2Z01A

Crystal structure of phosphoribosylaminoimidazole synthetase from geobacillus kaustophilus
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
326
structure length
313
Chain Sequence
QAVALMKEHVQKTMRPEVLGGGLFDLSALGYRQPVLISGTDGVGTKLKLAFLLDRHDTIGIDCVAMCVNDIIVQGAEPLFFLDYIACGKAVPEKIAAIVKGVADGCVEAGCALIGGETAEEYDLAGFAVGVAEKERLITGETIQAGDALVGLPSSGLHSNGYSLVRRIVFEQAKLSLDEIYEPLDVPLGEELLKPTRIYAKLLRSVRERFTIKGMAHITGGGLIENIPRMLPPGIGARIQLGSWPILPIFDFLREKGSLEEEEMFSVFNMGIGLVLAVSPETAAPLVEWLSERGEPAYIIGEVAKGAGVSFAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures and ligand binding of PurM proteins from Thermus thermophilus and Geobacillus kaustophilus
pubmed doi rcsb
source organism Geobacillus kaustophilus
molecule tags Ligase
molecule keywords Phosphoribosylformylglycinamidine cyclo-ligase
total genus 86
structure length 313
sequence length 326
ec nomenclature ec 6.3.3.1: Phosphoribosylformylglycinamidine cyclo-ligase.
pdb deposition date 2007-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00586 AIRS AIR synthase related protein, N-terminal domain
A PF02769 AIRS_C AIR synthase related protein, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.10 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; PurM-like, N-terminal domain 2z01A01
3.90.650.10 Alpha Beta Alpha-Beta Complex Phosphoribosyl-aminoimidazole Synthetase; Chain A, domain 2 PurM-like C-terminal domain 2z01A02
3FD6A 3VTIC 3MCQA 2HRYA 2Z1FA 1VQVA 1CLIA 2HS0A 3WJPA 3C9UA 3VIUA 3VYUC 2ZODA 2HRUA 2RB9A 2HS3A 3WJRA 2V9YA 2ZAUA 3KIZA 3C9SA 5AVMA 3WJQA 2HS4A 2I6RA 2Z1UA 2Z1EA 3FD5A 3VYTC 2Z01A 3P4EA 1VK3A 3QTYA 3VYSC 2YYEA 3C9TA 2YXZA 2Z1TA 3M84A 3C9RA 3MDOA 3D54A 2BTUA 3U0OA
chains in the Genus database with same CATH superfamily
3S06A 1VQVA 4DRXA 4LNUB 2UYPA 5HY0A 4BT4A 3LWRC 1W57A 3E22A 2RHHA 3K12A 3IEWA 2V9YA 5CA0A 2Q1YA 1GZ0A 3NK6A 3S0YA 3CCJF 2HVYD 4I55A 1XBIA 2EWCA 3L7QA 4IIJB 4TV8A 1R1MA 2PHNA 2RHOA 3N2KB 1QU9A 4G4VA 1JJ2F 5G4UC 5JVDA 3CYQA 2MQEA 4IHJB 5KX5B 3CCVF 5DCVA 1RQ7A 5IJ0B 5G4VC 5GIPC 4KWEA 1ODEA 5EB1B 4ZK7A 3S03A 3F0GA 5HWEA 4X1YB 5LYJB 1IV3A 1M1KH 1NMUB 3RYHB 5C8YA 5LOVB 4X3MA 3R0PA 4BW0B 3FD5A 1S72F 3BYQA 2H6LA 3C8LA 3KJKA 4B45A 5IYZA 1QVGF 3HAXD 3HKCB 3F0DA 4ZHVA 3FD6A 5LA6A 1W59A 1RA4A 4R40B 3VO8A 3K14A 4G4ZA 2BO1A 4ZHWA 3G6EF 5J2TA 3T80A 4C8IA 1IV4A 2QA4F 2LBTA 1VQ5F 2N48A 2QTPA 2AMTA 4G88A 1RLGA 3CMAF 2UYNA 5FNVA 3VYTC 3HKEA 3ELCA 3QHDA 5B8FA 5LP6B 1IV1A 4C81A 2YYEA 1FNKA 3SIVA 5IJ9B 1YIJF 3WPWA 4ZI7B 3JAKA 3RYIB 2UYKA 3WGMA 4X1KB 3CD6F 4F6RB 4I4TB 2GZLA 4O2BA 3CCQF 3M1XA 1QAHA 3I55F 1X7PA 3HTNA 5AVMA 1VQNF 1J7HA 1TUBA 4X1IB 3HKDA 3OBWA 2FGYA 1W5FA 4F6RA 4O4LA 2I6RA 1JFFB 1W42A 4BVQA 2P6YA 1NJIH 3RA6A 5EIBC 3K0TA 4X1YA 3P0ZA 5JH7A 5EYPA 5EIBD 3UT5B 1VQ4F 4C8EA 3MDOA 5CA1A 1Z5WA 5ITZA 1VQ7F 3PLAC 3ZOPA 4ERHA 3MQWA 3WJPA 3C9UA 5JQGA 4FFBA 3I7TA 5GONB 3WGNA 3O85A 5LA6B 2HS3A 3D00A 1T0KB 3KIZA 3LWPC 4B62A 4BT3A 4O4IA 4PWTA 2CW4A 4IIJA 1YGYA 5J2UA 4NUTA 5HXZA 2Z1UA 1GX1A 2AIZP 5C8YB 3I56F 1H48A 4HNAB 1H47A 1IV2A 5KMGA 1VQPF 4C82A 5CA0B 3E1YA 4TV9B 1RLUA 1UFYA 2BTUA 3CPQA 3P10A 1SZQA 5LOVA 3JASB 4LNUA 5LP6C 5MN6A 1GO1A 1W40A 4BVSA 2W8BC 2CHSA 3M4SA 1DT9A 3HWUA 3HKBA 2HRUA 2RB9A 3G71F 4EI9A 3GHZA 2H8EA 3VOBA 3ZP7A 2KGWA 3WGLA 3WJQA 1Q81H 2LCAA 4O4JB 4X20B 2VAMA 5CB4A 4I55B 3RYCB 4O4HA 5FJ4C 3HKCA 3RYIA 3V7EA 5J2UB 2ZVZA 3MBMA 2Z1TA 3IKFA 5CA1B 4YJ2B 2F9ZC 2R751 1Z5VA 4U3JA 5HY2A 5CB4B 3RYHA 5JH7B 5FNVB 2OTJF 3VIUA 1JD1A 1E7KA 3LWVC 2JNBA 1K8AH 4NQ3A 1U3PA 4YJ2A 5IJ0A 5GANK 5EYPB 3CC2F 3VMFB 1QD9A 4O4LB 2Z1EA 1VQLF 2L26A 2ZVYA 3QTYA 3CC4F 1FFXA 3CMEF 3VYSC 4ZHYB 2YXZA 4I50A 3HJWC 4U39A 3U0OA 3N4YA 2CWJA 4O4IB 3CB2A 5A2QM 1W5AA 3CCMF 2HP3A 2DYYA 3DC2A 4ZI7A 1OAPA 2KG4A 2VXYA 2CZWA 1KNKA 3JAWA 3DDNA 3JVHA 4DXDA 1CK2A 1TUBB 1RQ2A 3FBAA 4BVTA 3N2GA 1KC8H 2LBWA 1N8RH 2HP0B 1FSZA 2HX0A 3D01A 4BT2A 3CCSF 1VQ9F 3MCQA 4LCKA 2LBXA 1U3LA 2VGNA 3FPIA 1GO0A 3V7QA 5EB0A 3MCAB 3HKBB 1W5EA 2HQSC 3LWOC 1Q7YH 1YJ9F 3SIUA 1YJWF 1PXWA 3JATB 1W581 1X7OA 5IYZB 2RHLA 3LYBA 5HXUA 4WBNB 4TV9A 2OTLF 2WALA 2VGMA 1JY8A 3UT5A 2BTOA 2QI2A 2NMUA 5EZYB 3ZO8A 4O2AB 3FFMA 4BY9D 3K2XA 1VQ8F 1W3EX 3VYUC 1X25A 3S0HA 4B46A 5EO3A 3CXCF 3N2KA 5JVDB 4E6EA 1FFXB 4BT6A 4ZHQB 1VK3A 2B33A 3KE1A 5GINC 3KJJA 1H7MA 1KNJA 1XHOA 2Q1XA 3IMPA 1M90H 2BTQB 4ZOLA 2CHTA 3ESJA 3CG6A 3JASA 2IQQA 1VQ6F 3E20B 1CLIA 3J7AR 3CYPB 2UYJA 4NWOB 4C8GA 2RHJA 3WJRA 5JCOC 3HKDB 1YJNF 4EB6B 2HS4A 3LDTA 3F0FA 1YITF 3RYCA 4O4HB 2CVLA 2OZBA 5LXTB 3KHNA 1W55A 1XRGA 3WGKA 1KD1H 4X20A 1SA0A 5EZYA 1QVFF 3D54A 5JQGB 2ZOVA 4FFBB 1T0AA 2HS0A 1JFFA 3CCLF 1COMA 1XV2A 3JAWB 1UI9A 3LMEA 3N4ZA 4IHJA 3ZP4A 1VQKF 3OW2F 1W41A 2OTMA 3JARA 1VQOF 1VQMF 3J81M 4B5CA 5EAZA 3EORA 2G9IA 4G4WA 4O2BB 2KTUA 4TUYA 1SDSA 4YJ3B 3C9TA 5JCOA 4I50B 5GIOC 3TD4A 1KQSF 3F6MA 3I3FA 3M84A 3NK7A 3WXMB 2IG8A 4C4WC 4M8IA 3CC7F 5GAPK 2VAWA 3JAKB 3TD3A 1Q86H 3JALA 3WGJA 3ERNA 1Q8RA 1VHAA 2HP0A 3C9SA 3RYFB 3LWQC 3VCZA 4WBNA 5KX5A 2UZHA 2R6R1 3TD5A 5MN5A 4DRXB 3CCUF 2AIFA 2CSLA 4ZOLB 4X1IA 1JN1A 2VAPA 5FLXM 2ALEA 3IKEA 3G4SF 2I6DA 4BT5A 3WPXA 1TVKA 4X3LA 4YJ3A 5HY1A 5HY4A 4XCQA 3OBYA 4TZZA 3VI6A 3OONA 3JAMM 1YQNA 3IR9A 2PMPA 2OHWA 3N2GB 1ONIA 3S02A 3GTZA 3CPWF 1PF5A 1W2BF 3QUWA 3E22B 2UYNB 4EI8A 5EWRA 3P4EA 4BVRA 3LFOA 5BMVA 3NMUC 3JATA 3NVKE 3VOAA 3C9RA 2K1SA 4HNAA 3AGKA 3VTIC 4TV8B 2HRYA 1YI2F 2QEXF 4X1KA 3V4DA 2ZODA 4EB6A 3GYQA 1CN7A 3PAFA 1ZWZA 3RE3A 3S0WA 2KTVA 4G4XA 5HP8A 3JCMM 5LP6A 1Q82H 5GONA 4RHAA 1IPAA 1YHQF 4RQOA 4TUYB 2Z01A 4BT7A 3CCEF 3RYFA 4O4JA 3ON1A 5ITZB 2FC3A 5LYJA 2DT4A 3JARB 1VH8A 3CCRF 2GVIA 3JALB 2H8CA 5BMVB 1K73H 2Z1FA 3J80M 5KMGB 1DBFA 5HP7A 5IT9M 3F0EA 1NQ3A 1FNJA 4G4YA 4U3JB 3B6NA 3IEQA 5J2TB 2GLZA 2ZAUA 1U40A 3RA5A 1SA0B 4ZHQA 2IAFA 3NVIB 1OFUA 1W5BA 1K9MH 2ZF8A 1U43A 5LXTA 4I4TA 1X52A 3Q8HA 1TVKB 3V3TA 5MN4A 4O2AA 5IJ9A 4EI7A 3HKEB
chains in the Genus database with same CATH topology
3FD6A 3VTIC 3MCQA 2HRYA 2Z1FA 1VQVA 1CLIA 2HS0A 3WJPA 3C9UA 3VIUA 3VYUC 2ZODA 2HRUA 2RB9A 2HS3A 3WJRA 2V9YA 2ZAUA 3KIZA 3C9SA 5AVMA 3WJQA 2HS4A 2I6RA 2Z1UA 2Z1EA 3FD5A 3VYTC 2Z01A 3P4EA 1VK3A 3QTYA 3VYSC 2YYEA 3C9TA 2YXZA 2Z1TA 3M84A 3C9RA 3MDOA 3D54A 2BTUA 3U0OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FD6 A;  3VTI C;  3MCQ A;  2HRY A;  2Z1F A;  1VQV A;  1CLI A;  2HS0 A;  3WJP A;  3C9U A;  3VIU A;  3VYU C;  2ZOD A;  2HRU A;  2RB9 A;  2HS3 A;  3WJR A;  2V9Y A;  2ZAU A;  3KIZ A;  3C9S A;  5AVM A;  3WJQ A;  2HS4 A;  2I6R A;  2Z1U A;  2Z1E A;  3FD5 A;  3VYT C;  2Z01 A;  3P4E A;  1VK3 A;  3QTY A;  3VYS C;  2YYE A;  3C9T A;  2YXZ A;  2Z1T A;  3M84 A;  3C9R A;  3MDO A;  3D54 A;  2BTU A;  3U0O A; 
#chains in the Genus database with same CATH topology
 3S06 A;  1VQV A;  4DRX A;  4LNU B;  2UYP A;  5HY0 A;  4BT4 A;  3LWR C;  1W57 A;  3E22 A;  2RHH A;  3K12 A;  3IEW A;  2V9Y A;  5CA0 A;  2Q1Y A;  1GZ0 A;  3NK6 A;  3S0Y A;  3CCJ F;  2HVY D;  4I55 A;  1XBI A;  2EWC A;  3L7Q A;  4IIJ B;  4TV8 A;  1R1M A;  2PHN A;  2RHO A;  3N2K B;  1QU9 A;  4G4V A;  1JJ2 F;  5G4U C;  5JVD A;  3CYQ A;  2MQE A;  4IHJ B;  5KX5 B;  3CCV F;  5DCV A;  1RQ7 A;  5IJ0 B;  5G4V C;  5GIP C;  4KWE A;  1ODE A;  5EB1 B;  4ZK7 A;  3S03 A;  3F0G A;  5HWE A;  4X1Y B;  5LYJ B;  1IV3 A;  1M1K H;  1NMU B;  3RYH B;  5C8Y A;  5LOV B;  4X3M A;  3R0P A;  4BW0 B;  3FD5 A;  1S72 F;  3BYQ A;  2H6L A;  3C8L A;  3KJK A;  4B45 A;  5IYZ A;  1QVG F;  3HAX D;  3HKC B;  3F0D A;  4ZHV A;  3FD6 A;  5LA6 A;  1W59 A;  1RA4 A;  4R40 B;  3VO8 A;  3K14 A;  4G4Z A;  2BO1 A;  4ZHW A;  3G6E F;  5J2T A;  3T80 A;  4C8I A;  1IV4 A;  2QA4 F;  2LBT A;  1VQ5 F;  2N48 A;  2QTP A;  2AMT A;  4G88 A;  1RLG A;  3CMA F;  2UYN A;  5FNV A;  3VYT C;  3HKE A;  3ELC A;  3QHD A;  5B8F A;  5LP6 B;  1IV1 A;  4C81 A;  2YYE A;  1FNK A;  3SIV A;  5IJ9 B;  1YIJ F;  3WPW A;  4ZI7 B;  3JAK A;  3RYI B;  2UYK A;  3WGM A;  4X1K B;  3CD6 F;  4F6R B;  4I4T B;  2GZL A;  4O2B A;  3CCQ F;  3M1X A;  1QAH A;  3I55 F;  1X7P A;  3HTN A;  5AVM A;  1VQN F;  1J7H A;  1TUB A;  4X1I B;  3HKD A;  3OBW A;  2FGY A;  1W5F A;  4F6R A;  4O4L A;  2I6R A;  1JFF B;  1W42 A;  4BVQ A;  2P6Y A;  1NJI H;  3RA6 A;  5EIB C;  3K0T A;  4X1Y A;  3P0Z A;  5JH7 A;  5EYP A;  5EIB D;  3UT5 B;  1VQ4 F;  4C8E A;  3MDO A;  5CA1 A;  1Z5W A;  5ITZ A;  1VQ7 F;  3PLA C;  3ZOP A;  4ERH A;  3MQW A;  3WJP A;  3C9U A;  5JQG A;  4FFB A;  3I7T A;  5GON B;  3WGN A;  3O85 A;  5LA6 B;  2HS3 A;  3D00 A;  1T0K B;  3KIZ A;  3LWP C;  4B62 A;  4BT3 A;  4O4I A;  4PWT A;  2CW4 A;  4IIJ A;  1YGY A;  5J2U A;  4NUT A;  5HXZ A;  2Z1U A;  1GX1 A;  2AIZ P;  5C8Y B;  3I56 F;  1H48 A;  4HNA B;  1H47 A;  1IV2 A;  5KMG A;  1VQP F;  4C82 A;  5CA0 B;  3E1Y A;  4TV9 B;  1RLU A;  1UFY A;  2BTU A;  3CPQ A;  3P10 A;  1SZQ A;  5LOV A;  3JAS B;  4LNU A;  5LP6 C;  5MN6 A;  1GO1 A;  1W40 A;  4BVS A;  2W8B C;  2CHS A;  3M4S A;  1DT9 A;  3HWU A;  3HKB A;  2HRU A;  2RB9 A;  3G71 F;  4EI9 A;  3GHZ A;  2H8E A;  3VOB A;  3ZP7 A;  2KGW A;  3WGL A;  3WJQ A;  1Q81 H;  2LCA A;  4O4J B;  4X20 B;  2VAM A;  5CB4 A;  4I55 B;  3RYC B;  4O4H A;  5FJ4 C;  3HKC A;  3RYI A;  3V7E A;  5J2U B;  2ZVZ A;  3MBM A;  2Z1T A;  3IKF A;  5CA1 B;  4YJ2 B;  2F9Z C;  2R75 1;  1Z5V A;  4U3J A;  5HY2 A;  5CB4 B;  3RYH A;  5JH7 B;  5FNV B;  2OTJ F;  3VIU A;  1JD1 A;  1E7K A;  3LWV C;  2JNB A;  1K8A H;  4NQ3 A;  1U3P A;  4YJ2 A;  5IJ0 A;  5GAN K;  5EYP B;  3CC2 F;  3VMF B;  1QD9 A;  4O4L B;  2Z1E A;  1VQL F;  2L26 A;  2ZVY A;  3QTY A;  3CC4 F;  1FFX A;  3CME F;  3VYS C;  4ZHY B;  2YXZ A;  4I50 A;  3HJW C;  4U39 A;  3U0O A;  3N4Y A;  2CWJ A;  4O4I B;  3CB2 A;  5A2Q M;  1W5A A;  3CCM F;  2HP3 A;  2DYY A;  3DC2 A;  4ZI7 A;  1OAP A;  2KG4 A;  2VXY A;  2CZW A;  1KNK A;  3JAW A;  3DDN A;  3JVH A;  4DXD A;  1CK2 A;  1TUB B;  1RQ2 A;  3FBA A;  4BVT A;  3N2G A;  1KC8 H;  2LBW A;  1N8R H;  2HP0 B;  1FSZ A;  2HX0 A;  3D01 A;  4BT2 A;  3CCS F;  1VQ9 F;  3MCQ A;  4LCK A;  2LBX A;  1U3L A;  2VGN A;  3FPI A;  1GO0 A;  3V7Q A;  5EB0 A;  3MCA B;  3HKB B;  1W5E A;  2HQS C;  3LWO C;  1Q7Y H;  1YJ9 F;  3SIU A;  1YJW F;  1PXW A;  3JAT B;  1W58 1;  1X7O A;  5IYZ B;  2RHL A;  3LYB A;  5HXU A;  4WBN B;  4TV9 A;  2OTL F;  2WAL A;  2VGM A;  1JY8 A;  3UT5 A;  2BTO A;  2QI2 A;  2NMU A;  5EZY B;  3ZO8 A;  4O2A B;  3FFM A;  4BY9 D;  3K2X A;  1VQ8 F;  1W3E X;  3VYU C;  1X25 A;  3S0H A;  4B46 A;  5EO3 A;  3CXC F;  3N2K A;  5JVD B;  4E6E A;  1FFX B;  4BT6 A;  4ZHQ B;  1VK3 A;  2B33 A;  3KE1 A;  5GIN C;  3KJJ A;  1H7M A;  1KNJ A;  1XHO A;  2Q1X A;  3IMP A;  1M90 H;  2BTQ B;  4ZOL A;  2CHT A;  3ESJ A;  3CG6 A;  3JAS A;  2IQQ A;  1VQ6 F;  3E20 B;  1CLI A;  3J7A R;  3CYP B;  2UYJ A;  4NWO B;  4C8G A;  2RHJ A;  3WJR A;  5JCO C;  3HKD B;  1YJN F;  4EB6 B;  2HS4 A;  3LDT A;  3F0F A;  1YIT F;  3RYC A;  4O4H B;  2CVL A;  2OZB A;  5LXT B;  3KHN A;  1W55 A;  1XRG A;  3WGK A;  1KD1 H;  4X20 A;  1SA0 A;  5EZY A;  1QVF F;  3D54 A;  5JQG B;  2ZOV A;  4FFB B;  1T0A A;  2HS0 A;  1JFF A;  3CCL F;  1COM A;  1XV2 A;  3JAW B;  1UI9 A;  3LME A;  3N4Z A;  4IHJ A;  3ZP4 A;  1VQK F;  3OW2 F;  1W41 A;  2OTM A;  3JAR A;  1VQO F;  1VQM F;  3J81 M;  4B5C A;  5EAZ A;  3EOR A;  2G9I A;  4G4W A;  4O2B B;  2KTU A;  4TUY A;  1SDS A;  4YJ3 B;  3C9T A;  5JCO A;  4I50 B;  5GIO C;  3TD4 A;  1KQS F;  3F6M A;  3I3F A;  3M84 A;  3NK7 A;  3WXM B;  2IG8 A;  4C4W C;  4M8I A;  3CC7 F;  5GAP K;  2VAW A;  3JAK B;  3TD3 A;  1Q86 H;  3JAL A;  3WGJ A;  3ERN A;  1Q8R A;  1VHA A;  2HP0 A;  3C9S A;  3RYF B;  3LWQ C;  3VCZ A;  4WBN A;  5KX5 A;  2UZH A;  2R6R 1;  3TD5 A;  5MN5 A;  4DRX B;  3CCU F;  2AIF A;  2CSL A;  4ZOL B;  4X1I A;  1JN1 A;  2VAP A;  5FLX M;  2ALE A;  3IKE A;  3G4S F;  2I6D A;  4BT5 A;  3WPX A;  1TVK A;  4X3L A;  4YJ3 A;  5HY1 A;  5HY4 A;  4XCQ A;  3OBY A;  4TZZ A;  3VI6 A;  3OON A;  3JAM M;  1YQN A;  3IR9 A;  2PMP A;  2OHW A;  3N2G B;  1ONI A;  3S02 A;  3GTZ A;  3CPW F;  1PF5 A;  1W2B F;  3QUW A;  3E22 B;  2UYN B;  4EI8 A;  5EWR A;  3P4E A;  4BVR A;  3LFO A;  5BMV A;  3NMU C;  3JAT A;  3NVK E;  3VOA A;  3C9R A;  2K1S A;  4HNA A;  3AGK A;  3VTI C;  4TV8 B;  2HRY A;  1YI2 F;  2QEX F;  4X1K A;  3V4D A;  2ZOD A;  4EB6 A;  3GYQ A;  1CN7 A;  3PAF A;  1ZWZ A;  3RE3 A;  3S0W A;  2KTV A;  4G4X A;  5HP8 A;  3JCM M;  5LP6 A;  1Q82 H;  5GON A;  4RHA A;  1IPA A;  1YHQ F;  4RQO A;  4TUY B;  2Z01 A;  4BT7 A;  3CCE F;  3RYF A;  4O4J A;  3ON1 A;  5ITZ B;  2FC3 A;  5LYJ A;  2DT4 A;  3JAR B;  1VH8 A;  3CCR F;  2GVI A;  3JAL B;  2H8C A;  5BMV B;  1K73 H;  2Z1F A;  3J80 M;  5KMG B;  1DBF A;  5HP7 A;  5IT9 M;  3F0E A;  1NQ3 A;  1FNJ A;  4G4Y A;  4U3J B;  3B6N A;  3IEQ A;  5J2T B;  2GLZ A;  2ZAU A;  1U40 A;  3RA5 A;  1SA0 B;  4ZHQ A;  2IAF A;  3NVI B;  1OFU A;  1W5B A;  1K9M H;  2ZF8 A;  1U43 A;  5LXT A;  4I4T A;  1X52 A;  3Q8H A;  1TVK B;  3V3T A;  5MN4 A;  4O2A A;  5IJ9 A;  4EI7 A;  3HKE B; 
#chains in the Genus database with same CATH homology
 3FD6 A;  3VTI C;  3MCQ A;  2HRY A;  2Z1F A;  1VQV A;  1CLI A;  2HS0 A;  3WJP A;  3C9U A;  3VIU A;  3VYU C;  2ZOD A;  2HRU A;  2RB9 A;  2HS3 A;  3WJR A;  2V9Y A;  2ZAU A;  3KIZ A;  3C9S A;  5AVM A;  3WJQ A;  2HS4 A;  2I6R A;  2Z1U A;  2Z1E A;  3FD5 A;  3VYT C;  2Z01 A;  3P4E A;  1VK3 A;  3QTY A;  3VYS C;  2YYE A;  3C9T A;  2YXZ A;  2Z1T A;  3M84 A;  3C9R A;  3MDO A;  3D54 A;  2BTU A;  3U0O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...