2Z01A

Crystal structure of phosphoribosylaminoimidazole synthetase from geobacillus kaustophilus
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
326
structure length
313
Chain Sequence
QAVALMKEHVQKTMRPEVLGGGLFDLSALGYRQPVLISGTDGVGTKLKLAFLLDRHDTIGIDCVAMCVNDIIVQGAEPLFFLDYIACGKAVPEKIAAIVKGVADGCVEAGCALIGGETAEEYDLAGFAVGVAEKERLITGETIQAGDALVGLPSSGLHSNGYSLVRRIVFEQAKLSLDEIYEPLDVPLGEELLKPTRIYAKLLRSVRERFTIKGMAHITGGGLIENIPRMLPPGIGARIQLGSWPILPIFDFLREKGSLEEEEMFSVFNMGIGLVLAVSPETAAPLVEWLSERGEPAYIIGEVAKGAGVSFAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphoribosylformylglycinamidine cyclo-ligase
publication title Crystal structures and ligand binding of PurM proteins from Thermus thermophilus and Geobacillus kaustophilus
pubmed doi rcsb
source organism Geobacillus kaustophilus
molecule tags Ligase
total genus 86
structure length 313
sequence length 326
ec nomenclature ec 6.3.3.1: Phosphoribosylformylglycinamidine cyclo-ligase.
pdb deposition date 2007-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00586 AIRS AIR synthase related protein, N-terminal domain
A PF02769 AIRS_C AIR synthase related protein, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.10 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; PurM-like, N-terminal domain 2z01A01
3.90.650.10 Alpha Beta Alpha-Beta Complex Phosphoribosyl-aminoimidazole Synthetase; Chain A, domain 2 PurM-like C-terminal domain 2z01A02
2HRUA 2Z1UA 2HS0A 2Z1TA 3C9UA 2RB9A 3VYUC 3VYTC 3MDOA 3FD5A 2YXZA 3VTIC 1CLIA 3C9RA 3VIUA 3WJRA 2V9YA 3VYSC 5AVMA 1VQVA 3P4EA 2HRYA 3D54A 2ZODA 2ZAUA 3FD6A 2Z01A 3QTYA 3KIZA 2Z1FA 2BTUA 3C9TA 1VK3A 2I6RA 3M84A 3MCQA 3WJPA 2YYEA 2HS3A 3C9SA 3U0OA 2Z1EA 3WJQA 2HS4A
chains in the Genus database with same CATH superfamily
2HP3A 2K1SA 1CK2A 4DXDA 2OZBA 2BO1A 1W42A 1Z5VA 3VTIC 3CCJF 5LA6A 3WJRA 1KQSF 1IPAA 1NJIH 3ESJA 5AVMA 5JQGA 4I50B 4X20B 3WGMA 3KJJA 3I55F 1VQ5F 4C81A 1Q8RA 3GYQA 4O4IA 3I7TA 4X1IA 4NWOB 4O4LA 3IEWA 1VK3A 4U3JB 3S03A 1W5BA 3K12A 2YYEA 3LWPC 2MQEA 3ERNA 1W5EA 1OAPA 3Q8HA 3LDTA 3CYQA 3CC2F 2VGMA 3DDNA 3KE1A 2UZHA 3M1XA 2HP0B 1UFYA 1IV2A 2DYYA 5HY4A 3E22A 5GINC 4EB6A 2HX0A 1RLGA 3N4YA 2ZODA 5ITZA 1W5AA 4TV9A 4BT6A 3SIUA 1R1MA 5JH7B 4TZZA 2ZVZA 4LNUB 5JVDA 2Z1FA 2FGYA 3M84A 5HP8A 5G4VC 2UYJA 3KHNA 3F0DA 2AIZP 1FNJA 5LP6A 3JATB 4BVTA 3CXCF 2LCAA 4M8IA 3VI6A 1W581 3E20B 3IKFA 5BMVA 1VQ6F 1JFFA 5EIBC 4G88A 3NK6A 3HWUA 3K2XA 3TD3A 1X52A 4YJ2A 3WGKA 4DRXB 3S0YA 5HXZA 1U3PA 3O85A 1VQ8F 2KTVA 4ZI7B 3KJKA 2CSLA 2NMUA 3LYBA 4C8EA 5LYJB 3RYIB 3ELCA 3I56F 3J7AR 3IR9A 4I50A 4X20A 2RHJA 3WJQA 1FNKA 1ODEA 1Q82H 3B6NA 4X1KB 1XHOA 3S06A 3OBWA 3C9UA 3FBAA 3VYTC 1FSZA 3JASB 4U3JA 3LWVC 1CLIA 1QVGF 2F9ZC 4BT2A 3NK7A 3VYSC 3JCMM 3HTNA 2UYKA 1VQKF 3CPWF 1X7PA 3P10A 3D01A 3FD6A 3D00A 3CCLF 3ZP7A 2HP0A 1K8AH 1YIJF 1W40A 2HS3A 1YHQF 4G4WA 4G4VA 2HS0A 2QA4F 5JH7A 1IV1A 5FJ4C 4LNUA 2BTQB 3RYFB 2LBXA 2LBTA 1GZ0A 5EWRA 1S72F 1X7OA 3M4SA 3JATA 1OFUA 3WPXA 5CB4B 1H47A 3LMEA 3MQWA 1H48A 5GAPK 1DT9A 3KIZA 4TV8B 4LCKA 1IV3A 5J2UB 1U40A 3NVIB 1T0AA 1M90H 1RLUA 4DRXA 1Z5WA 2AIFA 2Z1EA 2VAPA 4YJ3B 2IQQA 3GHZA 4ZI7A 4B62A 1ZWZA 5LYJA 3RYIA 1VQ9F 2CVLA 2YXZA 1IV4A 4X3LA 5MN4A 3RYHB 4X1KA 5JCOC 3V7EA 2HRYA 5EB1B 2HQSC 4BT7A 3J81M 2UYPA 3G6EF 3JASA 2VAWA 3OW2F 3E1YA 1VHAA 1KC8H 5LOVB 4FFBB 1Q7YH 4C4WC 1T0KB 3WGLA 2QI2A 3F0EA 5J2TB 5EYPB 3RA6A 3CMEF 3WGNA 2KTUA 4BT3A 3N2KB 3NMUC 2OTLF 5MN6A 3V7QA 2OTJF 1NQ3A 1U3LA 1COMA 1YJWF 3RYFA 2UYNB 3C9TA 1VQLF 4I4TB 2IAFA 1W55A 1DBFA 5LXTB 2PHNA 1YJ9F 3VOBA 1KNKA 3ZOPA 4C8GA 2Z1UA 2AMTA 3IKEA 2Z1TA 5CB4A 3I3FA 4TV8A 5MN5A 3TD4A 4EI7A 3JVHA 5J2UA 3HKBB 4ZHQB 2VXYA 3CCVF 4YJ3A 5GIPC 1JD1A 2RHOA 1FFXB 1VQNF 3JARB 4U39A 5IJ9B 4EI9A 1QD9A 4C82A 3HAXD 3JAMM 3MCQA 2CHSA 2RHLA 1W2BF 4X1YB 3RYHA 1QAHA 2JNBA 3RA5A 3U0OA 3CG6A 2FC3A 4IIJB 5HY0A 1QU9A 3F0GA 3VO8A 5JCOA 5LOVA 3JAWB 1KNJA 4FFBA 4IHJB 4EI8A 4ZHWA 4B46A 1XRGA 3VIUA 1NMUB 1J7HA 4R40B 1VQVA 2R751 3VOAA 5KMGB 5J2TA 4HNAB 5EYPA 5HWEA 1UI9A 2H8CA 1PF5A 3N2KA 3CCUF 5EB0A 4RHAA 5EO3A 5CA1B 3S02A 1YQNA 1VQMF 3LWOC 2HS4A 2HRUA 4BVSA 5A2QM 1SA0B 2UYNA 2Q1YA 2RB9A 4ZOLB 1XBIA 4I4TA 2VGNA 3BYQA 3K0TA 5LXTA 3G71F 3UT5B 1KD1H 3CCSF 1N8RH 5EAZA 1H7MA 3HKEB 3RE3A 2CWJA 3RYCB 3HKBA 4ZHQA 5EZYB 3CC4F 3C9SA 1FFXA 5FLXM 3JARA 3DC2A 5IJ9A 5GANK 4ERHA 4G4YA 2ZOVA 2DT4A 5CA0B 3CYPB 4PWTA 1JJ2F 3CCMF 3WXMB 2W8BC 4X1YA 2QTPA 4IIJA 1W5FA 4B5CA 1X25A 3P4EA 2Q1XA 2KG4A 3CC7F 1TVKB 3ON1A 4C8IA 3D54A 3JAWA 1U43A 4F6RB 3HKDB 4IHJA 4BVRA 2G9IA 2LBWA 3WJPA 3CMAF 5FNVB 1GO0A 3QUWA 5HP7A 3R0PA 4O2AB 5KMGA 1VQ7F 3JAKB 3K14A 2N48A 4HNAA 3PAFA 3CCQF 3JALB 4TUYB 3MDOA 3PLAC 1CN7A 5CA1A 5IYZB 2KGWA 4I55B 4WBNB 3FPIA 3OONA 1SA0A 1W3EX 3EORA 4O4JB 3S0HA 2EWCA 4BT5A 4ZOLA 5GIOC 1W59A 2ZF8A 3VMFB 2GVIA 4ZHYB 3MBMA 3V4DA 1RQ2A 1GO1A 3UT5A 4BW0B 3P0ZA 1TUBB 4RQOA 3AGKA 4ZHVA 3HKEA 5B8FA 1GX1A 3RYCA 2GLZA 3VYUC 2L26A 4O2BB 5EZYA 2HVYD 3C9RA 3ZO8A 2V9YA 3LWRC 4BT4A 3GTZA 1W57A 2WALA 5KX5B 1RA4A 2ZAUA 4NUTA 5CA0A 2Z01A 3QTYA 2R6R1 3T80A 4BY9D 1TVKA 1VQ4F 1ONIA 5DCVA 5G4UC 4O4HB 5HY2A 3CB2A 2RHHA 5IJ0B 4F6RA 1YGYA 3HKDA 2CW4A 1VQOF 4X3MA 3HKCB 3CCEF 2CHTA 5FNVA 1QVFF 3VCZA 5HY1A 1RQ7A 5C8YB 3LWQC 4O2AA 3N2GB 3JAKA 3WGJA 5GONB 4G4XA 3JALA 2B33A 4NQ3A 3ZP4A 1PXWA 4TUYA 5IT9M 2H8EA 5HXUA 5IYZA 3LFOA 1SDSA 4I55A 4WBNA 3OBYA 1YI2F 2CZWA 5LA6B 1XV2A 3F0FA 3CPQA 4O4JA 3L7QA 5JQGB 2H6LA 2ALEA 1VQPF 1VH8A 3SIVA 1M1KH 4O4IB 3V3TA 3TD5A 1Q81H 4X1IB 3NVKE 3FD5A 4O4LB 2GZLA 3F6MA 1YJNF 1SZQA 1TUBA 3J80M 1K9MH 2OHWA 1JN1A 4E6EA 3C8LA 4O2BA 4B45A 3QHDA 4KWEA 3MCAB 2I6RA 2I6DA 2ZVYA 2PMPA 3E22B 1Q86H 1E7KA 2P6YA 3HJWC 4BVQA 4EB6B 5KX5A 3WPWA 2VAMA 3IMPA 2OTMA 5ITZB 4TV9B 4ZK7A 3CCRF 5JVDB 5LP6C 3G4SF 1YITF 4O4HA 5EIBD 2BTOA 5IJ0A 2QEXF 1K73H 3IEQA 5LP6B 4XCQA 3HKCA 1JY8A 2IG8A 3S0WA 3CD6F 1W41A 3N4ZA 2BTUA 5C8YA 5BMVB 1JFFB 3N2GA 5GONA 3FFMA 4YJ2B 4G4ZA
chains in the Genus database with same CATH topology
2HRUA 2Z1UA 2HS0A 2Z1TA 3C9UA 2RB9A 3VYUC 3VYTC 3MDOA 3FD5A 2YXZA 3VTIC 1CLIA 3C9RA 3VIUA 3WJRA 2V9YA 3VYSC 5AVMA 1VQVA 3P4EA 2HRYA 3D54A 2ZODA 2ZAUA 3FD6A 2Z01A 3QTYA 3KIZA 2Z1FA 2BTUA 3C9TA 1VK3A 2I6RA 3M84A 3MCQA 3WJPA 2YYEA 2HS3A 3C9SA 3U0OA 2Z1EA 3WJQA 2HS4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HRU A;  2Z1U A;  2HS0 A;  2Z1T A;  3C9U A;  2RB9 A;  3VYU C;  3VYT C;  3MDO A;  3FD5 A;  2YXZ A;  3VTI C;  1CLI A;  3C9R A;  3VIU A;  3WJR A;  2V9Y A;  3VYS C;  5AVM A;  1VQV A;  3P4E A;  2HRY A;  3D54 A;  2ZOD A;  2ZAU A;  3FD6 A;  2Z01 A;  3QTY A;  3KIZ A;  2Z1F A;  2BTU A;  3C9T A;  1VK3 A;  2I6R A;  3M84 A;  3MCQ A;  3WJP A;  2YYE A;  2HS3 A;  3C9S A;  3U0O A;  2Z1E A;  3WJQ A;  2HS4 A; 
#chains in the Genus database with same CATH topology
 2HP3 A;  2K1S A;  1CK2 A;  4DXD A;  2OZB A;  2BO1 A;  1W42 A;  1Z5V A;  3VTI C;  3CCJ F;  5LA6 A;  3WJR A;  1KQS F;  1IPA A;  1NJI H;  3ESJ A;  5AVM A;  5JQG A;  4I50 B;  4X20 B;  3WGM A;  3KJJ A;  3I55 F;  1VQ5 F;  4C81 A;  1Q8R A;  3GYQ A;  4O4I A;  3I7T A;  4X1I A;  4NWO B;  4O4L A;  3IEW A;  1VK3 A;  4U3J B;  3S03 A;  1W5B A;  3K12 A;  2YYE A;  3LWP C;  2MQE A;  3ERN A;  1W5E A;  1OAP A;  3Q8H A;  3LDT A;  3CYQ A;  3CC2 F;  2VGM A;  3DDN A;  3KE1 A;  2UZH A;  3M1X A;  2HP0 B;  1UFY A;  1IV2 A;  2DYY A;  5HY4 A;  3E22 A;  5GIN C;  4EB6 A;  2HX0 A;  1RLG A;  3N4Y A;  2ZOD A;  5ITZ A;  1W5A A;  4TV9 A;  4BT6 A;  3SIU A;  1R1M A;  5JH7 B;  4TZZ A;  2ZVZ A;  4LNU B;  5JVD A;  2Z1F A;  2FGY A;  3M84 A;  5HP8 A;  5G4V C;  2UYJ A;  3KHN A;  3F0D A;  2AIZ P;  1FNJ A;  5LP6 A;  3JAT B;  4BVT A;  3CXC F;  2LCA A;  4M8I A;  3VI6 A;  1W58 1;  3E20 B;  3IKF A;  5BMV A;  1VQ6 F;  1JFF A;  5EIB C;  4G88 A;  3NK6 A;  3HWU A;  3K2X A;  3TD3 A;  1X52 A;  4YJ2 A;  3WGK A;  4DRX B;  3S0Y A;  5HXZ A;  1U3P A;  3O85 A;  1VQ8 F;  2KTV A;  4ZI7 B;  3KJK A;  2CSL A;  2NMU A;  3LYB A;  4C8E A;  5LYJ B;  3RYI B;  3ELC A;  3I56 F;  3J7A R;  3IR9 A;  4I50 A;  4X20 A;  2RHJ A;  3WJQ A;  1FNK A;  1ODE A;  1Q82 H;  3B6N A;  4X1K B;  1XHO A;  3S06 A;  3OBW A;  3C9U A;  3FBA A;  3VYT C;  1FSZ A;  3JAS B;  4U3J A;  3LWV C;  1CLI A;  1QVG F;  2F9Z C;  4BT2 A;  3NK7 A;  3VYS C;  3JCM M;  3HTN A;  2UYK A;  1VQK F;  3CPW F;  1X7P A;  3P10 A;  3D01 A;  3FD6 A;  3D00 A;  3CCL F;  3ZP7 A;  2HP0 A;  1K8A H;  1YIJ F;  1W40 A;  2HS3 A;  1YHQ F;  4G4W A;  4G4V A;  2HS0 A;  2QA4 F;  5JH7 A;  1IV1 A;  5FJ4 C;  4LNU A;  2BTQ B;  3RYF B;  2LBX A;  2LBT A;  1GZ0 A;  5EWR A;  1S72 F;  1X7O A;  3M4S A;  3JAT A;  1OFU A;  3WPX A;  5CB4 B;  1H47 A;  3LME A;  3MQW A;  1H48 A;  5GAP K;  1DT9 A;  3KIZ A;  4TV8 B;  4LCK A;  1IV3 A;  5J2U B;  1U40 A;  3NVI B;  1T0A A;  1M90 H;  1RLU A;  4DRX A;  1Z5W A;  2AIF A;  2Z1E A;  2VAP A;  4YJ3 B;  2IQQ A;  3GHZ A;  4ZI7 A;  4B62 A;  1ZWZ A;  5LYJ A;  3RYI A;  1VQ9 F;  2CVL A;  2YXZ A;  1IV4 A;  4X3L A;  5MN4 A;  3RYH B;  4X1K A;  5JCO C;  3V7E A;  2HRY A;  5EB1 B;  2HQS C;  4BT7 A;  3J81 M;  2UYP A;  3G6E F;  3JAS A;  2VAW A;  3OW2 F;  3E1Y A;  1VHA A;  1KC8 H;  5LOV B;  4FFB B;  1Q7Y H;  4C4W C;  1T0K B;  3WGL A;  2QI2 A;  3F0E A;  5J2T B;  5EYP B;  3RA6 A;  3CME F;  3WGN A;  2KTU A;  4BT3 A;  3N2K B;  3NMU C;  2OTL F;  5MN6 A;  3V7Q A;  2OTJ F;  1NQ3 A;  1U3L A;  1COM A;  1YJW F;  3RYF A;  2UYN B;  3C9T A;  1VQL F;  4I4T B;  2IAF A;  1W55 A;  1DBF A;  5LXT B;  2PHN A;  1YJ9 F;  3VOB A;  1KNK A;  3ZOP A;  4C8G A;  2Z1U A;  2AMT A;  3IKE A;  2Z1T A;  5CB4 A;  3I3F A;  4TV8 A;  5MN5 A;  3TD4 A;  4EI7 A;  3JVH A;  5J2U A;  3HKB B;  4ZHQ B;  2VXY A;  3CCV F;  4YJ3 A;  5GIP C;  1JD1 A;  2RHO A;  1FFX B;  1VQN F;  3JAR B;  4U39 A;  5IJ9 B;  4EI9 A;  1QD9 A;  4C82 A;  3HAX D;  3JAM M;  3MCQ A;  2CHS A;  2RHL A;  1W2B F;  4X1Y B;  3RYH A;  1QAH A;  2JNB A;  3RA5 A;  3U0O A;  3CG6 A;  2FC3 A;  4IIJ B;  5HY0 A;  1QU9 A;  3F0G A;  3VO8 A;  5JCO A;  5LOV A;  3JAW B;  1KNJ A;  4FFB A;  4IHJ B;  4EI8 A;  4ZHW A;  4B46 A;  1XRG A;  3VIU A;  1NMU B;  1J7H A;  4R40 B;  1VQV A;  2R75 1;  3VOA A;  5KMG B;  5J2T A;  4HNA B;  5EYP A;  5HWE A;  1UI9 A;  2H8C A;  1PF5 A;  3N2K A;  3CCU F;  5EB0 A;  4RHA A;  5EO3 A;  5CA1 B;  3S02 A;  1YQN A;  1VQM F;  3LWO C;  2HS4 A;  2HRU A;  4BVS A;  5A2Q M;  1SA0 B;  2UYN A;  2Q1Y A;  2RB9 A;  4ZOL B;  1XBI A;  4I4T A;  2VGN A;  3BYQ A;  3K0T A;  5LXT A;  3G71 F;  3UT5 B;  1KD1 H;  3CCS F;  1N8R H;  5EAZ A;  1H7M A;  3HKE B;  3RE3 A;  2CWJ A;  3RYC B;  3HKB A;  4ZHQ A;  5EZY B;  3CC4 F;  3C9S A;  1FFX A;  5FLX M;  3JAR A;  3DC2 A;  5IJ9 A;  5GAN K;  4ERH A;  4G4Y A;  2ZOV A;  2DT4 A;  5CA0 B;  3CYP B;  4PWT A;  1JJ2 F;  3CCM F;  3WXM B;  2W8B C;  4X1Y A;  2QTP A;  4IIJ A;  1W5F A;  4B5C A;  1X25 A;  3P4E A;  2Q1X A;  2KG4 A;  3CC7 F;  1TVK B;  3ON1 A;  4C8I A;  3D54 A;  3JAW A;  1U43 A;  4F6R B;  3HKD B;  4IHJ A;  4BVR A;  2G9I A;  2LBW A;  3WJP A;  3CMA F;  5FNV B;  1GO0 A;  3QUW A;  5HP7 A;  3R0P A;  4O2A B;  5KMG A;  1VQ7 F;  3JAK B;  3K14 A;  2N48 A;  4HNA A;  3PAF A;  3CCQ F;  3JAL B;  4TUY B;  3MDO A;  3PLA C;  1CN7 A;  5CA1 A;  5IYZ B;  2KGW A;  4I55 B;  4WBN B;  3FPI A;  3OON A;  1SA0 A;  1W3E X;  3EOR A;  4O4J B;  3S0H A;  2EWC A;  4BT5 A;  4ZOL A;  5GIO C;  1W59 A;  2ZF8 A;  3VMF B;  2GVI A;  4ZHY B;  3MBM A;  3V4D A;  1RQ2 A;  1GO1 A;  3UT5 A;  4BW0 B;  3P0Z A;  1TUB B;  4RQO A;  3AGK A;  4ZHV A;  3HKE A;  5B8F A;  1GX1 A;  3RYC A;  2GLZ A;  3VYU C;  2L26 A;  4O2B B;  5EZY A;  2HVY D;  3C9R A;  3ZO8 A;  2V9Y A;  3LWR C;  4BT4 A;  3GTZ A;  1W57 A;  2WAL A;  5KX5 B;  1RA4 A;  2ZAU A;  4NUT A;  5CA0 A;  2Z01 A;  3QTY A;  2R6R 1;  3T80 A;  4BY9 D;  1TVK A;  1VQ4 F;  1ONI A;  5DCV A;  5G4U C;  4O4H B;  5HY2 A;  3CB2 A;  2RHH A;  5IJ0 B;  4F6R A;  1YGY A;  3HKD A;  2CW4 A;  1VQO F;  4X3M A;  3HKC B;  3CCE F;  2CHT A;  5FNV A;  1QVF F;  3VCZ A;  5HY1 A;  1RQ7 A;  5C8Y B;  3LWQ C;  4O2A A;  3N2G B;  3JAK A;  3WGJ A;  5GON B;  4G4X A;  3JAL A;  2B33 A;  4NQ3 A;  3ZP4 A;  1PXW A;  4TUY A;  5IT9 M;  2H8E A;  5HXU A;  5IYZ A;  3LFO A;  1SDS A;  4I55 A;  4WBN A;  3OBY A;  1YI2 F;  2CZW A;  5LA6 B;  1XV2 A;  3F0F A;  3CPQ A;  4O4J A;  3L7Q A;  5JQG B;  2H6L A;  2ALE A;  1VQP F;  1VH8 A;  3SIV A;  1M1K H;  4O4I B;  3V3T A;  3TD5 A;  1Q81 H;  4X1I B;  3NVK E;  3FD5 A;  4O4L B;  2GZL A;  3F6M A;  1YJN F;  1SZQ A;  1TUB A;  3J80 M;  1K9M H;  2OHW A;  1JN1 A;  4E6E A;  3C8L A;  4O2B A;  4B45 A;  3QHD A;  4KWE A;  3MCA B;  2I6R A;  2I6D A;  2ZVY A;  2PMP A;  3E22 B;  1Q86 H;  1E7K A;  2P6Y A;  3HJW C;  4BVQ A;  4EB6 B;  5KX5 A;  3WPW A;  2VAM A;  3IMP A;  2OTM A;  5ITZ B;  4TV9 B;  4ZK7 A;  3CCR F;  5JVD B;  5LP6 C;  3G4S F;  1YIT F;  4O4H A;  5EIB D;  2BTO A;  5IJ0 A;  2QEX F;  1K73 H;  3IEQ A;  5LP6 B;  4XCQ A;  3HKC A;  1JY8 A;  2IG8 A;  3S0W A;  3CD6 F;  1W41 A;  3N4Z A;  2BTU A;  5C8Y A;  5BMV B;  1JFF B;  3N2G A;  5GON A;  3FFM A;  4YJ2 B;  4G4Z A; 
#chains in the Genus database with same CATH homology
 2HRU A;  2Z1U A;  2HS0 A;  2Z1T A;  3C9U A;  2RB9 A;  3VYU C;  3VYT C;  3MDO A;  3FD5 A;  2YXZ A;  3VTI C;  1CLI A;  3C9R A;  3VIU A;  3WJR A;  2V9Y A;  3VYS C;  5AVM A;  1VQV A;  3P4E A;  2HRY A;  3D54 A;  2ZOD A;  2ZAU A;  3FD6 A;  2Z01 A;  3QTY A;  3KIZ A;  2Z1F A;  2BTU A;  3C9T A;  1VK3 A;  2I6R A;  3M84 A;  3MCQ A;  3WJP A;  2YYE A;  2HS3 A;  3C9S A;  3U0O A;  2Z1E A;  3WJQ A;  2HS4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...