2Z04A

Crystal structure of phosphoribosylaminoimidazole carboxylase atpase subunit from aquifex aeolicus
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
353
structure length
309
Chain Sequence
LTVGILGGGQLGWMTILEGRKLGFKFHVLEDKENAPACRVADRCFRTGQISEFVDSCDIITYEFEHIKDEVLEKCESKLIPNPQALYVKKSRIREKLFLKKHGFPVPEFLVIPVVIKAEFIIEEFVKFEAEISCIGVRDREGKTYFYPQPFNKHEEGILIYNYVPYAKLKEAEEITKRLMELLDIVGVFTVEFFLLKDGRVLINEFAPRVHNTGHWTLDGAYTSQFENLLRAITEMPLGSTELKLPSGMVNILGKSYEEIPLKEILSVEGAKLYWYGKEKKPRRKVGHVNVVGRSKEEVVEKVERVFTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphoribosylaminoimidazole carboxylase ATPase subunit
publication title Crystal structure of phosphoribosylaminoimidazole carboxylase ATPase subunit from Aquifex aeolicus
rcsb
source organism Aquifex aeolicus
molecule tags Lyase
total genus 97
structure length 309
sequence length 353
chains with identical sequence B
ec nomenclature ec 6.3.4.18: 5-(carboxyamino)imidazole ribonucleotide synthase.
pdb deposition date 2007-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02222 ATP-grasp ATP-grasp domain
A PF17769 PurK_C Phosphoribosylaminoimidazole carboxylase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 2z04A03
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2z04A01
3VOTA 4TV9F 4FFOA 2CNVA 4I55F 3N8DA 1WR2A 2W70A 4IZOA 3AX6A 1DV2A 3KAJA 1E4EB 3ORQA 4O7NA 2VHEA 5LOVF 5HBRB 2CNUA 2VQDA 1OBDA 4FFLA 3VMMA 4MA0A 4L1KA 4MA5A 5J2UF 2ZDQA 1OBGA 1DIKA 5H80A 2DLNA 5JH7F 2HGSA 3K5HA 3U9SA 2YZMA 3KAKA 5C1PA 2NU9B 3OUUA 4O4IF 2W6PA 4MV1A 5JVDF 2W6OA 2C00A 3SE7A 4XX0B 3WO1A 5C1OA 1M0TA 4EABA 1E4EA 4HR7A 2PVPA 3V4ZA 2FPPB 2DIKA 3K5IA 4MV9A 4MV8A 3BSYA 3LP8A 3MWEA 2R7KA 4ME6A 1EYZA 1CS0A 2I87A 3GLKA 4RZQA 4O4JF 2SCUB 2GPWA 4O86A 5CB4F 4I50F 2I8CA 3HB9A 1I7LA 3WNZA 2GLTA 2CNQA 3RV3A 4O2AF 1BXRA 3VA7A 3N6RA 2YRXA 2YZGA 3U55A 2DWCA 3MJFA 3V4SA 4O81A 1KUTA 2NUAB 1CQJB 3BFPA 2FPIB 2YS6A 4YJ3F 4FU0A 3GIDA 1KBLA 3HBLA 4YAKB 2QF7A 4TUYF 3Q1KA 4ZQIA 4I4TF 4MV4A 4MV7A 2NU7B 4O7TA 4DIMA 1VBGA 1M0WA 5D8DA 3U9TA 3RFCA 2R86A 2YZLA 2VPQA 5CA0F 2YZNA 4M98A 4EG0A 5CAEB 3UFXB 3MWDA 2NPOA 3U54A 4HQ6A 2V5AA 5HV6A 5C8YF 3G8DA 5DMXA 5GONF 2DZDA 3QFFA 2R7LA 1B6RA 1T36A 1JDBB 1A48A 2ZDGA 3I12A 3ETHA 3NUAA 4FE2A 1EUCB 3TIIA 4O2BF 1GGOA 2GQSA 4O7VA 2QK4A 2R7MA 3ORRA 4Y8VB 1KJ8A 2YS7A 2FPGB 5BPHA 5FNVF 5CA1F 4O84A 3BSSA 4TV8F 2R85A 2Z02A 1Z2NX 2W6QA 2X0SA 3AW8A 3WO0A 4DLKA 4FFMA 3Q2OA 4EGJA 2PBZA 2IP4A 4IWXA 4HNVA 2W6MA 5JQGF 4EAAA 4O4LF 2CZGA 2R84A 3JZIA 4FFPA 1GSHA 4E4TA 3JRWA 4EA8A 5LP6F 4QSHA 2XCLA 5K2MA 3JZFA 4GGMX 1KEEA 1C30A 1W96A 4O7YA 4O82A 3LWBA 2XD4A 5LXTF 2GQRA 5I47A 1I7NA 4O4HF 4O7SA 5LA6F 2W6NA 1AUVA 4MAMA 2P0AA 2YWVA 4IIJF 1GSOA 3TQTA 3RUPA 1KJIA 1GSAA 4EA7A 3KREA 2YYAA 3K3PA 3HO8A 5J2TF 1IOVA 4ZI7F 3TW6A 2PN1A 2YW2A 3VPCA 2FB9A 4YBZB 2V58A 3KALA 1EHIA 3R9RA 2Z04A 1SCUB 3R5FA 1Z2PX 1KC7A 3VPBA 5EZYF 4FGRA 4EA9A 4FFRA 3R23A 1JLLB 4O83A 4NYEA 5KKNB 4YJ2F 1KJJA 5BPFA 1JKJB 1B6SA 3RV4A 2W71A 2OLSA 4MV3A 5JVLA 3BG5A 5IYZF 5LYJF 2HJWA 3E5NA 4O7RA 1KJ9A 1EUDB 1ULZA 2YRWA 2NU8B 4XZ3B 4IHJF 1PK8A 4C5CA 2GPSA 3TIGA 3VPDA 1EZ1A 1DV1A 4J6EA 1C3OA 3DF7A 4YB8B 2R7NA 4WBNF 1AUXA 1KJQA 5JQWA 4XYLB 1UC8A 2YL2A 4M9CA 2ZDHA 1A9XA 4FFNA 3JRXA 2R82A 1UC9A 4HNUA 1W93A 4IWYA 1IOWA 3TINA 1BNCA 3R5HA 4O7WA 2FP4B 1PX2A 4C5AA 1GLVA 2R87A 2J9GA 1M6VA 4M9UA 5KX5F 4XYMB 3ETJA 4WD3A 3R5XA 2I80A 2NU6B 2WYOA 3G8CA 4O7ZA 4ZOLF 4C5BA 3OUZA 4YAJB 4HNTA 1JDEA 1Z2OX 4ZHQF 1CQIB 2W6ZA 2V59A 4O7LA 4MV6A 4M99A 1VBHA 1CE8A 4EGQA 5BMVF 2VR1A 3BSWA 1VKZA
chains in the Genus database with same CATH superfamily
1P7WA 4QYIB 3S55A 1ZHHA 2NXEA 2WV7A 3U3ZA 4QG3A 2UYYA 5AJHA 1SKYE 3HLTA 4G37A 1FYVA 3CWZA 1G2IA 4C3OB 4JI4B 1VKNA 2C5AA 3QA3E 2CHEA 5EPEA 3JD2A 1IHPA 2EBFX 3MAGA 3NT2A 1V96A 1OLXA 1LI7A 3L8YA 3GUUA 3EPRA 1MVNA 2R68A 2VF4X 3EG9B 4ALJA 2CNUA 1V1MB 4R1NA 3O47A 2X7JA 1FP1D 2RARA 4B82A 3U37A 3JWEA 2RHTA 4FFDA 4DC1A 3AOEA 4HXEB 4EAQA 1X1QA 4P4SB 4PW0A 5A62A 4BB9A 3GDFA 1M7GA 5K0LA 1T9GS 4ALNA 4ZGWA 5ALUA 3P2KA 3TLJA 1K89A 1NQ5A 1PFUA 2DR2A 1JHMA 4HDKB 4UARA 3ZUPA 1L4FA 3RC2A 2ZSAA 2CCKA 3BE6A 5BSFA 5FLKA 1D0IA 3OHSX 3SIXA 4DB4A 4JBIA 2B1JA 3LT4A 3HHPA 3NM4A 3P4YA 4NE2A 1C41A 4DLPA 4R5HA 4JR2A 4TYQA 1TGVA 1YQTA 4Z8XA 3K05A 5FV7A 1Z2CA 2JGFA 3M82A 4G5HA 5EKTA 2FSUA 3W8NA 1IHDA 2IEBA 2WOOA 4JLJA 4O4JA 3W2GA 5C8ZA 5E38A 1X2EA 4PLTA 5GVSA 5JNTA 3UMGA 1AHPA 221PA 4HZUB 2OHVA 1K88A 4OF4A 5ETJA 3GNSA 3RFFA 3ZLVA 1O9GA 4L5YA 3VR6D 1TVMA 4JXJA 1BOFA 4I2VA 4ALIA 1S8FA 3P9IA 1KJYA 3FLMA 3EWNA 2F67A 3V4RA 2EL7A 1KVTA 3ISVA 3LD9A 4MIOA 3QU4A 5F1YA 2HR1A 4Z1MA 2AB0A 3SE7A 3WO1A 1XVTA 4P32A 1C80A 1WNFA 4Y18A 3AY3A 4LOHA 2DLCX 4LISA 1IM5A 5B3JC 4AT1A 3S1LA 1TU3A 1W4BA 3IO3A 2Z3VA 3M6MD 1W5EA 1RPAA 2WPDD 5IZ4A 1TTTA 4HV4A 3OOSA 1R0WA 4AYWA 3DAPA 4NMHA 1G8FA 5JNLA 3EMVA 1ZI8A 4EPVA 1MO5A 3SEQA 1OJ7A 1PQ4A 1SN7A 2WRZA 5TT0A 4WQMA 3QHAA 4HVCA 2V98A 1OBCA 3GARA 3QU9A 4Q48A 2EGGA 2WJGA 3IQEA 5AJVB 3HYTA 1AQUA 3LPLA 1A04A 1XGKA 2HDKA 2CXHA 1F14A 3DHWC 1WX1A 4WZBE 3RIYA 4AZ3A 4F3NA 5BN5A 5LKAA 4R54A 3EODA 3QWUA 2I65A 5I5TA 2VAWA 1ZAYA 1M8FA 5CR9A 5IUNC 1C1XB 2D8MA 1M3SA 5JNWA 4CKWA 2J9ZB 3WNVA 4AJLA 3I0NA 3CVOA 3TQIA 4G65A 4DA6A 3NFRA 3OZTA 5L3SB 2HIXA 2GO7A 5U9CA 5E95A 1PV4A 1G21A 1P5JA 3I37X 4FLFA 5EJ4A 2V9CA 3PGXA 3S8MA 1CR4A 3UGJA 2PRZA 3HL0A 4Z7JA 2O59A 2GPWA 3NP9A 4K9RA 4YRPA 2J08A 3Q2KA 4OJKA 3WVNA 2FSVA 4F45A 1RXCA 4NCBA 2BDTA 4LHZA 3P9RA 4PWZA 1RADA 1R0BA 1T9KA 1YONA 4CMGA 3D0OA 1V43A 4KVFA 3KLPX 4WK0B 4EPTA 2GLTA 1S7CA 2QTTA 1M33A 5L3VA 3HV0A 2CNQA 3TG8A 4QQRA 2R60A 4EYKA 4UEWA 2VHWA 4ZU6X 3EWIA 3IALA 2YNMC 3PI6A 4IM7A 2NZUG 4N3NA 5GJCA 1AQYA 1U9CA 1ZUIA 3LQKA 3OEWA 5AVSA 3L0CA 4ABTA 2OBYA 2Q2NA 1G291 5DIFA 3X1ZA 3L2OB 3G23A 3KR0A 5AFSA 5BYBA 1A8QA 1SCKA 4YCDA 5FTMA 1CR2A 3N0WA 4UE6A 4MITA 1Z4QA 2NYUA 3DFIA 1CZOA 3JYHA 4IGAA 2J0QA 1SD2A 1I94B 5IF3A 2FPGA 4KIGA 2P9HA 5IDWA 1KE1A 3UYKA 2VK1A 4O4IA 4ZYTA 1QP4A 1CUCA 4RACA 1V47A 2QF7A 1DLIA 3NOOA 1AKTA 3VYRB 1RR6A 3JXEA 1XB2A 4LH6A 3AG5A 1N6LA 2W4MA 2XXAB 5A3SA 5JCJD 5GONA 4GBED 2BKUA 4JT8A 1OXSC 3S2EA 3LHKA 2HMWA 3I52A 3IR5A 3WLLA 1TL7C 1YB1A 3ZV6A 4Q7KA 3P2IA 2PBLA 4CR8A 4B3RB 1JBKA 4U2KA 2ADMA 4C03A 4E03A 4KMSA 1KY2A 4E21A 1JQBA 4PICA 1OFVA 5B3LA 2D74A 3BVPA 4RIEA 2JEOA 2PKWA 3ANYB 2FZ5A 4N40A 3ZU5A 3JQCA 4GKJB 4YRRA 5KC8A 5TC4A 1V0JA 2PX5A 3O1LA 3T7IA 1MC5A 2G4CA 2WTEA 4AW9A 1XNQB 1YC2A 2ISSD 1L5QA 2KS6A 3E6AA 4YCBA 4YUVA 1SBZA 4D5GA 5DDIP 5TGTA 4MGHA 2FMTA 1P4HA 1R2QA 1TOAA 2VQFB 1B14A 2IYVA 4OMCA 1YVEI 1QFJA 1RLIA 2QVCA 3NHFA 4IIDA 5BXQC 5FNVA 4WLFA 3SVLA 2YUTA 2E21A 2FSSA 3FW1A 3QU5A 4TMKA 3THRA 1ZZGA 4KREA 3UUFA 6REQB 3H6KA 2ZTLA 4RM3A 3TTVA 2FHSA 3QK7A 3Q6NA 4ZAWA 3RUCA 4DR5B 1VG9B 4FYKA 1JHZA 4QJIA 4D6XA 1D4ZA 2NPOA 3V34A 1H3NA 2ODQA 1KIMA 5AM5A 5EHQA 5KDOA 1PNQA 3R3HA 1PT8A 1JQKA 5AM3A 5LBIA 4XWKA 3KZXA 5EP4A 2YYZA 1EGHA 1GUFA 4PQRA 5TGDA 3OOHA 1I9CA 3KCNA 4UZEA 1B1AA 2OZEA 4O33A 1GGFA 1U5CA 4DIEA 4AS3A 1MRNA 4JBWA 3SM3A 3ZU4A 1ESMA 5EJIA 3RVDA 1NMSA 3BS4A 1T9CA 1GTJ1 2N46A 1PL8A 1XVLA 3TPZA 1JFSA 2WSMA 3AEKB 2X4DA 4UUOA 5TARA 1M2KA 3DBHB 4OQZA 4OHVA 2QTVA 4INPA 4ND4A 3ZNOA 4RA9B 3PVCA 2J4DA 2BKVA 3E8XA 4KE8A 2RFLA 2YJTD 3E9QA 1XZJA 4YROA 5JIBA 1UPFA 4KH1A 4K9OA 1EFCA 1JQAA 1KEEB 2QZJA 2ZQYA 3BDVA 1C30B 3FNIA 4DBLC 5EJ8A 2RBGA 4D9JA 2OQIA 4LJLA 4O0MA 3PX7A 2FSFA 4RK7A 5GTDA 1SBTA 4URZR 3ITNA 3DLCA 3R0ZA 3KLBA 1J70A 4M60A 4L9AA 4JXKA 3RJMA 3M6XA 3WMXA 4LF6B 5EE1A 4K9DA 1ABBA 3EZ9A 3ZVNA 1JV2B 3ZDYB 1HM5A 4RK0A 4RC9A 3ZXYA 5I5VA 2AJBA 4BOYA 4YCLA 2X0SA 2J6BA 4G0ZA 3TMYA 4J3FA 3WO0A 4HDCA 4TLMB 1AKQA 3Q2OA 3WGGA 4ZQFA 3T1HB 2IIQA 4QUJA 4MW4A 3G88A 1E1KA 1X70A 2JAXA 4IPTA 4Y9TA 3AEQA 3SGIA 1FX0A 3K2BA 2EATA 2MHCA 4UEJA 4HNVA 3RWBA 5AIBA 1LU9A 3HPQA 3AZQA 4EB6B 1SA0A 5ULLA 2X1LA 3O3MB 3O3CA 2CZGA 1UAYA 3LWDA 4M3NA 5NLLA 3CISA 4HZGA 4MLZA 4B34A 4KNYA 2O19A 1KKMA 3L8FA 4WADA 4N48A 1EGVB 2YZ7A 1OIVA 1S2NA 1HYHA 1JL3A 2QGZA 5G0WA 4ESHA 3L1UA 1T15A 2ZIXB 3PC8A 1T2CA 2POCA 3HJBA 4RQBA 3RFTA 1WWKA 2CDAA 2CXUA 3KEMA 1C29B 1TZJA 1HTWA 3GJZA 3PVZA 4LNUB 4WA8A 4XQEA 5SYAA 3U7JA 4WBNB 1SXQA 4RTJA 3Q15C 3O1IC 2A5YB 2XYGA 1ODIA 1P29A 1QR6A 3LUKA 3R44A 1V7CA 1OUMA 5CA1B 1W96A 4KCGA 5EE9A 1IG0A 1WMAA 1L7RA 2B1GA 4KXVA 5CVCA 2ZRJA 1XQYA 2NZJA 2GJ8A 2RHGB 3TL3A 4EB3A 5KSWB 4EHHA 1JNXX 3D8SA 3NHJA 3PTLA 3RS7A 5I47A 5KKAA 5ABPA 2REOA 4WGGA 1GHTA 2HQ1A 1R6VA 3KWJA 3KUCA 3OZUA 3TI9A 1KI6B 2A2ZA 4G4GA 4NBUA 5IJZA 1FNSA 2EFGA 4EYGA 2C9ZA 3T7RA 4QEKA 1UBHS 3QOWA 1GVHA 1FFWA 3R3ZA 1YFLA 1KDRA 2NV0A 1M73E 3LZCA 2VQ3A 3CZ9A 2YYAA 2Q8QA 3S1AA 1WKBA 2R96A 1II0A 3IEXA 4NYIQ 3GGJA 5GQSA 1G8HA 4R1SA 4BMVA 2HCBA 2ILTA 4HHEA 3T35A 3DLPX 4X6LA 3PT9A 3CLHA 3DZFA 1OFIA 2QVGA 2ZOSA 2PL9A 1OWOA 1BE1A 1WVGA 2D1RA 3GPBA 2NVWA 2X0DA 5FLXA 1Y37A 3HCDA 3DXXA 1DBVO 3HXLA 3RUHA 3GJXB 4H16A 5HIJA 4OFWA 1I6KA 4YXWA 2X9NA 2XCIA 4TS4A 4ZYUA 5BN3B 1FCJA 2PH5A 2F90A 1CY4A 2W2MA 3B51X 3JV7A 4PG6A 3V7WA 4IW3B 3GGSA 3FPFA 1QG2A 5HTOA 3DCNA 1U1EA 3ETDA 4HEHA 3AY0A 5AESA 1DCMA 4CLXA 3KTAB 3TR5A 1KOJA 2AZMA 3COWA 4G07A 1UBEA 4LF9B 5K99A 4FT4A 1IAQA 4LZWA 3S7TA 4PQEA 4Q4HA 1EX6A 3VHXB 1TM4E 3DTVB 5JMWA 2ZP1A 5DM1A 1Y42X 1HDYA 3DFFA 3K0HA 1KDOA 4P4GA 4U3JA 1QB7A 4D9HA 5HZHA 1A9PA 4G5GA 4GQAA 5JVLA 4ZI3A 4L9WA 1ZOOA 5B2EA 1FTSA 2DBYA 2MU1A 2M98A 2VYQA 2OGWA 5M34A 1LDGA 1NQOA 4I8DA 1DEHA 1GKKA 5TV2A 4PR0A 1ATZA 4QGHA 5GZ3A 4OLAA 1Z38A 4U1RA 4BGIA 5BW6B 3JQ8B 3WK8A 1ECBA 4URYR 4HADA 1SUPA 1PF7E 3I01M 4GBJA 1PP4A 1XEXB 4YT8A 4L0QA 4JLSA 5FPYA 3UT0A 2R6DA 5HBGA 2YRWA 3DQQA 4HFNA 3NHWA 3FRJA 2QPTA 4WACA 5EMNA 3VVLA 1SUBA 4UPVA 1JWBB 2EFDB 2GN6A 3CUTA 4X91A 4A0HA 1P17A 2XIJA 2GA8A 4YBZA 3MRXA 2X5JO 2XF2A 4U00A 5KVAA 1AZTA 5AUQA 8ATCA 1R66A 3UB4A 2G1AA 3QSYA 3UWKA 1XL0A 2P5TB 3BJIC 1I4DD 1K68A 3SYMA 1ENPA 3TLMA 1ORRA 1K7SN 4FIZA 4E51A 3C6YA 1EB8A 3LW7A 1ECCA 3ST7A 2WWYA 4TTPA 1ISMA 1HEUA 1F60A 4B7XA 1YDHA 3DZBA 1SU4A 1UC8A 3ETCA 3Q3VA 3HVIA 4PSUA 5AI4A 1RAFA 5ECDA 5HILA 4TTTS 1SXPA 1BDIA 2H5IA 3EY9A 1M5TA 1P45A 4OPMA 1XPUA 1U8AA 4G4IA 3S2ZA 1WMSA 3BRSA 1ISFA 3R7DA 3VNSA 4RCVA 1N5RA 2W6ID 1PEYA 4TSRA 4P3PA 2W2TA 3PHCA 4M0FA 1ADBA 4IVNA 5GAJA 3LXUX 4PZCA 4JI1B 1CETA 1TDJA 2KMLA 3ZGLA 1XCOA 3KWLA 4CHTA 2AS0A 3D2BA 3ZGYA 5I48A 1CJUC 4Z8YA 3TINA 3W6OA 1N5IA 3D02A 3WYAA 1AH2A 4ZT4A 1SB8A 3L7YA 4X92A 5ER6A 5K4AA 1BVYF 1ENYA 4JYBA 1C7JA 4BTVA 4H0FA 4PG7A 1ZM4A 2OFFA 5IKPA 1IYZA 2XRFA 7REQA 4OGWA 1PZHA 4FSHA 1BE6A 2QSZA 1YQWA 3JQAB 2R87A 1DWPA 1MAUA 1LVGA 1OAOA 5BY2A 1E92A 2ZTHA 4QUAA 3QQ5A 4TMXA 4LJ8A 4F12A 2RIRA 3G9QA 4LDPA 5CBPB 3INTA 4JI2B 3OQVA 1VIVA 4QYXA 2E4AA 3O26A 3T0GA 3MOSA 5DTQA 5B53A 2GHTA 3G8CA 5DGCA 1L5VA 3ZCXA 3AR4A 5FYDA 2XAAA 4C5BA 3HGQA 2IU6A 1DAIA 5CH5A 4NDNE 2X0FA 4DZTA 5ELXA 2TECE 5H70A 4NOJA 4FOPA 1QRDA 3NI2A 4GLFA 3A1NA 4Y2VA 1CQIB 1IXRC 1G7RA 4IUYA 3W8DA 3H1BA 2VSFA 5A6SA 4TWIA 5KYYA 1TMOA 2V59A 3IEPA 5IDVA 3VU9B 4EHDA 5JDIC 8ABPA 5KTYA 1A2QA 2BJVA 4CN9A 1QHHB 2G0AA 3U56A 2G9NA 1P0QA 2WD9A 4LZAA 4EO4A 2QYSA 4BU0A 1U11A 3CR7A 2IV7A 4LJYA 2ONZA 4OAOA 4F9FA 2IOFK 3K0CC 4I3GA 3G2HA 4S2UA 4QWWA 5L7TA 1N33B 4KQHA 4MO9A 1A7JA 1XRPA 4UCQA 4Z7QB 3LUAA 1E1CB 4JSTA 4G25A 4YT4A 1PD0A 5KAPA 5IXYA 2FX5A 4MQLA 1MPXA 3BJRA 3LNTA 5HYVA 1QYCA 4G1BA 2WNIA 4L2IA 3KPJA 1NVVQ 4KO2S 1T1GA 4M4SA 2DPMA 4BWVA 2P62A 3KAJA 1LSJA 3A10A 4XGIA 5IBCA 5AKKA 1NVVR 1NNSA 4AY3A 3L1VA 4NBSA 2JW5A 1Q7GA 1X9GA 5I8WA 3G8BA 2MTBA 4YQYA 1QE5A 2B35A 3DPUA 5GADl 3B48A 3JQGA 1RI2A 1B26A 2ECPA 3ZD6A 3ROZA 5C4IA 2LGJA 2D7DA 1ORIA 4GLXA 4DV5B 2BGTA 3DVRX 4MQMA 4CJXA 3BABA 4EJ0A 1RYYA 1FSFA 3KKKA 3NAGA 1J49A 4LDNA 1DWUA 2XQIA 3DFKA 3GJ3A 5GIPE 3VH2A 4JSYA 1NLUA 1RRPA 3G85A 4U5QA 5KCMA 2H5LA 3TFQA 5NULA 5C5CA 3H5VA 3S5JA 5JPIA 1F9AA 4F4FA 3O21A 3IV6A 1BXKA 2JBAB 3HFSA 2IYNA 1QH1B 2ZYIA 3DT6A 4OTZA 5DT9A 4ILEA 2G9VA 4ETNA 3FYUC 4LJAA 4NS1A 2XGMA 4NPCA 3KPUA 3RR2A 5TGZA 3HZRA 4ID3A 3M2TA 2QX6A 1VZ2A 1CIPA 1F6BA 2PGNA 2XKBA 5KUTA 1QQ7A 2BEUB 4NAVA 1S8OA 4ZRMA 3NVMB 4BTEA 1M0TA 1G3UA 1DE0A 1KEWA 4FKMA 2B82A 2Q28A 4G0YA 1JN0A 4WY8A 5DNCA 2BGRA 3R0QA 4EY8A 5DTRA 1BXRB 1IUKA 1VPVA 2ODPA 2QR2A 5JXIA 2WUVA 3EUFA 1XDUA 3W2IA 2XDQA 4KC0A 1FVIA 2OL4A 3D8TA 4NZ9A 4RQTA 5D86A 1DB3A 4TLLB 3IYLW 4ZO7A 1NIPA 2G5CA 3TQHA 2V5VA 4ZT2A 2YN2A 3OZ7A 3WGZA 1DADA 4OO3A 1IBRA 1Q22A 3A2LA 3I58A 4MV8A 4O29A 3S27A 4EX6A 3FYTA 3VTKA 1V71A 2GRAA 1T2UA 2Q4BA 2VAXA 3H9QA 1XYVA 4GW3A 1HE1C 4J0KA 5EY5B 2OBFA 1O0SA 3TL2A 3J81A 2AZTA 5J4HA 3B1VA 2R7KA 2LZ0A 4RD0A 1TMYA 3KSUA 3MJTA 1GNTA 2P9EA 5H3HA 3JSAA 1EYZA 1HLGA 3ABZA 5C5DA 3C87A 3PUIA 1MENA 1DBWA 2ZIZA 1QV6A 2BM0A 1PT5A 3B38A 2EJ0A 1FB5A 2CLDX 3R7AA 3THXB 2QLMA 4MQFB 1X86B 4JI8B 2PGJA 4BQFA 2ZWPA 3IBYA 4DCCA 4XUDA 5JNUA 4P0QB 3VUEA 2H1LA 3BIJA 3E35A 3K2QA 1QS0B 3MTBA 3QWHA 4H2DA 2HN9A 4I55A 2SCUB 2UVDA 2V8BA 1GOTA 2YXBA 2I6QA 3CSUA 1BG6A 1P0IA 2IYRA 3HCRA 1N6PA 4RU1A 4PAWA 1UADA 1O9HA 3PE4A 4WBXC 4CU5A 4QU9A 1S2GA 1Y7TA 1I3LA 4R2JA 2J85A 4K9QA 4MGIR 4M38A 5CB4F 4HQRA 3VKFA 3ZKAA 2G8NA 1JMYA 3X1DA 2FZVA 2PXAA 3EFEA 4LGVA 3H1TA 2Q3EA 1GZHB 3EFBA 2H54A 1A5SB 3P2YA 4LY0A 5D87A 5JO9A 1G16A 5TB5A 1D4FA 4YJHB 4EO9A 4E70A 2EKDA 1NUPA 1PKXA 2C29D 1Z15A 3I92A 4Q1EA 3HCAA 3FZGA 3SJZA 1R0RE 3KJGA 2N9UA 2OG1A 2QWXA 4U63A 1TAGA 5C53B 2CL5A 1Q57A 2ZT8A 4RTSA 3G89A 2QRKA 5F2KA 2O8DA 2FETA 1ZMRA 2WWXA 3IIJA 5KOHB 3WYDA 1ZR4A 5HMMA 3L4BA 3G0HA 5E9WA 2A57A 3E22B 5KSPA 2FW9A 4DSTA 3BKWA 2EW2A 2H2FA 1M6HA 2A9PA 3EVEA 3HB7A 2UZIR 2ADFA 2UYOA 1GQ2A 5DHAA 4C4SA 4CEIA 2QUJA 2R5FA 1F12A 2X9LA 5CEFA 2HBRA 1M72A 4TV8B 3ABRB 3DGFC 2XWBF 3CRQA 4QVGA 4R05A 2CHVA 5GZ6A 4E14A 3K0BA 4WX2B 2Z6VA 3CVJA 1JH9A 4PIMA 2GN1A 3MG9A 3N75A 1L8OA 1CQPA 1O94C 2EX1A 2XCUA 1NQTA 3I2YX 3EJ6A 3R3WA 3IAEA 4GVPA 4TUYF 2C96A 2D3TA 1F4VA 2AG0A 2JLSA 4KYIB 4M7WA 4WE3A 1K4YA 1PVVA 1USVA 1JPVA 2CCJA 3KKLA 3MELA 5EXSA 3ZWCA 3NXSA 2WNSA 1CUVA 4LWOA 2Z3WA 4XUGB 1GTRA 3MLAA 5IVIA 3VR6A 4DDVA 4BE9A 4DV1B 4D9GA 2ZTSA 4EUHA 3EMBA 2H4ZA 4QHYA 4B4OA 4C7OB 5KQMA 1E0JA 1VHJA 4HG2A 1DNPA 3ZY2A 1QIKA 1U4SA 2C7OA 2V0GA 1PK9A 2GB4A 4Q4CA 3ERCA 3DXYA 4N0MA 3WGVA 2ZSHA 4KQEA 4F5DA 2WPDA 4J2TA 5ALDA 4ZJYA 2C9OA 3C1UA 1W5FA 2EJCA 2D06A 3OQIB 4J76A 4D2IA 4Q02A 2KSQA 1ZCFA 5A4MS 4YACA 2EJWA 3E1SA 2VJOA 2XPCA 2OSBA 1VCNA 2VDWA 4I8IA 2R66A 2R86A 2W2QA 3NDRA 3OY7A 4MYTA 4QTUB 1ETUA 1M1XB 3EZYA 1H2AS 1RKXA 2IYQA 4YIKA 1YRQA 1P5ZB 1QGAA 2GVDC 4BB0A 3OPYB 1KXZA 5DNVA 4W5OA 4B4KA 1IY8A 1FVOA 1C7EA 3LHFA 2O0LA 1NVBA 2QB5A 2BZGA 4G0PA 3ACDA 4J90A 2EJ2A 2NSYA 4X66B 5FBWB 1HETA 2B61A 2Z2YA 3ZHBA 1TTQB 3DEYX 3JWIA 3LBNA 4P35A 4MKHA 2ONYA 3PC4A 2DH6A 1SHUX 1UOOA 5JYCA 2VVTA 3PRHA 2QPAA 2BFEB 1T5LA 3GELA 5D6NA 4DXHA 3WC4A 1H85A 4DNPA 3FDZB 1G63A 1G2OA 1X7GA 1ZD2P 5EKSA 5EJEA 2HLDD 2PM8A 3BD8A 5KYKA 3SC2B 1X9IA 4JBXA 2WZCA 1T36A 2UZAA 5EZQA 1DXHA 1LLCA 1EHCA 2B37A 4F3YA 4N6OA 5AW8A 2OSVA 3HDTA 1Z0JA 3FHLA 1USIA 3H1FA 2WF6A 2DTXA 3O82A 2NU7A 3ADBA 4LE2A 3GA7A 1S9HA 2I2WA 4QUGA 5GY7A 1FDTA 1NYLA 1XDWA 2GQSA 4NE9A 3PP8A 3BGSA 3KSZO 4REMA 5FWAA 2FMHA 3J80A 1QGZA 3QGMA 3GAMA 4OHYA 3DYVA 3WLMA 3ZX5A 2Q3BA 4D8UA 4GLLA 4RHTA 3SF8B 1ILEA 3MS4A 2QA5A 1L8XA 1N0VC 3CNBA 4HNQA 2P6OA 1IM8A 5KPJA 2E4YA 3L8EA 1UEIA 2XWSA 3TIVA 4HB2A 1GDDA 1H66A 1J2UA 1WSDA 2GN4A 3PC7A 3P97A 4LRXA 2VDPB 4UNSA 4C21A 2FUG6 4BAZA 1NVAA 2G17A 1D03A 4QPCA 1EJ2A 1G5RA 1PRYA 2CZCA 2G8LA 4ENWA 1GKUB 4S1NA 4U9IS 2F43A 4F9TA 5AUNB 5CEEA 2LVBA 4EG5A 5BWOA 3IQZA 4ZT3A 5LYYA 2WP8J 3SHQA 3EJWA 1UZNA 3NKLA 4C4XA 3ZZTA 1TUIA 5ALZA 3GOHA 4JLUA 5JCJA 4MAFA 3LQFA 1Z4OA 4KN9S 4O2BB 4PGAA 3WLSA 4ERNA 1WF6A 4GQBA 2BTQB 2COIA 2AH5A 2AMLA 2WHYA 4MSUA 1Y80A 5BWTA 4O4LF 1Q1GA 3AOGA 1E89A 4FD2A 4RJJA 1XHEA 3A1WA 1DPFA 1P1BA 2DECA 1US8B 3H3JA 4UMDA 4UHKA 2HHFB 1GPAA 3NCHA 2Q3JA 1T1EA 3EOZA 2IHYA 4LJSA 3A1SA 1GSHA 4XIGS 3TI7A 2YWXA 1MTOA 3LC7O 3K15A 3MQFA 3RSSA 3DQZA 1AK9A 1ENOA 2J4FA 3RG2A 1IRIA 1YE5A 4ER0A 1E32A 2WMDA 4EHFA 3QBDA 5JZ9A 1BHSA 2XZOA 2D1FA 5AXBA 1CUZA 3RBVA 1XJ5A 3GZTB 5FTWA 1K8RA 3I05A 3P45A 5IKOA 3BJZA 1ZMTA 4PFKA 3D6UA 3IJRA 4AKHA 3PFGA 4OHMA 4RF2A 5I01A 1EUZA 2DVMA 2YUIA 3F67A 3KT6A 1LSUA 5DO9A 2OBLA 3BB3A 4K6FA 4NTZA 4B76A 5JEEA 1B0UA 3GMTA 2ZB2A 2DQSA 4MDHA 4NMWA 4EIWA 5LXTF 2VJLA 2VAPA 2KHZA 4YRIA 4F85A 2V0CA 3O7MA 5CCBA 3OLYA 1KGDA 4ZZ1A 3MEQA 4ZK6A 4LXYA 5JQGB 4XD2A 1XC7A 2P9JA 3LLVA 1PLLA 2GBGA 5CP8A 1R8XA 4IIJF 1T5DX 5DIZA 3FHOA 2L17A 1CIVA 4WFIA 1GSAA 4AMGA 4V0MA 3GFPA 1E79D 2ODNA 3QUQA 1PZMA 2RHDA 4PZPA 2E7ZA 5KHAA 3ICQB 2BMWA 4WAUA 4XWYA 5ALYA 5CX1B 4DUYB 3ILHA 5DP1A 2IYAA 2FSPA 3GFBA 1AV7A 1KC3A 2VSQA 4MS4A 2IU3A 3U3XA 4QIHA 1YAHA 1GV1A 3AI3A 4R2IA 2XSZD 3VVBA 2Y9PB 3QTLA 3I61A 2O0MA 2PBFA 2XR1A 2NWQA 3O90A 4L5JA 5ALMA 2YQZA 4XW2A 1ULSA 3TD6A 4E22A 1KRHA 4F6LA 3JTMA 2HU7A 4M0PA 4TTVA 1NNEA 2F9LA 4YRZA 2GN8A 4YRTA 4R1PA 5KVSA 1OAOC 1GPJA 1K8QA 1U3GA 3LOPA 4TXHA 3N5CA 3CEHA 1DCFA 4G5FA 4PXYA 4RBNA 4XYMA 5D51S 4GOJA 2IQ5A 1ZM3A 4ENRA 2I6GA 1DKPA 4ZFNA 1I5RA 1W75A 2X7XA 3RAPR 3FMPB 3S3TA 5A5EA 2NZ2A 1NI3A 1FXWA 5LA6B 1G5TA 2YXDA 4C14A 3KVYA 3DTGA 2PLRA 5ALHA 3QIAA 4IP0A 3UJHA 1XA3A 2YFKA 2CXPA 3I2KA 3DNPA 1X2BA 4FLMA 4LK3A 4B3FX 1P4GA 3G2IA 3WKDA 2WB4A 2CLCX 3IUMA 4MUHA 1RYMA 1O57A 4RAOA 2GK3A 3WV5A 4DDKA 1BHQ1 2QIOA 4NZNA 3M6WA 3THYA 3S2UA 3T34A 4QG7A 1R10A 4FDVA 1ZA2A 5DNYB 5LR6A 4MTCA 3KSBC 3LA8A 3UPDA 1JQEA 3FWHA 2HLPA 4QAQA 2IKSA 1KJZA 1KU6A 4BO0A 1KJ9A 2H48A 4CMHA 4Q03A 3K35A 4F3CA 1M5UA 3TB6A 1C2YA 4DV3B 5ERGB 4G0UA 2VSYA 1T2VA 3KYDA 1Q0PA 4RTKA 4UNRA 1GPKA 1QTQA 4NZMA 5L53A 5MN6A 4XZ3B 2WHRA 4IHJF 1SU8A 3CJTA 3NS7A 3TIGA 5F64A 2BE9A 2QQEA 4MIKA 3U0VA 4LF8B 1NUQA 4FW9A 4B5KA 1A88A 1VA4A 4NXMB 1KSGA 3ZV3A 3B5JA 1SCUA 2B8WA 3HKCB 4Z9YA 3ESXA 1UPAA 2GESA 2Y93A 3DCYA 4K1LA 4QBGB 1XMXA 9ABPA 4OJNA 4WV3A 2VEDA 2OB2A 3FNHA 4JLMA 5KTRA 4JC0A 2ZREA 5LCXA 1YV9A 1L5NA 1IMOA 1T3LA 2OQ2A 4IJVA 1QHFA 4RXTA 5E6RA 4HN2A 1LTQA 2AXNA 1JLLA 3I9NA 3BTOA 1ZKMA 1OFTA 1XXHE 2C4MA 2Z57A 4Y7CA 3LX8A 5BRJA 1X77A 2IYTA 5GV8A 1JKJA 1MC4A 4LGCA 2C5GA 5EC8A 4I99A 1LZLA 1KS2A 2QXYA 2DH5A 2EZ8A 1MQAA 5GPBA 1NN0A 5LQMA 3QLUC 5CLHA 1XD2B 2H3HA 4Q4AB 3JD0A 1TJPB 1Z68A 1J0XO 2JFUA 2W6CX 3VX4A 1BGVA 1X7ZB 1D8AA 2FGKA 2JFXA 3V5NA 3NTRA 4ZGBA 1CEEA 4EFMA 1Y6RA 3ENKA 4R2WA 1FDIA 1NY5A 2JIPA 3ISTA 3FVRA 3LM8A 3KB2A 2PD6A 1HKUA 1C3EA 3JY6A 1BE0A 3RASA 3AVTA 1G8KA 1G1AA 4N5HX 3AH8A 3DV2A 4J29A 3KJHA 1V8PA 4A0SA 5FPOA 4KZKA 4MJLA 4PG4A 3AILA 2FEXA 4PBSA 3ETJA 1RLOA 1VHTA 4IQFA 4JDUA 1MO4A 1ACLA 1ADFA 2RI1A 1E8MA 1E66A 2OCAA 1VRVA 1P9RA 1E7YA 2YCBA 4QTXA 3RNOA 4L0CA 2IK8A 3TTSA 5A03A 1VJCA 2PWYA 3UKOA 1D7OA 2VPTA 2DAPA 1VJGA 4RK6A 2VNHA 2QTAA 3ND6A 4RFSB 2ZJ0A 4EHJA 1B8VA 1UCFA 4KOEC 1D6SA 2FMKA 2FWBA 3U49A 3I9JA 1ARZA 1Z17A 1ZH4A 3H9BA 4FMCB 3WFIA 5LYJA 4OGLA 3T7TA 2PBRA 4UTOA 2QG4A 2R4UA 2H4HA 4KLAA 4RAQA 1T0JB 1E20A 3FXAA 3NNNA 2P6MA 4ALLA 3I9V1 4QLAA 1TUBA 1KO4A 3VSCA 3A0UA 3HEMA 1E1LA 4FB5A 2QLNA 1QIIA 3MSCA 3QF4A 1ZVJA 3EGWA 5AHRA 1LJ8A 4EY5A 2ZUTA 2IW1A 3D6VA 4IIUA 3HO1A 2WV9A 2PMCA 4EWLA 4ZGGA 1SIWA 4EUNA 1II9A 3INRA 4KMOA 2NADA 4ZQGA 3SQLA 4IH1A 1O7JA 1JU3A 3ORHA 3WXBA 3PQCA 2XDWA 3N8DA 5KAMA 4A2CA 2IXAA 5HMLA 2O8FA 2QN6A 3LY8A 3WB2A 3ZWXA 1TZCA 2DFPA 2X6QA 4JOBA 2HT1A 2R25B 4OH1A 3I62A 3C5VA 1SD5A 3BK2A 2H65A 3SPXA 5CM0A 4O2RA 5IJ0A 4KXQA 2I1VB 2EYQA 1LJUA 2A94A 1JGTA 5HBRB 2M1ZA 3ESRA 3GAAA 3WJ2A 1EFAA 1UXOA 1Y3BE 2J09A 1B74A 4OKIA 2W93A 4RTOA 5G2OA 1MPTA 1NPYA 1IJEA 1OXBB 1OTYA 2BKLA 2HA7A 3A4VA 4BO4A 2HU2A 1EFPA 1X7WA 5E4FA 3QWFA 4NR0A 1W6UA 4G4SO 2QIPA 1Z3IX 2XMBA 4EGSA 2W6IA 1HLPA 2ZW9A 3L4BC 1JWAB 3HMKA 1TVKB 3VNAA 2H16A 4BVGA 1KSJA 1E5QA 2BR3A 2X14A 3E5HA 2NQ2C 3IQHX 3MB5A 4QICA 3WIBA 5I4KA 3O2NA 1P16A 3L06A 1I1MA 3ZHTA 1ZWLA 3N07A 2WTNA 1GCAA 3NTQA 3RADC 1NP6A 4DXDA 1P2SA 1E3SA 1MABB 5JJKA 1KS9A 1QYDA 3FGNA 2BR4A 2CFRA 2WWGA 3SLKA 5EJ6A 1LW6E 1D4OA 5SYNA 1Z06A 1EVKA 3PXAA 2COEA 3AHFA 4FYIA 5CG2A 2P5YA 5A2QA 2ZI7A 3O4GA 2K2QB 4QUEA 1W85A 2FQWA 4MP8A 2Q6TA 3LVRE 1NN5A 4EABA 5BVGB 3UPUA 2QLLA 2W0SA 4KWTA 5JI3E 1A5TA 1QE0A 5KQGA 3SIWA 3IKVA 5M7EA 1KQOA 4M8KA 1AKNA 3FIUA 1T2EA 4GZ3A 3UQZA 1KEUA 1QHSA 1VLJA 2QXUA 1AKEA 2VA9A 3C15C 5D01A 3TECE 2CW5A 3W7AA 3J81k 3PPIA 1WG8A 1HE8B 2PIDA 1FSGA 1Y5LA 1GRVA 1E3EA 1EX1A 2HIAA 4JI6B 3UK2A 3I04M 3LP8A 1Z07A 3T7EA 3GPCA 5KYWA 1D2GA 2P65A 3EDQA 3NORA 4H6VA 4KWHA 4NV0A 5KQPA 2ZM5A 2AFHB 3H2IA 4DCOA 1XTPA 3LT0A 4FT2A 3F9IA 5KBYA 2GCIA 4MQBA 3K0FA 2P0EA 1ZNQO 2AG8A 3I9MA 3RPEA 4WKNA 1K7EB 2RGXA 3T06B 2R3SA 2VDOB 2D5BA 3KT8A 4TUYA 5KPDA 4HATA 1TD9A 3BMQB 3R9XB 4R83A 5KHLB 1N2CA 1DZ3A 4HDSB 1JDTA 4RPLA 1Q1BA 2ZRKA 2EDCA 3ZWMA 4B3IA 5A02A 2C83A 1WBJB 1U0JA 2Y8EA 3L77A 1FS6A 4HLUA 2BLLA 3OOEA 4RMGA 1CLEA 1QRAA 1VYHA 4BMNA 3ICVA 1Z6TA 2I1QA 3QF7A 3UKDA 1ZD4A 2OHJA 4LBVA 1P31A 4XX0A 5EZSA 4ZN6A 1A4XA 4HYTA 1TMKA 3WBBA 5BV1A 2C7GA 5HQ3A 3K71B 3WAKA 2PKQP 4YAIA 2COGA 1ZFNA 1UZLA 1X1EA 2DU8A 3RYIB 3HNPA 3L04A 3FVWA 4X1KB 1V4NA 3QXSA 5C46F 1Q3HA 4NQRA 4D3YA 3N7UA 4J6FA 5DMHA 4HNRA 2HMTA 1E63A 3O31A 3NH9A 5F52A 1L0BA 2HW8A 4G0MA 1SC6A 4BC0A 4HAXA 2X4LA 4HAIA 1IUOA 3KYCB 1GPBA 4HAWA 3ZU3A 4DPMA 2DHEA 4NSNA 2IYWA 2Q0XA 4FE4A 3AKZA 1FFSA 1RS0A 2FEPA 2QN3A 3TLYA 3U7RA 3ZNQA 3ZXXA 2JJ8A 3AM1A 3MUFA 2QAIA 4JYAB 4B71A 3GIDA 2PNFA 1HK7A 5LBTA 3QE2A 1VI6A 5JZMA 3HBLA 2B4KA 3QPUA 1SUDA 3QVJA 1OX4A 5A4FS 2ZRHA 1V3VA 4WKCA 3DTVD 1TK9A 1HZZC 1WZUA 2AC2A 2CL7X 3E84A 3Q4GA 4EEXA 1YFJA 4F4HA 3W1GA 4DIOA 4H27A 3HXQA 4WLNA 2XUHA 1Q0UA 2I6FA 3CU5A 4X3OA 4D9EA 4NBNA 4QOEA 3RBZA 4I19A 3WJAA 4QVKA 3SR3A 1AB6A 2WB2A 1EXDA 4OOFA 1TPYA 4MW1A 3LPMA 4BFXA 3HGMA 3M6UA 5LNK6 3TXYA 4O3MA 4OBXA 4MV7A 1IG3A 3U80A 1V11A 1N6KA 4AL4A 2FQXA 3UAVA 2ZEJA 4DIMA 2ZE5A 2OESA 3OY2A 1HUQA 5TPWB 1FNMA 3RVSA 4MUEA 4AQYB 5AH0A 3EZ7A 4BNWA 1ZU5A 2N47A 3S2YA 2HZ7A 4MGZR 2PT6A 2Z3ZA 2C5FA 5DM2A 1QHXA 3G9XA 2KB0A 1E94E 3F7OA 4IYRA 5IASA 2IYXA 3OHPA 1XCPA 4D4KA 5HHTA 4Z86A 1U7HA 3DAHA 3R40A 4J4BA 4W8OA 4BNJA 1W5BA 2PGXA 1GUDA 3W6PA 3Q2IA 4JLOA 3IO5A 4PZ0A 2NUAA 1LB1B 2UUCB 4RPIA 1JA0A 3FPHA 2WKPA 4MWEA 3U31A 1DXQA 7ABPA 1CEXA 1UQTA 3FA2A 1J8YF 4L8LA 1Z2DA 2ZFUA 2HF8A 3VJLA 4A73A 2GHIA 4DA7A 3TSWA 3PFNA 4DT1A 5J58A 1RAIA 2AOXA 1IYEA 1XTUA 2DOKA 4OXQA 4XTRA 4C1BA 2AQIA 1G4HA 3AXSA 1FFBA 1VG8A 1XWWA 2D8AA 2DC1A 3KKNA 3N6VA 4MWDA 3SQMA 2Z5GA 3VM6A 1D6JA 1RACA 1H6AA 2X9QA 3IILA 3QH4A 1PFWA 1SQ0A 2MWMA 4KSCA 4AUKA 4EZEA 4E2ZA 1NXPA 1KVRA 3P5BA 3O75A 3PQ6A 4R9NA 4B8ZA 1Y0BA 1KY4A 1SO8A 3KQVA 2XWQA 3N3AC 5K1ZA 2DZDA 3MCVA 4W1QA 3LCVB 2O3SA 1JG1A 1YMQA 4MIYA 2AZXA 4ZVTA 2VN8A 3FCYA 4A6EA 4IVQA 1XP8A 2BEWB 1VL8A 2PHZA 4RPGA 4JLKA 4ND2A 1XKLA 4ZVRA 1OWPA 4NMXB 2VXCA 1O87A 3PJGA 4LRWA 3TZBA 4LPKA 1TAUA 1XA0A 4O0LA 3AIOA 4F91B 4ZYYA 4BQOA 4EW6A 3VOAA 3FUXA 3K1YA 4B3HA 5HOEA 1MW8X 1K9SA 3Q8WA 1UPCA 4OUDA 4OXIA 4IYJA 4XB1A 1ZNWA 1T6BY 1Y6JA 4GLOA 4JB0A 4MR9A 1GVNB 3QMWA 1RCUA 1H94A 4US1R 1YIDA 2P3LA 5EHGA 3EVTA 4ND1A 4Q66C 1NBME 4ZK2A 1M2VB 3MHPA 5AVZA 5LXTA 3WQBA 1W88A 4J16C 5BPHA 3GVHA 4YMSA 3U61B 4XJVA 4HGPA 1NPTO 5CA1F 2VCHA 4O84A 3CLUC 1FYXA 1MT3A 2NZYA 1THTA 5IFLA 5JCXA 10MHA 3MWGA 2HJGA 3TEKA 3GCGA 1K6IA 4PO3X 5JNSA 3A4TA 4ZOBA 3R2JA 3FOAA 4IIJA 3I76A 2IPAB 4BFUA 1P1JA 4ZVOA 2QR5A 5A3JA 2WJ6A 2QUBA 1LJLA 1GL3A 1Y7HA 1FDSA 1VKRA 5JAPA 3G2LA 4JGIA 5JHGB 1OYYA 1Q83A 5KZMB 2PGOA 4QECA 1X7YB 1PZFA 4KNVA 4D46A 5HUHA 2QRJA 2HMUA 3EDCA 4AECA 4NCAA 3ICPA 1GYRA 4CIXA 4HGZA 2QYHA 1CCWA 2Z2ZA 4KPFC 4B09A 1CFZA 4CG3A 4EF4A 3FTPA 1JR6A 4HWTA 4IFBA 3K6RA 1IJFA 2C3OA 3T9FA 2G3YA 3DBOB 1BEEA 2AW5A 3OU7A 1EKXA 4WXYB 4D80A 2Q2WA 3QV1A 1IHUA 3A1CA 5C31A 3VNQA 2PR7A 3DMDA 4QOHA 1UOEA 1NSFA 2YHBA 4M76B 5LP6C 2O8VA 1POXA 3COZA 2Q5LA 3QUBA 4AKIA 2VH1A 4JIMA 2WMNB 5LMUB 1MN6A 3TE6A 2L0XA 5HS6A 3EC1A 2Z83A 1QV9A 3OESA 3IKTA 2VUUA 3A1VA 4C7BA 1FVFA 5LP1A 3JQBC 2Q5OA 1S7GA 4V1CI 5AI6A 1GNVA 1SG6A 2R1ZA 4AX8A 3PXGA 2ID7A 3KC2A 1OA1A 2V97A 1U3DA 4KI0A 3FN4A 1B7GO 4QU8A 3NQ41 4BU1A 121PA 4DKJA 3MTAA 4O4HF 1UKBA 3AUUA 2HK6A 4Q1CA 4WK6A 2Z1DA 1YJCA 3VNRA 3WGYA 4HFRA 3D64A 3T9BA 1E9RA 1Z83A 2YIMA 1M2GA 3M4YA 4HO1X 3V3KA 4ZYVA 4EVSA 2F1JA 4GRDA 4URFA 2YWVA 1TIPA 3CH5A 4U7GA 3TX6A 3FMGA 4HRAA 1PU2A 2CDNA 2WWFA 4LTDA 5JSQA 3ZKWA 2DFKB 2GN9A 1V3QE 1ONOA 2HLDA 3SVZA 3F5QA 1U5BB 3IMFA 1DUVG 2VPXA 4TTIA 4II2A 4DRZA 4N3GA 4EPWA 3GFVA 1TQDA 1RD4A 5BNTA 2VJKA 3GDOA 1P60A 2OBXA 4ZCTA 1WF3A 3TLZA 4BV8A 4DMHA 4PRLA 2VNKA 2B78A 4JA2A 4MI6A 3TZ6A 2X9GA 5LC1A 1YJBA 4CF5A 3G2OA 3P0HA 2IGBA 4YRJA 5BUSA 4PO9A 3INGA 2C5HA 1NXVA 1KQ3A 4QGFA 1Y3DE 1W47A 5HKOA 3R9RA 4ARUA 4BUCA 1E9VA 3R5FA 4M87A 1OQAA 1ZVKA 1U7PA 3O4FA 5D6OA 2ECQA 4TRMA 1YCDA 2IZ6A 2MSNA 1GL6A 1Y8RB 2J3HA 1IDOA 2L69A 3ECSA 4YCSA 5L4SA 1KOFA 3QFCA 1IZ9A 5H16A 4CM7A 4KHPB 3N5KA 2XZTA 4NJEA 5EIHA 1A9XB 1E0SA 3A3KA 1OV4A 2QBYA 2PUCA 1S5PA 1V9CA 1WW3A 2PO7A 2H31A 2WDZA 1W0CA 2EFCB 3C6QA 3TSAA 5J1SB 1KRXA 5I7AA 1LCIA 1TA4A 1E3DA 3P2EA 4IFEA 4PRYA 2NAPA 4XGKA 5FOWA 1UWKA 2P6PA 3FHJA 2RB5A 1W7AA 1NUAA 1V2GA 3LLMA 3OX1A 5KDLA 3TDMA 1JSLA 3BICA 5KNCH 4BNMA 1CBUA 2L42A 3LP6A 4BNFA 2EEZA 1NMEA 1ESCA 2BGNA 2C8LA 2SICE 3A0RB 4H7PA 1SHLA 1Q50A 1Y1TA 3GZ4A 3BH7A 5JOQA 4RPJA 1SC3A 3PQ4A 4CUJA 1FW8A 4RTPA 3EQ6A 2XYPA 3EN0A 1GKLA 2X23A 4NABA 2H6EA 2HA3A 4TM8A 1E99A 3CKLA 2B7BA 3ZDQA 5M29A 1Y4SA 3GD7A 4MW6A 3WBKA 1FP2A 4LQLA 3MA0A 2W4QA 1GPMA 3OJWA 4M0DA 4ZWNA 5B58C 1G2QA 1TGYA 4A2WA 1M2FA 2WZQA 3TE7A 3TMKA 2ZJ4A 4ILKA 1UFQA 4RTMA 1DIRA 2F64A 4U6NA 1Z4MA 1QH8A 3CZ4A 3EISA 4JUDX 4N12A 2MSEB 4TS9A 1JA1A 2A7XA 4AXXA 3GCDA 3PF9A 4GG1A 3HMQA 2QTNA 4I5GA 1BKDR 1CRQA 1J0AA 4L8YA 3PDJA 1GL7A 2L2QA 3EG9A 4YECA 3PGJA 1NR5A 3CUWA 4RZ3A 5AOCA 4M9CA 2ZDHA 4FGSA 4IRMA 2FUKA 5K0ZA 2ZUEA 4L4YA 2G80A 4P4SA 2XMRA 1YJQA 1II8A 4Y1EA 1YASA 4J1QA 1UJ2A 3W5SA 3LQ2A 1OYWA 4HDKA 1YRAA 4WXEA 4BO3A 4LGMA 1IY9A 1V9SA 1EX7A 2ZUBA 3DOUA 3JQFA 5JH7B 3HBFA 1WCWA 1JAIA 2HA5A 3U2QA 4GR9A 2HPAA 3T3EA 3BBPA 4AO8A 3LW8A 2A92A 2I2XB 4FXPA 1XRMA 3FGOA 1SWVA 4Y6SA 1AQJA 3NBKA 2D6FA 4NZYA 5KNCD 5T67A 2FKNA 4C4ZA 5AW7A 2GNAA 1E79A 1SZPA 2JFYA 4GXRA 3UWOA 1N0UA 2REQA 4OLJA 3UH0A 1AGXA 4ZVMA 2ZI6A 1Q84A 5C4MA 1KZHA 1HGXA 5KQSA 3PNYA 3DR3A 4PSDA 4J1TC 1WB5A 3RVNA 2XSZA 3GW8A 4MQ6A 4FDMA 2BFFA 3Q0IA 3TUJC 3ZWQA 5DK4A 4PLVA 1ZCJA 2JLBA 2GNOA 1GAQA 1J8QA 1CKOA 4RF4A 1YZUA 4A9AA 4TKVA 1KNXA 1A76A 2I7XA 2XGGA 3FPKA 3OT1A 1YZNA 3R5XA 3DOEA 4PAQA 2O07A 4G0NA 1UL1X 1A4IA 4L78A 3HB1A 4MCIA 2H18A 3R4CA 1RWVA 2HOQA 1S0UA 1GADO 3KVRA 1LPAB 2ZZMA 2BF7A 1D1SA 4ML3A 4Y2QA 3H16A 3PKZA 3QA9A 5JYEA 1UBRS 1RQNA 2QNBA 4FQ5A 4IUDS 4B48A 5B4VA 3IT0A 4JJEA 1NJSA 4CT5A 4DKXA 1KK1A 3AUFA 4QGSA 3ESZA 1ZBQA 4YLEA 4EYEA 3WB9A 3U62A 2JAQA 3OCWA 5FFNA 1ZRNA 2B4AA 4LRQA 1EPUA 2QMYA 1PYDA 1T9AA 4F97A 2JAOA 3N2LA 1DS6A 2IOHA 4ZMSA 5JZOA 4X6UA 4R2KA 3O8RA 2XNSA 1PR3A 1WXFA 3GB9A 3NTOA 1M1YA 4HNGA 5IBPA 3DBRB 5EP3A 1RYFA 4X93A 1GPUA 1I1NA 3UQ8A 2F3TA 5FOVA 5AW9A 3SQDA 3R3UA 2IUYA 5CURA 3D8UA 3DDWA 1EFDN 3ET4A 3WFZA 4JUAA 4AY6A 1L8LA 4BO8A 2QQ5A 1KR5A 4Q3DA 4CDNA 2IW3A 3L7OA 2FPXA 4FFBB 2R11A 4CEHA 3VOTA 1XK6A 2Y9MB 3UUEA 1JEAA 3E7FA 4YR9A 1L4GA 3VPFA 3EHEA 1KEPA 1GFIA 4B87A 1IB0A 3GUZA 5C5IA 4M21A 3TRIA 4QNMA 3TVDA 4Z0PA 3PSAA 1SZJG 2HFJA 2X2EA 5C37A 3ACBA 2QJRA 3K4PA 3VPAA 2F8TA 4YMTA 3BAAA 1G41A 2IXGA 2P1RA 1IATA 1BX0A 4W8HA 3DF9A 4KPGA 3I6MA 5TQ2B 5BWNA 2QR3A 3AJ9A 1U80A 2P11A 4HEA1 3MJDA 3UMBA 4YAFA 2DRIA 1N8SA 5J2UF 2GM5A 4MVJI 2OZVA 4NFYA 1Y1RA 2PMEA 4ESEA 4YXFA 1BO6A 1DJMA 1XFDA 3QYPA 4QXAA 4XIYA 5HK8A 2ZUWA 5E2IA 1GLGA 2PUFA 1F8XA 3F8SA 1U4OA 4D82A 5DXJA 5KOJB 1WOYA 3CONA 5JJLA 1X92A 2RAFA 2RHCA 2ZYTX 5I7UA 4ZRDA 1YRHA 3NEAA 4F5WA 4F4JA 3LPCA 2I2CA 4YQEA 5K8UA 5L8VA 4ZZ2A 4JJZA 1W6RA 1XELA 2QDXA 3TZHA 4PPGA 4CI0B 2DUUA 4TSFD 1IRXA 2IIVA 5HM6A 3SHTA 2O2ZA 4XWTA 3SKXA 5ERYA 3V4FA 3AF6A 2G9QA 1IEVA 1YULA 3KJXA 1UP6A 4L5BA 2F3QA 4F1KA 5HUJA 1D9XA 1AE1A 2PR2A 2W6OA 4N5DA 4R68A 3OMXA 3BH0A 5IP5A 3WOVA 2XXAA 4EBBA 2BMVA 1QFXA 1PJ8A 3RT9A 2PSHA 4Y0NA 5B3KA 1GTMA 3G49A 4EW1A 3IR6A 1SUEA 4MUAA 3RSOA 2VDLB 3C24A 1PSZA 4NH4A 4HP8A 3EXEA 2EC5A 1YOVA 2FDXA 1COWD 1PS8A 4PYQA 3CURA 3CX8A 3V8VA 3BQ9A 4FS8A 1JXOA 3JQ9A 3W1VA 4NZZA 2FPPB 3ZVRA 3AVQA 5KYXA 1A4UA 2ZRIA 4HYEA 1GCOA 4GYWA 2OK7A 4C43A 2YN4A 3FOCA 2IX3A 4Q1FA 5ITZA 4KKXB 4TN5A 4LDRA 3ASVA 2WMOB 4YCJA 3G2QA 4YUAA 3ESBA 3GN2A 4DPLA 3GLFA 4ZDKA 2ZR9A 1LI4A 4D97A 1RFLA 2ZAIA 3OZFA 2J6IA 1WUJS 3QYJA 5A3VA 3TB4A 4KR6A 1CE8B 3DAAA 2AG1A 4U5XA 3K9GA 3PS9A 4L4XA 1UK9A 3PEUA 3NC1C 4L7QA 4BLVA 3QUTA 4KTTE 3W5CA 2FWAA 2GKOA 4BLRA 1GPH1 2H1RA 3IAHA 3AWDA 1Y9JA 4IWNA 3O84A 4XJTA 3WLQA 5LQJA 1NGSA 3JQ7A 2YWHA 3AL0C 4BIIA 3AT1A 3B6KA 4YRLA 4Q7QA 1VSUA 3NG1A 3O83A 1RJGA 5K8LA 3D1LA 3HB9A 2K87A 5LUBA 4RCNA 4Y2JA 1NZDA 5CT6A 2JKVA 3EVAA 3B1ZA 4LHSA 4P22A 4TMTA 2A5JA 1RP1A 2B4RO 3RROA 1ONNA 1X13A 5K0GA 4O2AF 2JFPA 4V2UA 4EFBA 3N58A 1ZA1A 2JZOA 5LMZA 1E7WA 3EY4A 3DBHA 5K3FA 2ETXA 4NNPA 5B57C 2RC6A 3DBLA 1A1SA 1L3CA 2P79A 1A3CA 3WZ2A 2AL7A 1YF3A 2FI1A 4V39A 3GAFA 4RA9A 3KVOA 3EIWA 4RX1A 4WKPA 3VYTB 3MBKA 4LVCA 3X43A 1ZYUA 1Y7PA 2E4WA 3L9WA 1ZOLA 1Z82A 4CKBA 2C59A 2OV3A 1ECGA 1R18A 1RKUA 4E2YA 5AI8A 3DPSA 3QE3A 1ZMBA 3L7JA 1UJNA 4AF6A 1S4QA 1VPWA 1IIRA 4CIAA 3L8GA 1WCV1 2EG5A 2I3GA 1GNSA 1C8LA 1UZAA 1FZQA 1UIMA 2G1JA 3A3OA 3M83A 4HZIA 4X20A 5EMLA 4WASA 4LZNA 5H83A 1UXKA 3L92A 1Z6GA 1KHHA 5DYWA 2ZYUX 4JYCA 1I2BA 3H8WA 1T5IA 1UMCB 3H5AA 5CLIA 5IZCA 3H9JA 1A8SA 2WWHA 2N42A 3HVUA 1FQOA 4DTIA 3NRCA 4AAYA 1CIJA 4ENPA 5EJ9A 2DCMA 1YS1X 3DNFA 4H18A 1I3NA 2XUAA 3ZEIA 4JI5B 3CH7A 2WIGA 3S0JA 4IO0A 4XQ0A 3DMRA 1L7EA 1SEVA 2PS9A 2YXEA 2MYPA 4LQCA 2JCVA 3BWMA 3TK1A 1IWPB 3PJRA 5I5YA 1DHTA 4NV3A 4X1OA 5FBLB 4MV4A 1YB5A 4QGAA 4EUFA 2GD2A 1PLJA 2WM8A 5KI6A 1ST3A 1U0EA 3VH1A 4IIBA 3VHQA 5FF9A 1ZI9A 1PL7A 2I3BA 2VA8A 2JZNA 2ZU0C 3A05A 4Q1AA 1N0IA 2C2HA 5AKXA 2DSNA 1M0WA 3GMIA 4NYJQ 1EWKA 2OM2A 3HL4A 3QKRA 3UPTA 2O8BA 4ER5A 3RFCA 1FL9A 3ITDA 5BW5A 4HRVA 4R41A 4QU5A 3RYCA 5BSMA 1QIJA 3M49A 4LNUA 2FN4A 4PC3A 3AK4A 1N2EA 2HF7A 4D8XA 2ASEA 1X0XA 3BFVA 3BFXA 5C0OE 3HKBB 4LRTB 4JI3B 4PZZA 2GJSA 3I1FA 1U2GC 2FPIA 2DY0A 3U44A 3SZMA 3U16A 5EINA 3WLRA 1SCDA 1N1GA 3AR3A 3K09A 5CVUA 2P40A 1L5GB 1NG1A 3FG9A 6YASA 3QVGB 4CV3A 4DVGA 2J5QA 2BOVA 1KZYC 1N6RA 1BDHA 3MWDA 2V5AA 2V6BA 2G72A 3OZGA 4QPDA 3G8DA 5IDYA 3WZMA 2AOTB 1VPTA 2OGZA 3PN1A 1R5BA 3F3KA 4H1UA 1I7PA 2OPHA 4LKOA 3GFQA 1KA9H 5I7VA 2HWUA 1A3GA 3EFOB 2H8GA 3OP4A 1TM1E 1IY0A 3KYJB 4GU5A 5FV4A 1MIHA 2NAFA 2SKDA 5BVHB 3HN7A 2IXEA 1CUUA 5F9MA 1O97D 1P5FA 1YL6A 4J2OA 5ESWA 4TLEA 2XCTB 4C0QC 2H07A 4QDZA 3DZ8A 4O2BF 1ZNXA 1XDDA 4YRFA 3BCHA 2C07A 4WBSA 1F8UA 1PTJA 4PO1A 3RSQA 2ZWIA 1S4MA 3E03A 1Y4ZA 5HE8A 5CT9A 1WMDA 5KVCA 1M67A 2FG5A 5FFMA 5FUBA 3ZDBA 3UXYA 1XQ1A 1BSVA 1W4AA 3KJEA 1T6ZA 3EF1A 3RARA 3ZE9A 1N3IA 3VC7A 1CQWA 4HLDA 3SIPA 3IVRA 4F93B 1AKYA 3LDUA 2YHUA 1YE3A 3LC2O 2QE6A 3NAMA 4I4CA 2W7TA 5TNXA 5LNK1 4AKGA 3BIFA 3IJ5A 2C54A 3UXEA 3WIUA 3LT2A 5BN3A 4OYRA 4M83A 4MLPA 3MCZA 1C9YA 2E1PA 1D2RA 2XT9A 3RJZA 5CAEA 2I9KA 1YQDA 2I71A 2AEFA 3PCXA 1ODTC 4O4HA 1L5FA 4UHEA 5LVAA 3KLNA 3C8UA 2F1HA 3UFXA 3URMA 3WMEA 4KPYA 3RAGA 3GQVA 4EQ6B 3CVYA 1U99A 1QGED 5COQA 2F1OA 1EFVB 4TTRA 3DTVA 4NOKA 2X13A 2EGHA 3PCTA 3VHXA 3VAAA 3VTZA 3WP1B 3QPWA 3SD7A 4MUXA 2ZRLA 3H2SA 4MLDA 3R7FA 2LD4A 3OX4A 4UBNA 5JQGF 1KDVA 1J2RA 1TYZA 1U6IA 1MH1A 1I30A 1XZPA 2IZ1A 2JI4A 4G5QA 2DERA 3MMZA 1USGA 3T5CA 4LX8A 4MWBA 3ZZ1A 3EXHB 1CFJA 4ZIRB 3GCWA 2QYOA 1MG5A 1R4MA 1YJ8A 1KL7A 1VYUA 1OILA 4A4DA 3BE8A 3S24A 2B21A 2M6RA 1XEXA 2Z8YA 3EPPA 2WU4A 3SXUB 3IEVA 1KP9A 1IN7A 3X44A 4QELA 1UZMA 4IMPA 1CV2A 3KFXA 1KO1A 2C99A 4BIMA 1GZ3A 3W5JA 1VZ3A 4EJSC 1Z73A 4BMSA 4DLZA 3A1FA 3IURA 1W76A 1UR5A 1BROA 2IHJA 2IFTA 1TB4A 3DMTC 1MEEA 4UASA 4Y8VA 5BYJA 3TXXA 2QRNA 1KYYA 1RIIA 1GFWA 2VRNA 3GPIA 1NUHA 2JD2A 3IR7A 2F55A 3U7QB 2YXNA 4ZXPA 2BI7A 1YKGA 2Q4TA 1P8AA 1XJ0A 3HU5A 3ZZ0A 4G3XA 4MW7A 1XJCA 4JENA 3B1FA 3I9V6 3TRHA 1UMDA 2XE7A 3IMGA 2D5IA 5LA6F 1QVRA 2H11A 4RZ2A 5T6MA 4E6PA 4F6RB 1I3KA 1V3UA 3NUZA 3FVTA 3T7KA 4BMCA 2ES4A 2YCLA 3BPSA 4FJ1A 1UK8A 3G5LA 1V5IA 2D7JA 3CSWA 1EINA 3D1JA 3N2IA 1T0PA 3HS3A 3ILVA 2WA2A 3EXFA 1PVDA 2HJ9A 4PLFA 3SM9A 1ZM9A 4UTPA 3AETB 3AHJA 4MV0A 4NFLA 4WCVA 1JLRA 4IIXA 2HBYA 2WE8A 3RU2A 5LDGA 2O57A 4YAGA 2C8JA 2C42A 2RHJA 4CG2A 1KI7A 3EQ7A 5AVKA 1RCTE 2AF4C 2CXQA 1XEWY 1TIBA 4KRYA 3TEMA 4WCFB 5D5QA 2ZLBA 1XE3A 2WBLC 1OMOA 1W34A 4JKYA 5HNEA 2GCEA 4DOMA 2HNBA 5A7GA 4MHSA 3X1MA 1NXQA 3OCYA 2WIJA 4NCNA 3F9RA 2B1QA 4LYYA 2A1TS 2YZKA 3V1LA 2V0NA 3BHNA 3HKDB 4WLOA 3SK0A 3CHYA 3OIWA 1GTVA 3UT5B 4OKSA 3KZCA 5FL3A 3K9NA 1EWQA 1ZGJA 3AHGA 3G2MA 2VHCA 1GUBA 2FR8C 4OHPA 2ZRMA 3R7NA 3HJFA 3N2ZB 4P7BA 2D2FA 2EP7A 1STOA 3LPAA 4YGXB 5J5CA 3H6GA 3CF2A 3RBAA 4O83A 4AC9A 4F3TA 1JPJA 1CQIA 2O2GA 5DNUA 5FWYB 1VMDA 4YY3B 1KVQA 1ENZA 1VE6A 3IELA 2VTVA 4L73A 5LB2A 4RETA 2QL7A 3VU9A 4CLDA 4EPXA 2XTAA 1QHHA 2P2CA 4DSNA 2CFOA 4WZAA 3WADA 2VP6A 2XKKA 2V3VA 1Z63A 2R65A 4FXOA 3G7SA 1OFHA 1IPFA 2RGNC 3CLKA 2M6KA 3E5NA 3WWPA 1LVHA 5HKKD 3JW8A 4EBFA 2YJGA 1E2HA 2ZIGA 5AK3A 3QYAA 5G53C 4B2LA 3UV7A 2D59A 4MGEA 5JATA 4GXQA 1DRVA 3OKFA 2B3DA 4EFKA 3QVSA 2X8BA 3NETA 2AQHA 1M6VB 4QEDA 4WLVA 2IKQA 4JVSB 4X1YA 3V8QA 1DG3A 1AJEA 2JLQA 2DWPA 5B55A 3EVCA 1W59A 3L0DA 4Q05A 1Z16A 3QXCA 3IMEA 3NWEA 4J6EA 1NJ8A 3ZC3A 5COBA 4UQLA 1SR8A 3WBJA 1E3WB 2A4MA 2PH1A 4QYTA 3NV7A 4WJKB 4Q9IA 1RZRD 2FQQA 4CR6A 2EIYA 1E5TA 3EASA 3ZOZA 4MTLA 3C1TA 2PDAA 3OQHA 1EJ6A 1XCLA 2FLWA 4V0NA 4W7SA 1C8BA 3T5BA 1MGPA 3KYHC 4AMZA 2XH8A 2Z2JA 3RRYA 3G13A 4FFNA 1WUHS 1C1YA 3LV8A 2ORYA 2PX4A 2HF9A 1SXJE 1VFPA 2PPLA 1KYZA 4G6ZA 4WI1A 3MK31 4AJIA 3E7PA 1JF8A 4FSXA 4CV1A 4PNZA 3FWYA 4YDHB 3O94A 4F71A 3GJ0A 5IC4A 1ZVMA 4MRMA 4RFLA 1L7DA 4U2BA 4FMCF 3FF4A 1VPLA 2CWWA 1P1FA 3PENA 5JWHA 2RK3A 1ZJYA 3Q8XB 3R5HA 3WWIA 1VS0A 3ILYA 4GBGA 3URKA 2HC9A 2ACVA 4GLJA 1A27A 4DV7B 2D2EA 3SP1A 4AKEA 2V7UA 1LBQA 1SG0A 1QG6A 3WGLA 2AI3A 2Q1WA 2J8ZA 3JYOA 1Z7EA 1EUDA 1FUEA 1I33A 5AKIA 3HWX1 1YQXA 2X0RA 1QCCA 3G1UA 1K6EA 2J9GA 1F1JA 2C7VA 5ELMA 2NU8A 1E1RD 1GNRA 1XPJA 3GFRA 3IAS1 5ES3A 1TZBA 1U8CB 1XZBA 2GASA 1HYQA 2ZSDA 2OD7A 4OXKA 5ALPA 4LE1A 4DABA 4JT4A 1I24A 2P27A 4E0BA 5D5HA 4E5PA 3LLCA 4P1ZA 3GBPA 5FWNA 1OLXB 4QJ5A 4YB8A 5TRTA 3BX1A 1HDXA 2V3CC 1ZUD1 1M66A 2X5XA 3FBTA 2CCGA 2QX8A 3G1WA 3FRHA 3C5EA 4OXRA 3BIXA 5J2UA 1KVSA 1RJDA 2CFCA 2P78A 2PZKA 5I9SA 4GOXA 5B7QA 5ALVA 1Y6FA 5U4XA 4HWKA 3I8OA 5D7BA 1N2IA 3LO5A 2UVQA 3MTGA 1RYZA 3CMCO 4OL9A 3TAXA 4LVOA 3VZRA 3DLAA 3D0RA 1YZVA 2OYRA 2QM0A 2J3QA 4LJ4A 3BD6A 4XH9B 2NUTA 4TGLA 1Z6QA 2VFAA 3O3NB 5DN9A 4EHLA 3HACA 5B7NA 2R79A 4L6CA 4JB3A 3P0EA 4V0KA 4Z1OA 2RG7A 1VBHA 3AEUA 4OK6A 5BUQA 4DR3B 1RVDA 2R5WA 3GMDA 4EGQA 1C1DA 5AVRA 5EJ7A 4ODIA 2VHVA 7ADHA 3ZE8A 4LCBA 1NG9A 3ZDFA 4BMXA 5IAOA 2C4NA 3PHJA 5AT1A 1W36C 2I2BA 3DKRA 3E8MA 5KNBH 3GLGB 1CS4C 2P3SA 4DF3A 4K8RB 4LHXA 4BO6A 4LZPA 2W70A 2VK2A 5CB6A 1RAAA 2O2YA 1Z5WA 4FYMA 3NOXA 4M6WA 1NT4A 5CYFA 5JBIA 3LVFO 1J25A 1P3Y1 4YHHB 3QTBA 2JJQA 5EJMA 3ONVA 3A6ZA 4LYHA 5EMHA 2VF2A 4KAXA 2JHFA 3KU4A 1H2BA 2IXTA 3G1TA 3K9QO 2HY7A 4MWSA 4NESA 5CUQA 1SOWA 2AHOA 3VMMA 1BQ3A 5ER9A 1O1YA 1A8HA 1N1MA 3MD9A 4GRIA 3WMGA 2VJMB 2CWDA 2A0WA 1N9GA 2JIZD 4WWHA 4IJMA 3VJRA 4AZ3B 2PKXA 1KMCA 3IE1A 2NVUA 3ASZA 3E22A 3RREA 5JZSA 1X9HA 5H80A 1NQVA 2YOGA 2HYIC 4B5LA 2KLBA 2FRDA 3ZGOA 1HH4A 5JANA 5KJFA 3U4QA 4J0FA 4CKWB 2ZWVA 5FA8A 5INTA 2TMKA 3KAKA 1ZBDA 3DA8A 3ECAA 3EEBA 3L4EA 2ZU6A 3K0KA 1YR3A 2JLYA 5F3RA 1PDVA 2C88A 2HNAA 1G21B 2GOYA 1U3WA 4YDSA 2PU7A 4TS1A 1DUIA 1OLUA 3FY4A 4TMYA 1EJBA 4TRRA 4XTCS 1SOVA 3TZLA 4HH1A 4IS2A 4ECEA 4MHOA 5HF8A 4MV1A 4Q00A 1I8TA 4LC1A 4QU0A 5KQLA 4CIWA 4KVAA 3KJNA 3IX7A 1AKRA 3ZOKA 3VPXA 4TWBA 2ZCVA 3T8YA 2X0KA 3TW7A 1N2SA 1U3VA 2B9EA 3DE3X 4M1EA 4UREA 5FB3A 3T7AA 1B6TA 3DH0A 4IDNA 4RMJA 5JADA 4O2AA 3M6VA 5CK5A 2JH3A 3JALA 1LS1A 4RO0A 2ORIA 3GVIA 4LZOA 4WTOA 4X3PA 1L1FA 2ZIEA 1GQYA 1V95A 3IAXA 4ZC8A 3IAAA 3DTFA 1FMLA 1NWHA 1Z0SA 4DDMA 1VHQA 3BJMA 4ZA2A 5H59A 4S3MA 3EEQA 1AB5A 2D4HA 3OQIA 4BCDA 3JSNA 1OW3B 1YTUA 3U3DA 2X86A 4LXQA 4EHBA 1XLVA 5AVXA 2G36A 3ND5A 1UFRA 2ONJA 2ZTVA 1FW6A 1K8YB 1FYDA 1H6CA 2UZ3A 3GJ4A 5HF5A 4JYZA 1OH8A 4FJ0A 4PPQA 4Q3AA 4EUSA 1O8BA 2EHJA 3A9CA 1CS0A 1LTHR 1QP8A 4YV1A 3LQ4A 4MCHA 2GNPA 1J0DA 3DVQX 1GPDG 5CT4A 5HCNA 1URPA 2YQ4A 2QL6A 4ARIA 3F78A 2DHDA 1ZJ6A 4O4IB 3GLKA 2Q4DA 4ZCRA 4EDFA 4AZSA 4CM3A 8OHMA 4KO3S 3I9FA 2Q5HA 3MGAA 1RXUA 4M0KA 3BKXA 1QIDA 3U4HA 4PQGA 3UAWA 2FW6A 5GONB 1YJAA 1F5NA 1Z29A 3FSRA 4W99A 4I4LA 1X8JA 1HQYE 2BBOA 3ND8A 4RIFA 5T4EA 3TR0A 3ZQ4A 2UXCB 5LKRA 1XZHA 4BO1A 1WQ4A 2JD1A 2ZJOA 2FEWB 3SC2A 2TSYB 5TF0A 4MWZA 3U4DA 4AN0A 3H5RA 3T1OA 1XRQA 4NK5A 5ALQA 1MQSA 3NONA 1EDBA 2R1VA 4E1AA 4KFTA 1E6KA 1IB6A 2DG2A 4L28A 5F9HA 2CXSA 1LD3A 2PIAA 1M1NA 5I9TA 5F4BA 1EH5A 5LQUA 1QIMA 1BS1A 1CF4A 4NATA 1EZZA 3HXPA 5E7MA 3LH5A 5JCOA 1QZXA 2X1HA 4ZEXA 4IDAA 2Q5EA 1DKMA 5J4KA 1ULTA 1CY0A 1QB8A 2I55A 3FF1A 1G5IA 1JSCA 1ZM2A 2HHCA 4RF3A 1M7BA 5GM1A 5FEUA 4JJFA 1IN5A 1NV9A 4UD2A 2A86A 3SF8A 5K7SA 4D26A 3T9EA 5J4LA 1HURA 2ERCA 3K96A 5FNVB 3WR5A 1R6XA 4C0JA 4C4OA 5IBQA 4AKSA 4B46A 4E7OA 1EK2A 3KKPA 3QFHA 1CJMA 1CJTC 2XKAA 4R2LA 3FCAA 2DBQA 4IR7A 2CUKA 3B9BA 4JJ8A 2ALJA 1JR3D 2XEXA 3K6JA 1A5BB 3IA7A 4UHCA 2GM3A 2XCSB 4DCJA 3VDMA 3CCBA 2FWNA 4M7PA 2DEUA 1AQIA 1SVKA 1G5FA 4TSFA 3TH5A 4HVTA 3W3ZB 3BB1A 4X71A 3WZLA 3FUWA 3T7DA 1J2TA 3CW9A 3N59A 4II3A 1ZSYA 1O6FA 2AHRA 1OI2A 3OHMA 4Q7LA 1YMUA 1YL7A 2NV2B 4ZI5A 4AY5A 4MH0R 3M4XA 3C3BA 3I3OA 2GDJA 4GSKA 4O2BA 3FWPA 1JHRA 2RJNA 2NN3C 2ZSEA 2J07A 2Q49A 4D3DA 6NULA 3O73A 2DTEA 1AGRA 5DRTA 1ZNZA 4E7PA 3RYTC 4RPCA 4U7PB 1S6YA 2BI8A 2QTVB 2FV8A 3T4XA 4DAOA 1COWA 3CBQA 2BEVA 4Q1VA 3UEOA 4Q1BA 4ZCQA 3ORYA 3M9WA 3P8ZA 2DKFA 3KYIB 4RJ2A 2X7HA 1YCGA 5CDTA 2CLHB 3FMVA 5JDCC 3E9YA 2ZM6B 2IEYA 3GLHE 5AJYA 4B8WA 4B3MB 2WM2A 4YMGA 4EJFA 4RTLA 3AESA 4Z99A 3UW1A 2H5EA 5JUWA 5CK4A 1OIXA 1HY3A 2OYCA 2DJIA 3P1JA 1ZXLA 3RBXA 4O1MA 3RYHA 4W82A 1CRPA 2A35A 4WECA 1A97A 3B3GA 1ZN2A 1DO8A 4U9HS 3PGMA 3CKYA 4DYDA 3CWQA 3H5NA 3RC8A 4YV2A 4B7AA 3KTDA 1AGYA 2JANA 3MW8A 1QHYA 3L05A 4HQ6A 3OCXA 5HEKA 5AW6A 1DQNA 3H75A 1K4MA 3VI4B 3OIVA 3ZR4B 2XCQA 1PR9A 3M1YA 1VLMA 5FPQA 1Z18A 3PA6A 3COYA 2WAXA 4YPFA 4QLOA 3BTSA 4RMIA 3EVGA 5AKZA 2HBZA 3NOQA 3DMGA 1SA0B 2OV1A 1VI2A 2H7YA 1CUWA 5CVJA 2GD6A 1EZ4A 4W63A 1U5AA 3KFVA 1A1VA 5FNZA 1PR0A 1QZZA 4UNPA 3K1AA 4KE7A 4DQVA 3HXOA 1Q0QA 4DXAA 1YR2A 3CUVA 3H1PA 1PFKA 1H4SA 3MTQA 3FSGD 4YMIA 2I4MA 1EI9A 1M1UA 5C7IO 4G9BA 3Q7QA 3RS3A 5IWAB 1RPTA 3FDFA 5LBUA 2YWEA 2QSYA 3C3YA 1B00A 3IIEA 1QK5A 3PQEA 1DWOA 1WP9A 2Y1DA 2J45A 3LS2A 3UMFA 4U7WA 2FJ0A 2HDOA 3PK0A 4XPIA 1ODJA 3E7WA 4MUFA 4A6XA 4E2FA 3KOYA 4DIFA 4ED9A 1I6LA 3CXRA 1Q16A 4LIPD 1JB9A 1G66A 5FFFA 3L8MA 5JXGA 4TKLA 1QZTA 3GGPA 2WKRA 1DBPA 1RWQA 2XMCA 2RGAA 3A1TA 1UJCA 3JARA 3QEJA 3VH3A 3DC7A 4DLKA 3BE5A 2R751 4C0AC 4WNCA 3T5TA 3QLEA 3EEOA 2OVBA 3ECCA 4JGGA 5EQFA 2Z8ZA 4QBHA 2B3TA 4BASA 1CP3A 3ISJA 4AFNA 4FDTA 1NMQA 2AMFA 4J1NA 3OSZA 3QLVC 2YC4C 3SJCA 1EA5A 2WJHA 5F77A 3N8IA 2Y0BA 5F7JA 4KK3A 3C43A 4JC4A 3S1AB 4V3CA 1DWQA 1NHGA 3X2SA 3C5WP 4OHKA 3VGJA 2PRYA 5F3DA 1MEJA 4BQQA 4JC5A 5B1IA 4CGYA 3V6LA 1RDFA 2W8BA 3WGJA 3EF3A 1WUYA 4E3WA 2JCGA 3RS9A 4FNAA 3V4VB 3OLQA 5D3MB 5EESA 4U2CA 3U4IA 4FILA 3TNYA 1WUKS 3IP5A 1WZEA 3ZHXA 1Q21A 1B43A 1SC1A 3BWBA 2OC4A 4HCJA 4KG7A 2LR0A 5CLLA 3WGIA 1VRWA 3DFUA 3SGLA 1E6EA 3HYNA 3L5KA 1EAMA 1JHVA 1KYWA 2TYSB 3IAM6 5ALGA 1W29A 5L6LB 3KWFA 3SLRA 4BCBA 2NG1A 1EWYA 3T6KA 2COJA 4LDZA 1LNQA 2R8PA 2WFLA 5B1EA 3OE4A 1NM5A 1U7TA 2V6MA 1LBSA 2PG3A 2HADA 2QAGA 2QQGA 3ES9A 4Q4HB 5HE9A 1ECPA 4EMTA 1UBKS 3S99A 1XTZA 3C74A 2RJ3A 4LC0A 1TCBA 4CL3A 4YBRA 3TQTA 4MEJA 3LHSA 2FE4A 3S2FA 1K97A 3U26A 3BQNB 2D62A 3MINB 2HMYB 2QVBA 3Q1LA 3ZZUA 2UUOA 3BK1A 2YDYA 3HVHA 4OMDA 5DBHX 5BSTA 4IOJA 3R9IA 5TVKA 3IBFA 1Q0TA 3H11A 2WKQA 4ND3A 1FTNA 2BM8A 2H52A 3KS9A 2KI5A 1NYRA 3MTEA 3RFVA 2XGSA 4H35A 3GOQA 4CF6A 3TW6A 2PN1A 1PJBA 1UXIA 2IOFA 3L6BA 3WRXA 3DL2A 5LD2C 1MO6A 4YC7A 4AJ1A 3VPCA 4YBZB 1CLUA 1W4CA 2WSSD 2ZYGA 5DH9A 3WDLA 5BORA 4HEA6 1AY0A 2BZ1A 1OFGA 1ZD1A 2QHXA 3KXIA 2WINI 2KBEA 1EHIA 1RYBA 1I3CA 2QEQA 3IDZA 4N0PA 2HCFA 2XKJE 3IGFA 4F9EA 2QUZA 1WB9A 4ZO8A 1Z2PX 4LH7A 1N2GA 1CYDA 1P6UA 3E9DA 4JKOA 4PYKA 2GBLA 2FKAA 2WFZA 1PS0A 1SUCA 1CT9A 1M2OA 1Z5PA 4FGRA 2OAEA 3CEJA 4OQLA 4UU0A 4YRDA 5TLSA 1ZG3A 5DWDA 4IIHA 4BFCA 4F38A 1HDGO 2ID4A 2P8SA 4FGKA 4ALKA 1WZ2A 2MMCA 1YQQA 2SNIE 2VCEA 1FXSA 3LUHA 1ZN7A 1G9TA 2V7GA 1XMIA 3GRKA 3GG2A 3CINA 3G79A 1JU9A 2E5WA 4ZAXA 5HPYB 3MJVA 4TM5A 1GM5A 1R3UA 1P3JA 2ACEA 2PX8A 4JHLA 4CVNA 3CJQA 1S8NA 1DU4A 3VV3A 3GHYA 2J3MA 2P69A 1JG6A 4CZ2A 5FUQA 3VR1A 1E5VA 1P72A 4U39A 5FEMA 1F38A 5DW0A 7REQB 1T2DA 1EM8B 4OMUA 3WB1A 1HYGA 4OYLA 4BQSA 3W5OA 5AWFC 2OCGA 2VYND 1JEJA 5DLQC 4BLUA 1QOPB 2PL1A 2YBDA 5BW8A 2CHUA 4OA5A 1VJRA 3VPDA 1NUSA 5CIWA 2PCJA 4FZVA 1XA4A 1S89A 5I5XA 3FSJX 1I1KA 2BFMA 2OUIA 3QKWA 1RHRA 2Y2UA 1K98A 1W5SA 4M1MA 4RA6A 3LG2A 6LDHA 5JAOA 4DV2B 3DF7A 5BWRA 3E9RA 4MYUA 1TCUA 1YB4A 1RI3A 4XRRA 2E9SA 1U02A 5HJEA 3TUIC 5CJ2A 1E9SA 4UULA 5IPFA 3WGUA 2ANBA 5HBRA 3LUFA 3N1UA 4XEUA 2XOXA 2O1SA 4H3VA 5C4GB 3TZEA 4BQEA 3FWNA 3K32A 4KXXA 3GDEA 4HTFB 2WTBA 2ZRCA 3JRXA 3GP3A 2OAGA 5KNLA 5G40A 1AM4D 4WUVA 5KYYB 1SPXA 4RKYA 2CV1A 2YJZA 3AZOA 2INGX 2OAQ1 2VT2A 3EC7A 4MGKR 2MOKA 4DA8A 5AKHA 3SMVA 2X8JA 1ZI6A 1QU2A 3OUTA 2XTJA 4EF5A 2WVAA 1ISSA 1VIYA 2XMQA 1Y3HA 2PT7A 2IP2A 3UA3A 3UK1A 2QLTA 4Z0HO 2E6UX 5D00A