2Z02A

Crystal structure of phosphoribosylaminoimidazolesuccinocarboxamide synthase wit atp from methanocaldococcus jannaschii
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
242
structure length
242
Chain Sequence
b'MEIKLEEILKKQPLYSGKAKSIYEIDDDKVLIEFRDDITAGNGAKHDVKQGKGYLNALISSKLFEALEENGVKTHYIKYIEPRYMIAKKVEIIPIEVIVRNIAAGSLCRRYPFEEGKELPFPIVQFDYKNDEYGDPMLNEDIAVALGLATREELNKIKEIALKVNEVLKKLFDEKGIILVDFKIEIGKDREGNLLVADEISPDTMRLWDKETRDVLDKDVFRKDLGDVIAKYRIVAERLGLL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphoribosylaminoimidazole-succinocarboxamide synthase
publication title Crystal structure of phosphoribosylaminoimidazolesuccinocarboxamide synthase from Methanocaldococcus jannaschii
rcsb
source organism Methanocaldococcus jannaschii
molecule tags Ligase
total genus 81
structure length 242
sequence length 242
chains with identical sequence B
ec nomenclature ec 6.3.2.6: Phosphoribosylaminoimidazolesuccinocarboxamide synthase.
pdb deposition date 2007-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01259 SAICAR_synt SAICAR synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2z02A01
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 2z02A02
3OROA 3VUIA 4RMZA 4RZWA 2NP8A 3QZFA 4YBZB 2WQNA 4ASEA 3UIXA 4F7SA 4R7IA 4U3ZA 2BTRA 3ZO3A 4HW7A 2ETMA 3O2MA 3KF7A 3QWKA 3OY1A 2B53A 4DA5A 2CMWA 1ZOEA 2WMQA 1KJ9A 2PPQA 4DEAA 2KTYA 1P4OA 3UP7A 4E26A 4G3EA 4ZZNA 1W96A 2W5AA 1BUHA 2GQRA 2YFXA 2W99B 2VTOA 5IPJA 4IZAA 5EQPA 1DAYA 1ZLTA 3ZC5A 5M56A 3HAVA 3F69A 5FBNC 4PRJA 5F95A 2H9VA 4HZSA 1Q3DA 2PWLA 1ZY4A 3QHRA 2W1CA 3MBLA 4FTLA 4DFBA 4DFUA 3SGCA 3GXLA 4EKKA 2Z04A 3FBVA 4UB7A 1KE7A 3FHRA 1XH6A 3NS9A 2J0KA 1NA7A 1ZMVA 3PG3A 4FV6A 4LRJA 5KZ0A 4B6LA 4EZ5A 5C8KA 3OUUA 3KVWA 1KJIA 4E20A 2HW6A 2ZV2A 3OS3A 1M2QA 3TZ9A 1WVXA 5E8XA 2R3QA 2E9PA 2NUAB 2VO6A 3SE7A 2WMAA 1LR4A 3L8SA 2QO2A 4WBNF 2OK1A 3V5PA 2J7TA 3R22A 5KMMA 5D7AA 1H27A 4RVTA 5D10A 3WARA 4OTQA 2ITVA 3NNUA 4AF3A 1B6CB 2XMYA 4EUTA 3HMMA 3TV7A 1IOVA 1UNHA 4F65A 1YW2A 5A14A 1FVRA 1M14A 3FC1X 2UZNA 4YZBA 3UO4A 3R83A 4ZY5A 3UVRA 3FY0A 2VN9A 5J2TF 5G6VA 3WF5A 3G8CA 3BLHA 1XBBA 2C30A 5IDPA 3IO7A 3LWBA 2YM3A 5H9BA 4C3RA 1UV5A 3IPHA 4MV9A 3D4QA 5HBRB 3L8VA 3FLWA 3KL8A 3Q4TA 3N4UA 4OTDA 4XBUA 3CTQA 4AW2A 4B8MA 4IZ5A 4NK9A 5EHOA 2YZAA 3UO5A 2PVPA 3ZLXA 4FKTA 1HOWA 1XBCA 4F64A 2F2UA 3F6XA 5LA6F 5CS6A 2XIYA 3EL8A 2KULA 3HBLA 4TYHB 3GCQA 5FXRA 3C5IA 4H3BA 4MV1A 4LRMA 5JVDF 5I4NA 3RINA 1I09A 2Q0NA 3EFKA 4JBOA 5FQDC 4FVPA 4ASXA 1W93A 5DMXA 5C8YF 3DB6A 2X2MA 4YAKB 1U5QA 3HAMA 5M51A 4CKIA 3PVWA 3ZO4A 2YDIA 3FL5A 3IKAA 4XJ0A 2PN1A 3AT3A 2NU9B 3V4SA 3SG9A 3QKKA 5E91A 3Q9ZA 2BZHB 4J97A 4G6NA 2Y4IB 4LQMA 3R71A 1OM1A 4EGQA 3F3VA 4D1ZA 5HTBA 2WZJA 3CQUA 3R9DA 2FPPB 3P7CA 3DXQA 4R6VA 4RSSA 3DBDA 3OOGA 2WTDA 2YN8A 4E4XA 5D7VA 3ZH8A 4TYHA 3D9VA 3E7OA 3LQ5A 4G3FA 3IG7A 3DK7A 5C4KA 3HMNA 3LW0A 2JIVA 3UQCA 5GNKA 3DGKA 1A9XA 3I1AA 3Q53A 3EIDA 2JITA 1OBDA 4XLVA 4DC2A 5JVLA 3WNZA 4BTMA 4FGBA 4PP9A 4USFA 3PXQA 4UXLA 5LXMA 4GL9A 3VIDA 5ETCA 2GPSA 3OWJA 4FV1A 4RFYA 4CT1A 2BRMA 3MN3A 4WBBB 2Y7JA 3QTZA 3BYVA 3BV2A 5HLWA 3VHKA 5IEVA 1NVRA 4BVUA 5DFPA 1W84A 3WF7A 3PG1A 4Z55A 4GU6A 4ZTNA 4FX3A 3DNEA 2XK8A 4DEGA 1W83A 3DBCA 3ZEPA 4IVAA 2GFSA 5HG9A 4ZJIA 4BTKA 3CR0A 4ZTLA 2HY0A 2HCKA 5E8YA 4GT3A 3VJNA 4BBMA 3V5TA 2O0UA 4EK6A 5LVMA 5CB4F 2XF0A 3R23A 1W7HA 1KE6A 2JFLA 3ID6C 3QCXA 5AM6A 4BR3A 3IECA 5JZNA 4FOBA 1I44A 3COIA 2UUEA 5JQ8A 4MA0A 4O4HF 4DH5A 4A4OA 3DB8A 1XH5A 4YJ2F 5IQDA 4IMYA 2B52A 4PMPA 5CANA 3D7ZA 5FEDA 3TQTA 4IHJF 3H0YA 3S95A 1PKGA 3BHTA 4RLKA 4CSVA 3VVHA 5FM3A 5E7RA 4AW1A 2XD4A 2F7ZE 3BIZA 3MIYA 4FZFB 4DGLC 3P7BA 4I0TA 3DXNA 4GYGA 4NKSA 2UVYA 3ZFXA 4D0XA 2XEZA 5JH6A 2PULA 3KXXA 3QRIA 3F88A 1KBLA 3QKLA 1XQZA 2HZ0A 3GQLA 3Q9YA 4M67A 4PL5A 4IM0A 4QNAA 1P4FA 2R3MA 4XG2A 3AC3A 5AP5A 1GOLA 3CGOA 4EEVA 4RG0A 2BZKB 3HV3A 3B2TA 2CJMA 5L6WL 4FSUA 3TL8A 3ORLA 3FEGA 4KA3A 1REJA 2YCQA 3PY0A 4XG3A 3H30A 5I9XA 4DEBA 4BF2A 4U6RA 2XRUA 3I5NA 4AW5A 3GU8A 5AV2A 1EHIA 3VMMA 3NZ0A 4IX3A 3QQFA 2YS6A 4JRNA 3LLAA 4NCTC 5AP7A 1CS0A 3Q2OA 3O8PA 3SV0A 4ACMA 4LOQA 3QQHA 5C8MA 3ACJA 2UZUE 4U81A 2J9GA 5M4FA 2JAVA 3CTJA 4S34A 1RQQA 1IEPA 5A6OA 2R3PA 4FK3A 5EK7A 2REIA 4NW6A 5AJQA 3NLBA 4IACA 3GBZA 2BRNA 4YNEA 2I80A 1QCFA 2R7LA 4F9WA 5EI2A 3FLSA 4FNZA 4XH6A 3BYUA 5CQWA 2VAGA 3BBTB 4O7LA 4OUCA 3N4VA 4FKLA 4F9YA 2PZPA 4BCHA 1BYGA 1I7LA 2WHBA 1IAHA 4O91A 4C4HA 4YUQA 5AX9A 5AP3A 4O21A 4RJ8A 4GSBA 3LCSA 4A4LA 3BEAA 3K5IA 3R7YA 3CIKA 2PTKA 3CGFA 2X0SA 5ANKA 3T8OA 4M84A 5DYJA 4I5HA 3SC1A 4YMJA 4G31A 3QRUA 3N4TA 2W6PA 3E63A 4OT5A 2HIWA 4QPSA 1OL7A 4EHZA 4ZS0A 3C4FA 3OBJA 4LM5A 3PXZA 4ZY4A 4HPTE 2DZDA 4I3ZA 2YWPA 5KX8A 3ATTA 5C1QB 4GU9A 5DR6A 2UW4A 3V8TA 1NT2A 1H07A 4RFMA 2C6IA 3B2WA 3UNJA 3LM5A 2XKFA 3KA0A 3MVMA 5CSXA 3V8SA 4QT1A 4FIHA 3GCUA 3CY2A 4HCTA 1Q8TA 4LRKA 1NW1A 3NUYA 4ITHA 1U54B 3KRJA 4H36A 4M12A 4O0UA 5BVOA 3OUNB 3SA0A 1YHSA 1YRPA 4K0YA 5HLPA 5B2KA 3VQUA 1OL1A 2E9NA 2WMBA 3FZ1A 4X2FA 4BC6A 4FG7A 3GENA 4YZ9A 2PE0A 4TYGA 4UZHA 4C38A 2QO7A 2YIWA 3LFDA 4FV5A 4JQ8A 1YDTE 5I9WA 4UWCA 5AFVA 3AT4A 3PA5A 3SRVB 3TJDA 2QODA 4CFXA 4YTCA 3CD8A 2CCIA 3QUDA 3WF6A 1W0XC 4FTNA 4X7QA 4UN0C 4BDAA 1WMKA 4FKUA 4RJ6A 4O0SA 3PXFA 1PMNA 1OL2A 4KNBA 5HORA 1U54A 3ZZEA 3GB2A 1WR2A 2ITXA 3ZSGA 2C4GA 2OF2A 4GG7A 2YL2A 1PXOA 2RFDA 2UZEA 1H1RA 4NM5A 2C0TA 3TDVA 4IZYA 2JLDA 4ASZA 2B54A 2W1GA 3VS6A 4OBPA 3VS0A 4TNBA 3CKWA 5AAFA 1KV1A 1CKIA 1ZMUA 3JY9A 4BDDA 3UBDA 5AV4A 5IISA 5M09A 2W7XA 4KABA 3OF0A 4BCPA 2BCJA 1MRVA 4WBOA 4XG8A 3SRVA 3PIXA 5TT7A 3OXIA 4ZK5A 2GNHA 1K3AA 3NDMA 4P5ZA 4X3JA 5LMBA 2V22A 5ACKA 3ZSIA 3UOLA 4Z3VA 2GS2A 3DAJA 1OBGA 5LARA 2XCHA 4C2WA 5DEWA 2QOHA 4HVIA 2UV2A 4C5AA 1K2PA 3QA0A 5CSWA 1Q4LA 1BLXA 1R39A 1KOBA 3QZIA 5J1WA 3LCTA 4YZNA 1LPUA 4WOVA 3SVVA 4L44A 3SLSA 4D1SA 3QGWA 4BDGA 3LFQA 2VU3A 1PJKA 2EXCX 4WT6A 4ZQIA 5GHVA 2UZDA 4QP6A 5CT7A 3ZC6A 5IUGA 2C00A 5KE0A 3U55A 3P1AA 5CALA 3GFWA 4BB4A 2IVVA 2X4ZA 1H8FA 2PZ5A 2WOUA 4U79A 4IIRA 5TF9A 3TKUA 1B6RA 1M0TA 4XZ3B 3TIIA 4AGCA 4EK3A 4FIEA 3II5A 5HQ0A 3QXPA 4C4JA 4DLJA 3KXMA 1EUDB 3G9LX 4KIPA 3GT8A 3GGFA 4FSNA 1PXLA 3KAKA 2P55A 3BHVA 4IB3A 2OIBA 5E8VA 3FC2A 5AV0A 3ZO1A 4AS0A 3CQWA 3PLSA 5M55A 3UO6A 3VUDA 5A4QA 5BVFA 4YJOA 5FP5A 3KXNA 4FKQA 3TACA 4R3RA 3RCJA 3DTWA 2V59A 2ESMA 3GLKA 3F5XA 5I5ZA 1RDQE 2CKOA 3NRMA 4PDYA 4RIWB 4HJOA 1H28A 5CAVA 4OTWA 2PVFA 3QQKA 4I50F 4ANBA 1VBHA 4QTBA 3TN8A 3OTVA 4NKAA 3PJCA 5KMJA 5A4TA 3FYJX 3GOPA 3NAYA 2W1IA 3BPRA 3OUZA 3JVSA 5IQGA 3KMMA 5CU3A 3LFBA 3OMVA 3SXSA 3PXYA 4YPDA 4TYIA 5C9CA 4KBKA 4U97A 3W32A 3KRLA 4NT4A 4IW0A 2VWZA 5AV3A 4UYNA 2W1FA 3R1SA 4PNIA 4EBVA 2JAMA 4ACCA 2V5QA 3VS7A 5HIEA 3K5HA 3VNTA 4N57A 2ONLC 2P2HA 5JZJA 2FSMX 3UGCA 3R00A 5CEQA 3T9TA 5KKRB 3W2SA 4LOOA 5DVRA 5ANIA 1OKZA 1UWHA 5DH3A 4RVKA 2R3KA 2BRHA 3A8WA 3ZBXA 2Z8CA 3ZXZA 3FKOA 2WQOA 5FBOA 4FIJA 5CYIA 2QHNA 4DBNA 4ZS4A 5BQ0A 4PTGA 4G16A 2WD1A 2PMIA 2WTJA 4IBMA 4IWQA 1SMHA 3DJ6A 4GEOA 3ZTXA 3VULA 3CPBA 3RK7A 2QOKA 3BQCA 1J7IA 5JQGF 2NPQA 3KCKA 2YACA 2IW6A 3R6XA 3LM0A 3SD0A 3VJOA 1YKRA 3S00A 3R8UA 3HGKA 1OVEA 2C6OA 2X81A 1VJYA 2C0OA 2XK9A 2GNFA 2H6DA 2V7OA 4Q5HA 5I9ZA 3VC4A 5F4NA 2WNTA 3GQIA 3EFWA 3NCZA 2WU6A 4QMUA 4FMQA 3UC4A 3V5JA 3W16A 2WTVA 3DT1A 3HO8A 4O7TA 2FPGB 1CTPE 1H0WA 2Y4PA 5I9YA 2AYPA 4IVBA 5L6PA 4OTRA 4GIHA 2Z7LA 2WU7A 1R0EA 2JIIA 3QX2A 4IZ7A 2C3LA 3UDBA 3UQGA 4F09A 4FFNA 5J2UF 3HX4A 2FSLX 1DV2A 1H01A 2XNNA 2V55A 4QYYA 2YA9A 3O7LD 5BPYA 5JN2A 3ORRA 1WBVA 2XNPA 2C5OA 4DH3A 1I7NA 2I0VA 4O7ZA 4ZTSA 4MXYA 4BCGA 4FKSA 4TN6A 3QQUA 4V05A 3WO1A 4FSRA 4IE9A 3V6SA 1P5EA 3C0IA 3LIJA 3THBA 3ZMMA 4RWLA 3E3BX 4E6QA 4I5MA 4GS6A 4I6FA 2R7MA 5DEYA 5E8SA 1XH4A 4O2AF 3Q2JA 3RI1A 4ZLYA 3G2FA 2NU6B 1Q8ZA 3HMOA 3MIAA 3NGAA 3HV4A 4O96A 5FM2A 4E5WA 3NCGA 4CVAA 3MWUA 4V01A 4HYHA 4QMMA 3W2PA 4EH6A 3DKGA 2I1MA 2XRWA 1Q24A 1X8BA 3EFLA 3OUKA 4AN2A 2VTHA 4I23A 4IAZA 4KD1A 4DIMA 2GDOA 3KC3A 3R04A 4FNYA 2H8HA 3LFCA 4O38A 3KULB 1PKDA 2R3IA 3CXWA 4CMOA 4JBPA 4AG8A 4ZIMA 2GS6A 2VWIA 3BKBA 1A48A 3I4BA 3UIUA 3DPKA 1BKXA 3R1NA 1EZ1A 5TR6A 4HGEA 4OBQA 3EZVA 3E88A 4NUSA 3HV7A 1ERKA 1YI6A 4RJ5A 5CF4A 4KAOA 3EQHA 1ZZ2A 2VD5A 2GMXA 1PXNA 2PK9A 3VQHA 1VYZA 5IU2A 2HXLA 2BALA 1XH9A 3F2NA 3W8QA 1IASA 1Z2PX 2QD9A 2YAKA 3TKHA 4JBQA 3QF9A 3OXTA 4IWPA 3NNVA 4K1BA 4JVGA 2QO9A 2ZMDA 4G3DA 4A07A 2DUVA 2EB3A 2FB9A 2R0UA 3DKOA 2R3JA 2Z02A 2GQSA 3VAPA 3KULA 2QLQA 3Q04A 4BTJA 1UU9A 3C50A 3DDPA 4O0WA 3ZO2A 3QCQA 1GZ8A 3N8DA 4U45A 4EJ7A 1GZKA 2FSTX 4XUFA 1PRYA 2OF4A 3OHTA 3R21A 5J5SA 2DWBA 3VBWA 4IIJF 3CCNA 2PVHA 2VNYA 3S0OA 2HWPA 1DI9A 1WAKA 1OPLA 3ATSA 4AT4A 2YIRA 3R28A 4CKJA 2W6QA 4ZOLF 4ZSLA 5CY3A 1LP4A 2OJJA 3ERKA 1Y57A 2C1AA 4HYUA 4AN3A 3HA6A 4MK0A 2IN6A 3OCSA 1MRYA 3H0ZA 3DV3A 4YJQA 3NW5A 4DLKA 2WMTA 2QOFA 4G17A 3F2AA 2XIKA 3TM0A 3L9PA 3O50A 4QP2A 4CFVA 3R8MA 2R5TA 1TKIA 2UW6A 4FU0A 2E2BA 4O6LA 3DXPA 1FGIA 1OB3A 1T45A 4B4LA 3D7TB 1BI7A 2PUPA 2QC6A 4MQ2A 4JOAA 5AP1A 4Z7GA 2QK4A 5TO8A 5HCXA 4EC9A 4MV3A 3RV3A 4Y46A 2IWIA 3EYGA 3FKLA 4ITJA 1U46A 3JZFA 3BU6A 5C1OA 4IADA 4AZSA 3LJ0A 4UZDA 3R63A 2QI8A 5H8BA 4EOLA 3KRRA 1PXPA 1V1KA 4F1OA 3HECA 2O64A 4H3PA 2VTRA 2BUJA 3LFFA 3NSZA 4JDJA 4JR7A 4O7WA 5EOLA 3R7EA 1B6SA 1JWHA 5CAPA 2X6EA 2V0DA 3RCDA 5J87A 1BL7A 3PY3A 4MD7E 3HKOA 4FT0A 4IDVA 4R78A 3GU6A 3QC4A 1YOLA 5J1VA 2YCSA 3OW4A 2CNUA 5I9VA 3E8CA 2X9FA 3HNGA 4AZTA 5EYKA 5HI2A 1CQJB 2XJ2A 5FEEA 3RAIA 4QP8A 3D7TA 3PRFA 1P14A 2WTWA 3GCVA 4QMPA 4U9AA 5HLNA 5FEQA 1P2AA 2A19B 2UVZA 5KUPA 1M52A 4FA2A 2WPAA 4M15A 4OT6A 3PFQA 3JY0A 2ITNA 1XH8A 3G8DA 3QLGA 2J5FA 3COHA 1DIKA 5KMKA 4IX5A 3W2QA 5E1SA 4F08A 4WG5A 3RPVA 2G01A 4DTAA 3F82A 3GU4A 3BWJA 3MA6A 4RIXB 5EFQA 4K6ZA 4AE9A 2NU8B 3V4ZA 4O7RA 1PHKA 2R2PA 1KJ8A 3VRYA 1WBSA 5HO7A 4QNYA 4QRCA 4XX9A 1Z5MA 2X7FA 3DAKA 2X2LA 3HP5A 4HVDA 2PMLX 2W1DA 3A62A 3WE8A 5CSVA 4EBWA 4C3FA 4AZVA 4OTGA 1CM8A 4EOOA 4N6YA 1A9UA 3FZPA 3PY1A 4Y85A 3ZLYA 4F1TA 5L6OA 1YI4A 4O7VA 4DGGA 2ERKA 3L9NA 1H26A 2OJGA 3RJCA 2XM9A 3G90X 3WE4A 3FLYA 3GC8A 4NSTA 2BAKA 3TUDA 3F3TA 3MWEA 4NJDA 2C3IB 4GMYA 4YO4A 2R3NA 4GVAA 4I1ZA 4XX0B 2PZRA 4QTCA 3EQGA 1OL6A 2VTSA 4RIXA 4D2RA 2ZM4A 4QYEA 1VKZA 3KAJA 1Q97A 2QU5A 2F2CB 5HEZA 2B9HA 4U42A 4O7NA 3IS5A 1WFCA 3QUEA 3EYHA 3I7CA 2JD5A 4JI9A 2BR1A 4M69B 5IA2A 2C6DA 4E4LA 2Z2WA 3FJQE 5CAUA 2Z60A 2SRCA 3GI3A 5BYLA 4L3PA 5GIPE 4WO5A 4C36A 4CFNA 2CHLA 5D12A 1GAGA 2C69A 2OKRA 2WYOA 3EQPA 5J9ZA 3BWFA 4BCFA 1RE8A 3FLNC 2ZDTA 4QQTA 4GG5A 2HXQA 5A46A 1NVQA 3CEKA 2B1PA 3RV4A 1GSAA 2P0AA 5LYJF 1FMKA 3A7GA 3BCEA 3NPCA 3QRTA 5J95A 4C35A 2JGZA 4O6EA 5EM5A 2QOIA 3MDYA 1G3NA 2IG7A 5HG7A 4N70A 2ZV7A 5D41A 2RL5A 4XV3A 3FI4A 3U9CA 4IWDA 3RWPA 4BZDA 1ZXEA 1R3CA 4YTHA 5HICA 2W1ZA 3CP9A 3L9MA 3E8DA 3ZYAA 4RJ3A 3RK5A 4ZXTA 4M7IA 2UW0A 4FTMA 5HE2A 2I7QA 5IDNA 2R3LA 2I40A 3FI8A 5FGKA 2UZTA 5C4LA 2VQDA 4KS7A 4H1MA 3CPCA 4FUXA 2CKEA 3BX5A 4TYEA 2YIQA 2BIYA 3V04A 4Q9SA 3R9OA 4LL5A 4WUAA 2BTSA 5AUYA 3NX8A 5HIDA 5CASA 3BG5A 4UWBA 3E87A 3MGYA 3BZ3A 3KK8A 4LOPA 4FSYA 3KRXA 4AU8A 2R7BA 4FTRA 3UZPA 4YHFA 1BNCA 4PMTA 3TV6A 4A4XA 2CPKE 5IQBA 3MFTA 2JKQA 4D5KA 4YB8B 3U9TA 1TQPA 5D8DA 4IAYA 3R1QA 4DLIA 2QR7A 3FY2A 4MEDA 2OH0E 5LVNA 3OVVA 2EB2A 4MXCA 2C5XA 5EDRA 1Z2NX 1Z57A 1DI8A 2YJSA 3QD2B 2VPQA 5E92A 3RTPA 4J95A 2YZMA 4I93A 4FIFA 1YI3A 4ZTHA 4CD0A 4TV8F 5IZFA 4CCBA 3F5PA 1OKYA 2F4JA 4NW5A 4EGJA 4CRSA 5M44A 4TYJA 1OPKA 1O6KA 2W70A 4I5PA 1KE8A 2YCFA 1BL6A 5HU9A 3VS1A 3O51A 3E3PA 1KOAA 4ANLA 3C1XA 3JXWA 1VR2A 3V5WA 2F57A 1J1CA 2R3OA 3D5VA 3LXNA 3MVHA 3OWKA 4FV4A 4EOKA 1DS5A 3MVLA 2CLXA 2BFXA 1H1WA 2WTIA 4NU1A 5BVKA 1JBPE 4QP9A 3Q3BA 4BGQA 2P0CA 3EQCA 4XP0A 1CKPA 4L68A 2OG8A 4AA5A 4ZZOA 2PZYA 2CLQA 4JBVA 3QWJA 4A06A 4GCJA 5IEYA 3KU2A 3E92A 4M14A 5L8KA 2CN8A 2R0IA 4O81A 2E9OA 4G3CA 2PE2A 2WMWA 4FT3A 2VTPA 1ZYCA 2R9SA 3ANRA 5BX0A 3GC7A 3VHEA 2QKRA 1RJBA 4LFIA 2ZDQA 1NY3A 4IZOA 4MWHA 2BAJA 4AOJA 3VF9A 2ITQA 4WG3A 1CMKE 2IVUA 4I6BA 4PQNA 4AP7A 3OCGA 5A4LA 3UMXA 5BMMA 3LE6A 2YERA 1JDEA 4DT8A 5CU2A 2W96B 2X0GA 4P90A 3WBLA 3ETHA 3ZRLA 4CZUA 5E8ZA 4UYAA 3TKIA 3TEIA 3Q4UA 4I4FA 5FUTA 3TG1A 2FO0A 4RA4A 3FQHA 3VBVA 1Y91A 3FMDA 3QTUA 4IJPA 2W17A 4RJ7A 4ZZMA 4BBFA 1U59A 3DBQA 4QMSA 4EHVA 3MS9A 5FG8A 2BPMA 3QD3A 2ZV9A 3OFMA 3TWJA 3WZDA 4MD8E 5EW3A 1O9UA 4HYSA 4K18A 4ZJVA 3G33A 2YDJA 5EI8A 4LMUA 4R5SA 4F70A 3MYGA 4G2FA 3NWWA 2YCRA 4O4IF 4E5BA 3BHHA 3AC4A 4BZOA 4QSHA 2RIOA 3GNIB 4ZSAA 3ZEWA 2C6LA 4FKJA 3TXOA 4UXQA 3U6HA 2G15A 3O96A 3QRKA 4S2ZA 2PVKA 4FT5A 4WG4A 3ZS5A 1LUFA 1AUVA 4WIHA 2W6MA 2C6TA 5KMNA 5J9YA 3ZUTA 3W2RA 5L2WA 4FSQA 5HNGA 4EOPA 5CU4A 3RM7A 4DGMA 4O0RA 4EUUA 2VTJA 1SYKA 2UW5A 5ANOA 4RQKA 3QGYA 3U6IA 3F5UA 4AN9A 4LUEA 1JKKA 3VRZA 4AUAA 3F3ZA 4AAAA 4Y72A 3F2RA 2HZ4A 4I22A 4NCTA 1OITA 3Q96A 4L43A 3FMMA 3QFVA 4EZ7A 5HVKA 5JEBA 3KRWA 2YM7A 3ULIA 4YZDA 1GY3A 3AT2A 3VUHA 2X1NA 4OW8A 3RALA 4BN1A 2XCLA 5FD2A 3HRCA 5E8UA 3PXKA 4J71A 4U3YA 2C47A 3FZSA 5L2IA 2OXDA 3FQEA 4BY9E 3N51A 5AUTA 4PTCA 5IMEA 4JDIA 2PVJA 4I4TF 3M1SA 3QA8A 5BVEA 5AMNA 4DAWA 1Z2OX 4JIAA 5C26A 4JJRA 1E4EB 2UW7A 3MV5A 4C61A 5HG5A 3VBYA 4FODA 4I4EA 3I60A 2WTKC 4B7TA 4FKRA 2OXYA 3S2PA 3TZ7A 3NMUF 4FG9A 3ZFMA 5AIRA 3IGOA 4EQCA 5LOHA 1W98A 4BCJA 1S9JA 4FNWA 5CU0A 4F0GA 5H8EA 4EQUA 2ITZA 2VNWA 2IVTA 3KVXA 5HKMA 4QPAA 3C13A 3R8PA 3R02A 3ZUUA 4FTQA 4N0SA 4EYJA 4B0GA 3UVPA 4D0WA 3I6WA 1XBAA 2Q0BA 1M6VA 1SCUB 1ZYSA 4YZCA 1CSNA 5IQFA 3G6HA 3KQ7A 3MH2A 3Q6WA 1GIHA 5KCVA 1E4EA 4MXZA 2QU6A 1YXSA 3UQFA 4G5PA 4C0TA 3SKCA 3HMIA 2GNGA 5E8TA 4B99A 5KX5F 2R87A 4DG3E 5J7HA 2B0QA 1JSTA 2CKQA 4IH8A 5LWNA 2P4IA 1PXMA 3I0OA 3LCKA 5F20A 4DFZE 4TZRA 2ZAZA 3MPTA 4L45A 1H0VA 5LVLA 3LP8A 4RIYA 2PVLA 2Y6MA 3MY1A 5HVYA 3TZ8A 2B9IA 3ITZA 3FI3A 1OI9A 4L3LA 3HB9A 4IAFA 3NYNA 4O0TA 5AEPA 5M57A 4IB0A 4Y5QA 3F3WA 1LEWA 3VBXA 5IF1A 2R7IA 3L9LA 1JLUE 5HO8A 5D11A 5K4JA 3KK9A 4FFMA 1M2PA 3NUUA 3ORTA 1YXVA 3NUXA 2GNLA 4P4CA 4F4PA 2YRXA 4TW9A 2YHVA 3V6RA 4FUYA 4D5HA 1OMWA 4YJVA 2QHMA 3DK3A 4EZ3A 4TTHB 4X6QC 3QD0A 4Y8VB 4U43A 3LHJA 4WA9A 3VBTA 5FLFA 5JFSA 2CGXA 4EORA 4I55F 3E64A 3R7OA 3UC3A 2ZM3A 4CEGA 2YISA 4ONAA 1URWA 3FMEA 1FQ1B 3R2YA 1WCCA 4XEYA 1JKTA 3AGLA 5CI6A 4AFEA 2OZAB 3V8WA 4RC2A 5FXQA 4YJUA 3FUPA 4IC8A 4MF1A 3UIMA 3H9RA 3RFCA 3LPBA 4PWNA 4D9UA 3PJ1A 4JAJA 2QKWB 4L1KA 3ZM9A 4XYLB 2GTNA 3BYMA 4XP3A 4ZI7F 1U5RA 4U41A 1Q62A 3ZDUA 5BMVF 2YABA 4MV4A 1S9IA 3MESA 4L52A 4NWMA 1BX6A 4TUYF 4QQCA 4A9RA 5J9LA 4GFOA 4ZTRA 3UODA 3BBWA 3PE1A 4ALVA 4ANMA 5IUHA 4FEXA 5ANDA 5LVPA 3QHWA 4XOYA 5T3QA 4PP7A 2JBOA 3AC8A 5TOZA 4DYMA 5IMXA 4Y73A 4ITIA 3SOCA 3EN6A 3OD6X 2FA2A 4KBAA 3EQDA 1BMKA 4BICA 5CEIA 2OZAA 4HGSA 3UJGA 5K4IA 3PJ2A 5DT4A 3T3VA 4DBXA 4MV8A 1OZ1A 3GCSA 1JSVA 3UIBA 5AUXA 1KC7A 2PU8A 5B0XA 1JQHA 3PSCA 5IH6A 4L01A 2XZSA 2W05A 4FT9A 3PRIA 4MNFA 4EH2A 4EL9A 5JH7F 1JLLB 1R78A 2RG6A 3QCSA 4L42A 5LP6F 1G5SA 3O0GA 4H05A 3M11A 4H3QA 4DEEA 4HGLA 4QTEA 5IA1A 5JGBA 2J0IA 4C5CA 3RUPA 4IFGA 4ENXA 4DINA 4MHAA 4RC4A 3MJ1A 3AW8A 3D94A 1IG1A 3TDWA 1FPUA 3PPJA 4FG8A 3UNZA 1K9AA 4DFNA 3TIYA 2DLNA 4MX9A 1GIJA 3B8RA 2GHLA 4BRXA 3DTCA 5DA3A 5KBRA 4TT7A 5IQEA 3K5UA 3CC6A 2WO6A 4KSQA 2VR1A 3PLAE 4IHPA 4RZVA 4W4VA 4BBEA 4FFRA 2ITWA 2W71A 3C7QA 2OSCA 3K3IA 5EYMA 4OLIA 4U8ZA 4RWJA 4E8AA 4FEQA 2W6ZA 2W5HA 4WNOA 2GQGA 4QYHA 1YVJA 1TVOA 3A7JA 4X21A 2XNOA 3W55A 5HVJA 5LVOA 2UW8A 5G1XA 1ZOHA 3F7WA 4FICA 4G34A 4HOKA 2BKZA 4J1RA 4HNTA 1TQIA 4GIIA 5DHJA 3PP0A 5HCZA 3RWQA 4F6UA 2PVRA 4BIEA 2UZVA 3KMUA 4AA0A 1QMZA 3U4UA 3TV4A 2J5EA 3RP9A 2UZLA 2ONLA 4ZY6A 3BLQA 4XRLA 1IA8A 3R5FA 3A8XA 3DLSA 5DI1A 3HUCA 5KZIA 4YZMA 5C1PA 5IA3A 3FL4A 5CTPA 4S31A 2QCSA 1AD5A 1W8CA 2OJIA 1Y8GA 3OZ6A 4RC3A 3LMIA 4QMLA 4YLJA 2H34A 2GHMA 2XCKA 3GC0A 4X2JA 4E7WA 1UU8A 3UZTA 3TW6A 3MSSA 4IC7A 4LL0A 2CKPA 1H25A 1UVRA 3FYKX 4TWCA 4W4WA 2ITYA 3EN5A 3GCPA 4WUNA 4S33A 3R7IA 4KINA 2Q83A 4H39A 1ZRZA 5FTOA 1AUXA 2PVNA 4JQEA 2OIQA 5CLPA 1SNUA 4ZHQF 3N9XA 3BGPA 4DH1A 2NRYA 4O0VA 4UALA 4GUBA 4ZP5A 3ORPA 3CD3A 1QPDA 2VO0A 5IUIA 5EDPA 1PXIA 1VZOA 5KMOA 2YYAA 3LXKA 4MH7A 1UU3A 2YM5A 3MB7A 5A4EA 2BKKA 4HVGA 2J0MB 4QYFA 1MP8A 3TI1A 3SXRA 4UX9A 2QOCA 3VUKA 4GW8A 2YS7A 1WBNA 3ZOSA 4FTOA 2CDZA 4F9CA 3ENMA 4I24A 3ZBFA 3TNHA 4HCVA 4YJSA 5GJGA 2RG5A 4AX8A 5KNJA 2IO6A 2UZBA 2G2IA 4K77A 2VGPA 2XYNA 4NZWB 1IOWA 4KSPA 4C2VA 5EKOA 3WILA 4C4GA 4OTFA 3FDNA 5AUWA 5ICPA 2I0EA 5IH5A 3FAAA 5EH0A 3DU8A 5DIAA 5AAEA 5C03A 3VOTA 4N6ZA 3MJ2A 5F94A 4EQMA 1O6YA 2LAVA 3IW7A 4BCNA 2W06A 3UE4A 3IDBA 4M0ZA 5A3XA 3CTHA 1M7QA 2I6LA 2C5NA 4V04A 4AACA 5KKNB 2JC6A 5CWZA 2C68A 3E5NA 3Q5ZA 4AWIA 4PMMA 5CZIA 2YJRA 3M42A 2VO7A 5ANEA 4EHGA 2AC5A 4KKEA 1SVHA 4NFMA 2YRWA 3DQWA 2Y9QA 4QMXA 4EOIA 1M0WA 2YDKA 2UZWE 2HELA 3KGAA 4R3PA 4XG6A 5LMAA 2WIHA 5CAEB 3Q5IA 1ZOGA 2CNQA 5DWRA 3TNIA 2NRUA 3G0FA 1OIYA 2Z7RA 5M08A 3H4JA 4IVDA 4PTEA 2PHKA 2IZRA 2HYYA 3HVCA 2RFNA 2W6OA 4GK4A 2XNMA 2W4KA 4KUJA 2HAKA 4L00A 3RPSA 4I92A 1APME 5HNIX 1UA2A 3DOGA 3UPZA 4FI1A 2ZYBA 4FIGA 4FNXA 5E9EA 3MTLA 4CFMA 1OIRA 1C30A 4PX6A 2QF7A 1JNKA 4MNEA 4RX8A 4YAJB 3DQXA 3IW6A 3OXZA 1OKWA 5B2LA 4BGGA 4FKOA 4FV9A 4USEA 1UNGA 4B9DA 4CV8A 2PL0A 4K11A 3OCBA 3WZUA 5JKGA 4NTSA 3IW4A 4O0YA 4IX4A 5CF6A 3PA4A 4U40A 4DHFA 1HCLA 4PDOA 1H00A 1H1PA 3PIZA 4YHJA 4FZDB 2WXVA 4K2RA 3KN6A 4DE4A 2QR8A 3KXGA 4AT3A 3QALE 4BI1A 4D1XA 5M06A 4IAKA 5ETAA 1ZWSA 2ETRA 2RFSA 2X4FA 3BHYA 4E4TA 3D0EA 3LAUA 1KV2A 2DQ7X 3FMNA 3LFSA 4MV7A 3FPMA 2OJFE 4R77A 4AGWA 4Q9ZA 2G2HA 2IP4A 4XV1A 3P23A 3ANQA 4DN5A 1E1XA 2QG5A 1JSUA 2JDSA 4YTIA 4E6DA 4XG9A 4WD5A 3AD4A 3Q52A 3DLZA 4CV9A 1GIIA 3BE9A 1G8AA 3I6UA 5GIOE 2OLCA 2WMUA 2FP4B 3NAXA 5BYYA 5CSPA 5H3QA 3Q32A 4XS2A 2B4SB 3EQFA 2ZMCA 4G5JA 3ORKA 5CENA 4RPVA 2VV9A 3RAKA 2XEYA 4B8LA 3JRWA 2W6NA 3FMLA 3NNXA 3NUPA 3AGMA 4FV2A 2V58A 2C6EA 2F49A 4AGUA 3C4ZA 3QBNA 4I21A 5CEMA 2WEVA 3NUSA 3PSDA 4KKHA 4BIDA 4FFLA 2XS0A 2LGCA 2ZB1A 5DRDA 4FKWA 2BZJA 3DAEA 3TNQB 2A27A 4EH3A 3CLYA 5IA4A 4RA5A 2VX0A 1UKIA 3PA3A 4ENYA 1ULZA 1Q5KA 1G8SA 1OIUA 3DFAA 3VN9A 3A2CA 2OBJA 4ZTQA 3N6RA 3DNDA 2SCUB 3T9IA 3O17A 2GLTA 5CEOA 4FV7A 1ZYJA 1UKHA 2XKCA 4ACDA 2EWAA 3P86A 3VS4A 4ALUA 2BRBA 3SDJA 5HE3A 3ULZA 3OEZA 3V5QA 4EK5A 2XUUA 3BGZA 1OL5A 3B8QA 1PMEA 3WOWA 2OWBA 4FTKA 4RVMA 2A0CX 4HQ6A 3HV5A 3A61A 2R7KA 2R3RA 3ETJA 4OGRA 5L8JA 1V0BA 4W8EA 3CJFA 5LMKC 3G15A 3GU7A 3UVQA 3ZLWA 3SW4A 4L46A 3SOAA 4TNDA 2V5AA 3K54A 3DKCA 4RVLA 2A4LA 2PUIA 2JDTA 3W1FA 2FVDA 1XJDA 4GKHA 3HDMA 2OLSA 2Z7QA 3OOMA 3BU3A 3AMAA 4QMNA 1ZAOA 4R5YA 3F5GA 4AOIA 2GU8A 3R01A 4PL4A 4E6AA 3D14A 4I94A 4ASDA 4YSJA 3TINA 5EM8A 1M7NA 3ORMA 3R0TA 4FL2A 4U44A 4EOSA 4WRSA 2BHHA 3ROYA 3BELA 3DZOA 4YSMA 2OW3A 2WQMA 3ZDIA 3GVUA 5D1JA 3ZFYA 4E93A 4F6SA 4PNKA 2O65A 1MQBA 2FB8A 2OGVA 3LXPA 4FSZA 4N4SA 4U5JA 5HE0A 5LXTF 3DKFA 3PUPA 5JK3A 5ETIA 3EWHA 3MFRA 3IOPA 2HOGA 1H1SA 2QNJA 3NVMB 1PXJA 4BI0A 4CG8A 4DGOA 3P79A 5BVNA 5EZYF 3TNWA 3PPKA 2BMCA 1DM2A 3OW3A 4U7ZA 5K3YA 3VUMA 5JSMA 4FKGA 1TQMA 5JRSA 4FBXA 4DEHA 4FVRA 4BI2A 3DJ7A 4IQ6A 4O0XA 4GT4A 4I20A 4I6QA 4L8MA 2WB8A 5F1ZA 3T3UA 4M9UA 3KF4A 3OC1A 4UBAA 4KRDA 2Z7SA 3AC5A 4AFJA 5M4UA 4MV6A 3R5XA 4NL0A 4HNVA 4K8AA 4ZLOA 3NIEA 4F63A 3GC9A 4FSTA 1YHWA 4L3JA 4MTAA 2J6MA 4OBOA 5JQWA 4BCOA 4L53A 1HCKA 2CNVA 2R3GA 4J99A 5AP4A 2NO3A 4FZ7A 2W9FB 4FYOA 3MH1A 4DFLA 4CNHA 3HZTA 2YIYA 4TL0A 1JKJB 3EFJA 5EHLA 2GFCA 3D83A 4XYFA 2JDVA 4FZ6A 3G51A 5E8WA 3SG8A 5BUEA 2W9ZB 1R1WA 3TIGA 4DFYA 3HYHA 3MB6A 4TWOA 3QFFA 2XIRA 3MPAA 2J2IB 1QPJA 4HVHA 4BDHA 4TXCA 4AGDA 4BCQA 5ETFA 4UY9A 5AM7A 4RLLA 4CTBA 5JFXA 3KY2A 2JKKA 1XO2B 3D15A 4DH7A 4L7SA 5EHYA 5EI6A 4FKIA 4ZSJA 5H2UA 3V3VA 1FGKA 4H58A 1SVEA 4UV0A 2PSQA 4W4YA 5ANGA 4AA4A 4CZTA 3COMA 1DAWA 1OKVA 3DBFA 4HNFA 3CY3A 3E8NA 2YZNA 4Y8DA 3FHIA 4UWYA 3PZEA 3JZIA 4LGGA 4Q5EA 2EVAA 4EOMA 3R7UA 3NNWA 3ORZA 3S1HA 4H1JA 5KBQA 3AXWA 2GSFA 4MYGA 4X3FC 1B38A 3RPRA 5JT2A 2FGIA 2OICA 3A4OX 5EOBA 4FKPA 1EH4A 2ERZE 4Q2AA 2B9FA 3C9WA 2HJWA 4C02A 4JQ7A 4R7BA 2BFYA 4L7FA 3ZSHA 2OXXA 4EKLA 5L2SA 4IAIA 5DOSA 5A4CA 1Z9XA 1VYWA 3FZOA 3H10A 1FBNA 4CCUA 1FVVA 2X2KA 4YJNA 2RFEA 2QOQA 3E62A 3LFEA 3LJ1A 4QP4A 1YXUA 4QMWA 3BLRA 3NVKI 2VX1A 4GFMA 1JAMA 3DK6A 3QTWA 5CA1F 5HX8A 3UPXA 5LQFA 5BMSA 3QX4A 4MKCA 3QD4A 4BDFA 5LWMA 1GZOA 5HU3A 2WMVA 2VWXA 4YC6A 3RPOA 4I0SA 1QPEA 2RF9A 3MWDA 2JKOA 4AZWA 2R7NA 3HRBA 3MH3A 5DT0A 4JAIA 2OFVA 1ZMWA 4WRGA 1OUKA 2R86A 4IM3A 4MAMA 5IQIA 2BDWA 2GCDA 3FE3A 3CBLA 3UP2A 4L67A 1ND4A 3C51A 1PW2A 4RJ4A 4XRJA 3FSFA 3CE3A 4AXAA 2CGUA 2QVSE 3LZBA 2W5BA 3POZA 4PDPA 4YHTA 3TNPC 4EH9A 4M8TA 4F7LA 4JG6A 3JYAA 4PF4A 1C3OA 3QRJA 4RBLA 5B2MA 4IAAA 4ACHA 3VPCA 1KWPA 4BGHA 2ZJWA 4TWNA 4C34A 5AX3A 3ZCLA 3P5KA 3GP0A 5JMSA 2RKUA 4JDHA 1PX2A 2CGVA 3FPQA 4CFFA 4I5CA 3OCTA 2GS7A 3AD5A 3W10A 3WZJA 3FMJA 5A54A 1NVSA 3GOKA 4FL3A 5FP6A 3ROCA 4CKRA 3ZRMA 3SQQA 3FKNA 5A6NA 5HGIA 4XMOA 3PSBA 4S32A 5CVHA 4HR7A 3D5WA 2ZDHA 3C4CA 1Y8YA 4FR4A 2PZIA 3K3PA 5L8LA 1PYXA 3E8EA 2Y6OA 3A99A 3CJGA 2ZDGA 4RZQA 3BYOA 3BRBA 3DA6A 3PYYA 4X2GA 4YC3A 3RM6A 4CMTA 4YP8A 5HX6A 4QMVA 4M3QA 2WELA 2Y8OA 3AC2A 3ORIA 5LOVF 4ZEGA 1QL6A 4E6CA 1BXRA 2V7AA 3UYSA 1R0PA 3HP2A 3OP5A 2WFYA 3FZTA 4IB5A 4WHZA 4F7NA 2VTMA 5BNJA 3UTOA 2PMOX 1EUCB 2VO3A 3R1YA 5GINE 5EYDA 5B7VA 3LQ8A 3R8LA 4BHNA 5IQAA 2WMXA 4PY1A 2A1AB 2VTQA 2OZOA 3QZHA 2WTKB 3ALNA 2OI4X 3BE2A 2XBJA 3PXRA 3QLFA 2FYSA 4ERKA 2G1TA 3EOCA 1YWNA 4UEUA 4GK2A 3FXXA 4QMQA 5M07A 1REKA 3LMGA 3MH0A 5CEPA 4J8NA 4O7YA 1WVYA 5CQUA 2X7OA 3HLLA 3ALOA 3I7BA 1PY5A 2BZIB 3EKNA 4C58A 3EH9A 2E9UA 3RAWA 4AQCA 5IYZF 4HPUE 4WNPA 3WO0A 4GJ2A 4X2KA 2ZOQA 3PJ3A 1URCA 4FIIA 3I5ZA 4AE6A 4BTFA 3FZRA 1J7UA 5HBEA 4KB8A 3VPBA 2IZUA 3UG2A 5J8IA 4ERWA 5FDXA 4O2PA 4YJ3F 4BZNA 1M2RA 3UFXB 1V0OA 4R1YA 4G9CA 2BILB 2QOBA 2YZGA 3BYSA 3ZHPC 4YU2A 5BUJA 5JQ5A 2XIZA 3P7AA 3ZUVA 2GPWA 1CDKA 5DR9A 3CSVA 4FL1A 4Y95A 5E90A 3SXFA 4DEDA 4JX3A 5CZHA 2DYLA 1YHVA 2XVDA 4YBKA 4XP2A 3K3JA 4G6OA 2VTTA 2CZGA 3Q4ZA 2ACXA 3W33A 4NJ3A 4EOJA 2XK3A 3IK3A 1O6LA 2X6DA 3NUAA 4ANSA 4EK4A 3MJFA 3BEGA 2QONA 1STCE 1Y6AA 3PZHA 4LV8A 3UZRA 3P08A 3Q9WA 2HENA 4J8MA 4CT2A 3KCFA 4U80A 3ZLSA 4FV0A 5T6KA 2CSNA 2F7XE 3EHAA 1ZZLA 5JFVA 4G6LA 5KHXA 2ZV8A 3SAYA 5AA8A 2Y4IC 1XR1A 2QOLA 4CFWA 4EH4A 2GHGA 5CAQA 4ZTMA 5ANJA 1H24A 2C1BA 4JR3A 2DIKA 3LCOA 3BU5A 3JPVA 2XNGA 1XHAA 4G9RA 3FI2A 4IB1A 4IDTA 4XCUA 3RVGA 4O2BF 2PE1A 3PE2A 3QYWA 4BYIA 4L9IA 4NM3A 2C6KA 3TCPA 2XBAA 3DY7A 1JPAA 4ZAUA 3FLQA 4NYEA 3U87A 5AIKA 3QC9A 4OTIA 4IJ9A 2W0JA 3OT8A 4YNOA 4RIYB 1IR3A 1FVTA 5EYCA 5CX9A 4FYNA 5AUZA 4JXFA 4IEBA 1YXTA 3H9FA 4TPTA 5E4HA 3QTQA 4E1ZA 4U0IA 5AA9A 4ANQA 5JRQA 1PK8A 1CQIB 4GH2A 3F61A 2UVXA 2PUUA 3F7ZA 4C4FA 3TTIA 2HW7A 3C4EA 1UU7A 1Q8UA 5F9EA 1A06A 4YJPA 4IANA 3VS5A 4AZEA 3A7FA 2J4ZA 3NEWA 5AWMA 4AOTA 2DS1A 2RGPA 2F9GA 3HV6A 4JX7A 4QQJA 5EW8A 3VS2A 3VW6A 3BV3A 4W8DA 4GRBA 4WNMA 3WYXA 3WF8A 4NFNA 4A9SA 4ALWA 1J91A 3F66A 3IQ7A 1Q8YA 2EU9A 3RMFA 3ZZWA 2BDJA 2QLUA 4D9TA 4EHEA 1B39A 5BPFA 5KMLA 2V62A 2PUNA 2J0LA 2ZM1A 3VO3A 2C5VA 4C3PA 2IZSA 5I9UA 3U54A 3EL7A 3WI6A 1YWVA 2C6MA 4APPA 4C4EA 4L6QA 4TV9F 2BAQA 2J50A 4M97A 3C4WA 4TY1A 2AUHA 2XK4A 3HDNA 3PVUA 4EC8A 4HNUA 2VGOA 3FSKA 4KWPA 1H1QA 3Q2MA 3P0MA 4RWIA 3L1SA 2X8EA 3WZKA 2EXMA 1Q99A 3DJ5A 4QP7A 4C59A 1OUYA 4XG7A 2BRGA 4GJ3A 3LJ2A 4I41A 4RFZA 5D9HA 4QMOA 3AC1A 2GNIA 3IW5A 4F7JA 1J1BA 4X6RA 3R9RA 3QTRA 2WQBA 4C62A 3O8TA 1GSHA 4X2NA 3U8WA 1LEZA 5AP2A 4CXAA 2JIUA 2CGWA 4J96A 4WSYA 3SHEA 2WAJA 4NIFB 3VA7A 3FLZA 5CU6A 5JGAA 3NR9A 2FUMA 3FMHA 3MFUA 4K9YA 2W1HA 2XH5A 3LFNA 3VW8A 4O83A 5EG3A 1U4DA 4ZMFA 4A9TA 3ETAA 5CF5A 2OU7A 2VZ6A 3DFCB 4RQVA 2VWYA 4S30A 4P2KA 3ZXTA 4CFUA 5EKNA 5HD4A 3F3UA 3Q60A 4AZFA 5DBXA 3PDTA 4EH8A 4QOXA 3EKKA 3U9NA 4LMNA 4I0RA 1ZARA 4DCAA 2CCHA 3E93A 3BHUA 1NXKA 1KE5A 2WIPA 2QG7A 4DG2E 2BIKB 5C01A 3Q9XA 4BCIA 3G0EA 3HEGA 5CXHA 4FEUA 4GUEA 1UNLA 4M0YA 3R8ZA 5HBJA 3W18A 5AADA 1F0QA 2W4OA 4BDCA 4EI4A 5K5NA 1JKLA 2VX3A 4V0GB 3RNIA 5IQHA 5KO1A 3DZQA 3L8PA 3TTJA 3HUBA 2J90A 2NNWB 2YM4A 3WF9A 4C37A 2VWVA 3QTXA 3RAHA 3HA8A 2BHEA 4BHZA 4FFOA 3PP1A 3HRFA 3QL8A 5IA0A 3HMPA 1KSWA 2PVYA 1CKJA 3NIZA 3ORNA 3K2LA 3H9OA 4J53A 4RIOA 4XHKB 3IGGA 4BDBA 2WEIA 5FRIA 5BVWA 3L8XA 4JLCA 4XLIA 3TUBA 1FINA 5HNBA 2O3PA 3RHKA 3P4KA 3I12A 5EM7A 3QCYA 2QURA 4YURA 4Y5HA 3CQEA 2VUWA 3DBEA 2P3GX 4QMZA 5DG5A 5FTGA 2ITOA 3NYXA 5AP0A 2XK6A 4V0GA 2UZOA 1L3RE 1SNXA 4A9YA 4RX7A 1F5QA 3O7LB 4AT5A 3S4QA 1YQJA 3G5DA 5T68A 4YBJA 4DEIA 4LYNA 1GSOA 3ENHA 3UOKA 3FXZA 3RHXA 4CMUA 5HIBA 1JKSA 5BYZA 3ODZX 4JT3A 4LI5A 4TRLA 2G2FA 4AW0A 2DWCA 4OTHA 2YW2A 5HG8A 1WBWA 2XJ1A 4F6WA 4F99A 2R82A 3REPA 2WGJA 2JDOA 3ACKA 3DDQA 1YWRA 4FV3A 3S3IA 4EWHA 3CS9A 4P7EA 3ODYX 1T46A 5GJFA 3C0GA 4YLKA 3KALA 4HYIA 4JDKA 4DCEA 1PYEA 4ZSGA 2IZTA 3AOXA 2WOTA 3A7IA 3NW6A 3GFEA 3OEFX 3PJ8A 3Q4CA 4PV0A 5DPVA 5EW9A 4QP3A 4MVFA 3U4WA 3V5LA 4DT9A 3EJ1A 3PWYA 2H96A 4ID7A 3ZM4A 2HZNA 5HBHA 4ACGA 4HVSA 1Q41A 4FSMA 5GJDA 5LJJA 1CE8A 4ORKA 1FOTA 4JG8A 4C33A 4EK8A 3OT3A 4O2ZA 4DTBA 1J3HA 2OFUA 1BI8A 2XJ0A 3MW1A 3QAME 4FTJA 4I6HA 5DGZA 4BDEA 4C4IA 2PMNX 2R4BA 4Z7HA 3P78A 4LGHA 1V0PA 3TUCA 3D2KA 3PIYA 3PVBA 2I0HA 5AV1A 4QTAA 1MRUA 4FE2A 3QUPA 5EQYA 2I0YA 3OY3A 3LQ3A 1SZMA 2ZVAA 4MAOA 1Y6BA 4XV2A 1UWJA 4FTUA 4PMSA 5HTCA 3VWAA 2W4JA 2X9EA 4R7HA 4FC0A 4O27B 4DGNA 2EUFB 2QQ7A 2VRXA 5KMIA 1JOWB 4KKGA 5K5XA 4MD9E 5A9UA 3LLTA 4MQ1A 1H08A 3JS2A 3WIKA 3NYOA 3JR1A 4QMYA 3TZMA 4BDJA 4CQEA 5ITAA 1YXXA 3R9HA 3QQJA 3UOJA 1W82A 3IDPA 5FDPA 5JFWA 1XH7A 2R3HA 4II5A 5IEXA 3WZEA 2O2UA 2OIDA 2YEXA 1E1VA 3VBQA 4YGAA 4FTCA 3EQIA 3RKBA 4DG0E 1PF8A 4JNWA 4DTKA 2J9MA 2PYWA 1H4LA 3TIZA 4F9AA 5JGDA 4RIWA 2FPIB 3AMYA 4KBCA 4D28A 3O23A 5CVGA 2YZLA 4KS8A 2ZB0A 3KN5A 4MBJA 4MNEB 1SM2A 2IVSA 1JVPP 2XB7A 3UMWA 4EWQA 1WBTA 3OBGA 2XKEA 2JFMA 2X8DA 4G3GA 4XBRA 3WIGA 3D2IA 4Z9LA 3IOKA 3G9NA 4NH1A 4DITA 4IWOA 4YJRA 4LV5A 5BVDA 2R85A 4M68A 3W2OA 3MFSA 4C7TA 1MUOA 2IPXA 4JS8A 2IW8A 4PUZA 3E5AA 4JL9A 3TT0A 3ORQA 3EN7A 1XWSA 3R30A 3VS3A 4TWPA 4XV9A 2R64A 2W1EA 3G6GA 5GONF 2YIXA 3H3CA 3OTUA 4JG7A 4KIOA 4RT7A 4EJNA 5C8NA 4CG9A 3A7HA 4XNEA 4QP1A 3EMGA 1PXKA 4GK3A 4IVCA 4EH5A 2C3KA 2JBPA 2BVAA 3A4PA 2I8CA 3PTGA 4O7SA 5LCKA 4O4LF 3AQVA 3JUHA 4DF3A 2WQEA 1GZNA 4YO6A 2J0JA 3R7VA 1GJOA 2VTAA 2XYUA 3MA3A 4APCA 5DNRA 3VF8A 5HZNA 1KJQA 3QYZA 4QYGA 1VBGA 1YOJA 2OO8X 5CNNA 5AUUA 3QKMA 4PDSA 3C5UA 2NU7B 4CLJA 5K9IA 5CA0F 3PVGA 4Y83A 3ET7A 5HE1A 5M53A 5M4CA 4HZRA 5DR2A 3GIDA 4BCMA 3UYTA 3AX6A 4FVQA 2B9JA 2PVMA 4GYIA 1KJJA 3U9SA 4QTDA 4CLIA 4M13A 4FGRA 4BIBA 4D4RA 1YOMA 1ZYDA 1E9HA 2GNJA 2HWOA 2X39A 4O84A 4GVJA 2FH9A 2YITA 2BROA 4O82A 5KKRC 2VTLA 3V51A 2G9XA 3KXZA 4MXOA 3AG9A 4GV1A 4D4SA 5H80A 5DT3A 4R1VA 5CF8A 3F9NA 1VEBA 5AUVA 4W4XA 5IH4A 1YDRE 5L2TA 2PBZA 5IG1A 2UW9A 4FK6A 4D55A 1OGUA 2PY3A 2XA4A 1J7LA 1OPJA 2AC3A 3MI9A 4RGJA 5DN3A 5EM6A 4CGAA 4F0IA 5DLSA 3R2BA 3FV8A 4Z16A 5DRBA 2R3FA 2XP2A 2O5KA 3W2CA 1MQ4A 2JKMA 2HGSA 5CXZA 3LOKA 2XM8A 1IAJA 1DV1A 1AGWA 3FQSA 4FTTA 3QU0A 5DE2A 3EN9A 3ZU7A 4NM7A 3QQLA 4EOQA 3FXWA 4MXXA 4XG4A 2FSOX 3RK9A 4FFPA 2UW3A 2HZIA 3A60A 4MXAA 4F1MA 5CT0A 5LMKA 3Q6UA 3O8UA 1WZYA 4RX5A 4TKSA 3GEQA 4JRVA 4ZOGA 2C0IA 2J51A 4O4JF 5LCJA 2IW9A 4O22A 4D4YA 3C0HA 4E73A 3IDCA 2O8YA 1OIQA 3QZGA 3EN4A 2QOOA 3SX9A 3JRXA 3UG1A 3BI6A 3LKMA 5BUIA 2VTIA 3BQRA 2WMRA 1Q3WA 3EB0A 4KRCA 4WKQA 3ZONA 4BCKA 4ARKA 4E4MA 1Q8WA 1QPCA 3UNKA 2VWWA 3KKVA 1WBPA 4D2SA 4FTIA 4CRLA 2YAAA 3LFAA 2ITUA 2P2IA 3TJCA 3GUBA 4IX6A 5M4IA 2OJ9A 2VWUA 4KIQA 2O63A 4D4VA 3QXOA 3NW7A 1PMVA 2OH4A 5L3AA 3R5HA 1GLVA 3RZBA 2B55A 2B7AA 3I0QA 3O71A 3OG7A 2ZDUA 3DCVA 4DFXE 4E4NA 4C5BA 3IONA 4MWIA 3MTFA 4K33A 3NUNA 5HHWA 4YPSA 1WBOA 2WMSA 5CI7A 4USDA 4XOZA 3SW7A 2WTCA 4G1WA 1IA9A 3PWDA 4RRVA 3FWQA 3M2WA 4BDKA 1KE9A 3EQRA 3NYVA 2XNEA 2I87A 5FXSA 4QMTA 4R3CA 5HV6A 1SVGA 1FMOE 2A2AA 4MBIA 3ELJA 3EZRA 2F7EE 5CVFA 2XNBA 5CSHA 5EDQA 4O86A 5CNOA 3Q1KA 4RWKA 4FZAB 3KMWA 2BDFA 4OR5A 2HK5A 4XYMB 2GPHA 3AMBA 5C27A 4ZJJA 2IJMA 1M17A 1OECA 3DS6A 2ETKA 5IA5A 3KREA 3I79A 3QTIA 3ZRKA 4F0FA 4IFCA 2E9VA 3WYYA 4ZLZA 3LCDA 2XKDA 3E7VA 4LUDA 4A9UA 4J98A 4MA5A 4BYJA 3R9NA 4A7CA 4X3FB 3KXHA 3U51A 4JIKA 2CN5A 3COKA 4YC8A 4LG4A 4NTTA 4PL3A 4YJTA 3LMHA 4ZMEA 3OWLA 4HNIA 3U6JA 3MVJA 4EYMA 4EG0A 3OWPA 3PPZA 3BGQA 5BPHA 3LVPA 2WKMA 1T36A 1ZY5A 2XIXA 3VUGA 5E1EA 4GKIA 4FKVA 2JDRA 3QTSA 1Q61A 4GFGA 4CTCA 3IW8A 4X0MA 1YDSE 3HL7A 2GTMA 4FV8A 4MCVA 4WNKA 2YM6A 3KFAA 4NM0A 5HCYA 5AAGA 3KB7A 1PMUA 4E5AX 4J7BA 4RX9A 4HCUA 3QQGA 3ORXA 3UOHA 4P5QA 4EONA 3GU5A 2X8IA 4FEWA 3W8LA 1EYZA 4D58A 4FOCA 3RPYA 1RW8A 1L8TA 1F3MC 1XKKA 2ITTA 3MPMA 4MBLA 2Y0AA 2VTNA 4X3FA 5HESA 2VWBA 3R8VA 5H8GA 5CAOA 5I0BA 3JVRA 3R73A 5IQCA 5AP6A 3MY5A 5ACBC 3V01A 1GGOA 5FNVF 2ITPA 4QQ5A 4YTFA 2XK7A 1KEEA 1IRKA 1GNGA 4DH8A 4YR8A 2YWVA 2P33A 4FT7A 2JEDA 4QO9A 5EQEA 3D5XA 4ZSEA 3EQBA 5KHWA 4GT5A 4BKJA 3KEXA 2R84A 4FSWA 4BDIA 4J52A 3FMKA 5HD7A 1JDBB 1WVWA 1ATPE 4IM2A 3POOA 2HY81 3LXLA 4F9BA 1AQ1A 2C3JA 3CKXA 4EH7A 4FEVA 3RGFA 3DF7A 5TKDA 4FTAA 3D5UA 1KUTA 3MY0A 5FTQA 3C4XA 3K5VA 2C5YA 3P9JA 4HGTA 4YLLA 2YM8A 4ME6A 3I81A 2X7GA 5CEKA 3AD6A
chains in the Genus database with same CATH superfamily
3OROA 3VUIA 4RMZA 4RZWA 5BWTA 2NP8A 3QZFA 4AXEA 3BABA 2WQNA 4ASEA 4YBZB 3UIXA 4F7SA 4R7IA 2COJA 4U3ZA 2BTRA 3ZO3A 4HW7A 2EJ2A 2ETMA 5CR5A 3O2MA 3KF7A 3QWKA 5FR9A 3OY1A 2B53A 4UCOA 4DA5A 2CMWA 1ZOEA 2WMQA 1KJ9A 2PPQA 4DEAA 2KTYA 1P4OA 3UP7A 4E26A 4G3EA 4ZZNA 1W96A 2W5AA 1BUHA 2GQRA 2W99B 2YFXA 2VTOA 5IPJA 4IZAA 5EQPA 1DAYA 1ZLTA 3ZC5A 5M56A 3HAVA 3F69A 4AXFA 5FBNC 3GDEA 4PRJA 5F95A 2H9VA 4HZSA 1Q3DA 2PWLA 1ZY4A 3QHRA 2W1CA 3MBLA 4FTLA 4DFBA 4DFUA 1KT8A 3SGCA 3GXLA 4EKKA 2Z04A 3FBVA 4UB7A 1KE7A 3FHRA 1XH6A 3NS9A 2J0KA 1NA7A 1ZMVA 3PG3A 4FV6A 4LRJA 5KZ0A 4B6LA 4EZ5A 5C8KA 3OUUA 3KVWA 1KJIA 4E20A 2HW6A 4JXUA 2ZV2A 3OS3A 1M2QA 3TZ9A 1WVXA 5E8XA 2R3QA 2E9PA 2NUAB 2VO6A 3SE7A 2WMAA 1LR4A 3L8SA 2QO2A 4WBNF 2OK1A 3V5PA 3BA9A 2J7TA 3R22A 5KMMA 5D7AA 1H27A 4RVTA 5D10A 3WARA 3AKJA 4OTQA 2ITVA 3NNUA 4AF3A 1B6CB 2XMYA 4EUTA 3HMMA 3TV7A 1IOVA 1UNHA 4F65A 1YW2A 5A14A 1FVRA 1M14A 3FC1X 2UZNA 4YZBA 3UO4A 3R83A 4ZY5A 3UVRA 3FY0A 2VN9A 5J2TF 5G6VA 3WF5A 3G8CA 3BLHA 1XBBA 2C30A 5IDPA 3IO7A 3LWBA 2YM3A 5H9BA 1CKMA 4C3RA 1UV5A 5E25A 3IPHA 4MV9A 3D4QA 5HBRB 3L8VA 3FLWA 3W0OA 3KL8A 3Q4TA 3N4UA 4OTDA 2XAOA 4XBUA 3CTQA 4AW2A 4B8MA 4IZ5A 4NK9A 5EHOA 2YZAA 3UO5A 2PVPA 3ZLXA 4FKTA 1HOWA 1XBCA 3W0PA 4F64A 2X5RA 2F2UA 3F6XA 5LA6F 5CS6A 2XIYA 4DHJA 3EL8A 2KULA 3HBLA 2COGA 4TYHB 3GCQA 5FXRA 3C5IA 4H3BA 4MV1A 4LRMA 5JVDF 5I4NA 3RINA 1I09A 2Q0NA 3EFKA 4JBOA 5FQDC 4FVPA 4ASXA 1W93A 5DMXA 4EFBA 5C8YF 3DB6A 2X2MA 4YAKB 1U5QA 3HAMA 5M51A 5BWUA 4CKIA 3PVWA 3ZO4A 2YDIA 3FL5A 3IKAA 4XJ0A 2PN1A 3AT3A 4IWXA 2NU9B 3V4SA 2EIYA 3SG9A 3QKKA 5E91A 3Q9ZA 2BZHB 4J97A 4G6NA 2Y4IB 4LQMA 3R71A 1OM1A 4EGQA 3F3VA 4D1ZA 5HTBA 2WZJA 3CQUA 3R9DA 2FPPB 3P7CA 3DXQA 4R6VA 4RSSA 3DBDA 3OOGA 2WTDA 2YN8A 4E4XA 5D7VA 3ZH8A 4TYHA 3D9VA 3E7OA 3LQ5A 4G3FA 3IG7A 3DK7A 5C4KA 3HMNA 3LW0A 2JIVA 3UQCA 5GNKA 3DGKA 1A9XA 3I1AA 3Q53A 3EIDA 2JITA 1OBDA 4XLVA 4DC2A 5JVLA 3WNZA 4BTMA 2HVRA 1ZYLA 4FGBA 4PP9A 4USFA 3PXQA 4UXLA 5LXMA 5KS8A 1OGYA 4GL9A 3VIDA 5ETCA 2GPSA 3OWJA 4FV1A 4RFYA 4CT1A 2BRMA 5I5UA 3MN3A 4WBBB 2Y7JA 3QTZA 3BYVA 3BV2A 5HLWA 3VHKA 5IEVA 1NVRA 4BVUA 5DFPA 1W84A 3WF7A 3PG1A 4Z55A 4GU6A 4ZTNA 5I5SA 4FX3A 3DNEA 2XK8A 4DEGA 4HN2A 1W83A 3DBCA 3ZEPA 4IVAA 2GFSA 5HG9A 4ZJIA 4BTKA 3CR0A 4ZTLA 5DAAA 2HY0A 2HCKA 5E8YA 4GT3A 3VJNA 4BBMA 3V5TA 2O0UA 4EK6A 5LVMA 4CMDA 5CB4F 2XF0A 3R23A 1W7HA 1KE6A 2JFLA 3ID6C 3QCXA 5AM6A 4BR3A 3IECA 5JZNA 4FOBA 1I44A 3COIA 2UUEA 5JQ8A 4MA0A 4O4HF 4DH5A 4A4OA 3DB8A 1XH5A 4YJ2F 5IQDA 4IMYA 2B52A 4PMPA 3VNNA 5CANA 3D7ZA 5FEDA 3TQTA 4IHJF 4JMQA 3H0YA 3S95A 1PKGA 3BHTA 4RLKA 4CSVA 3VVHA 5FM3A 5E7RA 4AW1A 2XD4A 2F7ZE 3BIZA 3MIYA 4FZFB 4DGLC 3P7BA 4I0TA 3DXNA 1S68A 4GYGA 4NKSA 2UVYA 3ZFXA 4D0XA 1TA8A 2XEZA 5JH6A 2PULA 3KXXA 3QRIA 3F88A 1KBLA 3QKLA 1XQZA 2HZ0A 3GQLA 3Q9YA 4M67A 4PL5A 4IM0A 4QNAA 1P4FA 2R3MA 4XG2A 3AC3A 5AP5A 1GOLA 3CGOA 4EEVA 4RG0A 2BZKB 3HV3A 3B2TA 2CJMA 5L6WL 4FSUA 3TL8A 3ORLA 3FEGA 4KA3A 1REJA 2YCQA 3PY0A 4XG3A 3H30A 5I9XA 4DEBA 4BF2A 4U6RA 2XRUA 3I5NA 4AW5A 3GU8A 5AV2A 1EHIA 3VMMA 3NZ0A 4IX3A 3QQFA 2YS6A 4JRNA 3LLAA 4NCTC 5AP7A 1CS0A 3Q2OA 3O8PA 3SV0A 3TMOA 4ACMA 4LOQA 4Q4DA 3QQHA 5C8MA 3ACJA 2UZUE 4U81A 2J9GA 5M4FA 2JAVA 3CTJA 4S34A 1RQQA 1IEPA 5A6OA 2R3PA 4FK3A 5EK7A 2REIA 4NW6A 5AJQA 3NLBA 4IACA 3GBZA 2BRNA 4YNEA 2I80A 1QCFA 2R7LA 4F9WA 5EI2A 3FLSA 4FNZA 4XH6A 3BYUA 5CQWA 2VAGA 3BBTB 4O7LA 4OUCA 3N4VA 4FKLA 4F9YA 3T9FA 2PZPA 4BCHA 1BYGA 1I7LA 2WHBA 1IAHA 4O91A 4C4HA 4YUQA 5AX9A 5AP3A 4O21A 4RJ8A 4GSBA 3LCSA 4A4LA 3W0SA 3BEAA 3K5IA 3R7YA 3UDTA 3CIKA 2PTKA 3CGFA 2X0SA 5ANKA 3T8OA 4M84A 5DYJA 4I5HA 3SC1A 4YMJA 4G31A 3QRUA 3N4TA 2W6PA 4CC6A 3W1GA 3E63A 4OT5A 2HIWA 4LDTA 1OL7A 4QPSA 4ZS0A 4EHZA 3C4FA 3OBJA 4LM5A 3PXZA 4ZY4A 4HPTE 2DZDA 4I3ZA 2YWPA 5KX8A 3WWJA 3ATTA 5C1QB 4GU9A 5DR6A 2UW4A 3V8TA 1NT2A 1H07A 4RFMA 2C6IA 3B2WA 3UNJA 3LM5A 2XKFA 3KA0A 3MVMA 5CSXA 3V8SA 4QT1A 3W5OA 4FIHA 3CEBA 3GCUA 3CY2A 4HCTA 1Q8TA 4LRKA 1NW1A 3NUYA 1I1LA 4ITHA 1U54B 3KRJA 4H36A 3BL7A 4M12A 4O0UA 3OUNB 5BVOA 3SA0A 1YHSA 1YRPA 4K0YA 5HLPA 5B2KA 3VQUA 1OL1A 2E9NA 2WMBA 3FZ1A 4X2FA 4BC6A 4FG7A 3GENA 4YZ9A 2PE0A 4TYGA 4UZHA 4C38A 2QO7A 2YIWA 3LFDA 4FV5A 4JQ8A 1YDTE 5I9WA 4UWCA 5AFVA 3AT4A 3PA5A 3SRVB 3TJDA 2QODA 4CFXA 4YTCA 2DABA 3CD8A 2CCIA 3QUDA 3WF6A 1W0XC 4FTNA 4X7QA 4UN0C 5BWRA 4BDAA 1WMKA 4FKUA 4RJ6A 4O0SA 3PXFA 1PMNA 1OL2A 4KNBA 5HORA 1U54A 3ZZEA 1EKVA 3GB2A 1WR2A 2ITXA 3ZSGA 2C4GA 3KIOC 2OF2A 2XARA 4GG7A 2YL2A 1PXOA 2RFDA 2UZEA 1H1RA 4NM5A 3PUFC 1A3GA 2C0TA 3TDVA 4IZYA 2JLDA 3PFFA 4ASZA 2B54A 2W1GA 3VS6A 4OBPA 3VS0A 4RCNA 4TNBA 3CKWA 5AAFA 1KV1A 1CKIA 1ZMUA 3JY9A 4BDDA 3UBDA 5AV4A 5IISA 5M09A 2W7XA 4KABA 3OF0A 5D1PA 1G2WA 4BCPA 2BCJA 1MRVA 4WBOA 4XG8A 3SRVA 3PIXA 3TY8A 5TT7A 3OXIA 4ZK5A 2GNHA 1K3AA 3NDMA 4P5ZA 4X3JA 2Q2UA 5LMBA 2V22A 5ACKA 3ZSIA 3UOLA 4Z3VA 2GS2A 3DAJA 1OBGA 5LARA 2XCHA 4C2WA 5DEWA 2QOHA 4HVIA 2UV2A 4C5AA 1K2PA 3QA0A 5CSWA 1Q4LA 1BLXA 1R39A 1KOBA 3QZIA 5J1WA 3LCTA 4UCUA 4YZNA 1LPUA 4WOVA 3SVVA 4L44A 3SLSA 4D1SA 3QGWA 4BDGA 3LFQA 4EEQA 2VU3A 1PJKA 2EXCX 4WT6A 4ZQIA 5GHVA 2UZDA 4QP6A 5CT7A 3ZC6A 5IUGA 2C00A 5KE0A 3U55A 3QQMA 3P1AA 5CALA 3GFWA 4BB4A 2IVVA 2X4ZA 1H8FA 2PZ5A 2WOUA 4U79A 4IIRA 5TF9A 3TKUA 1B6RA 1M0TA 4PZ7A 4XZ3B 3TIIA 4AGCA 4EK3A 4FIEA 3II5A 5HQ0A 3QXPA 4C4JA 4DLJA 3KXMA 4DRFA 1EUDB 3G9LX 4KIPA 3GT8A 3BACA 3GGFA 4FSNA 1PXLA 3KAKA 2P55A 3BHVA 4IB3A 2OIBA 5E8VA 3FC2A 5AV0A 3ZO1A 4AS0A 3CQWA 3PLSA 5M55A 3UO6A 3VUDA 5A4QA 5BVFA 4YJOA 5FP5A 3KXNA 4FKQA 3TACA 4R3RA 3RCJA 3DTWA 2V59A 2ESMA 3GLKA 3F5XA 5I5ZA 1RDQE 2CKOA 3NRMA 4PDYA 4RIWB 4HJOA 1H28A 5CAVA 4OTWA 2PVFA 3QQKA 4I50F 4ANBA 1VBHA 4QTBA 3TN8A 3OTVA 4NKAA 3PJCA 5KMJA 5A4TA 3FYJX 3GOPA 3NAYA 2W1IA 3BPRA 3OUZA 3JVSA 5IQGA 3KMMA 5CU3A 3LFBA 3OMVA 3SXSA 3PXYA 4YPDA 4TYIA 5C9CA 4KBKA 4U97A 3W32A 3KRLA 3GB8B 4NT4A 4IW0A 2VWZA 5AV3A 4UYNA 2W1FA 3R1SA 4PNIA 4EBVA 2JAMA 4ACCA 2V5QA 3VS7A 5HIEA 3K5HA 3VNTA 4N57A 2ONLC 5I5WA 2P2HA 5JZJA 2FSMX 3UGCA 3R00A 5CEQA 3T9TA 5KKRB 3W2SA 4LOOA 5DVRA 5ANIA 1OKZA 1UWHA 5DH3A 4RVKA 2R3KA 2BRHA 3A8WA 3ZBXA 2Z8CA 3ZXZA 3FKOA 2WQOA 5FBOA 4FIJA 5CYIA 2QHNA 4DBNA 4ZS4A 5BQ0A 4PTGA 4G16A 2WD1A 2PMIA 2WTJA 4IBMA 4IWQA 1SMHA 3DJ6A 4GEOA 3ZTXA 3VULA 3CPBA 3RK7A 2QOKA 2HVQA 3BQCA 1J7IA 5JQGF 2NPQA 1XK5A 3KCKA 2YACA 2IW6A 3R6XA 3LM0A 3SD0A 3VJOA 1YKRA 3S00A 3R8UA 3HGKA 1OVEA 3T9BA 2C6OA 2X81A 1VJYA 2C0OA 2XK9A 2GNFA 2H6DA 2V7OA 4Q5HA 5I9ZA 3VC4A 5F4NA 2WNTA 3GQIA 3EFWA 3NCZA 2WU6A 4QMUA 4FMQA 3UC4A 3V5JA 3W16A 2WTVA 3DT1A 3HO8A 4O7TA 2FPGB 1CTPE 1H0WA 2Y4PA 5I9YA 2AYPA 4IVBA 5L6PA 4OTRA 4GIHA 2Z7LA 2WU7A 1R0EA 2JIIA 3QX2A 4IZ7A 2C3LA 3UDBA 3UQGA 4F09A 4FFNA 5J2UF 3HX4A 2FSLX 1DV2A 1H01A 2XNNA 2V55A 4QYYA 2YA9A 3O7LD 5BPYA 5JN2A 3ORRA 1WBVA 2XNPA 2C5OA 4DH3A 1I7NA 2I0VA 4O7ZA 4ZTSA 4MXYA 4BCGA 4FKSA 4TN6A 3QQUA 4V05A 3WO1A 4FSRA 3BL9A 4IE9A 1P5EA 3C0IA 3LIJA 3THBA 3V6SA 4RWLA 3ZMMA 3E3BX 4E6QA 4I5MA 4GS6A 4I6FA 2R7MA 5DEYA 5E8SA 1XH4A 4O2AF 3Q2JA 3RI1A 4ZLYA 3G2FA 2NU6B 1Q8ZA 3HMOA 3MIAA 3NGAA 3HV4A 4O96A 5FM2A 4E5WA 3NCGA 4CVAA 3MWUA 4V01A 4HYHA 4QMMA 3W2PA 4EH6A 3DKGA 2I1MA 2ABJA 2XRWA 1Q24A 1X8BA 3EFLA 3OUKA 4AN2A 2VTHA 4I23A 4IAZA 4KD1A 4DIMA 1IYEA 2GDOA 3KC3A 3R04A 4NZOA 4FNYA 2H8HA 3LFCA 4O38A 3KULB 1PKDA 2R3IA 3CXWA 4CMOA 4JBPA 4AG8A 4ZIMA 3WWIA 2GS6A 2VWIA 3BKBA 1A48A 3I4BA 3UIUA 3DPKA 1BKXA 3R1NA 1EZ1A 5TR6A 4HGEA 4OBQA 3EZVA 3E88A 4NUSA 3HV7A 1ERKA 1YI6A 4RJ5A 5CF4A 4KAOA 3EQHA 1ZZ2A 2VD5A 2GMXA 1PXNA 2PK9A 3VQHA 1VYZA 5IU2A 2HXLA 2BALA 1XH9A 3F2NA 3W8QA 1IASA 1Z2PX 2QD9A 2YAKA 3TKHA 4JBQA 3QF9A 3OXTA 4IWPA 3NNVA 4K1BA 4JVGA 2QO9A 2ZMDA 4G3DA 4A07A 2DUVA 2EB3A 2FB9A 2R0UA 3DKOA 2R3JA 2Z02A 2GQSA 3VAPA 3KULA 2QLQA 3Q04A 4BTJA 1UU9A 3C50A 3DDPA 4O0WA 3ZO2A 3QCQA 1GZ8A 3N8DA 4U45A 4EJ7A 1GZKA 3TY5A 3U0GA 2FSTX 4XUFA 1PRYA 2OF4A 3OHTA 3R21A 5J5SA 2DWBA 3VBWA 4IIJF 3CCNA 4TVIA 2PVHA 2VNYA 3S0OA 2HWPA 1DI9A 1WAKA 1OPLA 3ATSA 4AT4A 2YIRA 3R28A 4CKJA 2W6QA 2EJ3A 4ZOLF 4ZSLA 5CY3A 1LP4A 2OJJA 3ERKA 1Y57A 2C1AA 4HYUA 4AN3A 3HA6A 4MK0A 2IN6A 3OCSA 3NC0B 1MRYA 3H0ZA 3DV3A 4YJQA 3NW5A 4DLKA 2WMTA 2QOFA 4G17A 3F2AA 2XIKA 3TM0A 3L9PA 3O50A 4QP2A 4CFVA 3R8MA 2R5TA 1TKIA 2UW6A 4FU0A 2E2BA 4O6LA 1I1KA 3DXPA 1FGIA 1OB3A 1T45A 4B4LA 3D7TB 1BI7A 2PUPA 2QC6A 4MQ2A 4JOAA 5AP1A 4Z7GA 2QK4A 5TO8A 5HCXA 4EC9A 4MV3A 3RV3A 4Y46A 2IWIA 4CMFA 3EYGA 3FKLA 4ITJA 1U46A 3JZFA 3BU6A 4K6NA 5C1OA 4IADA 4AZSA 3LJ0A 4UZDA 3R63A 2QI8A 5H8BA 4EOLA 3KRRA 1PXPA 1V1KA 4F1OA 3HECA 2O64A 4H3PA 2VTRA 2BUJA 3LFFA 3NSZA 4JDJA 4JR7A 4O7WA 5EOLA 3R7EA 1B6SA 5I5YA 1JWHA 2HIVA 5CAPA 2X6EA 2V0DA 3RCDA 5J87A 1BL7A 3PY3A 3TY9A 4MD7E 3HKOA 4FT0A 4IDVA 4R78A 3GU6A 3QC4A 1YOLA 5J1VA 2YCSA 3OW4A 3L2PA 2CNUA 5I9VA 3E8CA 2X9FA 3HNGA 4AZTA 5EYKA 5HI2A 1CQJB 2XJ2A 5FEEA 3RAIA 4QP8A 3D7TA 3PRFA 1P14A 2WTWA 3GCVA 4QMPA 4U9AA 5HLNA 5FEQA 1P2AA 2A19B 2UVZA 5KUPA 1M52A 4FA2A 2WPAA 4M15A 4OT6A 3PFQA 3JY0A 2ITNA 1XH8A 3G8DA 3QLGA 2J5FA 3COHA 1DIKA 5KMKA 4IX5A 3W2QA 5E1SA 4F08A 4WG5A 3RPVA 2G01A 4DTAA 3F82A 3GU4A 3BWJA 3MA6A 4RIXB 5EFQA 4K6ZA 4AE9A 4FJVA 2NU8B 3V4ZA 5I5XA 4O7RA 1PHKA 2R2PA 1KJ8A 3VRYA 1WBSA 5HO7A 4QNYA 4QRCA 4XX9A 1Z5MA 2X7FA 3DAKA 2X2LA 3HP5A 4HVDA 2PMLX 2W1DA 3A62A 3WE8A 5CSVA 4EBWA 4C3FA 4AZVA 4OTGA 1CM8A 4EOOA 4N6YA 1A9UA 3FZPA 3PY1A 4Y85A 3ZLYA 4F1TA 5L6OA 1YI4A 4O7VA 4DGGA 2ERKA 3L9NA 1H26A 2OJGA 3RJCA 2XM9A 3G90X 3WE4A 3FLYA 3GC8A 4NSTA 2BAKA 3TUDA 3F3TA 3MWEA 4NJDA 2C3IB 4GMYA 4YO4A 2R3NA 4GVAA 4I1ZA 4XX0B 2PZRA 4QTCA 3EQGA 1OL6A 2VTSA 4RIXA 4D2RA 2ZM4A 4QYEA 1VKZA 3KAJA 1Q97A 2QU5A 2F2CB 5HEZA 2B9HA 4U42A 4O7NA 3IS5A 1WFCA 3QUEA 3EYHA 3I7CA 2JD5A 4JI9A 2BR1A 4M69B 5IA2A 2C6DA 4E4LA 2Z2WA 3FJQE 5CAUA 2Z60A 4PZ8A 2SRCA 3GI3A 5BYLA 4L3PA 5GIPE 4WO5A 5K2MA 4C36A 4CFNA 2CHLA 5D12A 1GAGA 2C69A 2OKRA 2WYOA 3EQPA 5J9ZA 3BWFA 4BCFA 1RE8A 3BLAA 2ZDTA 3FLNC 4GG5A 2HXQA 4QQTA 1NVQA 5A46A 3CEKA 2B1PA 3RV4A 1GSAA 2P0AA 5LYJF 1FMKA 3A7GA 3BCEA 3NPCA 3QRTA 5J95A 4BJJB 2JGZA 4C35A 3T9DA 4O6EA 5EM5A 2QOIA 3MDYA 1G3NA 2IG7A 5HG7A 4N70A 2ZV7A 5D41A 2RL5A 4XV3A 3FI4A 3U9CA 4IWDA 3RWPA 4BZDA 1ZXEA 1R3CA 4YTHA 5HICA 2W1ZA 3CP9A 3L9MA 3E8DA 3ZYAA 4RJ3A 3RK5A 4ZXTA 4M7IA 2UW0A 4FTMA 5HE2A 2I7QA 5IDNA 5CM0A 2R3LA 2I40A 3FI8A 5FGKA 2UZTA 5C4LA 2VQDA 4KS7A 4H1MA 3CPCA 4FUXA 2CKEA 3BX5A 4TYEA 5D1OB 2YIQA 2BIYA 3V04A 4Q9SA 3R9OA 4LL5A 4WUAA 2BTSA 5AUYA 3NX8A 5HIDA 5CASA 3BG5A 4UWBA 4BJJA 3E87A 3MGYA 3NFFB 3BZ3A 3KK8A 4LOPA 1DAAA 4FSYA 3KRXA 4AU8A 2R7BA 3UDZA 3RNYA 4FTRA 3UZPA 4YHFA 1BNCA 4PMTA 3TV6A 4A4XA 2CPKE 5IQBA 3MFTA 2JKQA 4D5KA 4YB8B 3U9TA 1TQPA 5D8DA 4IAYA 3R1QA 4DLIA 2QR7A 3FY2A 4MEDA 2OH0E 5LVNA 3OVVA 2EB2A 4MXCA 2C5XA 5EDRA 1Z2NX 1Z57A 1DI8A 2YJSA 3QD2B 2VPQA 5E92A 3RTPA 4J95A 2YZMA 4I93A 4FIFA 1YI3A 4ZTHA 4CD0A 1EKPA 5D1OA 4TV8F 5IZFA 4CCBA 3F5PA 1OKYA 2F4JA 4NW5A 4EGJA 1KTAA 4CRSA 5M44A 4TYJA 1OPKA 1O6KA 2W70A 4I5PA 1KE8A 2YCFA 1BL6A 5HU9A 3VS1A 3O51A 3E3PA 1KOAA 4ANLA 3C1XA 3JXWA 1V9PA 1ST4A 1VR2A 3V5WA 2F57A 1J1CA 2R3OA 3D5VA 3LXNA 3MVHA 3OWKA 4FV4A 4EOKA 1DS5A 3MVLA 2CLXA 2BFXA 1H1WA 2WTIA 4NU1A 5BVKA 1JBPE 4QP9A 3Q3BA 4BGQA 2P0CA 3EQCA 4XP0A 4EFEA 1CKPA 4L68A 2OG8A 4AA5A 4ZZOA 1X9NA 2PZYA 2CLQA 4JBVA 3QWJA 4A06A 4GCJA 5IEYA 3KU2A 3E92A 4M14A 5L8KA 2CN8A 2R0IA 4O81A 2E9OA 4G3CA 2PE2A 2WMWA 4FT3A 2VTPA 1ZYCA 2R9SA 3ANRA 5BX0A 3GC7A 3VHEA 2QKRA 1RJBA 4LFIA 2ZDQA 1NY3A 4IZOA 4MWHA 2BAJA 4AOJA 3VF9A 2ITQA 4WG3A 1CMKE 2IVUA 4I6BA 4PQNA 4AP7A 3OCGA 5A4LA 3UMXA 5BMMA 3LE6A 2YERA 1JDEA 4DT8A 5CU2A 2W96B 2X0GA 4P90A 3WBLA 3ETHA 3ZRLA 4CZUA 5E8ZA 4CC5A 4UYAA 3TKIA 3TEIA 3Q4UA 4I4FA 5FUTA 3TG1A 3UZBA 2FO0A 4RA4A 2VUGA 3FQHA 3VBVA 1Y91A 3FMDA 3QTUA 4IJPA 2W17A 4RJ7A 4ZZMA 4BBFA 1U59A 3DBQA 4QMSA 4EHVA 3MS9A 5FG8A 2BPMA 3QD3A 2ZV9A 3OFMA 3TWJA 3WZDA 4MD8E 5EW3A 4AQKA 1O9UA 4HYSA 4K18A 4AXDA 4ZJVA 3G33A 2YDJA 5EI8A 3JZ6A 4LMUA 4R5SA 4F70A 3MYGA 4G2FA 3NWWA 2YCRA 4O4IF 4E5BA 3BHHA 3AC4A 4BZOA 4QSHA 2RIOA 3GNIB 4ZSAA 3ZEWA 2C6LA 4FKJA 3TXOA 4UXQA 3U6HA 2G15A 3O96A 3QRKA 4S2ZA 2PVKA 4FT5A 4WG4A 3ZS5A 1LUFA 1AUVA 4WIHA 2HGWA 2W6MA 2C6TA 5KMNA 5J9YA 3ZUTA 3W2RA 5L2WA 4FSQA 5HNGA 4EOPA 5CU4A 3RM7A 4DGMA 4O0RA 4EUUA 2VTJA 1B04A 1SYKA 2UW5A 5ANOA 5FPRA 4RQKA 3QGYA 1I1MA 3U6IA 3F5UA 4AN9A 4LUEA 1JKKA 3VRZA 4AUAA 3F3ZA 4AAAA 4Y72A 3F2RA 2HZ4A 4I22A