2Z00A

Crystal structure of dihydroorotase from thermus thermophilus
Total Genus 153
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
153
sequence length
426
structure length
426
Chain Sequence
b'MILIRNVRLVDARGERGPADVLIGEGRILSLEGGEAKQVVDGTGCFLAPGFLDLHAHLREPGEEVKEDLFSGLLAAVRGGYTDLVSMPNTKPPVDTPEAVRALKEKAKALGLARLHPAAALTEKQEGKTLTPAGLLREAGAVLLTDDGRTNEDAGVLAAGLLMAAPLGLPVAVHAEDAGLRRNGVMNDGPLADLLGLPGNPPEAEAARIARDLEVLRYALRRSPATPRLHVQHLSTKRGLELVREAKRAGLPVTAEATPHHLTLTEEALRTFDPLFKVAPPLRGEEDREALLEGLLDGTLDAIATDHAPHTLAEKEKDLLRAPFGIPSLEVAFPLLYTELHLKRGFPLQRLVELFTDGPRRVLGLPPLHLEEGAEASLVLLSPKERPVDPSAFASKARYSPWAGWVLGGWPVLTLVAGRIVHEALK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Dihydroorotase
molecule tags Hydrolase
source organism Thermus thermophilus
publication title Crystal structure of dihydroorotase from Thermus thermophilus
rcsb
total genus 153
structure length 426
sequence length 426
ec nomenclature ec 3.5.2.3: Dihydroorotase.
pdb deposition date 2007-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01979 Amidohydro_1 Amidohydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.40.10 Mainly Beta Roll Urease, subunit C; domain 1 Urease, subunit C, domain 1 2z00A01
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 2z00A02
4ICMA 4F0RA 4H9YA 1V77A 4DZIA 3GTFA 4C65A 4DYKA 2EG8A 4LAKA 1O12A 3F4DA 3QY8A 4WGXA 2DVXA 1KRAC 1EYWA 1YIXA 4C6EA 4CQBA 1A5LC 2WJEA 4INFA 3K4WA 3JZEA 2FTWA 1P6CA 3PBMA 4LANA 4GOAA 3DUGA 2Z2BA 4RDZA 4KIRA 2P50A 3FDKA 3OQEA 3GIPA 1PB0A 2Z00A 3TN6A 3BE7A 2YB4A 4C60A 4KEZA 1BF6A 2FVKA 4BJHA 4MUPA 1GKQA 3MTWA 1PO9A 4UBPC 1XGEA 2R1NA 4GY1A 1HZYA 2Z28A 4B3ZA 2FFIA 3HPAA 4C6FA 4ERIA 5FSEC 4DZHA 2PGRA 3RYSA 1UIOA 3T81A 2WM1A 3TN5A 1K6WA 4GZ7A 3LSBA 1QW7A 2Q09A 2PUZA 2VC5A 4H01A 4PBEA 3SO7A 2Z7GA 4PBFA 1FWCC 2ZC1A 5A6TC 2UBPC 1RJQA 1EJRC 4JOMA 1JGMA 3B40A 2Q01A 1EF2A 4LAMA 3HM7A 1FKXA 4H9VA 4ZSTA 1J79A 3GTIA 2F6KA 4LFYA 2FVMA 1PSCA 3ORWA 2XIOA 4PCNA 4KF1A 4C6KA 2GSEA 2VM8A 4XAGA 1GKRA 3GU1A 1A4LA 1R9ZA 1VFLA 4H9TA 4IFKB 2PLMA 2GWNA 1K70A 4CNSA 4H9ZA 5HMDA 2Z27A 2G3FA 2OQLA 4ERGA 4GY0A 1FWGC 1XRFA 1E9ZB 3URAA 3F2DA 3C86A 5FSDC 4IFKA 3S2LA 3PNUA 2O4MA 3E0FA 2GZXA 4LALA 2Z25A 4QTGA 1ZZMA 2OOFA 1J5SA 1O5RA 3IARA 4YIWA 3OJGA 4EPEC 3OVGA 1ONXA 5G4HC 1UMLA 4CQDA 4HJWA 4XAZA 3TNBA 1P1MA 2P53A 4CNTA 2Z29A 4XD6A 4R85A 4E3TA 3GUWA 4P5UA 1YBQA 2W9MA 3FDGA 4DIAA 4EPKA 4R7WA 4EP8C 4KEVA 4QS5A 1RK6A 4AC7C 1I0DA 1K1DA 3KM8A 3EWDA 4DI9A 4HK5A 3GG7A 5CH9A 3LA4A 4DI8A 4XAYA 3URQA 2HNHA 2GOKA 1KRCC 4BY3A 1A4MA 4G7EB 1ONWA 4CNUA 4RDYA 1POJA 1NDZA 4IQJA 4M51A 3UBPC 1POKA 3RN6A 3UPMA 2Z26A 2VUNA 4G2DA 2AQOA 1E9YB 4CEUC 4C6QA 1RA5A 1S3TC 1M65A 3IV8A 4DNMA 4C5ZA 4LEFA 5HMEA 4G7EA 4LCQA 1EJXC 1KRBC 1ITQA 3URNA 2IMRA 3LGGA 3F2BA 3E38A 1XRTA 4XD4A 2HPMA 3NQBA 3MKVA 3ITCA 3GIQA 4B91A 4J2MA 2VC7A 2BGNE 3E74A 2WJFA 3R0DA 3LNPA 3QY6A 4PCPA 3A4JA 3OOQA 1A5OC 4B90A 1UBPC 2DVUA 2YB1A 4OFCA 3WZ0E 3LSCA 3S2NA 1DPMA 3NEHA 3D6NA 3UF9A 1FWJC 4GYFA 3AU2A 3LU2A 4IFOA 3MDWA 3MPGA 4C6MA 1V7AA 2Z24A 4C6LA 1FKWA 4F0LA 4XD5A 4LH8A 1J6OA 3GRIA 3GTXA 4WHBA 1R9YA 4RZBA 3E3HA 1NDWA 2OODA 1IE7C 4IG2B 5HMFA 4L9XA 2Z2AA 4LAOA 1RAKA 4RDWA 3S2JA 4RE0A 3F2CA 4HA0A 3LGDA 1J6PA 4F0SA 4J35A 1RJPA 3B0YA 2AQVA 1YBQB 2AMXA 5LXXA 2PAJA 2VHLA 3GU9A 4C6IA 4C6BA 1FWHC 2RAGA 2ADAA 1YMYA 2HBVA 1EJVC 4TQTA 3QGKC 4I6VA 2WJDA 3V7PA 4GXWA 4GK8A 1I0BA 3RCMA 3WYZA 1FWFC 2R1KA 3PANA 4XD3A 4KEUA 3GU2A 4IGMA 3URBA 4DO7A 2HQAA 4HK6A 2E1WA 2HPIA 2YXOA 3ID7A 4CQCA 2CZVA 3MJMA 4IGNA 3QGAC 3OU8A 3IRSA 4I6KA 1WXYA 3CAKA 2ICSA 4H9UA 3QY7A 1W1IE 2O4QA 4LCRA 4NG3A 4CEXC 3DCPA 3EGJA 3OODA 3RHGA 1EJWC 1FWAC 4V1YA 4ERAA 4B92A 3HTWA 4H9MA 3A3XA 1A5NC 1KRMA 4HK7A 1NDVA 4IG2A 3GTHA 3A3WA 4C6PA 3CJPA 1P6BA 4C6OA 3MVIA 3LY0A 1PTAA 2D2GA 3T1GA 4ZSUA 4Z42C 4GX8A 2P9BA 2R1LA 4KQNA 1NFGA 2Y1HA 1NDYA 3DC8A 3O0FA 3PNZA 1YRRA 2DVTA 2QPXA 3AUOA 2HBXA 4GY7A 3S2MA 3F4CA 1ITUA 4D8LA 4WVXA 2OB3A 2OGJA 3CS2A 3MVTA 3IJ6A 1RK5A 4IFRA 1GKPA 3UR5A 2I5GA 3T8LA 4C5YA 3WMLA 3AU6A 4H00A 2E25A 3IPWA 4L6DA 1FWIC 2I9UA 1A5MC 3ICJA 4C6CA 4R88A 4KERA 4PE8A 4QSFA 2GWGA 3IACA 4QROA 1V4YA 3G77A 2ANUA 2EG6A 1YNYA 4UB9A 2KAUC 2UZ9A 4C6DA 4LCSA 3SFWA 4EPBC 3E2VA 2YZ5A 4V1XA 1WXZA 4J5NA 4C6NA 1A5KC 1UIPA 1V79A 1M68A 2VR2A 1V51A 4KESA 3UR2A 2QS8A 3EWCA 1FWEC 1RJRA 3IGHX 2QT3A 4RDVA 1ADDA 3TN3A 2A3LA 3LS9A 2D2HA 4GC3A 2EG7A 3ISIX 4QS6A 1RA0A 1FWBC 1EZ2A 3E0LA 5E5CA 1EJUC 3K5XA 4XAFA 5AKQA 3FEQA 3O7UA 1KCXA 2PGFA 2R1PA 4C6JA 1R9XA 3TN4A 4IH3A 4IF2A 2Z4GA 1FWDC 4EPDC 3NURA 3PAOA 3MDUA 4NP7A 3N2CA 2QVNA 2R1MA 4GX9A 1EJSC 3B0XA 4AQLA 4DLFA 1M7JA 1QXLA 2FTYA 4QRNA 4BKNA 4H9XA 4DLMA 1XWYA 3K2GA 3GGMA 3MSRA 4KETA 4GBDA 4NI8A 1EJTC 2BB0A 2D2JA 3S4TA
chains in the Genus database with same CATH superfamily
3OVQA 2GK1A 4F2UA 1PKLA 4Q4MA 3ITXA 3K4AA 1VFHA 3W7QA 2NUWA 1JNDA 1SGJA 3BL3A 1ZU8A 2ZX6A 1TWZA 2A3HA 3D5HA 1XF0A 5AHMA 4LQ1A 1Q6DA 3SADA 5HQLA 5F2MA 3BVJA 2GJXA 1DTUA 2CHNA 2V9WA 1T0OA 3APYA 1CW2A 4GUFA 3E02A 3TVAA 3ITVA 2PDGA 4F9DA 5F9LA 1WPCA 2VC5A 2IXUA 4P8UA 3TZNA 3HIJA 2YLLA 3EDJA 1IEQA 4LSBA 3EMQA 1H49A 2PC8A 3LHUA 4ASTA 4YCPA 1M01A 3AXMA 5GJNA 3CUJA 4PB3A 8XIMA 4HYVA 5KFCA 5I6SA 2IA6A 3OZPA 4F9JA 1A0EA 3BMVA 4N2YA 2WM0A 2WLZA 1A49A 4ADTA 3URAA 3LXAA 1SJBA 4EF9A 3IGUA 3H4WA 3PW5A 1F8IA 4ED6A 4NI3A 3SCOA 4LYPA 3OJGA 3IIPA 4HNLA 3TTEA 1XH2A 1MWOA 4TQRA 3GXPA 4HOWA 2VEFA 3GUWA 3BGGA 3FDGA 1JZ7A 4BEQA 1I0DA 4DBDA 3UCCA 1OF6A 3GG7A 3DENA 5L1JA 4Q8QA 4CQ8A 5A8MA 2IKHA 1JAEA 3BCDA 5J8LA 1CZ1A 3KRSA 3VM7A 1AW5A 5DT5A 3PZTA 5DQGA 1X1NA 1AH3A 4QG8A 2QCEA 1DWIM 1H7RA 1KNWA 1TVLA 3LBCA 5D9OA 1J0HA 2V81A 4GI8A 2PI6A 3AO0A 5BMXA 4GI6A 5BXPA 1EXBA 4DYEA 3PVFA 1Z6KA 5HUPA 1AL8A 1VEMA 1XLFA 3LHVA 2X1RA 1XINA 1NTHA 1DHPA 2FYMA 1V6TA 1EEXA 2UV8G 5M3WA 1BTCA 3T55A 2W4XA 2YCEA 3PB2A 3DFSA 2XG9A 1MDRA 2YXGA 4F2BA 4IMAA 2PDWA 3Q8RB 3NZGA 1TWSA 1TVNA 2W5FA 2XN0A 4U31A 2NSXA 2EPMX 1X39A 3L4TA 4E2OA 3MZNA 4PA8A 1IEWA 1ZNNA 3THCA 1FKWA 2Y7GA 3INPA 4YYFA 2ZXDA 1R9YA 3WLRA 2QCNA 3L4VA 2G3NA 3FA4A 1JEZA 2QEZA 1ALDA 1XBZA 3LHZA 3DI1A 5CJ5A 2FMNA 1EIXA 3KEHA 3MB9A 1OX4B 4IPNB 4UQAA 1KCKA 3F4WA 4HNOA 3CZLA 3W76A 2W79A 4XWUA 1WZLA 1VYRA 4XUGA 1R7AA 1WOAA 5CPMA 1ME8A 4AWUA 1QO2A 1YMYA 1TIWA 5HPOA 4N9CA 3UWEA 1V6WA 5TQLA 4H7CA 2VXNA 4YS1A 4KEUA 1GW9A 2WHMA 2YDRA 2RJGA 2YXOA 3ID7A 2XDFA 2PWHA 1RVGA 1UUOA 1LROA 2WLYA 4C7GA 3B9EA 3HGOA 3C2YA 3OU8A 4MNLA 4NHVA 1ELSA 1FCQA 3NYDA 4MB3A 2TODA 3T4CA 4LS1A 4HHLA 2OX1A 2D2OA 1DBTA 2UY3A 3KL0A 1YDOA 3B3DA 2VO5A 4MFEA 5DFAA 1GT8A 3M9NB 3NDZA 4KWSA 2VDGA 1RBOB 2B7OA 3TAOA 3A3WA 4IXHA 3CJPA 4ZBCA 1LBLA 4ZOCA 3WEZA 1IGSA 5GQBA 3M0JA 4ZSUA 2XGZA 5KT7A 1QW9A 1XPYA 1L0PA 3T40A 4W88A 1T7LA 4ATWA 3SRDA 2V2CA 1ICSA 1W1B1 3S2MA 4DO6A 3R4IA 2FIQA 2RDXA 3MVTA 4GNJA 3IJ6A 3UPBA 1LT7A 4BF7A 1MW1A 2Y24A 2O55A 1FDYA 5C6MA 4IISA 1TR1A 3GQYA 3CLWA 2QVHA 2V5LA 1DJGA 3GHTA 2WB5A 1G4EA 2WKLA 1ZAHA 4I3GA 1V4YA 2VZUA 1RBLA 3ABXA 2FHCA 2E5DA 4UB9A 3VE9A 1E3XA 2DH2A 1IZJA 5BNKA 1XIEA 1TPDA 3NQFA 2XIMA 4ECVA 8A3HA 3PC0A 4A2SA 3LM7A 2G96A 1UIPA 2WNWA 2HVMA 4LVBA 1P0EA 4WRHA 4S3CA 4KESA 4LW7A 1OADA 4DF1A 1QVBA 1PE1A 3IGHX 3WIJA 4AZIA 1XIDA 4DQWA 4MKVA 5F2GA 1RD6A 2XVPA 4FSAA 3BDKA 4WJEA 4B5NA 4WY0A 3OQ8A 1V08A 3K5XA 4M1BA 2PGFA 4JCMA 3T05A 2ZRYA 4AD3A 3CV6A 4CQ9A 1XXXA 3GK0A 1S2CA 2Z4GA 3SJ3A 1X6NA 3S5NA 5CEWA 5E6ZA 3C2VA 2V9DA 4DL2A 2G0WA 1DJNA 3C2OA 3W01A 3GZ3A 2VFIA 2J6VA 1S2UA 5KFWA 1WKYA 4AHQA 2BS9A 2VEMA 3ES8A 1OGGA 3WQGA 3WQ5A 1PYMA 5DMYA 3MSRA 3NPXA 3WBXA 4KETA 3QMRA 4Q7BA 4Q8WA 2X7VA 3HGRA 4EIVA 2PLCA 3PBGA 4P7NA 3CAQA 3W7HA 4EWJA 2PDKA 3RB4A 2WBKA 1M53A 2A7NA 3CHDA 3EOEA 3TZFA 1T8QA 4YMZA 1GW1A 4HGXA 3NQGA 4KIRA 3KBWA 4OBRA 3L4XA 3VIMA 2VFEA 4UTTC 2GDQA 2E9MA 4KWOA 1HZYA 1DQXA 4JQ2A 1AH4A 3E0IA 4NRSA 3NZPA 5C8BB 4Z0SA 3T81A 3UGRA 4I7VA 3AHZA 4FS9A 1TE1A 2V69A 2CC0A 3H2EA 3TJXA 5GJPA 1XDMA 2WC3A 3VU2A 1RJQA 4WQ6A 3RMEA 1XFBA 1JGMA 3EPNA 1OSEA 2O9OA 2Q01A 1GZJA 2Q6ZA 1G94A 3PJWA 3B9OA 2OG9A 2CHRA 1VKFA 2E0PA 3ME3A 4ES4A 2C1IA 1DIOA 3VILA 4PCNA 1VJIA 4J3XA 1F61A 3DBNA 3I6EA 4F0MA 1A4LA 3AIUA 3L0GA 3KE0A 1FA2A 4F0HA 2CBVA 1KGWA 3BOXA 5DN1A 1Q6QA 5EY5A 2WCGA 4AG0A 4DJED 3U4FA 4JX5A 4IJCA 7ENLA 2GZXA 2VD8A 5BWFA 5LSMA 1UKSA 3GNRA 1E6SM 2FLLA 3R8RA 3N2TA 3KHJA 5CPQA 1TPEA 4UTWA 1OFRA 2ASJA 4US6A 1GOIA 2RDUA 1P1MA 3RRXA 3KL5A 4HHPA 4GYJA 4E3TA 3QYSA 3THAA 3AYSA 1MZRA 4MB5A 1GUVA 5KFQA 2ZA1A 5KFHA 1T41A 4NYUA 3A24A 1A4MA 4W89A 3W37A 1NU5A 5KFMA 3V75A 3UETA 2VNCA 1YDVA 4MGGA 4GQBA 3G0XA 1HGWA 4B16A 3E96A 1LQ2A 4JR5A 1M7OA 1TZ9A 3EWBX 4RE4A 3BAJA 3VNDA 3VX1A 4C5ZA 1JXJA 6REQB 3CQKA 4JTFA 2D3LA 1N8FA 2IMRA 3CEUA 3LGGA 1TO3A 2J7BA 1ZSXA 5I2UA 4YR0A 3GW0A 3MKVA 1DWFM 4RNIA 5HUOA 1QOQA 4QEEA 1X6LA 2G4FA 1E4MM 4CN6A 3ZYZA 4JPGA 1JYNA 1Z69A 3CPGA 4PN2A 2ZVIA 2JKEA 1LJYA 1FWJC 1IWBA 3PPGA 3AIRA 4JTUA 4LF2A 4FK9A 2BQ3A 4A3UA 3GXIA 4S2BA 1DTNA 4DM1A 4NL1A 2ZXAA 3B9DA 3N11A 2JEQA 4PUUA 2GLKA 1QTWA 3K8KA 1TZ7A 1GTEA 1BXBA 4HPXA 2VC9A 4QJ3B 4IT1A 4J35A 5BW6A 5CG7A 2I7GA 1SFLA 2Y63A 3WQ8A 1J4EA 4CU7A 4GUIA 3A21A 3SCSA 4JNMA 4V28A 1KWKA 2Z6IA 1JCMP 1KFEA 3QGKC 3SN4A 5LIXX 4O1DA 3KP0A 3RLUA 3D3AA 4U4MA 1RLDA 1OFQA 3W26A 1PHQA 4ECLA 3NJ3A 3R12A 1YPFA 3HBLA 3QOKA 1SFTA 1F76A 2PCQA 3QVQA 2GJLA 2ICSA 4H9UA 3CL7A 4RL3A 3T78A 3DCPA 1C8YA 3RHGA 4XUYA 3B97A 2VGFA 2EGZA 2PBOA 1MZHA 3IGSA 3GIJA 1KQYA 4FR1A 1UPMB 1XBYA 4AIOA 3OZOA 3NL6A 2VRJA 3U3HA 4LJ3A 1UR4A 3GTHA 2X1UA 5CZJA 4W9TA 5IBXC 2DT3A 4ZODA 1XRSA 4L1XA 3TSBA 4YJ5A 3T1GA 1Q7ZA 3OYZA 1DWAM 4WZHA 1B3XA 3FS2A 2Y1HA 2P1FA 3VUSA 3PZIA 3GHSA 4RK8A 3TYEA 2GJXB 4AU0A 1HKIA 1BYCA 2J47A 2WSKA 2RDIA 2J74A 2OGJA 1FP9A 2OXNA 3VE7A 4PTMA 3MS8A 3NUKA 2VWSA 5AZ1A 3AU6A 4IRCA 1FWTA 2GL5A 2ALZA 2A0NA 5DQHA 2GDVA 1PAMA 1CX9A 2X2GA 1B3ZA 3E12A 4LY4A 3EEGA 3HO8A 5KSWA 3PJXA 3EWXA 1VPQA 3TNOA 2JEIA 5MF5A 1J5TA 1KFBA 4JICA 1MW0A 3BLLA 4S1FA 1E1CB 5FAJA 1WX0A 1MXGA 4MPQA 4Q43A 3DGRA 2YBTA 1CGVA 1Z44A 3B4UA 3BANA 1ZBWA 3EEZA 4RDVA 1M7PA 1BKSA 2Y85A 1KB3A 5FF7A 4EBDA 1E6PA 2IKIA 2CZ5A 4J40A 2ZDSA 1EZ2A 4HJFA 3VIOA 1EJUC 1WA3A 4LGXA 2X8RA 1FHVA 4IF2A 5DG9A 1W54A 1BWVA 1VIZA 3EBVA 3G6VA 2WSYA 1XCXA 3UD6A 1J2BA 2FZ8A 4WD0A 3N3MA 1WP6A 1P4CA 3WD1A 1AW1A 1EC9A 1NIUA 1US0A 2GOUA 4ZB2A 1E6ZA 3TONA 4AY7A 4AVNA 1KFCA 1C9WA 2Z7KA 3NG3A 1TPH1 1DE5A 4AUBA 1H3GA 5T9CE 1TJ1A 2NLYA 3W1NA 4G3IA 5TAOA 1XIJA 3A5VA 1F3TA 1Q8JA 3Q8SB 2WZIA 3T8QA 1UR0A 2RH9A 3DI0A 1BYDA 2B81A 3SUSA 4LEQA 1MXDA 3CWOX 1L2QA 4KEMA 2VEIA 4DJDC 3NM3A 3P8IA 3STPA 3FDKA 4HB7A 1XV8A 3LV6A 5DELA 1ZFJA 2J27A 4JTRA 5IBXA 3QW3A 1REQB 1MMFA 3ARTA 3G1YA 1ZJAA 3RYSA 3O0KA 1UIOA 1F9CA 1LRNA 3GG8A 2PGWA 4F48A 1C91A 3F4NA 3TMQA 4I9AA 5CAKA 1W3LA 3WNKA 4JHZA 1BGGA 3SGGA 2W27A 3AS1A 2YFOA 3VNYA 1F4HA 1KKRA 1AMKA 2JFEX 4M0XA 1CYGA 2FVMA 3GY1A 3Q67A 2QAPA 3W83A 4K39A 2ZZ6A 1W3NA 4D6DA 3DIPA 2OSXA 2I1OA 4ATDA 2O9RA 2XYLA 1JCTA 4PUMA 3QW4B 2V5KA 3THUA 1P0KA 1FX6A 4PEKA 2CLPA 2WHKA 3HG4A 3C86A 7XIMA 3TOYA 1UD5A 3I6RA 1O5KA 4DWDA 4IMDA 1SZFA 5KZMA 3A9IA 3OVGA 1E5NA 4CQDA 2HE5A 1C92A 2PTWA 5LGXA 3N17A 4X9YA 4IJRA 3DZ1A 2J78A 4GQGA 2W9MA 4MVAA 3USBA 3DU0A 2NQ9A 4GC4A 4ZQRA 4B9YA 4GKTA 1U1UA 3WK1A 1JI1A 4XAYA 2RDWA 2Q02A 3WQVA 3CYVA 4ZFMA 1TJPA 2XCAA 5KFVA 4S23A 4FR6A 5LKYA 1S10A 2F61A 4UFIA 1XC4A 3TWAA 3W7GA 3CTTA 2ABAA 1XGDA 3BJFA 4FEZA 4E2DA 4HA4A 4DUWA 2V3FA 3D47A 4Y9AA 4W7UA 4MIMA 2WKGA 2J4GA 2HISA 1C93A 2DV0A 1UR9A 1T3NA 2RUSA 4QWCA 5AC7A 3MBDA 3TMLA 3NXFA 3M43A 4YTSA 1VFFA 3HG5A 4TO8A 1HT6A 1M04A 1IWPA 1LUCB 2X0HA 3ZLHA 3PPCA 1JDDA 2ATLA 1UKOA 1UOZA 2YB1A 4OFCA 1Q2RA 4UOQA 4OUIA 3NEHA 1TV7A 4R34A 1T6MA 4NJJA 3P7YA 3HU7A 4BWLA 5J5DA 2F38A 2FDMA 1TUFA 3MDWA 4MLJA 1TPB1 4ATLA 2DSZA 1IR2A 1KA9F 3ANVA 3ARVA 3GTXA 4KPLA 5BMWA 4MY9A 2PBGA 3IJ7A 1KWGA 3MHGA 3E3HA 1GOMA 3CQHA 3CM4A 1GOWA 3E2RA 3UY8A 3TKFA 6CGTA 5J04A 2AQVA 3KBSA 3T2PA 1QI0A 2AMXA 1J96A 1E4NA 5K9XA 4QDMA 5D8ZA 4OV4A 1GYNA 5G1MA 3V5OA 2FJKA 4GE8A 3FA5A 2PLJA 3MMDA 3KP1A 4DVOA 3LCHA 2C28A 1U5HA 4AEOA 3V7PA 4ECXA 2HVOA 3PR2A 5DXXA 1CWYA 3CUXA 1H09A 5HJYA 2ZBTA 5LZLA 4RUCA 3RR1A 2HQAA 4IL0A 3W75A 3OHAA 7TIMA 3PM6A 2Y0FA 2EAWA 5L1KA 3KVKA 4J9QA 1IT0A 2INZA 2XSAA 1PV8A 4HA3A 3LRLA 3OODA 4IUGA 3EOUA 2DU2A 1PCWA 3TR9A 4V1YA 3A3XA 4OZOA 5G2HA 4C6PA 4LUTB 3UG8A 2DIKA 4QXIA 1T94A 4ED1A 1P43A 3TAKA 1J0IA 3ZVHA 3K30A 2G41A 2ZZ2A 3R7MA 2PDYA 5AHIA 3IVSA 1RPKA 4IPLA 4N7QA 4XZNX 2YW4A 3PR5B 4GY7A 1BGAA 2R94A 5GPRA 2W9CA 2JEFA 1GKPA 4EXBA 1R3QA 2I5GA 2VX5A 3WDQA 5KT4A 4OT7A 3UJSA 1JGIA 1MUMA 4HPGA 3WQDA 1M5WA 2R8GA 4F79A 3ICJA 1XM3A 2OZTA 3GWQA 4IUOA 3CUZA 5A6SA 1WDWA 3NVTA 3IACA 1MQQA 1RPXA 3OSPA 5CJNA 3R13A 3STEA 1EOKA 1C3FA 4RNFA 3K13A 3RO6A 1V93A 2DPEA 5AYIA 2G97A 3O07A 4AF0A 2ZCGA 1M68A 3KHRA 3A5FA 4DM2A 3IVTA 4UTLA 2QS8A 3UW6A 3FXGA 4M7TA 2WVUA 1ADDA 1CXLA 4IP5A 3NM1A 2D2HA 3EWZA 3ALFA 4L4LA 3ISIX 2AL2B 3UZ5A 3E0LA 2A85A 4LRTA 1XYZA 2NT0A 2V8ZA 4MZYA 1KCXA 1Q13A 4DWSA 4F4XA 2ZQ0A 1QASA 1F2JA 1ZGDA 3AIEA 3NURA 4S3BA 1KGXA 3A64A 4YHGA 2I16A 3ZFHA 1EGMA 3MJYA 3VNKA 3LCXA 5HDRA 4PUWA 1XFCA 1F73A 5I78A 3L5LA 2ZUVA 2PWDA 1HF6A 3L4ZA 4ECTA 1W1ZA 3AMGA 1KFJA 3S4TA 4JTDA 3RO8A 1A5AA 2CPUA 5JH1A 4DYKA 2EG8A 1JF5A 2H3BA 4QDPA 3O05A 4MLRA 3CL6A 3VOFA 3UQNA 3GB6A 4WY0B 1MW2A 1V3HA 1S2VA 5CBIA 2BXZA 4O0KA 2EPOA 2Y62A 1FVPA 2PTXA 1XIHA 1XS2A 3WBEA 4Z2IA 3GIKA 3WL1A 1OEPA 5F9NA 2JEJA 2YB4A 1YTDA 2CCRA 3PUGA 2AGPA 1K6AA 1US2A 2DP3A 3OYXA 5FSEC 3ARUA 1R38A 3QPEA 5BU6A 5A8OA 2A2IA 3ABOA 4L65A 4M56A 1RR2A 3LLXA 3SN0A 2W61A 3KOZA 2ZC1A 2PRLA 1FCBA 3VOHA 4YNGA 4UTKA 1GVQA 1Q66A 3MYPA 1FKXA 2WCSA 3EWYA 1ISXA 1Y65A 3EB3A 3UXKA 4ZSTA 3FSUA 2XN1A 4Y9NA 2QV5A 1IR1A 1ZJIA 4UNIA 2D3NA 2GPTA 4D72A 4O10A 3LLFA 2YCIX 1LT8A 3KZSA 4ZO7A 3BSGA 2NXIA 3DYPA 1X38A 4ENLA 4XSMA 4H9TA 4UC5A 2GWNA 2X30A 4CNSA 3B8WA 3M9MB 2G3FA 3BJSA 4FIRA 4JTCA 4GY0A 4DJDA 5A2CA 4S3KA 4WXYA 3NQVA 3MI3A 4AD5A 2XVNA 3GNXA 1UA3A 2H9AA 1L9WA 2PPGA 3SJNA 4LALA 4MM1A 1UKQA 4B5WA 1J5SA 3AUJA 2G8ZA 4ZOEA 5A8QA 3C4UA 4DJEC 4JCLA 1QNVA 4PTXA 5EWGA 1GJPA 3EX6A 1W9XA 4ED2A 4AD2A 4D1IA 5HA7A 2V2DA 5EMMA 3QYQA 1S2WA 3R79A 3EPIA 5CKSA 3UJ2A 4IX0A 2PWFA 4RNJA 3DH7A 1ONWA 4CNUA 5LIKX 1XUUA 1QRQA 1B54A 2GQ3A 2BSLA 2QYGA 4ADUA 1OFAA 2JKPA 2YIHA 3W7IA 2DUZA 3H2FA 1DIKA 4WF7A 3SUWA 5EBUA 1S3TC 3PZOA 3WK3A 2REQB 3KLKA 4ACYA 4DN1A 1I4NA 4JNZA 3GFZA 1JPDX 2QQ6A 4DBWA 3NGJA 3F2BA 3DBPA 1TA3A 1ODZA 1E55A 3H6OA 4GNKB 2WJFA 2ZWZA 4Z2GA 5KFLA 3GH5A 3QY6A 3A4JA 2IPFA 1UBPC 1OC7A 4Y96A 2AOSA 3KHHA 1MO0A 3S47A 3LSCA 1I6NA 3EDEA 1SVDA 1HVQA 3N4AA 1TX0A 4AIUA 3FGCB 3PW2A 5I23A 2D24A 2Z24A 4U3AA 1JAKA 4B3LA 2DZXA 3SQLA 3ONBA 1AZ2A 3EA2A 2WQDA 4O15A 4GGBA 1NELA 1LCOA 5KINA 5I3GA 1BPLB 3B0YA 4GUGA 4NZJA 3AFBA 4HTBA 2WAGA 3GH7A 4OIFA 3BLKA 1U33A 4NAFB 2FHBA 1Y0EA 3A13A 1FDJA 3I3DA 5CPLA 3RCMA 1AA1B 1IEXA 3GU2A 4DO7A 3VCCA 1GVOA 1LG1A 1UWRA 3GBEA 3K8MA 5AECA 3W24A 4WDTA 3QGAC 5CGQA 2Z1KA 1DWHM 3EWWA 1SJCA 1W1IE 2PU1A 4O1EA 4AMCA 4D6HA 3S5ZA 1OINA 2HMCA 5I09A 3CB3A 1PXGA 4B92A 3HTWA 4S3JA 5KFRA 4IP4A 3VKKA 3GDMA 1TE6A 4IG2A 4H8NA 4IM4A 5FI8A 4LRSA 1MXSA 3P93A 3C0JA 5D09A 1O5QA 2BTMA 4FXSA 3P8JA 5KT2A 2JGQA 5C5YA 3E9AA 5I24A 4GJ1A 1XPGA 1EHNA 3PZUA 1V3JA 3VA8A 1YRRA 1UCWA 1V02E 3V6HA 2HE8A 3NQ6A 3OEXA 4FOUA 4K8GA 5HR7A 1JZ8A 1O60A 1OX4A 3PS7A 4QW8A 3ZM8A 4JX4A 3FNDA 4BF5A 2CZFA 1RQBA 5D9NA 3ZWTA 1WAUA 2PWGA 4MJZA 2ASDA 4R88A 1G4PA 5CPOA 3WFLA 5HMSA 4PMDA 2GWGA 4FS1A 4FA3A 5RUBA 1SR9A 1EJ7L 2EG6A 1KM1A 1ZTVA 3HG2A 3B05A 4B5XA 3KUMA 2DFAA 4JIIX 2A21A 3PZ9A 5XIMA 3K4DA 1S97A 3RITA 4DHGA 3G1HA 2VR2A 4XG1A 4GYPA 4W8LA 1N7KA 3EWCA 1OT2A 3A6OA 3W7DA 5CGMA 1WXJA 3N2BA 5AOUA 3U2EA 4YHEA 3V1HA 1ZP4A 2ZA3A 3DFOA 3QV8A 1QPQA 3AYRA 1UBSA 3GVWA 2YDQA 1X97A 2POTA 1K9TA 4S2CA 1KBLA 3JS3A 3EDDA 1TCDA 3HQ1A 3CL8A 1HL9A 2WZEA 2NT1A 3FN9A 4P7QA 1YNQA 5KT6A 3FFSA 1U1JA 2BVTA 2XGPA 4QRNA 3NYZA 4N9DA 1KM4A 3ARWA 4H9XA 4B5SA 1V0LA 3WDIA 1JI2A 4W7VA 3W0KA 3AMDA 3IIZA 3GDKA 4ICMA 5FOOA 1PUDA 1P7TB 4L1GA 5HQEA 4LBSA 3AHXA 3HMCA 4K7VA 2E8ZA 3RXZA 1MW3A 3K4WA 2QNEA 4WGHA 4PFMA 4GZEA 3DUGA 1W2VA 3QJAA 4PUDA 5ECVA 1VR6A 1L6SA 2QR6A 4L1WA 3LXBA 1XGEA 2Z28A 3UP8A 3H7RA 3WQFA 1WQ5A 5C9ZA 1O1ZA 1YQ2A 2J8TA 3EXRA 4ED3A 1JUKA 3V3WA 4WSHA 1E0XA 3LSBA 2WNQA 3BG3A 2D0GA 2I56A 2A7RA 3VGDA 1HKVA 1X8CA 2UVUA 5FF4A 2YOCA 1OFEA 4YLWA 4YCOA 2W9BA 2XISA 4J9MA 4AY1A 3LPOA 4Z1AA 1A50A 1BVWA 3GTIA 3VK5A 2F6KA 3WG6A 4DJDD 1GQLA 4NNCA 3AWOA 1H1NA 2C0AA 4U7CA 1O68A 3W7KA 3S6OA 3JW7A 1UH3A 4CCEA 5LNUA 4H8UA 1Q8AA 2P8CA 1GOQA 4LWWA 1FWGC 3IVUA 3RB3A 1IXNA 1EP3A 3TCEA 3F2DA 3VCRA 3EPOA 4ZOBA 2VCAA 4YN5A 2JEGA 1EC7A 1WE5A 3OHMB 3PPFA 4QTGA 3WBYA 3HQPA 2IBKA 1O1HA 3TSDA 4ADSA 3VI2A 1QAPA 1B4KA 1DXFA 1VFMA 5B7YA 1ME9A 1LUCA 7A3HA 1H7PA 1ZJBA 2J6XA 2OYKA 3TA9A 4JTAA 2Z29A 3NZ1A 2QDEA 3WD2A 4A8NA 4E38A 4GGHA 2Y70A 4NT0A 1HTIA 2G4JA 3VFLA 3WLHA 1HVXA 1XP3A 2RKXA 3N2OA 4IIBA 4DNHA 3QH2A 1BVNP 3WEMA 2HTMA 1MNZA 4FX8A 2Q71A 3MO7A 5A8GA 2XH4A 4L80A 3ERPA 3TYDA 1NDZA 2BLEA 2BXYA 2B4GA 1DV7A 2DZSA 1PEZA 2V3EA 1KV8A 3MUXA 1WDSA 3NDOA 4Y9OA 2YJQA 2PDHA 1WV2A 4PCSA 1LRTA 4M80A 2C15A 4DNMA 1EJXC 1L6WA 3RGTA 3Q58A 3EDKA 3IV3A 4NILA 3M7WA 1W9UA 1K1QA 3CZKA 4B91A 3GILA 4GIAA 1CLVA 3V36A 1RP9A 2Y7FA 3SUUA 1CCWB 4E2BA 2AGTA 1W8SA 1L6FA 1TUXA 4ZMGA 1B9BA 2E6DA 1DHKA 1TJ0A 4PMOA 4RNOA 1UH4A 2I14A 4C6LA 3CAVA 1JRBA 3L2LA 3JVAA 3PZNA 2CZDA 4JTLA 4J9KA 4DJFC 1BEUA 1EF3A 2JE8A 4RDWA 1YNPA 5T9BG 3ZLGA 1CGTA 4DZAA 5TIMA 5DCEA 5ABFB 2JIEA 3TJ4A 1P48A 2WNZA 1K9EA 3H4DA 2XH7A 5DLGA 1QFEA 1E6QM 1YDYA 2YKKA 4TQSA 4IIEA 1RLCL 3NPUA 3VKJA 1R0MA 4Y9PA 4Y6GA 1ECQA 5H2ZA 1SR0A 3JRKA 4DPPA 2OEKA 3SY1A 1LORA 1HNYA 6REQA 1JNEA 4AC1X 5I3FA 3ARPA 5DG8A 5KFXA 3NZQA 4U33A 4JBRA 4V33A 4AFYA 3V35A 5KZ6A 4K68A 4QQUA 4JZ5A 1CIUA 2XFFA 4YVVA 4C90A 2VEGA 3RCNA 1NF7A 4L9YA 1W56A 2QJJA 5L9FA 3CB8A 4X22A 1GVIA 4AF0B 4N42A 5K9DA 3EPGA 3T09A 1LTDA 3QGVA 3QLDA 1JG9A 2ZZ7A 1ZETA 5ABHA 5ENLA 1JDEA 1TFVA 1UD2A 3HFTA 4JTJA 4O4WA 1C9DA 4UFKA 3TWBA 5D02A 4LY8A 3WLKX 5HNRA 1HKWA 5K4XA 3QPYA 1MRAA 1WCGA 1BVZA 4QQ3A 4EBCA 1AJ0A 2QCCA 4X3ZA 2CW6A 2XWEA 1GQIA 2VDIA 3FY1A 3D46A 1KM0A 3CH9A 1OF8A 3B9AA 2O56A 3W29A 2O0TA 4D71A 2VGBA 3BURA 4HZ8A 2WK2A 3SGUA 2NQJA 4IWWA 4OTKA 3KTXA 1XLLA 4ICCX 5C9RA 3N6JA 5BRBA 1HJQA 2CLIA 3MU7A 2VCBA 3KBJA 1OYBA 1KCLA 2UZ9A 1RUSA 2ZUTA 2YCLB 3H21A 2WKJA 1C7SA 2J7CA 1SM9A 5AY7A 4V1XA 1K9DA 3UESA 2DSUA 2PLKA 2E77A 4JN6A 3PP7A 2WZTA 4YVXA 3K1GA 4OOZA 3VMOA 4F0KA 1F8MA 3TDFA 1FHLA 4GH3A 1N8IA 4QS6A 4MUZA 4UIOA 5AYZA 1VCGA 5AZ0A 4EBEA 4MB4A 4N0RA 1F6KA 4QSHA 4MWAC 4JFSA 4EPDC 2VX4A 3EKLA 3CUHA 2JGYA 3AAMA 3NR0A 3DC0A 4JDBA 3GD6A 3GC2A 4PC8A 2A3AA 3I68A 3W7MA 3FX4A 4LF1A 2QPSA 1Y5WA 4BKNA 5KFTA 1E0VA 4DLMA 1XWYA 1EWEA 4J4KA 4TMBA 3OP2A 4GBDA 5DEZA 2OO0A 3CMFA 2E8YA 2ACSA 4R9OA 3B0VC 2TYSA 3AMLA 2QCGA 3QHMA 1WDPA 4JYDA 4ZENA 2F7FA 3G1SA 1S0OA 3QY8A 2DVXA 2VOTA 3VVGA 1KRAC 3RM9A 2OQYA 4CQBA 4URIA 5FCZA 2PF8A 3V4BA 1REQA 1P6CA 1VFSA 1WAWA 2ZX5A 1DJYA 5KFUA 1H5VA 3VGHA 3O15A 4NXSA 4XQ6A 1SFSA 2J13A 1W3IA 3FDSA 2E6FA 4JYFA 1U5VA 1W9PA 4OV9A 4GCAA 1LWIA 4BZYA 1E9LA 1K6WA 2X40A 3W1MA 1BWLA 1QHZA 4PUNA 1SO6A 5A6BD 1HGYA 1UWAA 3SO7A 4F4RA 1FWCC 1RZMA 3PAJA 2OTDA 3ARZA 3SURA 3E2QA 1XSKA 4ALDA 4JEQA 3WH8A 1F3WA 1T99A 4DF0A 1S46A 1V3IA 1NOWA 2J62A 3H23A 3WF1A 4GYKA 3I4KA 1SZRA 2OT1A 3ABQA 3L12A 2VM8A 3NQ7A 5L9XA 2R14A 4IFKB 2XVLA 3CT7A 4NQ1A 4ZR8A 4EEYA 2B7QA 4OKDA 1E71M 1RQEA 4AY8A 3H4GA 2L5HA 4JS3A 3LXCA 1OCJA 2VL4A 3OA3A 2QIWA 2YLAA 2BP1A 4AWTA 2Z25A 5KFYA 4Z08A 3H53A 1WDDA 2PP0A 1Q5MA 3MV01 2E5BA 1PJ9A 2JK2A 4Y8EA 1YYAA 4HU4A 4HJWA 4OE7A 5EL1A 3UWYA 2P53A 4KFNA 2ZXBA 3IAPA 3W6LA 4Z1YA 1YBQA 3AZSA 4JQ1A 1DORA 2GGHA 4R7WA 3BPWA 4D2JA 2O9TA 3O8AA 3A12A 2VFFA 1V3LA 4DI8A 1NOFA 2ZX9A 1XW8A 2HK1A 2BY2A 2WHJA 4OHQA 4M7SA 4XBSA 5A95A 4CN4A 3POHA 1UROA 3L4YA 4NJHA 4EWND 3TYBA 3K1DA 4ECUA 2WPGA 1LL4A 4HP5A 3QC0A 4JUZA 3WQ4A 2GGEA 2GUYA 1XLMA 1KV5A 3BJTA 1E73M 2HXUA 2NX1A 3MFHA 3W38A 1UR8A 5H8PA 5DBUA 1IM4A 1S5TA 4V27A 1UW9A 2VUYA 3U7VA 1XSIA 3IWPA 3P80A 3GVRA 3Q45A 3C0SA 4LV9A 2OWXA 3H4XA 3C52A 2C16A 3FXYA 2PMQA 1YTEA 1QWGA 1KFKA 2ZE0A 2X42A 2VDHA 1K4HA 2BVYA 3TR2A 3KLLA 4MKNA 3SEPA 1WBJA 4HHHA 4PTNA 4LH8A 4UTMA 4MDPA 3EKZA 4WR3A 3W87A 3BWWA 2ZRZA 9XIAA 2C7FA 1I9CB 5CSRA 2Z2AA 4KRUA 3QZ6A 3IGXA 4ZCWA 3KBNA 4GMEA 5ABGA 1SO5A 3XINA 1PIIA 1XIBA 3DG6A 4Q7IA 4LS2A 4GA8A 1M41A 4AXKA 3PULA 4YWIA 4NKCA 1QPNA 3GVQA 2IPJA 2WJDA 3O06A 4KH2A 4PCFA 4HZMA 4UZSA 4M3PA 3MSDA 3SDOA 1K8ZA 1N2VA 2VX7A 4AAJA 1C8VA 1F7BA 1WXYA 2BZNA 1U1HA 1V8EA 5BCAA 4P7RA 1ML1A 5FF0A 2HK0A 5LHEA 4E8DA 1NP2A 2CLOA 2PDUA 4H41A 8CGTA 1I2OA 3U6WA 3CASA 3MT1A 3T0CA 4ERAA 1TYGA 5F1UA 1NDVA 4WDUA 5E9AA 3MZ2A 3LY0A 4GRSA 4JHOA 1W91A 4B5UA 4HOXA 1R30A 3KTSA 4UQEA 4REQB 4I9JA 5HK4A 1EA0A 2HBXA 1OM0A 3R58A 3ZT5A 1PPIA 3G8RA 1PKMA 2Y5JA 4L6OA 4FNUA 3OG2A 1Z42A 3CIVA 3NIYA 3NOEA 2GDUA 4RPPA 2XFRA 3GR8A 2G5WA 3TCSA 3QTPA 2MANA 4QNEA 3DFYA 3N9SA 3MSYA 1VFTA 1E15A 5TNVA 2TSYA 1MDLA 4MAZA 1XLGA 2ANUA 4RV8A 4UCFA 5REQB 2WVTA 4KWWA 5FEWA 3SFWA 3DESA 3W7PA 3DFPA 4CD7A 1LDCA 4R9XA 4J5NA 3NWRA 4ZB0A 4YQWA 3VDCA 3VD4A 5DLCA 3R25A 5I03A 2O92A 4HN8A 3FKKA 4IPIA 2YGYA 1VYSX 3M0HA 3HPFA 4M6QA 3BICA 5E5CA 2P10A 4XAFA 1TTIA 3UZWA 4MJMA 4JL1A 2ZZ4A 4UOJA 4JFTA 3SFKA 3ZSTA 1VCFA 3OGVA 3M5XA 4NX0A 1TRIA 1ZS2A 3PSWA 4BQ3A 1D9EA 2J6TA 2EKGA 1UQYA 5DLFA 4IR9A 2NQZA 4O52A 1E51A 1LRQA 4GH1A 2H8ZA 8XIAA 3C0QA 4JY8A 2P0OA 4MZ1A 3W85A 5K9CA 1BHGA 4UR7A 2BB0A 3DYMA 1DXIA 4I5RA 1TJRA 3MI6A 1Z41A 4E6MA 3UCDA 5D37A 1TPWA 4PMYA 5C2CA 3MR2A 3UA4A 3GDTA 3RX2A 4J1OA 4INFA 2OZ0A 2AU0A 3ARXA 4HIBA 2W7OA 3DEQA 2BHYA 4J3SA 2VEPA 3VUPA 4KRZA 2PGEA 2CU0A 1VS1A 5LGZA 3IIVA 3WQWA 5REQA 3N19B 3DFHA 1OHLA 4Z2HA 2CBJA 2F6XA 4R27A 5HNNA 4FLRA 3TN5A 2V5BA 3EZ4A 4US5D 1UWTA 2Z1BA 2ZYFA 1RP8A 3H22A 3T08A 1VEPA 1NQ6A 3W73A 2ISWA 3OVRA 1EJRC 3C2RA 5AHFA 4Z2KA 2VMFA 3B40A 2EHHA 4RW5A 2QCLA 4GIEA 1QR7A 1S2TA 2J24A 1QI3A 5H8UA 3RPDA 1ZHAA 2BG5A 2PU0A 5LIYX 3GU1A 3O6CA 2HRWA 4FI4A 4KCUA 4LYRA 3HQNA 5C9XA 2GSHA 3UWUA 2CEQA 1K4GA 5E0CA 1PKYA 2INFA 4XZ9A 3RLGA 5FIPA 2VCCA 1HW6A 1FHUA 5KG0A 2BOFX 2A79A 2NSOA 2FZ9A 3W7RA 4H8VA 3IUIA 3U2CA 4XK2A 2DUXA 3JR2A 4F50A 4QG9A 3DHFA 1S5MA 1TMQA 3OIHA 2VZOA 2WVVB 3WNMA 3VGEA 3RNDA 3VYLA 1OC6A 4XZHA 3GIYA 4EP8C 3NGFA 2B7NA 1KBIA 1EKOA 1MNSA 6TAAA 3LGEA 3GV5B 3PF3A 5B80A 3AROA 4IR1A 1P1XA 1RY8A 4LB3A 2QHAA 3N73A 6PTDA 2ZADA 4BR1A 3F7JA 1TQXA 3M44A 3UWQA 3ZXWA 4EYHB 5LYRA 5LIWX 2EF9A 4DAIA 1XDLA 3IEBA 3ZJ7A 3BTNA 3ZWSA 3NQBA 3KOWA 3JU2A 4ORIA 1YLVA 4IIDA 3RLVA 3CZ8A 2BGNE 3E74A 2J7EA 1H5YA 1XD0A 1A5OC 2QZRA 4PRTA 3SCPA 4EX4A 3QV9A 1RYRA 3WBAA 1GEHA 4GYFA 1OZQA 5E09A 3GO2A 3WJXA 3I6TA 3VZXA 1ZCCA 3KOYA 5FAGA 1J6OA 3BARA 3VKDA 1XIFA 2FKPA 1CB7B 1GYMA 4WOZA 2Y7EA 1WKEA 2FTPA 2ZRXA 5EGRA 3A4XA 1AQMA 1IE7C 1THFD 1OCBA 1YXCA 5LHFA 2ZX8A 1BXNA 4ZZ9A 3CUIA 3VABA 3W74A 4CUCA 3ITYA 4K8EA 4B5TA 3OSNA 3U57A 2RHGA 4UCGA 4I6VA 2V67A 3WSUA 3TA6A 2VA2A 2E09A 5EMUA 3URBA 2YW3A 4PMQA 4LT9A 3C5QA 2QDDA 1ZQ5A 5KFIA 3AI0A 1GTHA 1EB3A 1EA9C 3FOKA 4ACZA 4DYJA 1Q3NA 1W5OA 1H11A 4XIAA 5AHLA 1NJJA 3RX3A 1RYSA 4QCFA 1T40A 2PA6A 2WC4A 2O4QA 1XL9A 4TTUA 2YL5A 5BXRA 1H0IA 3VTRA 2VZSA 5HPCA 3P60A 4GPNA 4O1FA 1E1FA 1JR1A 1XR2A 3AISA 3O3RA 1P6BA 2QJHA 2UY5A 4C6OA 1X7FA 2TAAA 4MAVA 1JIBA 3THQA 1CLKA 1W9DM 2GYIA 4H7ZA 4GX8A 3W81A 2P9BA 1JRCA 4MWAA 5HWJA 1NARA 1VH7A 3G6MA 4EAYA 4AYSA 4UXDA 1H50A 4AIBA 3JUGA 4NAEB 4MWAB 4AZGA 3IIOA 1H1YA 2Q3OA 4D8LA 1JD7A 3CS2A 1DJWA 1E4IA 3QR3A 3T8LA 2W6RA 2ZRWA 1Q4WA 3LDVA 2YZRA 2RDTA 4UUIA 1KBJA 5LXEA 3IPWA 5CSUA 2J7HA 4IQLA 4GQRA 1MFUA 3RX4A 4EE9A 4NAFA 2GVLA 2DZPA 3TK7A 3RR4A 3BAKA 2DZTA 5E93A 4LC8A 1AJ2A 1LF1A 1LLWA 2YDAA 2XGBA 4M8UA 4F4YA 1XG3A 2Y4SA 2DZUA 3GVGA 1M3UA 4UTTA 1Z9AA 3N4FA 1ZUAX 1BQGA 3VPLA 4WSJA 2BX7A 2W8LA 4K36A 1J0ZA 1RSCA 4OOUA 4LVDA 1EO7A 1PYFA 2V68A 3LRMA 1E5JA 2A3LA 4LBUA 2PDMA 3VINA 5F4XA 3ANUA 4NYYA 3STCA 3IK2A 1FP8A 4WKFA 3LD5A 4TV5A 4QAIA 3DGBA 1PDYA 1UR1A 4WKAA 1VLIA 5GJMA 3O7UA 5AB3A 2XN2A 3N14A 2E3ZA 1S5NA 3LENA 4EACA 3LM3A 3CQJA 2PDPA 1NQKA 3E0WA 2NV9A 4B2DD 2AMGA 3PTDA 5I07A 4G1NA 1EP2A 3AOFA 1G1YA 5KMYA 4A8RA 2PDXA 4JKKA 5EMJA 1TR9A 3GTFA 4C65A 1U83A 1WDRA 1A3XA 4IP7A 3WNPA 1YIXA 4AHOA 1B2YA 1A5LC 3MR3A 1EL3A 1DJXA 4Q4RA 3TW6A 2FLIA 5M2FX 2P50A 2ZTJA 3EPMA 3GIPA 5FJTA 4ZE5A 2OQHA 3FVMA 4Q6XA 3OHBA 2CXEA 3W71A 4H6KA 1XI3A 1BF2A 3S5OA 1EX1A 1Q6LA 4DZHA 5CBJA 2B0MA 3W7OA 4OQVA 5B7ZA 4WXZA 3BG9A 1C7TA 3MWAA 2WWDA 3C2FA 3BXWA 2E7FA 3MY9A 2QCDA 2VD9A 1PS9A 3B8SA 3M5ZA 2UBPC 4MY8A 3ZT6A 4JV0A 4JOMA 1IEVA 1WKDA 1L8PA 1EUNA 3DXIA 5KFEA 4IPJA 5D38A 3VKBA 1OVDA 1H0GA 1TSIA 3TTOA 3ZR4A 4YXGA 2CNCA 2OLSA 3TUUA 2VJXA 5IXEA 1GQNA 1GVYA 1H62A 3W7CA 2OU4A 1FWRA 2H3DA 3KWSA 4X2PA 2QDHA 5LNVA 4FX7A 4M6PA 1HO4A 2FZMA 4ZVJA 3MUY1 4ERGA 3W84A 4Z17A 4FLQA 3PK7A 3NPWA 3ARYA 3WEOA 5C9WA 1B5TA 4BK9A 3CHVA 4D6GA 1ZAJA 4PFHA 3LHWA 3H2NA 1DWGM 1PL9A 1X8FA 2O4MA 4XKMA 1M03A 3QHOA 4RXFA 4YIWA 4Q4SA 5EMKA 4J9OA 3BAXA 3MMUA 2FGBA 3G5EA 3EOLA 1XYBA 3OB8A 3M0YA 3WBWA 3KVMA 4R53A 3N9KA 1UH2A 3T44A 1NP0A 4P5UA 4Y2WA 1ZAIA 3CEPA 2ZWYA 2IMWP 5PTDA 5DT7A 3R5EA 4AZCA 3ZJKA 3VO0A 4FLOA 4HK5A 3FV9A 2HNHA 1ICPA 2CWNA 5AC6A 1XLDA 4ZGYA 3W1RA 3NSNA 3SSZA 1POJA 3LG3A 5LNWA 3AMCA 4GJJA 3RN6A 1HX0A 3TW7A 4HMNA 3UPMA 4UQBA 4BQ5A 2BOEX 1NWRA 1V03A 2NXGA 4MOZA 2XU2A 4CEUC 4L4OA 4RPQA 4JX6A 4EF8A 1RA5A 1WZAA 4HZ6A 5DGAA 3MO4A 3UU0A 1XIGA 1F6PA 1TJ2A 1FOBA 3EDFA 4AYGA 4M81A 1KLYA 1N55A 4MJ2A 2BV9A 1PTGA 3VMPA 3EB2A 4P8WA 3HURA 1OZMA 2OWCA 5FL1A 3LBMA 3UXAA 4H2CA 4J2PA 2QF8A 4DY1A 1ZPTA 2FVLA 4CCDA 2XZ7A 1N8WA 4DB7A 3NFUA 4NZ5A 2XM2A 3LU2A 1JL8A 3QR1A 1XBXA 4HPJA 4GNVA 4PUJA 1OD0A 5KTLA 4XD5A 2A6LA 3L21A 4PYSA 4GVIA 1GPFA 3A47A 3L65A 4FOKA 1ESWA 3MYOA 3KS5A 1Q7QA 2XIQA 3IJDA 3OGSA 3CV7A 1EHAA 1XYFA 3M1ZA 3WDJA 3PB0A 1BTMA 4NNBA 3DYOA 5JQ9A 3VD5A 1BG4A 4O3OA 3W23A 3P5YA 5T91A 1NFPA 2A3CA 4XZWA 3EXSA 4Q4PA 4FAMA 5DMNA 4QIUA 4GCXA 4XTIA 1RV8A 4RJEA 1VZWA 2PODA 4F3HA 5CPSA 5CPTA 1SYTA 2PWVA 3O63A 2B7PA 5CC6A 4JTTA 2WOQA 3WYZA 2PD5A 4FX6M 2R1KA 4JGDA 3M16A 2YFNA 3W22A 2ZKMX 3SRHA 3P0WA 2XGQA 3AMKA 4J3WA 3WMCA 4UMAA 4P7LA 4D8ZA 2H90A 4IIFA 1ITXA 5LNRA 3OBKA 4H1ZA 2BR0A 1V6VA 3VD7A 1Q6GA 2WW5A 4LVFA 4J9JA 1A0CA 1HL2A 5FEZA 2ODOA 2QJGA 3RG6A 4ZA0A 2RGMA 1W1PA 3QSTA 1MI3A 3PW4A 2VELA 1KFWA 2YX0A 7PTDA 2NVAA 3SBFA 3L2IA 4ZQNA 3RBEA 1XKYA 4FIQA 3TX9A 3DC8A 3FLUA 1LQ0A 5CLWA 3TTSA 1UQZA 1V0NA 3G1XA 1VAHA 1YE6A 1UWUA 3F4CA 1U30A 4HKPA 1B3WA 1E3ZA 5HR6A 1UZ4A 2OSWA 3KOFA 5DG7A 1A80A 2E6AA 3NQ2A 3IIXA 1JXKA 4NU7A 3CUGA 1Q4NX 3RU6A 2F6UA 2VEKA 4JXCA 3SCVA 1A5MC 4FXFA 4V2XA 1JVNA 4U2YA 1HJVA 1SPQA 1Z32X 4MDOA 3RF9A 1KM6A 3LPFA 2AAAA 4DBEA 2FPYA 3QXBA 2VFGA 2VFHA 4YP3A 2GFTA 1KR1A 3GW3A 2QGHA 2WXDM 3II1A 1H7OA 4E8GA 4HD5A 2PEVA 3UR2A 3W7JA 3AJ7A 2GK1B 2CLMA 4KMQA 3PW7A 1QDSA 4QWAA 5L1LA 2H9AB 5KFNA 1RCOB 3LUTA 4F40A 1GHRA 4TXEA 5I7GA 1AQFA 4IOTA 4LYKA 2VENA 3VNLA 4MNMA 1ZLPA 1NEYA 1UZ1A 1PZ3A 3K8LA 5LNSA 1P0BA 1WO2A 3UYCA 3R8GA 2NX3A 4GQQA 3RJXA 2CITA 3MC5A 4DLFA 4CU8A 1JD9A 3ALGA 3BQ6A 1FUYA 3E6EA 3QMTA 1KW1A 3F1QA 4UNKA 2EQDA 3GAKA 2QUUA 4UFHA 2WQPA 3T5LA 2F2KA 5GNZA 2JQXA 3CAWA 4O19A 1ZALA 2R91A 3MP5A 3H2CA 2OT0A 4KCVA 1EDGA 2J8FA 2RFGA 3MKKA 3DHUA 4L9ZA 2D1ZA 2X41A 3TYCA 1B3VA 4HSNA 1EYWA 4LUYA 3EA1A 4AD0A 5TF0A 5IDIA 1BG9A 4O3RA 5FJOA 2PFHA 1ISZA 5C55A 1K8YA 3PN8A 1DVJA 3N1AA 1UJPA 4JV1A 4DUVA 3E5BA 2A7PA 5D33A 5CC3A 2BY3A 3MTWA 5IOBA 3M0KA 1X96A 1B4EA 1JPKA 4C6FA 2C2EA 3TFXA 2Y5EA 1US3A 3CBWA 4IHCA 1XH1A 4H19A 4J9NA 1QW8A 2OVLA 3VZZA 3UGVA 2Z1SA 4YYCA 2FGLA 2E5CA 3P14A 2UVWA 3SCUA 1A47A 4FBUA 4KWUA 4RZ5A 3G0SA 2BHUA 2PSNA 3VNMA 4ONVA 4ZTXA 3BCFA 1SJDA 1XIIA 2V5JA 2GJRA 1TMLA 4NF7A 4ZXOA 5I3IA 3A22A 3ORWA 1J18A 2PDNA 2W62A 2WZHA 5U4NA 3VGFA 2AGOA 4B2DA 3T5KA 3NA8A 1JCXA 3VOGA 4H9ZA 4I8YA 5HMDA 5C5JA 1BKHA 5L1IA 3Q37A 5BYWA 3UR7A 2I5IA 1AG1O 1AVAA 4HYRA 5A2BA 1LLOA 1V6XA 3WDPP 2YDSA 4BI6A 4GACA 4UOZA 1YDNA 4RLIA 4F8XA 3T07A 1UD3A 2EPHA 5D9PA 2V2HA 3U2OA 1NH6A 4LUIA 4O8AA 1XISA 1UWQA 3QC3A 5KG5A 3B0PA 3H55A 1VF8A 4MF4A 2Z6JA 2DQXA 3IJ8A 4R7JA 4ED8A 2PDBA 3BW2A 2I5QA 1QBBA 4DIAA 3UFYA 1OQFA 2VI0A 4AC7C 3EMCA 2ZZ1A 1K1DA 6ALDA 5TBOA 5EKYA 1VBHA 2HVNA 3LA4A 3IUHA 1VC4A 5FJPA 4IX2A 1OCQA 1KKOA 3T7VA 4H6QA 3BW4A 3G18A 4KFPA 4L5ZA 3OBEA 4BHYA 4M51A 3UBPC 5KFBA 3SIZA 2J7FA 4XIMA 1KLZA 4HVXA 2VUNA 3OA5A 3SGZA 2E28A 2G37A 1UWIA 3T0BA 4C6QA 4I8DA 3NQ8A 4UMBA 1A5CA 4QBXA 5HMEA 4MNJA 1K9FA 2GJNA 2WCAA 2PDJA 1D3CA 2PCEA 3ENLA 3DFQA 1Q6CA 3KL3A 1JZ2A 5D2TA 2W0UA 2VC7A 3HPZA 4DBSA 1OWQA 1O4UA 1TMHA 1R86A 8TIMA 3RDKA 4PMNA 3UG3A 1DPMA 2E68A 3AS3A 3LBOA 4BF9A 3G1AA 3NDYA 3FJNA 5CQ1A 3V0TA 1IZKA 1FCVA 4EAMA 3WLSA 1XG4A 4WHBA 1U2YA 2CYGA 1KO0A 1KC7A 4Q33A 2REQA 3WQOA 2OODA 2XINA 1GVEA 5I3KA 4B15A 4LAOA 5FEXA 4IICA 3UJFA 4HMDA 5A6BA 2UWFA 2J66A 1J6PA 1KR0A 2XWDA 1YBQB 4N02A 3VIKA 4JTQA 3WLIA 2G95A 4YU1A 2E6YA 3W70A 2FGZA 2HBVA 3LHTA 2BBFA 3WLPA 3EB4A 2VT0A 1IT7A 4JIQA 1I2PA 5D2XA 5DCBA 1XIMA 4K6AA 3F5KA 1H4PA 3GG1A 4C7FA 4HSOA 2P0IA 1L2UA 1XBVA 2WMIA 3KAOA 3I7QA 3ZR5A 2D69A 4KGLA 3M4HA 1GQJA 1ITCA 3T42A 1TVPA 1Q6OA 2EBNA 3A23A 4YTUA 1AL7A 2X05A 4QE5A 1A5SA 1QNOA 1WYIA 5EA9A 1QNPA 4O1CA 3TTQA 3M0VA 1VJZA 1P5BA 4CGTA 4C1NB 1LP6A 3BAWA 4AVOA 5DMMA 4A3HA 1JF6A 3S83A 3M6YA 1HJSA 2C1GA 4D9PA 4W5ZA 1J12A 4AEEA 3USZA 3PNZA 2E1DA 3DDMA 3LN3A 1NWUA 3G0UA 2QMKA 3GS6A 3GKAA 2WSQA 4BI5A 2Z1XA 4GZIA 3M9OB 1QHPA 2C2DA 3VZYA 2UY4A 4PMRA 3AC0A 3TXZA 3MMWA 2ESCA 1HP5A 1KCZA 2JF6A 3RILA 5I3HA 7ODCA 1GJWA 4QAWA 4W84A 3SRFA 4C6CA 1S38A 1V5XA 4HPNA 4J7RA 2OR2A 2ZUSA 2VR5A 3TC7A 1UP0A 5AHEA 1TV5A 1E6XM 2F84A 1OG0A 1H7WA 2XFWA 4AD4A 2HCVA 2VGIA 4W86A 3L4WA 1A5KC 3CK5A 5G4EA 3OIXA 3OVPA 5T26A 3DG7A 1J01A 1OK6A 4Q22A 4K38A 4Q8TA 2XH2A 4GC3A 1JZ4A 4NIRA 5M5DA 3R6IA 3MKCA 3ARSA 1A3WA 3WF4A 2BMBA 3FEQA 3RPMA 4QWDA 3APTA 5F2LA 4C6JA 3FHAA 3WKZA 4JIEA 3PTKA 2W63A 4GVHA 4UR9A 3PAOA 4BEUA 1MEWA 1AD1A 2G3IA 4QW9A 4AQLA 1ZCOA 4HMEA 3M0ZA 2FPVA 5CZSA 4XX6A 4AISA 4JL2A 3DX5A 4Y9MA 1SW0A 2GVYA 3TLQA 4MYAA 3SRKA 3GGMA 1DEDA 3WQEA 3OZMA 2D2JA 2NWSA 2VWTA 3MUZ1 1FWNA 4ZFCA 3TQVA 4DEZA 1S1RA 4JIRA 3VDAA 1IXPA 1HIZA 4C6EA 5A6LA 4P2VA 3KVLA 4MHBA 1VHNA 3GXFA 4FXJA 4RDZA 1Q63A 4DUOA 1Y5VA 3UNDA 1CNVA 1QBAA 4X60A 3W82A 4LS0A 3KOXA 1GOXA 5D04C 2YA2A 4DELA 5T14A 1LL7A 1SSDA 3SQSA 2V38A 2MNRA 4Q6JA 4GZ7A 1MQRA 2QUTA 5HAOA 2PUZA 1A5BA 3WLTA 1UP2A 3EKGA 5F1VA 3SCNA 4PBFA 4K2SA 4GIRA 4WJ8A 4CD4A 5DCDA 2IPWA 4G8TA 3UZJA 3CYJA 1O66A 4UQCA 4LOCA 1CBGA 5G1TA 2DDXA 1PSCA 2FJUB 1WZMA 2WMIB 1GKRA 1E6NA 2FZBA 3H12A 4PUKA 1KXHA 2ZA2A 3O6YX 1K70A 3M46A 4PR4A 5GVJA 1V3KA 3GC4A 5KG2A 2DUAA 5F2IA 3S9ZA 3BMWA 3N12A 4H6EA 4ZL1A 3PNUA 1MEIA 4PGLA 4FXRA 4KGJA 5KFGA 4HU0A 4NX5A 2D20A 1ONXA 5G4HC 3CWNA 3B8DA 1HJUA 3LTSA 4A29A 4TVCA 3PWGA 1EGVA 1CLXA 4EPKA 4QS5A 2W9BB 5AYYA 1EQPA 1VFUA 2JBMA 2YL8A 3VC6A 3ZT7A 2QMJA 4I7WA 3W2MA 3GYEA 4LUJA 3GG0A 1XLIA 1EBHA 4L64A 5IFPA 2PDFA 1AODA 1F6YA 4G2DA 2YA1A 4U6PA 4RR4A 1FH7A 3W4RA 3WJZA 4PTWA 4O11A 4IPPA 4QEHA 3TQKA 1EYEA 1SW7A 1A5UA 3WLNA 4XD4A 1R8LA 3GIQA 1B3YA 3AQUA 4TUFA 2I17A 3WD3A 1H7NA 2QPUA 1XYCA 4LUSA 1HJXA 3N2MA 3OLEA 2IPGA 1JPIA 4QX4A 3FHQA 3RMJA 4DL5A 1ISVA 4V15A 3UF9A 3CU2A 3HGSA 1TIMA 5D8WA 3E1F1 3C3NA 4HHMA 4ECSA 1MFVA 1D7KA 3AJXA 3LERA 1PTDA 2V6AA 4TVUA 1BD0A 2ZZ3A 4QCEA 4RZRA 3BZGA 2ZICA 4TTGA 3REQB 5FL0A 4NNAA 1QT1A 4G6CA 4H6RA 3H40A 3RAOA 4PB5A 5C2XA 5LXXA 3I4EA 3P2VA 3WD4A 4PODA 3BC9A 3WJYA 3GNDA 3TQ0A 3PY2A 1LOQA 1W5NA 3OLDA 4O0ZA 3GXNA 4MG4A 1R2TA 1QCWA 4JAWA 2BOGX 4G56A 3G22A 3QR0A 4D6EA 5A1AA 3Q2DA 4B9ZA 3T4WA 5JU6A 4U28A 5CC5A 2W91A 1FH8A 3SCRA 3OLGA 1B9ZA 1G01A 1W8GA 2Z2UA 4K8HA 4GG9A 2Q8XA 2VFDA 3CAKA 1R7OA 5EMYA 2BQUA 2ZUUA 1E0UA 1ODUA 4GO8A 4O57A 4LCRA 3T5JA 3P0XA 4KT2A 4DJFA 3AZRA 2R8IA 2AKZA 1DXEA 1TQJA 4QM1A 1GG0A 2DW7A 2FH6A 4JV2A 2IQTA 3OW1A 4H04A 3PPHA 1LL6A 1Q6FA 1O7AA 1X7IA 3M5YA 4LV4A 3RM4A 3QEZA 2WHLA 2OZ8A 3HF3A 1OABA 1V3MA 1JZ6A 1EGZA 1O94A 4XB3A 3F03K 2Y2WA 4Z42C 4O8RA 4GZJA 5I3DA 2PS2A 4ZO9A 2PZNA 4K1WA 4JD4A 1D3GA 1QMLA 4OGZA 1XLCA 2C91A 3PFRA 2NZLA 2OB3A 1KXVA 3LZ5A 1PX8A 1G0CA 3WMLA 1SMDA 3SB0A 2YCLA 1U5JA 3M9YA 3P3BA 5JBEA 4XZBA 3TSMA 2VP8A 4DRSA 2GJPA 1XGZA 4KERA 3U48A 4CD8A 5GNXA 4IJBA 4P61A 1KM2A 3W28A 1JZ3A 2XCPA 1CXHA 2QUNA 3MSGA 3I3BA 4C6DA 1WUEA 3OPSA 4LCSA 3F4VA 3E2VA 4IGHA 5FF2A 3B03A 1UHVA 3QPZA 3DERA 1WXZA 3SY5A 3HN3A 1AK5A 4O3PA 3BAYA 4FNTA 3NNTA 4W5UA 3WMBA 3GZAA 3COTA 3S9IA 1VBUA 2CZEA 5G2WA 2NUYA 1T8XA 2V0TA 1HKKA 1L6YA 3TP4A 5ECUA 2GSJA 5GNYA 1WBHA 1KQZA 4IH3A 4JKLA 3EX2A 4PULA 3VKAA 3BW3A 3M6DA 1GPWA 3H24A 1JDFA 2QCHA 2YA0A 4UFMA 3CC1A 1F3XA 2A1YA 3FK4A 4AX7A 4W93A 2F8QA 4ED7A 3EX1A 3DAQA 2PRMA 2X1IA 2CIPA 1UD6A 4RE2A 2JALA 3STFA 1G9HA 3VXGA 4N9BA 1S5WA 2J6SA 2PTZA 3VIIA 1D7FA 1IF2A 3ZR6A 5KG4A 3TN6A 1K7XA 4MUPA 2CWXA 2R1NA 2D0FA 4GY1A 2NWRA 3TXVA 3ONCA 2X7WA 2DIJA 3UR8A 1FFRA 4ZQOA 4M82A 2BXVA 2KZHA 4LU0A 3TW9A 1QW7A 3H26A 3ITTA 3NQAA 4Y8FA 1ICQA 1JPHA 5HNTA 3C61A 4AZHA 3S2CA 4QLKA 1C29A 1PX3A 6TIMA 5DXYA 1CENA 2DPJA 3HM7A 5C7VA 4QISA 3GHUA 3IRDA 3WQ6A 1GWJA 3W2LA 3AS2A 4GVFA 5D4YA 4GHRA 1W6TA 3G6LA 4KF1A 4F66A 1DQWA 2WSRA 3GBDA 1ME7A 3I10A 1Y5XA 3LV5A 2DZAA 1QOXA 3Q94A 4IIGA 3ZO9A 1WDQA 1SSGA 4AZ5A 4PL1A 5EBAA 5FJJA 4Z2LA 3S2LA 1W0MA 4ZTYA 1ZZMA 2OJPA 3CMJA 1B57A 4LX4A 3W6MA 3H7UA 2FZNA 4YWSA 2E9LA 3G24A 4OBSA 2ALDA 3N25A 4JNYA 4UMCA 2HS8A 4EXAA 1FDZA 3TLLA 3AALA 4NAEA 4O0QA 4R85A 2W8KA 1H61A 3IJLA 3QZ7A 4W7WA 4J27A 1XC6A 2GUBA 3KM8A 3UXIA 1K77A 5CH9A 3URQA 1QNRA 5L6UA 4AIEA 5JH2A 2WVVA 2ZVRA 2FDSA 1NVMA 2OYLA 2P5NA 4R33A 1CPUA 1QATA 3P74A 4D6CA 2Z26A 5HINA 2VX6A 1AZ1A 2OKOA 3VIGA 3G6XA 3GX9A 1KFLA 4FNPA 3G8EA 3LX9A 3IV8A 1G6CA 1ZENA 2RJHA 3FYYA 1AD4A 2PP1A 3S46A 4LCQA 3N18A 4UZUA 3Q8PB 3MP4A 4FHAA 1GVFA 1R3TA 5E0FA 2XIJA 4WKHA 2QUVA 4PMJA 4PMZA 3AIQA 3R0DA 1QNQA 1GQKA 2QW5A 4GFSA 2OPJA 1EPXA 4B90A 2WC7A 4XZIA 3S6DA 1TTPA 2R8JA 2F2HA 1BAGA 4DPQA 5D9MA 3T2OA 1QPRA 2DEPA 1BLIA 4XSLA 4MZ8A 1TV2A 3PZQA 1QI5A 4YL2A 1DE6A 1V7AA 3NGDA 4F0LA 1ISWA 1IHIA 2J25A 1Y8BA 4NXKA 2UVVA 4ZB5A 2ONEA 4US5A 2X0SA 2ZIDA 2J79A 4ZOAA 1BXCA 3H4BA 3UXLA 1VHCA 4LPCA 4I5XA 4LVAA 2CLFA 3KRZA 4S3DA 3WCZA 2VOMA 2R24A 4TR9A 4U3CA 3HV8A 1D2KA 1XSJA 3LGDA 4UQDA 2V3GA 1VBJA 1RJPA 1ZY9A 3LYEA 4XTDA 3SECA 1KBKA 1CGYA 4XZMX 2GQ8A 2ATSA 4JFWA 3K46A 2RAGA 4BQ2A 4N6FA 4Q8MA 4J9RA 3DHDA 3MCNA 3LRKA 4ECYA 1OFDA 4EK7A 3CZGA 3NQEA 1OK4A 3WNNA 4HK6A 1E6RA 3PZMA 2VR4A 2I57A 4WX2A 5HULA 3CT2A 2XTKA 5FESA 2KX9A 3U5YA 4DO5A 1HG3A 4G1KA 5D30A 2J6UA 1EJWC 4H2HA 3G1FA 3CO4A 1HP4A 4G5DA 1JUBA 1K02A 3SCQA 1VIWA 2OZ3A 1FBAA 2C8NA 4WSKA 4HK7A 2FPTA 4MWAD 3QN3A 4JN7A 2TMDA 1BYBA 1CTNA 1LZOA 5HBFA 5JBFA 4O13A 5KT3A 4QNWA 5BRPA 4GI9A 5FF3A 5MKGA 3OO2A 1IEIA 3O0FA 2ZTKA 3MP3A 1EO5A 3C6CA 1JYWA 2YXXA 4M24A 2FHFA 3DN5A 1R87A 2PWEA 5CBBA 3O6DA 1IWAA 2DY3A 4C5YA 4HPHA 3QMSA 4NZ1A 1OX5A 3D3FA 3D0CA 2WVSA 1G5AA 4BFAA 1FWIC 1XH0A 1Z7AA 1E1CA 1FY6A 3BQ1A 3V18A 1J9YA 4QROA 3G77A 4C1NA 1YNYA 3UWZA 5AYXA 5FJIA 5C9UA 2J77A 3VOJA 1DJQA 1K1SA 1IIHA 4DXKA 2YZ5A 3UT0A 4ED0A 2XUCA 3N15A 3PG8A 5IDZA 1C90A 4AZCB 2OKTA 4F4ZA 4D1JA 1JQXA 4AH7A 1VBGA 5EB8A 3RM8A 3RRAA 1GYLA 1XLEA 2R8WA 1R6WA 4DJEA 1M7XA 1C8QA 5CGTA 3S1XA 1S9FA 5BOEA 1WKFA 9RUBA 4ZEPA 5U7SA 1BRLB 4RCXA 5HOSA 5AVNA 4X0NA 1GHSA 2X1TA 2R1PA 3I3EA 3VIJA 5CC7A 1P0NA 1UKPA 5D03A 1GZGA 3MDUA 1IZCA 4NP7A 4ROPA 1TPVA 4M29A 4PUEA 4A05A 2PF0A 4JIHA 3UY7A 5HWMA 1EJSC 3B0XA 3IJ9A 1M7JA 4J3UA 1AUSL 4CQAA 1HO1A 4O3NA 4PTVA 2WV8A 4C1KA 4O12A 1F74A 4NI8A 4ECWA 4AVFA 2GOKA 3N6QA 3LLDA 5EFDA 5HXMA 1W9BM 1MEHA 2IS7A 4H9YA 4DZIA 4ZQMA 3MHFA 3MCMA 6XIAA 4DXXA 4ECQA 2WJEA 3P82A 1DJHA 4MB1A 3GNOA 2Z2BA 4P7OA 5A94A 2PB1A 3EOSA 1CXFA 4GXMA 2Z00A 5IFTA 3UZZA 1S0MA 1BF6A 2ZRUA 3MR5A 4UBPC 3CMGA 3MHUA 3CXOA 3L5MA 4OUEA 4DWSB 8RUCA 1H7XA 2FFIA 3PBYA 4ERIA 3KS6A 4P8VA 4KKXA 2PGRA 2YCKX 1IQ8A 3AICA 3HG3A 2CLEA 3RK8A 3LPGA 2AQWA 1YE4A 1L8NA 1XLHA 1TV3A 3NSMA 4TV6A 4DL6A 2VRKA 3BQ0A 2ZDRA 2CLHA 3QFWA 5KFAA 4HA1A 5XINA 3ATZA 4C6KA 3AIVA 4GJIA 2GVEA 3ZS4A 1XLJA 1T5AA 3E2SA 4HNVA 3O6AA 3W2NA 1TWIA 4IQDA 5BOFA 1XRFA 3RAQA 4CVUA 4IIHA 4NRRA 4IQEA 2ZE3A 3E0FA 1I2NA 1VQTA 3G1RA 2XGIA 4WCJA 2OOFA 4H4IA 4GINA 3W1QA 4JY9A 4FB7A 4I7UA 3UNTA 3W1AA 4XAZA 4I90A 4MYXA 3GXDA 3LPPA 4PCTA 3NO1A 3CHEA 3CIXA 4IMEA 3LNMA 3S5SA 5K7JA 3WUBA 4DI9A 4K7YA 3CHFA 4BY3A 4DBUA 4JN8A 4G7EB 1TCMA 3UERA 1QOPA 3P81A 2P88A 2P3ZA 1Q65A 3FW6A 4BWLC 1N48A 3EA3A 4NJGA 2FH8A 3VGBA 3WH9A 2HSAA 4DZ5A 1RY0A 2JIWA 3H2MA 2DORA 5LA0A 2NQHA 4GFIA 2AQOA 1E9YB 3GAYA 4HT3A 2YBUA 5A2AA 3L23A 4DEFA 1GORA 1R2RA 3T2QA 3L7RA 5CSSA 2QF7A 4LEFA 3LB0A 2ALRA 1JFHA 3CIWA 1K8XA 2FFCA 4MKSA 4QR6A 1XRTA 2PRHA 4C1LA 4GVGA 1S5VA 4JFUA 3B8VA 4YTQA 1GOKA 2XPKA 3O16A 1PZ0A 2HV5A 4HU8A 1K03A 4DXVA 5FKYA 3N4EA 4FO4A 3S8HA 1BWKA 3WLLA 2X2YA 4MMWA 4IFOA 4YPJA 1DJZA 1M1BA 4C6MA 2WSPA 4DX3A 5CAHA 4S3EA 3WH7A 1SMAA 4FBTA 4N9EA 2BNJA 3IUDA 4RZBA 1FXPA 1NDWA 1OD8A 3L2MA 1ZB5A 1QWKA 2OO6A 4L9XA 2VA3A 5DQIA 2W92A 1OT1A 1UOKA 4QP0A 4KFOA 3I7RA 2OLHA 4WJXA 4XV0A 3TYZA 4O14A 4F0SA 4XBJA 5CLTA 2ZXQA 1Q85A 1ONRA 3O9NA 3TTYA 1HKMA 4PRRA 4C6BA 1FWHC 1PIFA 5CJMA 2WMGA 2CKRA 5H91A 1DJIA 4FS2A 5FA5A 3VNZA 1H60A 1CXKA 2QDGA 3KBVA 2A4AA 1W5MA 2HZGA 1J11A 4IGMA 1TKKA 1DP0A 3MUCA 4O1AA 4IMCA 4JDYA 2DSWA 3BGAA 3W07A 1I2RA 3DECA 3MQTA 4CD5A 1IYXA 5AYBA 3L66A 2V5DA 4BQ4A 3RJYA 4QJ1A 4FMVA 4NG3A 4MTVA 1R47A 4Q44A 2HWGA 4XKYB 1WZKA 1FWAC 3QOMA 3SR7A 4XZLX 4H9MA 1KRMA 4WEVX 2V3DA 3UA3A 1YPXA 5BROA 2BQRA 3V6KA 2E40A 3V16A 5D2WA 2WMFA 1PTAA 3KHLA 2GGGA 3PR4A 5A6JA 1SZEA 5I02A 4KQNA 1NFGA 3PTQA 1NOUA 3UWWA 1NDYA 1HUVA 4HOZA 4ML9A 1TTJA 3GR4A 2BHZA 4HNCA 3UYIA 3AUOA 3GQCA 3ABZA 3EOOA 5HANA 2J7DA 1QI4A 4H8HA 3KW3A 5CZKA 1E56A 2IXVA 2TPSA 2UY2A 4WVXA 2BASA 3B0UX 4OJYA 2NV1A 4C91A 3STGA 1G4TA 5IHRA 4GBUA 1XLAA 2WMJA 3UR5A 4G7FA 3EX4A 4UFLA 1VPXA 5AC5A 1CB2A 4E3VA 4XAPA 1XKJA 2AKMA 3TQPA 5MHBA 1B0IA 2XSXA 1OIFA 4W4QA 2OFJA 4QWBA 1FRBA 5KG7A 2KAUC 4F4WA 2J88A 2VZTA 3AYTA 4JTEA 1YEYA 2X16A 5FD0A 4MWAE 4HNUA 2R82A 3VDGA 5I0DA 1V79A 3TE9A 4UTJA 1JX4A 1DKWA 2V82A 1V51A 1X6UA 1LG2A 1M9HA 4J9SA 4E8CA 4IMGA 3FSTA 1K7EA 1QPOA 3BLOA 1RCQA 3NOYA 1RA0A 1LLZA 1FWBC 2PTDA 3PTMA 4Q8EA 3KX6A 1MUCA 4JTGA 5DANA 1NF0A 3AXIA 3ZJ6A 3HB9A 4FOJA 3ZIZA 3BLIA 3N2CA 2DT2A 2P8BA 2ISDA 3L5AA 1UUQA 5C0QA 1V6UA 1PWLA 1B31A 1F5ZA 2QXWA 4LVGA 1GVSA 3V5CA 3SSJA 4QJ5B 1K8CA 1VPYA 1W31A 2GGIA 3A3HA 1VRXA 3LK6A 1KGUA 4ECRA 5EMLA 3WO8A 1HQTA 4E4PA 1QO5A 2CLLA 2W9CB 1KTNA 3C8NA 5T8GA 3SW6A 4LAKA 2XVGA 4M6UA 3W3OA 3ZMRA 1K3UA 3RBDA 4GISA 5A3HA 2HDJA 2PDQA 3T0DA 3QQ0A 3JZEA 1QK2A 4ORMA 1PBGA 3PBMA 4LANA 4GOAA 5KFKA 3MW7A 3PBWA 3WELA 2A3BA 4C60A 4KEZA 2CBIA 4BJHA 4N4PA 3UVAA 3T9PA 1UC5A 4B3ZA 4PRWA 1TPUA 5DO8A 4ICNA 4O17A 3GSMA 2EO7A 1G4SA 1T96A 5KETA 1CGUA 3N3TA 3PWIA 1B1YA 2BVWA 4PH6A 2NVDA 4Z1CA 5I5RA 3V6JA 1A3HA 4X0VA 4TX8A 3T0AA 4O16A 1JULA 4S3FA 3WX7A 4YR2A 1HJWA 4AEFA 4N4QA 1MQPA 2D0HA 4Q3MA 3CTLA 1J79A 1OFOA 4AZBA 1QUMA 3HPXA 1E0TA 5DBTA 4GQ0A 4RX0A 4TU1A 2VZVA 1VFOA 2NQ5A 3U8GA 3Q4DA 4QDWA 1W3TA 1VYPX 1VGAA 1GK8A 3WH5A 1EBGA 1S0NA 4NUWA 2HXTA 1BSIA 1KTCA 1SO4A 4O54A 4LXFA 3ATYA 4Z2JA 4IGSA 3MA8A 5CXPA 3NTYA 2PDCA 1VLWA 2IKJA 2PP3A 2X1SA 4IFKA 5BWAA 1H2JA 4JKMA 3IARA 2FB3A 1FCUA 5A8PA 2JF7A 4YTTA 1UP3A 4REQA 3M7SA 4DJFD 2R8HA 5G4WA 4ECZA 2GGJA 4H3DA 1L6GA 4RNNA 2ISSA 3IS4A 5LA2A 4O4VA 3UG5A 4DL4A 5K2ZA 1XCFA 5EPDA 5F7UA 2ISVA 1FHDA 1A0DA 4ZQCA 3PHAA 3WL0A 3PBUA 1ZBKA 1TB3A 5JXQA 4ILSA 4IQJA 4CLMA 3FJ4A 3KXQA 3UWVA 3WK0A 2IQ0A 1ZJHA 3AHYA 1H1ZA 5D2VA 1EP1A 1Q6RA 1JIHA 4PMVA 3NEVA 4KIEA 4Q45A 2NVCA 3CO8A 4KRTA 4UTWC 4LUSB 3B8UA 3C2EA 5C71A 1ITQA 4QE4A 5JUMA 3VNJA 2C14A 1R3WA 4A8LA 1UC4A 3S1UA 5KITA 4L4MA 3E5PA 4JQ3A 4DO4A 3KTCA 4I9MA 4HYKA 1X1OA 6ENLA 1E0WA 3BV7A 1XDJA 3D6NA 1EFZA 3G1DA 2DGAA 3UEQA 3BSHA 5DRCA 1I1XA 2G3JA 2OEMA 2CETA 1UPPA 3SZ8A 4TX6A 4CU6A 1OGBA 1UD8A 2RDJA 1IXQA 2QLYA 3NQCA 3SQMA 3AZTA 3AXHA 3IN5A 2J9YA 3CQIA 5HMFA 1FXQA 1RAKA 2QULA 2YL9A 1CDGA 3Q8QB 1YXYA 1TRDA 3F2CA 1J0KA 1LBMA 5KG6A 4D6JA 3H70A 2P3EA 4EVZA 2CKSA 3TV8A 3LQGA 3W00A 1G67A 2HS6A 3ZJ8A 3P62A 3GU9A 2CHOA 3G1VA 2J75A 3ARRA 1GNXA 1W1TA 2ADAA 1N56A 2EEXA 4Y90A 1WUFA 4AWEA 3KHGA 4O1BA 5CG0A 3PANA 2G3MA 4M1RA 3RIKA 5HJLA 3P6LA 3HZ3A 2EXOA 3QZ8A 3AWNA 1ZRQA 2E1WA 4CQCA 3B8TA 5ABEA 3P5ZA 3M47A 1CECA 4PSPA 4XBKA 3QRHA 4A6GA 3VFCA 5I3JA 2J7GA 4I6KA 4B3KA 2FQIA 3TEVA 2DZWA 4A2RA 1TPFA 3GDLA 1NY1A 2C6QA 3LZ3A 1QNSA 4AWSA 1ZBCA 1UR3M 1P6WA 1B30A 3ECQA 6XIMA 1W5PA 3F5JA 5ABFA 3GIIA 1Q7MA 2WMHA 1JCNA 1I75A 4L6HA 4MPKA 1JQVA 4WDWA 3AYVA 5KFSA 2DSKA 4O53A 4L56A 4FNSA 1D3HA 4XVEA 2C19A 3FYPA 3TYUA 5EWFA 4GLEA 3TQ1A 3SUTA 1IXOA 4U5IA 4IRDA 4GWEA 2DVTA 3OG3A 3NQDA 4FPSA 1TPC1 1ITUA 2ABBA 3APGA 2XHYA 3Q65A 1I1WA 3LI0A 4QJ4B 2XZ9A 3FJLA 3BV4A 1XHGA 4AW7A 2NXHA 5FJRA 5C70A 2C1HA 4GKLA 3PVXA 5AC4A 2X0YA 3VMNA 3CPUA 3R11A 1UZDA 2V63A 5KFDA 4FNRA 1TV8A 1TREA 2DIEA 2AQ4A 4X61A 4HMCA 2DQWA 1SUXA 1OIMA 1XD1A 2NV2A 3N13A 4EPBC 1DOSA 3GE7A 4NJKA 4X2RA 3VOCA 3R89A 2XH0A 4NZFA 3CZEA 2PWUA 3BH4A 3ZOAA 3W2UA 1YADA 2OCZA 4RXGA 4MADA 1YHTA 5AKQA 4LBRA 4RUAA 4CNOA 3L68A 2E4TA 1FWDC 3L67A 2WO5A 3EMZA 2F9RA 4AZ7A 2R1MA 4GX9A 4FALA 4R8UB 4O18A 4LAZA 2AGKA 2ZX7A 3BQ2A 4AB4A 4J3VA 2BGQA 2PZ0A 2ACQA 1P0DA 3VCNA 2QUMA 3RU8X 4E4UA 2VKZG 3R1ZA 2VC6A 4GD0A 1E72M 4YVPA 3PUEA 1R85A 1Y7VA 4QWEA 2ZUMA 4WGXA 3GDRA 1J0JA 2QIIA 3NZRA 3A4WA 4WK9A 4A21A 3R8HA 3TC6A 3FA3A 5LA1A 3KRUA 3FIGA 2FVKA 2QAFA 3ELFA 1GKQA 2Y88A 3BK0A 4QITA 2I9EA 1DIDA 3P67A 1RD5A 1UUMA 2DSVA 3VIPA