPA 2X7VA 3HJZA 1WO2A 3MSGA 5FAGA 1UW9A 4UMAA 3LHYA 3P93A 3VUSA 4LC8A 4KWVA 4J28A 1W1B1 3PJTA 3AISA 4S39A 2PTDA 2POTA 3TP4A 3W7IA 4HJFA 4ZQCA 3MKCA 2DT2A 2VJXA 3BLPX 3VPLA 4A3RA 3GFYA 2Y88A 3T0TA 4MF4A 1NWRA 1QPOA 4C6FA 4L5ZA 5BOOA 3LCIA 4OGZA 4PYSA 3PSVA 4C6PA 3WLJA 1FWBC 4OJYA 1E0VA 3FHQA 4WJ8A 3D3AA 4PMZA 1BRLA 5J8LA 1EBGA 2GQ3A 1QI3A 4DL3A 2VD9A 1H41A 2FHFA 2VC6A 3W74A 3OLEA 3AMCA 4E8CA 1MW0A 3HU7A 3UPMA 1UR4A 2V2CA 3BLKA 4PUKA 2AGPA 3DIPA 3ARPA 3EPMA 1CXIA 4N9EA 5A6KA 4ML4A 3S1VA 2ZRZA 1K1SA 4DLMA 1PPIA 2CZDA 3W73A 4IIEA 4CNSA 3PBWA 3PBUA 2GUUA 1MEHA 2YBTA 2HJPA 2ZYFA 5FJPA 1KXHA 2AU0A 1FH7A 4RKAA 4GXPA 3MR5A 1OADA 2NX1A 4RL3A 3PPGA 4DBDA 3W7PA 5H8MA 3UBPC 3SRDA 1NSJA 4MWAE 2X05A 3C86A 4TTUA 2Q02A 3HGRA 3MDWA 4UTTC 3BVJA 2BS9A 3OW1A 3VU2A 3GVRA 4IRKA 4O1FA 4AX6A 4CQAA 2FKPA 1L6GA 2CU0A 4F4YA 3UR7A 3HPSA 4AD0A 2CZVA 4DELA 3QMTA 3AXHA 5DRCA 1HKVA 3PVXA 3BARA 4PFHA 1W9UA 2IKGA 3ES8A 2VFHA 2HQAA 2YXOA 1KLYA 5KZEA 3EDKA 3T81A 3P0XA 1XFBA 4DL5A 2PS2A 1S0NA 1XG4A 2CWNA 2AGQA 1B9BA 4J9LA 5CC6A 3VE9A 1XIJA 5GJMA 4LS1A 4DAFA 1HQTA 1DOSA 1JRCA 1MFUA 2DPEA 3KDNA 3AQUA 3B03A 1RQBA 2Y2WA 3QGKC 1W1PA 3VIMA 3VMNA 4Y8EA 1V3MA 1A4MA 4P8WA 3VGFA 5I3FA 3EOEA 4JV2A 2DPJA 1FCUA 2Z29A 4ZO9A 3K8KA 4IQEA 4A05A 5L1KA 1I2RA 3C52A 5DLCA 2OFJA 3C3UA 3S46A 1G69A 1WQ5A 2GVEA 2ZZ4A 1ZBVA 1EL3A 4KFPA 3CUGA 1MXSA 1A5OC 4FNPA 3WJWA 2WKGA 3TYDA 1PX3A 3PBVA 3APYA 3MSDA 4HHMA 4AWTA 2JGQA 1CXEA 2ACQA 3VTRA 1UUMA 5AZ0A 3PR5B 2RUSA 4WOZA 1O5QA 4J9QA 3IK2A 2XFYA 2QS8A 2NLYA 2GSEA 3G1DA 3G1XA 2D3LA 1TPVA 5K7JA 3U9IA 3DU0A 1ME9A 2UVRA 3B4YA 1GEQA 4F4XA 3AXIA 4R34A 1TVNA 1EKOA 5XIAA