2Z0PA

Crystal structure of ph domain of bruton's tyrosine kinase
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
167
structure length
158
Chain Sequence
AAVILESIFLKRSQQKKKTSPLNFKKRLFLLTVHKLSYYEYDFERGRRGSKKGSIDVEKITCVETVVPEKNPPPERQIMEQISIIERFPYPFQVVYDEGPLYVFSPTEELRKRWIHQLKNVIRYNSDLVQKYHPCFWIDGQYLCCSQTAKNAMGCQIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the Bruton's tyrosine kinase PH domain with phosphatidylinositol
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Tyrosine-protein kinase BTK
total genus 34
structure length 158
sequence length 167
chains with identical sequence B, C, D
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2007-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
A PF00779 BTK BTK motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2z0pA00
2HTHB 2RUKB 4K2PA 1TJ6A 5D27A 3FEHA 3UZTA 1PMSA 1UNQA 3ML4A 4TKNA 1V88A 2G35A 1Z87A 1UNPA 2GCLA 2FJLA 1B55A 2Z0PA 1NU2A 2HE7A 2RSGA 2BCJA 4EMOA 4P7IA 1UNRA 3TVVA 2H7DA 3VIAA 1WVHA 1PFJA 2Y8GA 3TO1A 2H7EA 1WG7A 2J0MA 3DXDA 3DXCA 5LONB 1BWNA 1GC7A 1KI1B 4K2OA 1WGUA 1LW3A 2D9VA 4F7GA 1XODA 3U7DA 3KZ1A 3SNHA 1P6SA 1WJMA 3WYFB 3A98B 3F0WA 1ZM0A 3SYXA 2DKQA 2DHIA 2D4QA 2CAYA 1ZSQA 2Q13A 2N23A 1DDVA 5C16A 1ZVRA 3GYPA 4BBKA 2GJYA 1U5FA 1FHWA 4NY0A 3KRXA 1W1DA 4WSFA 2DYQA 3NSUA 2YS1A 2NZ8B 4Z2NA 4CHMA 4A6HA 2I5FA 2K2UA 1GG3A 1Q67A 4HDQA 3SO6A 2D9ZA 4XWXA 1NTYA 4C0AA 5DIFB 2COAA 2COFA 3GYOA 2IYBA 2VRWB 4TYZA 2MFQA 3T06A 2EMTA 2EJ8A 2D2QA 1SHCA 3CXBB 4A6FA 3MPXA 2DX5A 4KHOA 4MT7A 3FM8C 1FB8A 2P0FA 3PVUA 3PSCA 2YF0A 2DTCA 5D3WA 2DHJA 3BINA 2P0DA 4WJ7A 2DFKA 4DXAB 2P8VA 3RCPA 1XD4A 2X18A 5L81A 1XR0B 1J19A 2D9YA 4YL8A 1V89A 1QQGA 5HE3A 2DKPA 2EMSA 3QWMA 2KGXB 5DI9B 4HB0B 2DN6A 3PVLA 2DYNA 5CLQB 1M7RA 2Z0OA 2UVMA 2QKLA 1KZ7A 1X1FA 2M38A 1UPRA 4MY6A 3AJ4A 2D9WA 3KRWA 1W1GA 5KCVA 1XX0A 1IRSA 1TQZA 4PQ0A 3D8DA 2L2IA 3PG7A 3P7ZA 2Z0QA 5KQ4A 1MAIA 1EF1A 1M7EA 1U29A 4EKUA 3PZDA 4HAWB 4Z2MB 3AU4A 2YVCA 2VSZA 5JHGA 1I7AA 1OMWA 1OY2A 3KSYA 2DA0A 3KY9A 1U5GA 1TXDA 2CRFA 1FOEA 1ISNA 4F7UP 2DLWA 4KAXB 1FHXA 3ODWA 3O96A 1OQNA 2ADZA 4GXBA 3X23A 5C5BA 3WA0A 3AU5A 4HAZB 2LULA 4L6EA 5J3YA 2UZSA 4HAVB 4HHVA 1LB1A 2NMBA 2XQNM 2RVBB 1X05A 3D8FA 4NSWA 2VKIA 4GN1A 2Y7BA 1K5DB 3HQCA 1UEFA 5C5BB 4GMVA 4K81A 2COCA 3LJUX 2J0KA 4IOYX 1WGQA 4HATB 3ZVRA 1N3HA 3ULCA 5LOPB 3TCAA 4Y94A 4B6HA 1AWEA 4YONA 3SUZA 4CHJA 3PVWA 2D11A 1U5EA 4HDOA 1Y5OA 4IAPA 4HAXB 3DXEA 4KHAA 2W2WA 3A8QA 5JP4A 3ODOA 5KQ1A 1GC6A 2PZ1A 4DBBA 1V61A 5HE1A 2D9XA 2EC1A 3QBVB 1U27A 1DYNA 4GPTB 2AL6A 1UPQA 1P3RA 2LKOA 2MDXA 3D8EA 1DROA 5J3TA 2R09A 2DHKA 1MK9B 2V76A 4ZRIA 3PP2A 2LG1A 2RGNB 2N0YA 4IFSA 1XCGA 3TFMA 1DDWA 3HK0A 3A8PA 5EFXA 1NTVA 1DBHA 5DH9B 1SGHA 2CODA 4HB2B 3FSSA 3PEGA 1U2BA 2KUPA 5HE2A 3N7CA 3HW2B 2LOXA 3U8ZA 3F5RA 1U5DA 3V5WA 4WVFB 3OANA 2R0DA 2YS3A 4MK0A 2P0HA 3ULBA 4A6KA 2I1JA 2K00A 1V5MA 4A6FB 1K5GB 1FGZA 5CLLB 2MKRA 1BTKA 3VOQA 2IFSA 1MIZB 5J3QA 4PNKA 1FAOA 4ZRJA 5D3XA 2E2XA 2I5CA 2Y8FA 2JP2A 1WJ1A 3M1IB 4HAUB 1Y19B 3P6AA 3MDBC 4GMXB 2CY4A 2ELAA 1ZC3B 1E5WA 1P5TA 4H8SA 5GOWB 1X86A 1X11A 2AEHA 2CY5A 1EVHA 1I2HA 4KVGB 2I1KA 5C79A 2W2XC 4F7HA 5HE0A 2DX1A 1X1GA 1EGXA 3QIJA 2ROZB 5DHFB 5FI1A 5JHHA 2ROVA 4CYEA 1J0WA 1H4RA 2OTXA 5FI0A 1H10A 2RLOA 1AQCA 2YRYA 4EJNA 1XKEA 1BTNA 2LYDA 2KCJA 5D3YA 3CIKA 3ODXA 1NI2A 2UZRA 1FHOA 1RRPB 4HB4B 3SV1A 2MWNB 2J0JA 5JLJB 2YT1A 1ZC4B 1MIXA 1WI1A 4A5KA 2ELBA 2LOZA 2OQBA 4HAYB 2RNRB 1EAZA 3TW1A 4HB3B 4DX8A 1V5PA 3G9WA 3IVFA 5D3VA 2M14A 1QC6A 4GZUA 2J59M 4DX90 4KHBB 5DHAB 2YT0A 3ZDTA 2D10A 4D0NB 2YSZA 1PLSA 4K17A 1W1HA 2K2JA 2YS5A 1FGYA 1RJ2A 2QKMA 1V5UA 5C6RA 2GCJA 1MKEA 3BJIA 1DDMA 1KZGA 1MK7B 1MPHA 2GS0A 2W2XD 4ZRKA 2L1CA 1BAKA 2ZPYA
chains in the Genus database with same CATH superfamily
2HTHB 5LG4B 2RUKB 4K2PA 1TJ6A 5D27A 3FEHA 3UZTA 1PMSA 1UNQA 3ML4A 4TKNA 1V88A 2G35A 1Z87A 1UNPA 2GCLA 2FJLA 1B55A 2Z0PA 1NU2A 2HE7A 2RSGA 2BCJA 4EMOA 4P7IA 1UNRA 3TVVA 2H7DA 3VIAA 1WVHA 1PFJA 2Y8GA 3TO1A 2H7EA 1WG7A 2J0MA 3DXDA 3DXCA 5LONB 1BWNA 1GC7A 1KI1B 4K2OA 1WGUA 2Z59A 4QXAB 1LW3A 2D9VA 4F7GA 1XODA 3U7DA 3KZ1A 3SNHA 1P6SA 1WJMA 3WYFB 3A98B 3F0WA 1ZM0A 3SYXA 2DKQA 2DHIA 2D4QA 2CAYA 1ZSQA 2Q13A 2N23A 1DDVA 5C16A 1ZVRA 3GYPA 4BBKA 2GJYA 3A58A 1U5FA 1FHWA 4NY0A 3KRXA 1W1DA 4WSFA 2DYQA 3NSUA 2YS1A 2NZ8B 4Z2NA 4CHMA 4A6HA 2I5FA 2K2UA 1GG3A 1Q67A 4HDQA 3SO6A 3NWFA 2D9ZA 4XWXA 1NTYA 4C0AA 5DIFB 2KR0A 2COAA 4OT1A 2COFA 3GYOA 2IYBA 2VRWB 3DCXA 5I2MA 4TYZA 2MFQA 2EMTA 3T06A 2EJ8A 2D2QA 1SHCA 3CXBB 4A6FA 3MPXA 2DX5A 4KHOA 4MT7A 3FM8C 1FB8A 2P0FA 3PVUA 3PSCA 2RRFA 2YF0A 4QJ3B 3HSAA 2DTCA 5D3WA 2DHJA 3BINA 2P0DA 4WJ7A 2DFKA 4DXAB 2P8VA 3RCPA 1XD4A 2X18A 5L81A 1XR0B 1J19A 2D9YA 4YL8A 1V89A 1QQGA 5HE3A 4DIXA 2DKPA 2EMSA 3QWMA 2KGXB 5DI9B 4HB0B 2DN6A 3PVLA 2DYNA 5CLQB 1M7RA 2Z0OA 2UVMA 2QKLA 1KZ7A 1X1FA 2M38A 1MI1A 1UPRA 4GOUA 4MY6A 3AJ4A 2D9WA 3KRWA 1W1GA 5KCVA 1XX0A 1IRSA 1TQZA 4PQ0A 3D8DA 2L2IA 4GNKB 3PG7A 3P7ZA 2Z0QA 5KQ4A 1MAIA 1EF1A 1M7EA 1U29A 4EKUA 3PZDA 4HAWB 4Z2MB 3AU4A 2YVCA 2VSZA 5JHGA 1I7AA 1OMWA 1OY2A 3KSYA 2DA0A 3KY9A 1U5GA 1TXDA 2CRFA 1FOEA 1ISNA 4F7UP 2DLWA 4KAXB 1FHXA 3ODWA 3O96A 1OQNA 2ADZA 4GXBA 3X23A 5C5BA 3WA0A 3AU5A 4HAZB 2LULA 4L6EA 5J3YA 2UZSA 4HAVB 4HHVA 3OHMB 1LB1A 2NMBA 2XQNM 2RVBB 1X05A 2Z14A 3D8FA 4NSWA 2VKIA 4GN1A 2Y7BA 1K5DB 4OSNA 3HQCA 1UEFA 5C5BB 4GMVA 4K81A 4QJ4B 5M4YB 2COCA 3LJUX 2J0KA 4IOYX 1WGQA 4HATB 3ZVRA 1N3HA 4L1RA 3ULCA 5LOPB 3TCAA 4Y94A 4B6HA 4QJ5B 1AWEA 4YONA 3SUZA 4CHJA 3PVWA 2D11A 5I2SA 1U5EA 4HDOA 1Y5OA 4IAPA 4HAXB 3DXEA 4KHAA 2W2WA 3A8QA 5JP4A 2KUQA 2K49A 3ODOA 5KQ1A 1GC6A 2PZ1A 2GUMA 4DBBA 1V61A 5HE1A 2D9XA 2EC1A 3QBVB 1U27A 1DYNA 4GPTB 2AL6A 1UPQA 1P3RA 2LKOA 2MDXA 3D8EA 1DROA 2NBVA 5J3TA 2R09A 2DHKA 1MK9B 2V76A 4ZRIA 3PP2A 2LG1A 2RGNB 4D6WA 2N0YA 4IFSA 1ZYIA 1XCGA 3TFMA 1DDWA 3HK0A 3A8PA 5EFXA 1NTVA 1DBHA 5DH9B 1SGHA 2CODA 4HB2B 3FSSA 3PEGA 1U2BA 2KUPA 5HE2A 3N7CA 3HW2B 2LOXA 3U8ZA 3F5RA 1U5DA 3V5WA 4WVFB 3OANA 2KIGA 2R0DA 2YS3A 4MK0A 2P0HA 3ULBA 4A6KA 2I1JA 2K00A 1V5MA 4A6FB 1K5GB 1FGZA 5CLLB 2MKRA 1BTKA 2K8EA 3VOQA 2IFSA 2Z4DA 1MIZB 5J3QA 4PNKA 1FAOA 4ZRJA 5D3XA 2YT2A 2E2XA 2I5CA 2Y8FA 2JP2A 1WJ1A 3M1IB 4HAUB 1Y19B 3P6AA 3MDBC 4GMXB 2CY4A 2ELAA 3FVCA 1ZC3B 1E5WA 1P5TA 4H8SA 5GOWB 1X86A 1X11A 2AEHA 1T77A 2CY5A 5IRSA 1EVHA 1I2HA 4KVGB 2I1KA 5C79A 2W2XC 4F7HA 5HE0A 2DX1A 1X1GA 1EGXA 3QIJA 2ROZB 5DHFB 5FI1A 5JHHA 2ROVA 4CYEA 1J0WA 1H4RA 3U12A 2OTXA 5FI0A 1H10A 2RLOA 1AQCA 2YRYA 4EJNA 1XKEA 3HIEA 1BTNA 2LYDA 2KCJA 5D3YA 3CIKA 3ODXA 1NI2A 2UZRA 1FHOA 1RRPB 2KIEA 4HB4B 3SV1A 2MWNB 2J0JA 5JLJB 2YT1A 1ZC4B 1MIXA 1WI1A 4A5KA 2ELBA 2LOZA 2OQBA 4HAYB 2RNRB 1EAZA 3TW1A 4HB3B 4DX8A 1V5PA 4KHBA 3G9WA 3IVFA 5D3VA 2M14A 1QC6A 3NWAA 2J59M 4GZUA 4DX90 4KHBB 2ZKMX 2Z13A 5DHAB 2YT0A 3NWDA 3ZDTA 2D10A 4D0NB 4HSIA 2YSZA 1PLSA 4K17A 3NW8A 1W1HA 2K2JA 2YS5A 3B77A 1FGYA 1RJ2A 2QKMA 1V5UA 5C6RA 2FJUB 2GCJA 4CSQA 1MKEA 3BJIA 1DDMA 1KZGA 1MK7B 1MPHA 2GS0A 2R2YA 2W2XD 4ZRKA 2L1CA 1BAKA 2ZPYA
chains in the Genus database with same CATH topology
2HTHB 2RUKB 4K2PA 1TJ6A 5D27A 3FEHA 3UZTA 1PMSA 1UNQA 3ML4A 4TKNA 1V88A 2G35A 1Z87A 1UNPA 2GCLA 2FJLA 1B55A 2Z0PA 1NU2A 2HE7A 2RSGA 2BCJA 4EMOA 4P7IA 1UNRA 3TVVA 2H7DA 3VIAA 1WVHA 1PFJA 2Y8GA 3TO1A 2H7EA 1WG7A 2J0MA 3DXDA 3DXCA 5LONB 1BWNA 1GC7A 1KI1B 4K2OA 1WGUA 1LW3A 2D9VA 4F7GA 1XODA 3U7DA 3KZ1A 3SNHA 1P6SA 1WJMA 3WYFB 3A98B 3F0WA 1ZM0A 3SYXA 2DKQA 2DHIA 2D4QA 2CAYA 1ZSQA 2Q13A 2N23A 1DDVA 5C16A 1ZVRA 3GYPA 4BBKA 2GJYA 1U5FA 1FHWA 4NY0A 3KRXA 1W1DA 4WSFA 2DYQA 3NSUA 2YS1A 2NZ8B 4Z2NA 4CHMA 4A6HA 2I5FA 2K2UA 1GG3A 1Q67A 4HDQA 3SO6A 2D9ZA 4XWXA 1NTYA 4C0AA 5DIFB 2COAA 2COFA 3GYOA 2IYBA 2VRWB 4TYZA 2MFQA 3T06A 2EMTA 2EJ8A 2D2QA 1SHCA 3CXBB 4A6FA 3MPXA 2DX5A 4KHOA 4MT7A 3FM8C 1FB8A 2P0FA 3PVUA 3PSCA 2YF0A 2DTCA 5D3WA 2DHJA 3BINA 2P0DA 4WJ7A 2DFKA 4DXAB 2P8VA 3RCPA 1XD4A 2X18A 5L81A 1XR0B 1J19A 2D9YA 4YL8A 1V89A 1QQGA 5HE3A 2DKPA 2EMSA 3QWMA 2KGXB 5DI9B 4HB0B 2DN6A 3PVLA 2DYNA 5CLQB 1M7RA 2Z0OA 2UVMA 2QKLA 1KZ7A 1X1FA 2M38A 1UPRA 4MY6A 3AJ4A 2D9WA 3KRWA 1W1GA 5KCVA 1XX0A 1IRSA 1TQZA 4PQ0A 3D8DA 2L2IA 3PG7A 3P7ZA 2Z0QA 5KQ4A 1MAIA 1EF1A 1M7EA 1U29A 4EKUA 3PZDA 4HAWB 4Z2MB 3AU4A 2YVCA 2VSZA 5JHGA 1I7AA 1OMWA 1OY2A 3KSYA 2DA0A 3KY9A 1U5GA 1TXDA 2CRFA 1FOEA 1ISNA 4F7UP 2DLWA 4KAXB 1FHXA 3ODWA 3O96A 1OQNA 2ADZA 4GXBA 3X23A 5C5BA 3WA0A 3AU5A 4HAZB 2LULA 4L6EA 5J3YA 2UZSA 4HAVB 4HHVA 1LB1A 2NMBA 2XQNM 2RVBB 1X05A 3D8FA 4NSWA 2VKIA 4GN1A 2Y7BA 1K5DB 3HQCA 1UEFA 5C5BB 4GMVA 4K81A 2COCA 3LJUX 2J0KA 4IOYX 1WGQA 4HATB 3ZVRA 1N3HA 3ULCA 5LOPB 3TCAA 4Y94A 4B6HA 1AWEA 4YONA 3SUZA 4CHJA 3PVWA 2D11A 1U5EA 4HDOA 1Y5OA 4IAPA 4HAXB 3DXEA 4KHAA 2W2WA 3A8QA 5JP4A 3ODOA 5KQ1A 1GC6A 2PZ1A 4DBBA 1V61A 5HE1A 2D9XA 2EC1A 3QBVB 1U27A 1DYNA 4GPTB 2AL6A 1UPQA 1P3RA 2LKOA 2MDXA 3D8EA 1DROA 5J3TA 2R09A 2DHKA 1MK9B 2V76A 4ZRIA 3PP2A 2LG1A 2RGNB 2N0YA 4IFSA 1XCGA 3TFMA 1DDWA 3HK0A 3A8PA 5EFXA 1NTVA 1DBHA 5DH9B 1SGHA 2CODA 4HB2B 3FSSA 3PEGA 1U2BA 2KUPA 5HE2A 3N7CA 3HW2B 2LOXA 3U8ZA 3F5RA 1U5DA 3V5WA 4WVFB 3OANA 2R0DA 2YS3A 4MK0A 2P0HA 3ULBA 4A6KA 2I1JA 2K00A 1V5MA 4A6FB 1K5GB 1FGZA 5CLLB 2MKRA 1BTKA 3VOQA 2IFSA 1MIZB 5J3QA 4PNKA 1FAOA 4ZRJA 5D3XA 2E2XA 2I5CA 2Y8FA 2JP2A 1WJ1A 3M1IB 4HAUB 1Y19B 3P6AA 3MDBC 4GMXB 2CY4A 2ELAA 1ZC3B 1E5WA 1P5TA 4H8SA 5GOWB 1X86A 1X11A 2AEHA 2CY5A 1EVHA 1I2HA 4KVGB 2I1KA 5C79A 2W2XC 4F7HA 5HE0A 2DX1A 1X1GA 1EGXA 3QIJA 2ROZB 5DHFB 5FI1A 5JHHA 2ROVA 4CYEA 1J0WA 1H4RA 2OTXA 5FI0A 1H10A 2RLOA 1AQCA 2YRYA 4EJNA 1XKEA 1BTNA 2LYDA 2KCJA 5D3YA 3CIKA 3ODXA 1NI2A 2UZRA 1FHOA 1RRPB 4HB4B 3SV1A 2MWNB 2J0JA 5JLJB 2YT1A 1ZC4B 1MIXA 1WI1A 4A5KA 2ELBA 2LOZA 2OQBA 4HAYB 2RNRB 1EAZA 3TW1A 4HB3B 4DX8A 1V5PA 3G9WA 3IVFA 5D3VA 2M14A 1QC6A 4GZUA 2J59M 4DX90 4KHBB 5DHAB 2YT0A 3ZDTA 2D10A 4D0NB 2YSZA 1PLSA 4K17A 1W1HA 2K2JA 2YS5A 1FGYA 1RJ2A 2QKMA 1V5UA 5C6RA 2GCJA 1MKEA 3BJIA 1DDMA 1KZGA 1MK7B 1MPHA 2GS0A 2W2XD 4ZRKA 2L1CA 1BAKA 2ZPYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HTH B;  2RUK B;  4K2P A;  1TJ6 A;  5D27 A;  3FEH A;  3UZT A;  1PMS A;  1UNQ A;  3ML4 A;  4TKN A;  1V88 A;  2G35 A;  1Z87 A;  1UNP A;  2GCL A;  2FJL A;  1B55 A;  2Z0P A;  1NU2 A;  2HE7 A;  2RSG A;  2BCJ A;  4EMO A;  4P7I A;  1UNR A;  3TVV A;  2H7D A;  3VIA A;  1WVH A;  1PFJ A;  2Y8G A;  3TO1 A;  2H7E A;  1WG7 A;  2J0M A;  3DXD A;  3DXC A;  5LON B;  1BWN A;  1GC7 A;  1KI1 B;  4K2O A;  1WGU A;  1LW3 A;  2D9V A;  4F7G A;  1XOD A;  3U7D A;  3KZ1 A;  3SNH A;  1P6S A;  1WJM A;  3WYF B;  3A98 B;  3F0W A;  1ZM0 A;  3SYX A;  2DKQ A;  2DHI A;  2D4Q A;  2CAY A;  1ZSQ A;  2Q13 A;  2N23 A;  1DDV A;  5C16 A;  1ZVR A;  3GYP A;  4BBK A;  2GJY A;  1U5F A;  1FHW A;  4NY0 A;  3KRX A;  1W1D A;  4WSF A;  2DYQ A;  3NSU A;  2YS1 A;  2NZ8 B;  4Z2N A;  4CHM A;  4A6H A;  2I5F A;  2K2U A;  1GG3 A;  1Q67 A;  4HDQ A;  3SO6 A;  2D9Z A;  4XWX A;  1NTY A;  4C0A A;  5DIF B;  2COA A;  2COF A;  3GYO A;  2IYB A;  2VRW B;  4TYZ A;  2MFQ A;  3T06 A;  2EMT A;  2EJ8 A;  2D2Q A;  1SHC A;  3CXB B;  4A6F A;  3MPX A;  2DX5 A;  4KHO A;  4MT7 A;  3FM8 C;  1FB8 A;  2P0F A;  3PVU A;  3PSC A;  2YF0 A;  2DTC A;  5D3W A;  2DHJ A;  3BIN A;  2P0D A;  4WJ7 A;  2DFK A;  4DXA B;  2P8V A;  3RCP A;  1XD4 A;  2X18 A;  5L81 A;  1XR0 B;  1J19 A;  2D9Y A;  4YL8 A;  1V89 A;  1QQG A;  5HE3 A;  2DKP A;  2EMS A;  3QWM A;  2KGX B;  5DI9 B;  4HB0 B;  2DN6 A;  3PVL A;  2DYN A;  5CLQ B;  1M7R A;  2Z0O A;  2UVM A;  2QKL A;  1KZ7 A;  1X1F A;  2M38 A;  1UPR A;  4MY6 A;  3AJ4 A;  2D9W A;  3KRW A;  1W1G A;  5KCV A;  1XX0 A;  1IRS A;  1TQZ A;  4PQ0 A;  3D8D A;  2L2I A;  3PG7 A;  3P7Z A;  2Z0Q A;  5KQ4 A;  1MAI A;  1EF1 A;  1M7E A;  1U29 A;  4EKU A;  3PZD A;  4HAW B;  4Z2M B;  3AU4 A;  2YVC A;  2VSZ A;  5JHG A;  1I7A A;  1OMW A;  1OY2 A;  3KSY A;  2DA0 A;  3KY9 A;  1U5G A;  1TXD A;  2CRF A;  1FOE A;  1ISN A;  4F7U P;  2DLW A;  4KAX B;  1FHX A;  3ODW A;  3O96 A;  1OQN A;  2ADZ A;  4GXB A;  3X23 A;  5C5B A;  3WA0 A;  3AU5 A;  4HAZ B;  2LUL A;  4L6E A;  5J3Y A;  2UZS A;  4HAV B;  4HHV A;  1LB1 A;  2NMB A;  2XQN M;  2RVB B;  1X05 A;  3D8F A;  4NSW A;  2VKI A;  4GN1 A;  2Y7B A;  1K5D B;  3HQC A;  1UEF A;  5C5B B;  4GMV A;  4K81 A;  2COC A;  3LJU X;  2J0K A;  4IOY X;  1WGQ A;  4HAT B;  3ZVR A;  1N3H A;  3ULC A;  5LOP B;  3TCA A;  4Y94 A;  4B6H A;  1AWE A;  4YON A;  3SUZ A;  4CHJ A;  3PVW A;  2D11 A;  1U5E A;  4HDO A;  1Y5O A;  4IAP A;  4HAX B;  3DXE A;  4KHA A;  2W2W A;  3A8Q A;  5JP4 A;  3ODO A;  5KQ1 A;  1GC6 A;  2PZ1 A;  4DBB A;  1V61 A;  5HE1 A;  2D9X A;  2EC1 A;  3QBV B;  1U27 A;  1DYN A;  4GPT B;  2AL6 A;  1UPQ A;  1P3R A;  2LKO A;  2MDX A;  3D8E A;  1DRO A;  5J3T A;  2R09 A;  2DHK A;  1MK9 B;  2V76 A;  4ZRI A;  3PP2 A;  2LG1 A;  2RGN B;  2N0Y A;  4IFS A;  1XCG A;  3TFM A;  1DDW A;  3HK0 A;  3A8P A;  5EFX A;  1NTV A;  1DBH A;  5DH9 B;  1SGH A;  2COD A;  4HB2 B;  3FSS A;  3PEG A;  1U2B A;  2KUP A;  5HE2 A;  3N7C A;  3HW2 B;  2LOX A;  3U8Z A;  3F5R A;  1U5D A;  3V5W A;  4WVF B;  3OAN A;  2R0D A;  2YS3 A;  4MK0 A;  2P0H A;  3ULB A;  4A6K A;  2I1J A;  2K00 A;  1V5M A;  4A6F B;  1K5G B;  1FGZ A;  5CLL B;  2MKR A;  1BTK A;  3VOQ A;  2IFS A;  1MIZ B;  5J3Q A;  4PNK A;  1FAO A;  4ZRJ A;  5D3X A;  2E2X A;  2I5C A;  2Y8F A;  2JP2 A;  1WJ1 A;  3M1I B;  4HAU B;  1Y19 B;  3P6A A;  3MDB C;  4GMX B;  2CY4 A;  2ELA A;  1ZC3 B;  1E5W A;  1P5T A;  4H8S A;  5GOW B;  1X86 A;  1X11 A;  2AEH A;  2CY5 A;  1EVH A;  1I2H A;  4KVG B;  2I1K A;  5C79 A;  2W2X C;  4F7H A;  5HE0 A;  2DX1 A;  1X1G A;  1EGX A;  3QIJ A;  2ROZ B;  5DHF B;  5FI1 A;  5JHH A;  2ROV A;  4CYE A;  1J0W A;  1H4R A;  2OTX A;  5FI0 A;  1H10 A;  2RLO A;  1AQC A;  2YRY A;  4EJN A;  1XKE A;  1BTN A;  2LYD A;  2KCJ A;  5D3Y A;  3CIK A;  3ODX A;  1NI2 A;  2UZR A;  1FHO A;  1RRP B;  4HB4 B;  3SV1 A;  2MWN B;  2J0J A;  5JLJ B;  2YT1 A;  1ZC4 B;  1MIX A;  1WI1 A;  4A5K A;  2ELB A;  2LOZ A;  2OQB A;  4HAY B;  2RNR B;  1EAZ A;  3TW1 A;  4HB3 B;  4DX8 A;  1V5P A;  3G9W A;  3IVF A;  5D3V A;  2M14 A;  1QC6 A;  4GZU A;  2J59 M;  4DX9 0;  4KHB B;  5DHA B;  2YT0 A;  3ZDT A;  2D10 A;  4D0N B;  2YSZ A;  1PLS A;  4K17 A;  1W1H A;  2K2J A;  2YS5 A;  1FGY A;  1RJ2 A;  2QKM A;  1V5U A;  5C6R A;  2GCJ A;  1MKE A;  3BJI A;  1DDM A;  1KZG A;  1MK7 B;  1MPH A;  2GS0 A;  2W2X D;  4ZRK A;  2L1C A;  1BAK A;  2ZPY A; 
#chains in the Genus database with same CATH topology
 2HTH B;  5LG4 B;  2RUK B;  4K2P A;  1TJ6 A;  5D27 A;  3FEH A;  3UZT A;  1PMS A;  1UNQ A;  3ML4 A;  4TKN A;  1V88 A;  2G35 A;  1Z87 A;  1UNP A;  2GCL A;  2FJL A;  1B55 A;  2Z0P A;  1NU2 A;  2HE7 A;  2RSG A;  2BCJ A;  4EMO A;  4P7I A;  1UNR A;  3TVV A;  2H7D A;  3VIA A;  1WVH A;  1PFJ A;  2Y8G A;  3TO1 A;  2H7E A;  1WG7 A;  2J0M A;  3DXD A;  3DXC A;  5LON B;  1BWN A;  1GC7 A;  1KI1 B;  4K2O A;  1WGU A;  2Z59 A;  4QXA B;  1LW3 A;  2D9V A;  4F7G A;  1XOD A;  3U7D A;  3KZ1 A;  3SNH A;  1P6S A;  1WJM A;  3WYF B;  3A98 B;  3F0W A;  1ZM0 A;  3SYX A;  2DKQ A;  2DHI A;  2D4Q A;  2CAY A;  1ZSQ A;  2Q13 A;  2N23 A;  1DDV A;  5C16 A;  1ZVR A;  3GYP A;  4BBK A;  2GJY A;  3A58 A;  1U5F A;  1FHW A;  4NY0 A;  3KRX A;  1W1D A;  4WSF A;  2DYQ A;  3NSU A;  2YS1 A;  2NZ8 B;  4Z2N A;  4CHM A;  4A6H A;  2I5F A;  2K2U A;  1GG3 A;  1Q67 A;  4HDQ A;  3SO6 A;  3NWF A;  2D9Z A;  4XWX A;  1NTY A;  4C0A A;  5DIF B;  2KR0 A;  2COA A;  4OT1 A;  2COF A;  3GYO A;  2IYB A;  2VRW B;  3DCX A;  5I2M A;  4TYZ A;  2MFQ A;  2EMT A;  3T06 A;  2EJ8 A;  2D2Q A;  1SHC A;  3CXB B;  4A6F A;  3MPX A;  2DX5 A;  4KHO A;  4MT7 A;  3FM8 C;  1FB8 A;  2P0F A;  3PVU A;  3PSC A;  2RRF A;  2YF0 A;  4QJ3 B;  3HSA A;  2DTC A;  5D3W A;  2DHJ A;  3BIN A;  2P0D A;  4WJ7 A;  2DFK A;  4DXA B;  2P8V A;  3RCP A;  1XD4 A;  2X18 A;  5L81 A;  1XR0 B;  1J19 A;  2D9Y A;  4YL8 A;  1V89 A;  1QQG A;  5HE3 A;  4DIX A;  2DKP A;  2EMS A;  3QWM A;  2KGX B;  5DI9 B;  4HB0 B;  2DN6 A;  3PVL A;  2DYN A;  5CLQ B;  1M7R A;  2Z0O A;  2UVM A;  2QKL A;  1KZ7 A;  1X1F A;  2M38 A;  1MI1 A;  1UPR A;  4GOU A;  4MY6 A;  3AJ4 A;  2D9W A;  3KRW A;  1W1G A;  5KCV A;  1XX0 A;  1IRS A;  1TQZ A;  4PQ0 A;  3D8D A;  2L2I A;  4GNK B;  3PG7 A;  3P7Z A;  2Z0Q A;  5KQ4 A;  1MAI A;  1EF1 A;  1M7E A;  1U29 A;  4EKU A;  3PZD A;  4HAW B;  4Z2M B;  3AU4 A;  2YVC A;  2VSZ A;  5JHG A;  1I7A A;  1OMW A;  1OY2 A;  3KSY A;  2DA0 A;  3KY9 A;  1U5G A;  1TXD A;  2CRF A;  1FOE A;  1ISN A;  4F7U P;  2DLW A;  4KAX B;  1FHX A;  3ODW A;  3O96 A;  1OQN A;  2ADZ A;  4GXB A;  3X23 A;  5C5B A;  3WA0 A;  3AU5 A;  4HAZ B;  2LUL A;  4L6E A;  5J3Y A;  2UZS A;  4HAV B;  4HHV A;  3OHM B;  1LB1 A;  2NMB A;  2XQN M;  2RVB B;  1X05 A;  2Z14 A;  3D8F A;  4NSW A;  2VKI A;  4GN1 A;  2Y7B A;  1K5D B;  4OSN A;  3HQC A;  1UEF A;  5C5B B;  4GMV A;  4K81 A;  4QJ4 B;  5M4Y B;  2COC A;  3LJU X;  2J0K A;  4IOY X;  1WGQ A;  4HAT B;  3ZVR A;  1N3H A;  4L1R A;  3ULC A;  5LOP B;  3TCA A;  4Y94 A;  4B6H A;  4QJ5 B;  1AWE A;  4YON A;  3SUZ A;  4CHJ A;  3PVW A;  2D11 A;  5I2S A;  1U5E A;  4HDO A;  1Y5O A;  4IAP A;  4HAX B;  3DXE A;  4KHA A;  2W2W A;  3A8Q A;  5JP4 A;  2KUQ A;  2K49 A;  3ODO A;  5KQ1 A;  1GC6 A;  2PZ1 A;  2GUM A;  4DBB A;  1V61 A;  5HE1 A;  2D9X A;  2EC1 A;  3QBV B;  1U27 A;  1DYN A;  4GPT B;  2AL6 A;  1UPQ A;  1P3R A;  2LKO A;  2MDX A;  3D8E A;  1DRO A;  2NBV A;  5J3T A;  2R09 A;  2DHK A;  1MK9 B;  2V76 A;  4ZRI A;  3PP2 A;  2LG1 A;  2RGN B;  4D6W A;  2N0Y A;  4IFS A;  1ZYI A;  1XCG A;  3TFM A;  1DDW A;  3HK0 A;  3A8P A;  5EFX A;  1NTV A;  1DBH A;  5DH9 B;  1SGH A;  2COD A;  4HB2 B;  3FSS A;  3PEG A;  1U2B A;  2KUP A;  5HE2 A;  3N7C A;  3HW2 B;  2LOX A;  3U8Z A;  3F5R A;  1U5D A;  3V5W A;  4WVF B;  3OAN A;  2KIG A;  2R0D A;  2YS3 A;  4MK0 A;  2P0H A;  3ULB A;  4A6K A;  2I1J A;  2K00 A;  1V5M A;  4A6F B;  1K5G B;  1FGZ A;  5CLL B;  2MKR A;  1BTK A;  2K8E A;  3VOQ A;  2IFS A;  2Z4D A;  1MIZ B;  5J3Q A;  4PNK A;  1FAO A;  4ZRJ A;  5D3X A;  2YT2 A;  2E2X A;  2I5C A;  2Y8F A;  2JP2 A;  1WJ1 A;  3M1I B;  4HAU B;  1Y19 B;  3P6A A;  3MDB C;  4GMX B;  2CY4 A;  2ELA A;  3FVC A;  1ZC3 B;  1E5W A;  1P5T A;  4H8S A;  5GOW B;  1X86 A;  1X11 A;  2AEH A;  1T77 A;  2CY5 A;  5IRS A;  1EVH A;  1I2H A;  4KVG B;  2I1K A;  5C79 A;  2W2X C;  4F7H A;  5HE0 A;  2DX1 A;  1X1G A;  1EGX A;  3QIJ A;  2ROZ B;  5DHF B;  5FI1 A;  5JHH A;  2ROV A;  4CYE A;  1J0W A;  1H4R A;  3U12 A;  2OTX A;  5FI0 A;  1H10 A;  2RLO A;  1AQC A;  2YRY A;  4EJN A;  1XKE A;  3HIE A;  1BTN A;  2LYD A;  2KCJ A;  5D3Y A;  3CIK A;  3ODX A;  1NI2 A;  2UZR A;  1FHO A;  1RRP B;  2KIE A;  4HB4 B;  3SV1 A;  2MWN B;  2J0J A;  5JLJ B;  2YT1 A;  1ZC4 B;  1MIX A;  1WI1 A;  4A5K A;  2ELB A;  2LOZ A;  2OQB A;  4HAY B;  2RNR B;  1EAZ A;  3TW1 A;  4HB3 B;  4DX8 A;  1V5P A;  4KHB A;  3G9W A;  3IVF A;  5D3V A;  2M14 A;  1QC6 A;  3NWA A;  2J59 M;  4GZU A;  4DX9 0;  4KHB B;  2ZKM X;  2Z13 A;  5DHA B;  2YT0 A;  3NWD A;  3ZDT A;  2D10 A;  4D0N B;  4HSI A;  2YSZ A;  1PLS A;  4K17 A;  3NW8 A;  1W1H A;  2K2J A;  2YS5 A;  3B77 A;  1FGY A;  1RJ2 A;  2QKM A;  1V5U A;  5C6R A;  2FJU B;  2GCJ A;  4CSQ A;  1MKE A;  3BJI A;  1DDM A;  1KZG A;  1MK7 B;  1MPH A;  2GS0 A;  2R2Y A;  2W2X D;  4ZRK A;  2L1C A;  1BAK A;  2ZPY A; 
#chains in the Genus database with same CATH homology
 2HTH B;  2RUK B;  4K2P A;  1TJ6 A;  5D27 A;  3FEH A;  3UZT A;  1PMS A;  1UNQ A;  3ML4 A;  4TKN A;  1V88 A;  2G35 A;  1Z87 A;  1UNP A;  2GCL A;  2FJL A;  1B55 A;  2Z0P A;  1NU2 A;  2HE7 A;  2RSG A;  2BCJ A;  4EMO A;  4P7I A;  1UNR A;  3TVV A;  2H7D A;  3VIA A;  1WVH A;  1PFJ A;  2Y8G A;  3TO1 A;  2H7E A;  1WG7 A;  2J0M A;  3DXD A;  3DXC A;  5LON B;  1BWN A;  1GC7 A;  1KI1 B;  4K2O A;  1WGU A;  1LW3 A;  2D9V A;  4F7G A;  1XOD A;  3U7D A;  3KZ1 A;  3SNH A;  1P6S A;  1WJM A;  3WYF B;  3A98 B;  3F0W A;  1ZM0 A;  3SYX A;  2DKQ A;  2DHI A;  2D4Q A;  2CAY A;  1ZSQ A;  2Q13 A;  2N23 A;  1DDV A;  5C16 A;  1ZVR A;  3GYP A;  4BBK A;  2GJY A;  1U5F A;  1FHW A;  4NY0 A;  3KRX A;  1W1D A;  4WSF A;  2DYQ A;  3NSU A;  2YS1 A;  2NZ8 B;  4Z2N A;  4CHM A;  4A6H A;  2I5F A;  2K2U A;  1GG3 A;  1Q67 A;  4HDQ A;  3SO6 A;  2D9Z A;  4XWX A;  1NTY A;  4C0A A;  5DIF B;  2COA A;  2COF A;  3GYO A;  2IYB A;  2VRW B;  4TYZ A;  2MFQ A;  3T06 A;  2EMT A;  2EJ8 A;  2D2Q A;  1SHC A;  3CXB B;  4A6F A;  3MPX A;  2DX5 A;  4KHO A;  4MT7 A;  3FM8 C;  1FB8 A;  2P0F A;  3PVU A;  3PSC A;  2YF0 A;  2DTC A;  5D3W A;  2DHJ A;  3BIN A;  2P0D A;  4WJ7 A;  2DFK A;  4DXA B;  2P8V A;  3RCP A;  1XD4 A;  2X18 A;  5L81 A;  1XR0 B;  1J19 A;  2D9Y A;  4YL8 A;  1V89 A;  1QQG A;  5HE3 A;  2DKP A;  2EMS A;  3QWM A;  2KGX B;  5DI9 B;  4HB0 B;  2DN6 A;  3PVL A;  2DYN A;  5CLQ B;  1M7R A;  2Z0O A;  2UVM A;  2QKL A;  1KZ7 A;  1X1F A;  2M38 A;  1UPR A;  4MY6 A;  3AJ4 A;  2D9W A;  3KRW A;  1W1G A;  5KCV A;  1XX0 A;  1IRS A;  1TQZ A;  4PQ0 A;  3D8D A;  2L2I A;  3PG7 A;  3P7Z A;  2Z0Q A;  5KQ4 A;  1MAI A;  1EF1 A;  1M7E A;  1U29 A;  4EKU A;  3PZD A;  4HAW B;  4Z2M B;  3AU4 A;  2YVC A;  2VSZ A;  5JHG A;  1I7A A;  1OMW A;  1OY2 A;  3KSY A;  2DA0 A;  3KY9 A;  1U5G A;  1TXD A;  2CRF A;  1FOE A;  1ISN A;  4F7U P;  2DLW A;  4KAX B;  1FHX A;  3ODW A;  3O96 A;  1OQN A;  2ADZ A;  4GXB A;  3X23 A;  5C5B A;  3WA0 A;  3AU5 A;  4HAZ B;  2LUL A;  4L6E A;  5J3Y A;  2UZS A;  4HAV B;  4HHV A;  1LB1 A;  2NMB A;  2XQN M;  2RVB B;  1X05 A;  3D8F A;  4NSW A;  2VKI A;  4GN1 A;  2Y7B A;  1K5D B;  3HQC A;  1UEF A;  5C5B B;  4GMV A;  4K81 A;  2COC A;  3LJU X;  2J0K A;  4IOY X;  1WGQ A;  4HAT B;  3ZVR A;  1N3H A;  3ULC A;  5LOP B;  3TCA A;  4Y94 A;  4B6H A;  1AWE A;  4YON A;  3SUZ A;  4CHJ A;  3PVW A;  2D11 A;  1U5E A;  4HDO A;  1Y5O A;  4IAP A;  4HAX B;  3DXE A;  4KHA A;  2W2W A;  3A8Q A;  5JP4 A;  3ODO A;  5KQ1 A;  1GC6 A;  2PZ1 A;  4DBB A;  1V61 A;  5HE1 A;  2D9X A;  2EC1 A;  3QBV B;  1U27 A;  1DYN A;  4GPT B;  2AL6 A;  1UPQ A;  1P3R A;  2LKO A;  2MDX A;  3D8E A;  1DRO A;  5J3T A;  2R09 A;  2DHK A;  1MK9 B;  2V76 A;  4ZRI A;  3PP2 A;  2LG1 A;  2RGN B;  2N0Y A;  4IFS A;  1XCG A;  3TFM A;  1DDW A;  3HK0 A;  3A8P A;  5EFX A;  1NTV A;  1DBH A;  5DH9 B;  1SGH A;  2COD A;  4HB2 B;  3FSS A;  3PEG A;  1U2B A;  2KUP A;  5HE2 A;  3N7C A;  3HW2 B;  2LOX A;  3U8Z A;  3F5R A;  1U5D A;  3V5W A;  4WVF B;  3OAN A;  2R0D A;  2YS3 A;  4MK0 A;  2P0H A;  3ULB A;  4A6K A;  2I1J A;  2K00 A;  1V5M A;  4A6F B;  1K5G B;  1FGZ A;  5CLL B;  2MKR A;  1BTK A;  3VOQ A;  2IFS A;  1MIZ B;  5J3Q A;  4PNK A;  1FAO A;  4ZRJ A;  5D3X A;  2E2X A;  2I5C A;  2Y8F A;  2JP2 A;  1WJ1 A;  3M1I B;  4HAU B;  1Y19 B;  3P6A A;  3MDB C;  4GMX B;  2CY4 A;  2ELA A;  1ZC3 B;  1E5W A;  1P5T A;  4H8S A;  5GOW B;  1X86 A;  1X11 A;  2AEH A;  2CY5 A;  1EVH A;  1I2H A;  4KVG B;  2I1K A;  5C79 A;  2W2X C;  4F7H A;  5HE0 A;  2DX1 A;  1X1G A;  1EGX A;  3QIJ A;  2ROZ B;  5DHF B;  5FI1 A;  5JHH A;  2ROV A;  4CYE A;  1J0W A;  1H4R A;  2OTX A;  5FI0 A;  1H10 A;  2RLO A;  1AQC A;  2YRY A;  4EJN A;  1XKE A;  1BTN A;  2LYD A;  2KCJ A;  5D3Y A;  3CIK A;  3ODX A;  1NI2 A;  2UZR A;  1FHO A;  1RRP B;  4HB4 B;  3SV1 A;  2MWN B;  2J0J A;  5JLJ B;  2YT1 A;  1ZC4 B;  1MIX A;  1WI1 A;  4A5K A;  2ELB A;  2LOZ A;  2OQB A;  4HAY B;  2RNR B;  1EAZ A;  3TW1 A;  4HB3 B;  4DX8 A;  1V5P A;  3G9W A;  3IVF A;  5D3V A;  2M14 A;  1QC6 A;  4GZU A;  2J59 M;  4DX9 0;  4KHB B;  5DHA B;  2YT0 A;  3ZDT A;  2D10 A;  4D0N B;  2YSZ A;  1PLS A;  4K17 A;  1W1H A;  2K2J A;  2YS5 A;  1FGY A;  1RJ2 A;  2QKM A;  1V5U A;  5C6R A;  2GCJ A;  1MKE A;  3BJI A;  1DDM A;  1KZG A;  1MK7 B;  1MPH A;  2GS0 A;  2W2X D;  4ZRK A;  2L1C A;  1BAK A;  2ZPY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...