2Z01A

Crystal structure of phosphoribosylaminoimidazole synthetase from geobacillus kaustophilus
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
326
structure length
313
Chain Sequence
b'QAVALMKEHVQKTMRPEVLGGGLFDLSALGYRQPVLISGTDGVGTKLKLAFLLDRHDTIGIDCVAMCVNDIIVQGAEPLFFLDYIACGKAVPEKIAAIVKGVADGCVEAGCALIGGETAEEYDLAGFAVGVAEKERLITGETIQAGDALVGLPSSGLHSNGYSLVRRIVFEQAKLSLDEIYEPLDVPLGEELLKPTRIYAKLLRSVRERFTIKGMAHITGGGLIENIPRMLPPGIGARIQLGSWPILPIFDFLREKGSLEEEEMFSVFNMGIGLVLAVSPETAAPLVEWLSERGEPAYIIGEVAKGAGVSFAG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphoribosylformylglycinamidine cyclo-ligase
molecule tags Ligase
source organism Geobacillus kaustophilus
publication title Crystal structures and ligand binding of PurM proteins from Thermus thermophilus and Geobacillus kaustophilus
pubmed doi rcsb
total genus 86
structure length 313
sequence length 326
ec nomenclature ec 6.3.3.1: Phosphoribosylformylglycinamidine cyclo-ligase.
pdb deposition date 2007-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00586 AIRS AIR synthase related protein, N-terminal domain
A PF02769 AIRS_C AIR synthase related protein, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.10 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; PurM-like, N-terminal domain 2z01A01
3.90.650.10 Alpha Beta Alpha-Beta Complex Phosphoribosyl-aminoimidazole Synthetase; Chain A, domain 2 PurM-like C-terminal domain 2z01A02
2HS0A 3C9SA 2HS4A 3WJPA 2HS3A 3VYTC 2Z1TA 3P4EA 2Z01A 5AVMA 3VYSC 3MDOA 3WJQA 3M84A 2BTUA 3D54A 3VYUC 1VQVA 2Z1EA 3C9TA 2V9YA 2Z1FA 2I6RA 2ZAUA 3QTYA 2Z1UA 2HRUA 3VTIC 3U0OA 1VK3A 2RB9A 2ZODA 2HRYA 3FD5A 3WJRA 3VIUA 2YYEA 3MCQA 3C9UA 2YXZA 3FD6A 1CLIA 3KIZA 3C9RA
chains in the Genus database with same CATH superfamily
3JASA 2KTUA 5HWEA 1YI2F 2FGYA 3NVKE 4M8IA 2UYJA 5LP6B 4DXDA 4DRXB 4LCKA 3HKEB 4RQOA 5JH7A 2RHOA 5GINC 1KD1H 2HQSC 1VQPF 2GVIA 4TUYA 5LOVB 1JN1A 3CC7F 3S0HA 3LWVC 3UT5A 3IKEA 3E1YA 3N2KB 3F0EA 2H6LA 1E7KA 3KJJA 3C9UA 3N2KA 5MN4A 2LBTA 3CXCF 5LXTA 4O4LB 5CB4B 4U3JB 4X3MA 4I55B 1W5BA 3JCMM 2PHNA 5J2UA 3P0ZA 3GTZA 3V3TA 5FLXM 1YHQF 3CYPB 4E6EA 3VOAA 4I4TB 4F6RA 5JQGA 1X25A 2ZVZA 3F0FA 3NK7A 4KWEA 1JFFB 1Q7YH 3O85A 2ZODA 3T80A 2Q1YA 1K73H 5HY4A 5ITZB 3D01A 5IJ9B 4TZZA 3JATA 5G4UC 5JVDB 2VGMA 4EI9A 3HKBA 3FFMA 3MCAB 4O4JA 3RA6A 5ITZA 2KTVA 2Z01A 2QA4F 3VYSC 3B6NA 1XHOA 3M84A 3MBMA 1T0AA 4EB6B 1W5AA 2EWCA 1IV2A 4FFBB 1VQOF 4YJ3B 4IHJA 1VQNF 1KC8H 3IEWA 2RB9A 4IHJB 3V7QA 1RLGA 5HXZA 3JVHA 3TD3A 1S72F 4O4IB 5IJ0B 3R0PA 2CSLA 3LWRC 2H8CA 4O2BA 1FSZA 4O4JB 2OHWA 4BT7A 1VQ9F 5LOVA 1IV3A 2R6R1 1OFUA 1T0KB 3CPWF 3JARA 3K0TA 4G88A 2P6YA 5EB0A 5CA1A 4C4WC 3LFOA 4X3LA 1YIJF 5EYPA 1YGYA 1W55A 2CWJA 3CPQA 4I4TA 4F6RB 2JNBA 1PXWA 3I7TA 3P4EA 1X7OA 3D00A 2B33A 4BVSA 3WGNA 1QVFF 3CD6F 4C8IA 3JAMM 4O4LA 1YQNA 4U39A 5EAZA 5BMVA 3QTYA 3KJKA 5IJ9A 3CCSF 4BT3A 5J2TB 1SDSA 5DCVA 2R751 4X1YA 3U0OA 2IG8A 4LNUB 1JD1A 1QVGF 3FD5A 3P10A 4BW0B 3K12A 4ZOLB 3NK6A 1W5FA 3HKCB 2DYYA 3GYQA 3N2GA 3TD5A 3UT5B 4C8EA 4ERHA 5G4VC 2QI2A 3CMAF 4I50B 3CMEF 4XCQA 2RHHA 5FNVA 3WXMB 3I55F 1YJWF 3HKCA 3N2GB 4LNUA 5LP6A 4ZOLA 5B8FA 5EZYB 4FFBA 1VQKF 3HTNA 2OTMA 2UYKA 3KE1A 1GZ0A 4TV9A 1RQ2A 1JY8A 1U43A 3ZP7A 4B45A 1Q81H 1XV2A 4C82A 3Q8HA 4X1KB 4G4WA 2OTJF 3RYIA 1J7HA 3RYFA 3F0DA 3CC4F 3JAWA 3CCMF 4ZI7A 4BT5A 2I6DA 5FNVB 1OAPA 2CVLA 3K14A 3S0YA 3CCUF 3WGJA 4B46A 3C9TA 1VQ4F 3OBYA 3VOBA 4EI7A 1H48A 4ZHVA 2ZOVA 3C8LA 4TV8A 2AIFA 5A2QM 3VTIC 1GX1A 5GIOC 2HRYA 1IV4A 3VMFB 3WJRA 5LYJB 1U40A 2H8EA 4RHAA 5IYZB 4IIJA 5EIBD 3J80M 2RHJA 2VXYA 3ON1A 4NWOB 3RYCB 1W581 1W40A 3LWQC 4ZHYB 4NUTA 5HY1A 2K1SA 4O4IA 5FJ4C 2GLZA 3CCLF 1XBIA 5KX5A 3G6EF 1Q8RA 2NMUA 1SA0B 5IT9M 3FPIA 1W57A 2ZF8A 3VI6A 3HWUA 3RYHB 2HP3A 4YJ3A 1VHAA 2DT4A 1QU9A 3SIUA 1TUBB 3K2XA 4BT2A 3M4SA 4O4HB 1SA0A 3IR9A 4ZK7A 2YYEA 5LA6B 3MCQA 3N4YA 2W8BC 1W2BF 3CCJF 3FD6A 2HP0A 1SZQA 3OW2F 3JARB 4WBNA 3IMPA 5JCOC 2LCAA 3WJQA 4O2AA 2BTUA 3D54A 5LA6A 4G4YA 2HP0B 1CK2A 1K9MH 1Z5VA 4X1IB 1Z5WA 2G9IA 5C8YB 2VAWA 3TD4A 2BO1A 2IAFA 1N8RH 3NMUC 4ZHQA 1H7MA 1NMUB 2UYNA 3BYQA 3F0GA 4I55A 4X20A 5J2UB 4G4VA 3LWOC 3HKDA 2UYNB 5GONA 3I56F 4ZHQB 3S06A 2QEXF 3PLAC 2ZVYA 1W59A 5LXTB 3VYUC 3S02A 1IV1A 2CHTA 3L7QA 4BT6A 1NJIH 3RYIB 1DBFA 1X52A 2Z1FA 1VQLF 1W42A 5GAPK 4TUYB 1KQSF 3HKBB 3HKEA 5HY0A 5JH7B 2QTPA 3CC2F 1W41A 1GO0A 5EB1B 1R1MA 1VQ8F 3VIUA 2L26A 3I3FA 2CHSA 1JFFA 5EZYA 3VCZA 1CLIA 3KIZA 3C9RA 3VYTC 2Z1TA 4G4ZA 1QAHA 2KGWA 5KX5B 4BVTA 5EIBC 3VO8A 3RYFB 1W3EX 3IKFA 2ZAUA 1TVKB 3E22B 1M90H 2BTOA 3RYCA 1FNKA 4EI8A 4NQ3A 2VAMA 2OTLF 1UFYA 2GZLA 3ESJA 4C81A 5GANK 4HNAB 3EORA 1CN7A 3KHNA 5CA0B 2F9ZC 3DC2A 5LP6C 1COMA 2HS0A 2BTQB 3LMEA 4I50A 2FC3A 4ZHWA 3WGLA 2RHLA 4X1IA 2IQQA 2AIZP 2V9YA 4ZI7B 1W5EA 3CYQA 2Q1XA 3GHZA 3JASB 3PAFA 4BT4A 2HRUA 3S0WA 5HP7A 4BVRA 3CG6A 4O2AB 1U3LA 4WBNB 1KNJA 5JVDA 3FBAA 3SIVA 3ELCA 1NQ3A 5GIPC 4O4HA 3QHDA 2AMTA 3DDNA 2HS4A 1RQ7A 3AGKA 3IEQA 3RYHA 3MDOA 4TV9B 3N4ZA 1GO1A 1VQVA 3G4SF 5JQGB 3HJWC 2KG4A 2CW4A 5GONB 2I6RA 2LBWA 3E20B 4R40B 4X20B 3J7AR 1M1KH 1VK3A 4BY9D 1XRGA 5CA0A 3JALA 3JAKB 3M1XA 1JJ2F 5C8YA 2UYPA 1YJ9F 1RLUA 1U3PA 3JALB 2UZHA 5JCOA 2WALA 5J2TA 1VH8A 2HS3A 5HP8A 4X1YB 4B5CA 4TV8B 4O2BB 3JAKA 1TVKA 3E22A 3HKDB 3ZOPA 3CCQF 3ZO8A 3WGKA 4C8GA 3CCEF 2Z1UA 1FFXB 3F6MA 1Q82H 2HX0A 3MQWA 1YITF 1UI9A 5EWRA 4BVQA 3OONA 3WPWA 3LWPC 1RA4A 3G71F 5EYPB 2CZWA 3WPXA 2YXZA 4EB6A 3HAXD 1KNKA 5HXUA 3CCRF 1ZWZA 2PMPA 4G4XA 3C9SA 1FFXA 3CCVF 2ALEA 5CB4A 1DT9A 1QD9A 3V4DA 2Z1EA 5EO3A 3ZP4A 1ODEA 5LYJA 5MN6A 5MN5A 3ERNA 4IIJB 1ONIA 2VAPA 1PF5A 2VGNA 1FNJA 1H47A 1TUBA 2LBXA 5IJ0A 1Q86H 1VQ6F 3J81M 4U3JA 4DRXA 3S03A 3WJPA 4PWTA 4HNAA 5AVMA 5BMVB 3LDTA 1YJNF 3WGMA 1X7PA 5HY2A 4B62A 1VQ5F 3JAWB 5IYZA 1IPAA 5KMGB 2OZBA 3RA5A 3LYBA 4YJ2A 3QUWA 2MQEA 4X1KA 4YJ2B 3JATB 1VQMF 1K8AH 2HVYD 5KMGA 3V7EA 3RE3A 3CB2A 3NVIB 3OBWA 5CA1B 1VQ7F 2N48A
chains in the Genus database with same CATH topology
2HS0A 3C9SA 2HS4A 3WJPA 2HS3A 3VYTC 2Z1TA 3P4EA 2Z01A 5AVMA 3VYSC 3MDOA 3WJQA 3M84A 2BTUA 3D54A 3VYUC 1VQVA 2Z1EA 3C9TA 2V9YA 2Z1FA 2I6RA 2ZAUA 3QTYA 2Z1UA 2HRUA 3VTIC 3U0OA 1VK3A 2RB9A 2ZODA 2HRYA 3FD5A 3WJRA 3VIUA 2YYEA 3MCQA 3C9UA 2YXZA 3FD6A 1CLIA 3KIZA 3C9RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HS0 A;  3C9S A;  2HS4 A;  3WJP A;  2HS3 A;  3VYT C;  2Z1T A;  3P4E A;  2Z01 A;  5AVM A;  3VYS C;  3MDO A;  3WJQ A;  3M84 A;  2BTU A;  3D54 A;  3VYU C;  1VQV A;  2Z1E A;  3C9T A;  2V9Y A;  2Z1F A;  2I6R A;  2ZAU A;  3QTY A;  2Z1U A;  2HRU A;  3VTI C;  3U0O A;  1VK3 A;  2RB9 A;  2ZOD A;  2HRY A;  3FD5 A;  3WJR A;  3VIU A;  2YYE A;  3MCQ A;  3C9U A;  2YXZ A;  3FD6 A;  1CLI A;  3KIZ A;  3C9R A; 
#chains in the Genus database with same CATH topology
 3JAS A;  2KTU A;  5HWE A;  1YI2 F;  2FGY A;  3NVK E;  4M8I A;  2UYJ A;  5LP6 B;  4DXD A;  4DRX B;  4LCK A;  3HKE B;  4RQO A;  5JH7 A;  2RHO A;  5GIN C;  1KD1 H;  2HQS C;  1VQP F;  2GVI A;  4TUY A;  5LOV B;  1JN1 A;  3CC7 F;  3S0H A;  3LWV C;  3UT5 A;  3IKE A;  3E1Y A;  3N2K B;  3F0E A;  2H6L A;  1E7K A;  3KJJ A;  3C9U A;  3N2K A;  5MN4 A;  2LBT A;  3CXC F;  5LXT A;  4O4L B;  5CB4 B;  4U3J B;  4X3M A;  4I55 B;  1W5B A;  3JCM M;  2PHN A;  5J2U A;  3P0Z A;  3GTZ A;  3V3T A;  5FLX M;  1YHQ F;  3CYP B;  4E6E A;  3VOA A;  4I4T B;  4F6R A;  5JQG A;  1X25 A;  2ZVZ A;  3F0F A;  3NK7 A;  4KWE A;  1JFF B;  1Q7Y H;  3O85 A;  2ZOD A;  3T80 A;  2Q1Y A;  1K73 H;  5HY4 A;  5ITZ B;  3D01 A;  5IJ9 B;  4TZZ A;  3JAT A;  5G4U C;  5JVD B;  2VGM A;  4EI9 A;  3HKB A;  3FFM A;  3MCA B;  4O4J A;  3RA6 A;  5ITZ A;  2KTV A;  2Z01 A;  2QA4 F;  3VYS C;  3B6N A;  1XHO A;  3M84 A;  3MBM A;  1T0A A;  4EB6 B;  1W5A A;  2EWC A;  1IV2 A;  4FFB B;  1VQO F;  4YJ3 B;  4IHJ A;  1VQN F;  1KC8 H;  3IEW A;  2RB9 A;  4IHJ B;  3V7Q A;  1RLG A;  5HXZ A;  3JVH A;  3TD3 A;  1S72 F;  4O4I B;  5IJ0 B;  3R0P A;  2CSL A;  3LWR C;  2H8C A;  4O2B A;  1FSZ A;  4O4J B;  2OHW A;  4BT7 A;  1VQ9 F;  5LOV A;  1IV3 A;  2R6R 1;  1OFU A;  1T0K B;  3CPW F;  3JAR A;  3K0T A;  4G88 A;  2P6Y A;  5EB0 A;  5CA1 A;  4C4W C;  3LFO A;  4X3L A;  1YIJ F;  5EYP A;  1YGY A;  1W55 A;  2CWJ A;  3CPQ A;  4I4T A;  4F6R B;  2JNB A;  1PXW A;  3I7T A;  3P4E A;  1X7O A;  3D00 A;  2B33 A;  4BVS A;  3WGN A;  1QVF F;  3CD6 F;  4C8I A;  3JAM M;  4O4L A;  1YQN A;  4U39 A;  5EAZ A;  5BMV A;  3QTY A;  3KJK A;  5IJ9 A;  3CCS F;  4BT3 A;  5J2T B;  1SDS A;  5DCV A;  2R75 1;  4X1Y A;  3U0O A;  2IG8 A;  4LNU B;  1JD1 A;  1QVG F;  3FD5 A;  3P10 A;  4BW0 B;  3K12 A;  4ZOL B;  3NK6 A;  1W5F A;  3HKC B;  2DYY A;  3GYQ A;  3N2G A;  3TD5 A;  3UT5 B;  4C8E A;  4ERH A;  5G4V C;  2QI2 A;  3CMA F;  4I50 B;  3CME F;  4XCQ A;  2RHH A;  5FNV A;  3WXM B;  3I55 F;  1YJW F;  3HKC A;  3N2G B;  4LNU A;  5LP6 A;  4ZOL A;  5B8F A;  5EZY B;  4FFB A;  1VQK F;  3HTN A;  2OTM A;  2UYK A;  3KE1 A;  1GZ0 A;  4TV9 A;  1RQ2 A;  1JY8 A;  1U43 A;  3ZP7 A;  4B45 A;  1Q81 H;  1XV2 A;  4C82 A;  3Q8H A;  4X1K B;  4G4W A;  2OTJ F;  3RYI A;  1J7H A;  3RYF A;  3F0D A;  3CC4 F;  3JAW A;  3CCM F;  4ZI7 A;  4BT5 A;  2I6D A;  5FNV B;  1OAP A;  2CVL A;  3K14 A;  3S0Y A;  3CCU F;  3WGJ A;  4B46 A;  3C9T A;  1VQ4 F;  3OBY A;  3VOB A;  4EI7 A;  1H48 A;  4ZHV A;  2ZOV A;  3C8L A;  4TV8 A;  2AIF A;  5A2Q M;  3VTI C;  1GX1 A;  5GIO C;  2HRY A;  1IV4 A;  3VMF B;  3WJR A;  5LYJ B;  1U40 A;  2H8E A;  4RHA A;  5IYZ B;  4IIJ A;  5EIB D;  3J80 M;  2RHJ A;  2VXY A;  3ON1 A;  4NWO B;  3RYC B;  1W58 1;  1W40 A;  3LWQ C;  4ZHY B;  4NUT A;  5HY1 A;  2K1S A;  4O4I A;  5FJ4 C;  2GLZ A;  3CCL F;  1XBI A;  5KX5 A;  3G6E F;  1Q8R A;  2NMU A;  1SA0 B;  5IT9 M;  3FPI A;  1W57 A;  2ZF8 A;  3VI6 A;  3HWU A;  3RYH B;  2HP3 A;  4YJ3 A;  1VHA A;  2DT4 A;  1QU9 A;  3SIU A;  1TUB B;  3K2X A;  4BT2 A;  3M4S A;  4O4H B;  1SA0 A;  3IR9 A;  4ZK7 A;  2YYE A;  5LA6 B;  3MCQ A;  3N4Y A;  2W8B C;  1W2B F;  3CCJ F;  3FD6 A;  2HP0 A;  1SZQ A;  3OW2 F;  3JAR B;  4WBN A;  3IMP A;  5JCO C;  2LCA A;  3WJQ A;  4O2A A;  2BTU A;  3D54 A;  5LA6 A;  4G4Y A;  2HP0 B;  1CK2 A;  1K9M H;  1Z5V A;  4X1I B;  1Z5W A;  2G9I A;  5C8Y B;  2VAW A;  3TD4 A;  2BO1 A;  2IAF A;  1N8R H;  3NMU C;  4ZHQ A;  1H7M A;  1NMU B;  2UYN A;  3BYQ A;  3F0G A;  4I55 A;  4X20 A;  5J2U B;  4G4V A;  3LWO C;  3HKD A;  2UYN B;  5GON A;  3I56 F;  4ZHQ B;  3S06 A;  2QEX F;  3PLA C;  2ZVY A;  1W59 A;  5LXT B;  3VYU C;  3S02 A;  1IV1 A;  2CHT A;  3L7Q A;  4BT6 A;  1NJI H;  3RYI B;  1DBF A;  1X52 A;  2Z1F A;  1VQL F;  1W42 A;  5GAP K;  4TUY B;  1KQS F;  3HKB B;  3HKE A;  5HY0 A;  5JH7 B;  2QTP A;  3CC2 F;  1W41 A;  1GO0 A;  5EB1 B;  1R1M A;  1VQ8 F;  3VIU A;  2L26 A;  3I3F A;  2CHS A;  1JFF A;  5EZY A;  3VCZ A;  1CLI A;  3KIZ A;  3C9R A;  3VYT C;  2Z1T A;  4G4Z A;  1QAH A;  2KGW A;  5KX5 B;  4BVT A;  5EIB C;  3VO8 A;  3RYF B;  1W3E X;  3IKF A;  2ZAU A;  1TVK B;  3E22 B;  1M90 H;  2BTO A;  3RYC A;  1FNK A;  4EI8 A;  4NQ3 A;  2VAM A;  2OTL F;  1UFY A;  2GZL A;  3ESJ A;  4C81 A;  5GAN K;  4HNA B;  3EOR A;  1CN7 A;  3KHN A;  5CA0 B;  2F9Z C;  3DC2 A;  5LP6 C;  1COM A;  2HS0 A;  2BTQ B;  3LME A;  4I50 A;  2FC3 A;  4ZHW A;  3WGL A;  2RHL A;  4X1I A;  2IQQ A;  2AIZ P;  2V9Y A;  4ZI7 B;  1W5E A;  3CYQ A;  2Q1X A;  3GHZ A;  3JAS B;  3PAF A;  4BT4 A;  2HRU A;  3S0W A;  5HP7 A;  4BVR A;  3CG6 A;  4O2A B;  1U3L A;  4WBN B;  1KNJ A;  5JVD A;  3FBA A;  3SIV A;  3ELC A;  1NQ3 A;  5GIP C;  4O4H A;  3QHD A;  2AMT A;  3DDN A;  2HS4 A;  1RQ7 A;  3AGK A;  3IEQ A;  3RYH A;  3MDO A;  4TV9 B;  3N4Z A;  1GO1 A;  1VQV A;  3G4S F;  5JQG B;  3HJW C;  2KG4 A;  2CW4 A;  5GON B;  2I6R A;  2LBW A;  3E20 B;  4R40 B;  4X20 B;  3J7A R;  1M1K H;  1VK3 A;  4BY9 D;  1XRG A;  5CA0 A;  3JAL A;  3JAK B;  3M1X A;  1JJ2 F;  5C8Y A;  2UYP A;  1YJ9 F;  1RLU A;  1U3P A;  3JAL B;  2UZH A;  5JCO A;  2WAL A;  5J2T A;  1VH8 A;  2HS3 A;  5HP8 A;  4X1Y B;  4B5C A;  4TV8 B;  4O2B B;  3JAK A;  1TVK A;  3E22 A;  3HKD B;  3ZOP A;  3CCQ F;  3ZO8 A;  3WGK A;  4C8G A;  3CCE F;  2Z1U A;  1FFX B;  3F6M A;  1Q82 H;  2HX0 A;  3MQW A;  1YIT F;  1UI9 A;  5EWR A;  4BVQ A;  3OON A;  3WPW A;  3LWP C;  1RA4 A;  3G71 F;  5EYP B;  2CZW A;  3WPX A;  2YXZ A;  4EB6 A;  3HAX D;  1KNK A;  5HXU A;  3CCR F;  1ZWZ A;  2PMP A;  4G4X A;  3C9S A;  1FFX A;  3CCV F;  2ALE A;  5CB4 A;  1DT9 A;  1QD9 A;  3V4D A;  2Z1E A;  5EO3 A;  3ZP4 A;  1ODE A;  5LYJ A;  5MN6 A;  5MN5 A;  3ERN A;  4IIJ B;  1ONI A;  2VAP A;  1PF5 A;  2VGN A;  1FNJ A;  1H47 A;  1TUB A;  2LBX A;  5IJ0 A;  1Q86 H;  1VQ6 F;  3J81 M;  4U3J A;  4DRX A;  3S03 A;  3WJP A;  4PWT A;  4HNA A;  5AVM A;  5BMV B;  3LDT A;  1YJN F;  3WGM A;  1X7P A;  5HY2 A;  4B62 A;  1VQ5 F;  3JAW B;  5IYZ A;  1IPA A;  5KMG B;  2OZB A;  3RA5 A;  3LYB A;  4YJ2 A;  3QUW A;  2MQE A;  4X1K A;  4YJ2 B;  3JAT B;  1VQM F;  1K8A H;  2HVY D;  5KMG A;  3V7E A;  3RE3 A;  3CB2 A;  3NVI B;  3OBW A;  5CA1 B;  1VQ7 F;  2N48 A; 
#chains in the Genus database with same CATH homology
 2HS0 A;  3C9S A;  2HS4 A;  3WJP A;  2HS3 A;  3VYT C;  2Z1T A;  3P4E A;  2Z01 A;  5AVM A;  3VYS C;  3MDO A;  3WJQ A;  3M84 A;  2BTU A;  3D54 A;  3VYU C;  1VQV A;  2Z1E A;  3C9T A;  2V9Y A;  2Z1F A;  2I6R A;  2ZAU A;  3QTY A;  2Z1U A;  2HRU A;  3VTI C;  3U0O A;  1VK3 A;  2RB9 A;  2ZOD A;  2HRY A;  3FD5 A;  3WJR A;  3VIU A;  2YYE A;  3MCQ A;  3C9U A;  2YXZ A;  3FD6 A;  1CLI A;  3KIZ A;  3C9R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...