2Z0PA

Crystal structure of ph domain of bruton's tyrosine kinase
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
167
structure length
158
Chain Sequence
AAVILESIFLKRSQQKKKTSPLNFKKRLFLLTVHKLSYYEYDFERGRRGSKKGSIDVEKITCVETVVPEKNPPPERQIMEQISIIERFPYPFQVVYDEGPLYVFSPTEELRKRWIHQLKNVIRYNSDLVQKYHPCFWIDGQYLCCSQTAKNAMGCQIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the Bruton's tyrosine kinase PH domain with phosphatidylinositol
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Tyrosine-protein kinase BTK
total genus 34
structure length 158
sequence length 167
chains with identical sequence B, C, D
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2007-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
A PF00779 BTK BTK motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2z0pA00
1ZC4B 4Z2NA 2D9VA 1BTNA 5J3QA 4CHJA 2IYBA 5DIFB 4KHAA 2UZSA 3HK0A 2R09A 2XQNM 5KQ4A 2LYDA 1UNPA 1K5GB 2ELBA 1B55A 2YS1A 4A6HA 2COAA 3ML4A 2GS0A 4EMOA 4KHOA 2V76A 1UEFA 2LKOA 3A8PA 1WI1A 4WSFA 1KZGA 1MPHA 3PZDA 5LOPB 1ZM0A 2ADZA 2ZPYA 5CLQB 3TCAA 1DDVA 4GMVA 1EVHA 3O96A 4HDQA 2HTHB 3SYXA 3NSUA 4P7IA 3DXCA 1XCGA 1AQCA 2DHKA 3LJUX 3N7CA 3U7DA 4HAYB 3QWMA 4DX8A 2D10A 1M7RA 4H8SA 2OTXA 1EAZA 5C5BB 2ELAA 5J3TA 1U5FA 1XODA 2MWNB 2P8VA 2Q13A 2I5CA 2CODA 5GOWB 2QKLA 1DBHA 1DROA 2E2XA 2I1KA 1V5PA 4F7GA 1V61A 2KCJA 2QKMA 4HATB 5D3WA 4B6HA 5FI1A 3TVVA 3G9WA 4EJNA 1WGQA 4HAUB 1UNQA 5CLLB 1Y5OA 2GJYA 1V89A 2DYQA 1WJMA 3A8QA 2Y7BA 2Y8FA 2BCJA 2DN6A 1I7AA 2GCLA 2YS3A 1FAOA 2Y8GA 3D8DA 3P7ZA 4HB0B 3ULCA 5JP4A 2DHIA 2P0FA 2AEHA 5HE0A 5C79A 5L81A 5LONB 4F7UP 4TKNA 4A6FB 1FHXA 3F5RA 2LOZA 2Z0QA 4F7HA 4IOYX 5EFXA 1NTVA 3D8EA 4TYZA 2GCJA 3X23A 3QIJA 2VSZA 1OMWA 1RRPB 4KHBB 1MK9B 2OQBA 1TJ6A 4L6EA 3KRWA 5D3XA 1M7EA 3ZVRA 4DX90 2DX5A 2D9ZA 2I5FA 2DHJA 3RCPA 3P6AA 3AJ4A 4IAPA 3WA0A 2KUPA 4K81A 1ZSQA 2W2XD 2H7EA 2DTCA 1GC6A 5C5BA 2L2IA 1GC7A 1BTKA 2NMBA 2Z0PA 2KGXB 4MY6A 1PLSA 1U5GA 2CY4A 2D4QA 3AU4A 2CRFA 2UZRA 4DXAB 1FHOA 2FJLA 4IFSA 3PP2A 2K00A 1QQGA 5KQ1A 3KSYA 5D3YA 4Y94A 1SHCA 1UPRA 2YS5A 5HE3A 1FHWA 1U2BA 5DHAB 5HE1A 2COFA 4A5KA 2NZ8B 1Q67A 3SO6A 1MKEA 1LB1A 2RSGA 2YT0A 1OY2A 2VKIA 3VIAA 2M38A 1BAKA 5C16A 1XKEA 3CIKA 1NI2A 3A98B 1P3RA 2J0KA 4HHVA 4MK0A 1W1GA 1X1FA 1ZVRA 4GXBA 3PEGA 3ZDTA 4HB2B 3TW1A 4K2OA 1QC6A 3KZ1A 4EKUA 1TXDA 2UVMA 2J59M 4HB4B 4GZUA 2MFQA 5DI9B 4CYEA 2CAYA 1OQNA 2YRYA 4GN1A 1LW3A 3HQCA 2EJ8A 3IVFA 2L1CA 1WJ1A 1XR0B 1Y19B 1NU2A 1PFJA 4YL8A 5DH9B 1EGXA 3QBVB 5D3VA 5KCVA 1TQZA 2H7DA 2N0YA 1E5WA 3CXBB 2X18A 2K2UA 2ROVA 2RGNB 2RUKB 3BINA 2IFSA 1KZ7A 1MIXA 1PMSA 2YSZA 2PZ1A 3D8FA 2DA0A 1U5DA 1EF1A 1BWNA 1U5EA 1AWEA 2Z0OA 1FGZA 2W2WA 2D9YA 3DXEA 2DFKA 5HE2A 4GPTB 1P6SA 4NY0A 4A6KA 4BBKA 1DDWA 2HE7A 4GMXB 5FI0A 3GYPA 2K2JA 2EC1A 4YONA 5DHFB 2YT1A 3MPXA 2JP2A 3TFMA 2RNRB 2LOXA 2EMSA 1UNRA 1DYNA 1MAIA 1WGUA 1H10A 3FEHA 3SV1A 2LG1A 1FGYA 2M14A 1MK7B 4HDOA 1XX0A 1XD4A 4NSWA 3F0WA 4K17A 4C0AA 5D27A 4CHMA 4XWXA 4HAVB 3BJIA 3OANA 4DBBA 2P0DA 1MIZB 1WG7A 3FM8C 1V5MA 2J0MA 1ZC3B 3PG7A 1X11A 1IRSA 3V5WA 2LULA 2DX1A 4K2PA 1KI1B 2COCA 2MKRA 5JHGA 4HAXB 3ODWA 3PVWA 1J19A 2G35A 4HAZB 1NTYA 1V88A 4MT7A 2N23A 2D9XA 4HAWB 3SUZA 4Z2MB 2EMTA 1RJ2A 3VOQA 1H4RA 3ODOA 4ZRIA 5C6RA 3HW2B 3PSCA 3WYFB 1W1HA 5JLJB 1ISNA 2DYNA 2D2QA 1DDMA 2P0HA 1WVHA 4KVGB 3KRXA 3SNHA 2DKQA 4ZRKA 4KAXB 2RLOA 4WJ7A 4D0NB 2DLWA 3UZTA 1V5UA 4A6FA 2W2XC 1P5TA 1I2HA 4WVFB 3MDBC 2VRWB 3ODXA 2YVCA 3U8ZA 3TO1A 5JHHA 3FSSA 4ZRJA 1K5DB 3GYOA 3T06A 2R0DA 2RVBB 3PVUA 1UPQA 5J3YA 4PNKA 2ROZB 1W1DA 1X86A 1SGHA 2D9WA 2YF0A 1X1GA 1X05A 1FOEA 2AL6A 1N3HA 3DXDA 4HB3B 3PVLA 2I1JA 2DKPA 1J0WA 3KY9A 3M1IB 1U27A 1Z87A 2J0JA 4PQ0A 3AU5A 2D11A 3ULBA 1U29A 2CY5A 2MDXA 1FB8A 1GG3A
chains in the Genus database with same CATH superfamily
1ZC4B 4Z2NA 2D9VA 1BTNA 4L1RA 4CHJA 5J3QA 2IYBA 5DIFB 4KHAA 5I2SA 2UZSA 3HK0A 2R09A 2RRFA 2XQNM 5KQ4A 2LYDA 1UNPA 1K5GB 2ELBA 1B55A 2YS1A 4A6HA 2COAA 2Z14A 3ML4A 2GS0A 4EMOA 4KHOA 2V76A 1UEFA 2LKOA 3A8PA 1WI1A 4WSFA 4QXAB 1KZGA 1MPHA 3PZDA 5LOPB 3HIEA 1ZM0A 2ADZA 2ZPYA 5CLQB 3DCXA 3TCAA 1DDVA 4GMVA 1EVHA 3O96A 4HDQA 2HTHB 3SYXA 3NSUA 4P7IA 3DXCA 1XCGA 1AQCA 2DHKA 3LJUX 3N7CA 3U7DA 4HAYB 3QWMA 4DX8A 2D10A 1M7RA 4H8SA 5LG4B 2OTXA 1EAZA 5M4YB 5C5BB 2ELAA 2YT2A 5J3TA 1U5FA 1XODA 2MWNB 2P8VA 2Q13A 2I5CA 2CODA 5GOWB 2QKLA 1DBHA 1DROA 2E2XA 2I1KA 3OHMB 1V5PA 4F7GA 4QJ3B 1V61A 2KCJA 2QKMA 4HATB 5D3WA 4B6HA 5FI1A 3TVVA 3G9WA 4QJ5B 4EJNA 1WGQA 4HAUB 1UNQA 5CLLB 1Y5OA 2GJYA 1V89A 2DYQA 1WJMA 3A8QA 2Y7BA 2Y8FA 2BCJA 2DN6A 1I7AA 2GCLA 2YS3A 1FAOA 2Y8GA 3D8DA 3P7ZA 4HB0B 3ULCA 5JP4A 2DHIA 2P0FA 2AEHA 4CSQA 5HE0A 5C79A 5L81A 5LONB 4F7UP 4TKNA 4A6FB 3NWFA 2R2YA 1FHXA 3F5RA 2Z59A 2LOZA 2Z0QA 4F7HA 2Z4DA 4IOYX 5EFXA 1NTVA 3D8EA 4TYZA 2GCJA 1MI1A 3X23A 3QIJA 2KUQA 2VSZA 1OMWA 1RRPB 4KHBB 4DIXA 1MK9B 2OQBA 1TJ6A 4L6EA 3KRWA 5D3XA 1M7EA 3ZVRA 4DX90 3NWAA 2KIGA 2DX5A 2D9ZA 2I5FA 2DHJA 3RCPA 3P6AA 3AJ4A 4IAPA 3WA0A 2KUPA 4K81A 1ZSQA 3NWDA 2W2XD 2H7EA 2DTCA 1GC6A 2ZKMX 5C5BA 2L2IA 1GC7A 1BTKA 2NMBA 2Z0PA 2KGXB 4MY6A 1PLSA 1U5GA 2CY4A 2D4QA 3AU4A 2CRFA 2UZRA 4DXAB 1FHOA 2FJLA 4IFSA 1ZYIA 3PP2A 2K00A 1QQGA 5KQ1A 3KSYA 5D3YA 4Y94A 1SHCA 1UPRA 2YS5A 4OT1A 5HE3A 1FHWA 1U2BA 5DHAB 5HE1A 2COFA 4A5KA 2NZ8B 1Q67A 3SO6A 4OSNA 1MKEA 1LB1A 2RSGA 2YT0A 1OY2A 2VKIA 3VIAA 2M38A 1BAKA 4GOUA 5C16A 1XKEA 2NBVA 3FVCA 3CIKA 1NI2A 3A98B 1P3RA 2J0KA 4HHVA 4MK0A 1W1GA 1X1FA 1ZVRA 4GXBA 3PEGA 3ZDTA 4HB2B 5IRSA 3TW1A 4K2OA 1QC6A 3KZ1A 4EKUA 1TXDA 2UVMA 2J59M 4HB4B 4GZUA 2MFQA 2Z13A 5DI9B 4CYEA 2CAYA 1OQNA 2YRYA 4GN1A 1LW3A 4KHBA 3HQCA 2EJ8A 3A58A 2K8EA 3IVFA 2KR0A 2L1CA 1WJ1A 1XR0B 1Y19B 1NU2A 1PFJA 4YL8A 5DH9B 1EGXA 3QBVB 5D3VA 5KCVA 1TQZA 2H7DA 3NW8A 4QJ4B 2N0YA 1E5WA 3CXBB 2X18A 2K2UA 2ROVA 2RGNB 2RUKB 3BINA 2IFSA 1KZ7A 1MIXA 1PMSA 2YSZA 2PZ1A 3D8FA 4D6WA 2DA0A 1U5DA 1EF1A 1BWNA 3HSAA 1U5EA 1AWEA 2Z0OA 1FGZA 2W2WA 2D9YA 3DXEA 2DFKA 5HE2A 4GPTB 1P6SA 4NY0A 4A6KA 4BBKA 1DDWA 2HE7A 4GMXB 5FI0A 3GYPA 2K2JA 2EC1A 4YONA 5DHFB 2YT1A 3MPXA 1T77A 2JP2A 3TFMA 2RNRB 2LOXA 2EMSA 1UNRA 1DYNA 1MAIA 1WGUA 1H10A 3FEHA 3SV1A 2LG1A 1FGYA 2M14A 1MK7B 4HDOA 1XX0A 1XD4A 4NSWA 3F0WA 4K17A 4C0AA 5D27A 4CHMA 4XWXA 4HAVB 3BJIA 3OANA 4DBBA 2P0DA 1MIZB 1WG7A 3FM8C 1V5MA 2J0MA 1ZC3B 3PG7A 1X11A 2GUMA 1IRSA 3V5WA 2LULA 2DX1A 4K2PA 1KI1B 2COCA 2MKRA 5JHGA 2KIEA 4HAXB 3ODWA 3PVWA 1J19A 2G35A 4HAZB 1NTYA 1V88A 4MT7A 2N23A 2D9XA 4HAWB 3SUZA 4Z2MB 3U12A 2EMTA 1RJ2A 3VOQA 3B77A 1H4RA 3ODOA 4ZRIA 5C6RA 3HW2B 3PSCA 3WYFB 1W1HA 5JLJB 1ISNA 2DYNA 2D2QA 2FJUB 5I2MA 2P0HA 1DDMA 1WVHA 4KVGB 3KRXA 3SNHA 2DKQA 4ZRKA 4KAXB 2RLOA 4WJ7A 4D0NB 2DLWA 3UZTA 1V5UA 4A6FA 2W2XC 1P5TA 1I2HA 4WVFB 3MDBC 2VRWB 3ODXA 2YVCA 3U8ZA 3TO1A 5JHHA 3FSSA 4ZRJA 1K5DB 3GYOA 3T06A 2R0DA 2RVBB 3PVUA 1UPQA 5J3YA 4PNKA 2ROZB 1W1DA 1X86A 1SGHA 2D9WA 2YF0A 1X1GA 4HSIA 1X05A 1FOEA 2AL6A 1N3HA 3DXDA 4HB3B 3PVLA 2I1JA 2DKPA 2K49A 1J0WA 3KY9A 3M1IB 1U27A 1Z87A 2J0JA 4GNKB 4PQ0A 3AU5A 2D11A 3ULBA 1U29A 2CY5A 2MDXA 1FB8A 1GG3A
chains in the Genus database with same CATH topology
1ZC4B 4Z2NA 2D9VA 1BTNA 5J3QA 4CHJA 2IYBA 5DIFB 4KHAA 2UZSA 3HK0A 2R09A 2XQNM 5KQ4A 2LYDA 1UNPA 1K5GB 2ELBA 1B55A 2YS1A 4A6HA 2COAA 3ML4A 2GS0A 4EMOA 4KHOA 2V76A 1UEFA 2LKOA 3A8PA 1WI1A 4WSFA 1KZGA 1MPHA 3PZDA 5LOPB 1ZM0A 2ADZA 2ZPYA 5CLQB 3TCAA 1DDVA 4GMVA 1EVHA 3O96A 4HDQA 2HTHB 3SYXA 3NSUA 4P7IA 3DXCA 1XCGA 1AQCA 2DHKA 3LJUX 3N7CA 3U7DA 4HAYB 3QWMA 4DX8A 2D10A 1M7RA 4H8SA 2OTXA 1EAZA 5C5BB 2ELAA 5J3TA 1U5FA 1XODA 2MWNB 2P8VA 2Q13A 2I5CA 2CODA 5GOWB 2QKLA 1DBHA 1DROA 2E2XA 2I1KA 1V5PA 4F7GA 1V61A 2KCJA 2QKMA 4HATB 5D3WA 4B6HA 5FI1A 3TVVA 3G9WA 4EJNA 1WGQA 4HAUB 1UNQA 5CLLB 1Y5OA 2GJYA 1V89A 2DYQA 1WJMA 3A8QA 2Y7BA 2Y8FA 2BCJA 2DN6A 1I7AA 2GCLA 2YS3A 1FAOA 2Y8GA 3D8DA 3P7ZA 4HB0B 3ULCA 5JP4A 2DHIA 2P0FA 2AEHA 5HE0A 5C79A 5L81A 5LONB 4F7UP 4TKNA 4A6FB 1FHXA 3F5RA 2LOZA 2Z0QA 4F7HA 4IOYX 5EFXA 1NTVA 3D8EA 4TYZA 2GCJA 3X23A 3QIJA 2VSZA 1OMWA 1RRPB 4KHBB 1MK9B 2OQBA 1TJ6A 4L6EA 3KRWA 5D3XA 1M7EA 3ZVRA 4DX90 2DX5A 2D9ZA 2I5FA 2DHJA 3RCPA 3P6AA 3AJ4A 4IAPA 3WA0A 2KUPA 4K81A 1ZSQA 2W2XD 2H7EA 2DTCA 1GC6A 5C5BA 2L2IA 1GC7A 1BTKA 2NMBA 2Z0PA 2KGXB 4MY6A 1PLSA 1U5GA 2CY4A 2D4QA 3AU4A 2CRFA 2UZRA 4DXAB 1FHOA 2FJLA 4IFSA 3PP2A 2K00A 1QQGA 5KQ1A 3KSYA 5D3YA 4Y94A 1SHCA 1UPRA 2YS5A 5HE3A 1FHWA 1U2BA 5DHAB 5HE1A 2COFA 4A5KA 2NZ8B 1Q67A 3SO6A 1MKEA 1LB1A 2RSGA 2YT0A 1OY2A 2VKIA 3VIAA 2M38A 1BAKA 5C16A 1XKEA 3CIKA 1NI2A 3A98B 1P3RA 2J0KA 4HHVA 4MK0A 1W1GA 1X1FA 1ZVRA 4GXBA 3PEGA 3ZDTA 4HB2B 3TW1A 4K2OA 1QC6A 3KZ1A 4EKUA 1TXDA 2UVMA 2J59M 4HB4B 4GZUA 2MFQA 5DI9B 4CYEA 2CAYA 1OQNA 2YRYA 4GN1A 1LW3A 3HQCA 2EJ8A 3IVFA 2L1CA 1WJ1A 1XR0B 1Y19B 1NU2A 1PFJA 4YL8A 5DH9B 1EGXA 3QBVB 5D3VA 5KCVA 1TQZA 2H7DA 2N0YA 1E5WA 3CXBB 2X18A 2K2UA 2ROVA 2RGNB 2RUKB 3BINA 2IFSA 1KZ7A 1MIXA 1PMSA 2YSZA 2PZ1A 3D8FA 2DA0A 1U5DA 1EF1A 1BWNA 1U5EA 1AWEA 2Z0OA 1FGZA 2W2WA 2D9YA 3DXEA 2DFKA 5HE2A 4GPTB 1P6SA 4NY0A 4A6KA 4BBKA 1DDWA 2HE7A 4GMXB 5FI0A 3GYPA 2K2JA 2EC1A 4YONA 5DHFB 2YT1A 3MPXA 2JP2A 3TFMA 2RNRB 2LOXA 2EMSA 1UNRA 1DYNA 1MAIA 1WGUA 1H10A 3FEHA 3SV1A 2LG1A 1FGYA 2M14A 1MK7B 4HDOA 1XX0A 1XD4A 4NSWA 3F0WA 4K17A 4C0AA 5D27A 4CHMA 4XWXA 4HAVB 3BJIA 3OANA 4DBBA 2P0DA 1MIZB 1WG7A 3FM8C 1V5MA 2J0MA 1ZC3B 3PG7A 1X11A 1IRSA 3V5WA 2LULA 2DX1A 4K2PA 1KI1B 2COCA 2MKRA 5JHGA 4HAXB 3ODWA 3PVWA 1J19A 2G35A 4HAZB 1NTYA 1V88A 4MT7A 2N23A 2D9XA 4HAWB 3SUZA 4Z2MB 2EMTA 1RJ2A 3VOQA 1H4RA 3ODOA 4ZRIA 5C6RA 3HW2B 3PSCA 3WYFB 1W1HA 5JLJB 1ISNA 2DYNA 2D2QA 1DDMA 2P0HA 1WVHA 4KVGB 3KRXA 3SNHA 2DKQA 4ZRKA 4KAXB 2RLOA 4WJ7A 4D0NB 2DLWA 3UZTA 1V5UA 4A6FA 2W2XC 1P5TA 1I2HA 4WVFB 3MDBC 2VRWB 3ODXA 2YVCA 3U8ZA 3TO1A 5JHHA 3FSSA 4ZRJA 1K5DB 3GYOA 3T06A 2R0DA 2RVBB 3PVUA 1UPQA 5J3YA 4PNKA 2ROZB 1W1DA 1X86A 1SGHA 2D9WA 2YF0A 1X1GA 1X05A 1FOEA 2AL6A 1N3HA 3DXDA 4HB3B 3PVLA 2I1JA 2DKPA 1J0WA 3KY9A 3M1IB 1U27A 1Z87A 2J0JA 4PQ0A 3AU5A 2D11A 3ULBA 1U29A 2CY5A 2MDXA 1FB8A 1GG3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZC4 B;  4Z2N A;  2D9V A;  1BTN A;  5J3Q A;  4CHJ A;  2IYB A;  5DIF B;  4KHA A;  2UZS A;  3HK0 A;  2R09 A;  2XQN M;  5KQ4 A;  2LYD A;  1UNP A;  1K5G B;  2ELB A;  1B55 A;  2YS1 A;  4A6H A;  2COA A;  3ML4 A;  2GS0 A;  4EMO A;  4KHO A;  2V76 A;  1UEF A;  2LKO A;  3A8P A;  1WI1 A;  4WSF A;  1KZG A;  1MPH A;  3PZD A;  5LOP B;  1ZM0 A;  2ADZ A;  2ZPY A;  5CLQ B;  3TCA A;  1DDV A;  4GMV A;  1EVH A;  3O96 A;  4HDQ A;  2HTH B;  3SYX A;  3NSU A;  4P7I A;  3DXC A;  1XCG A;  1AQC A;  2DHK A;  3LJU X;  3N7C A;  3U7D A;  4HAY B;  3QWM A;  4DX8 A;  2D10 A;  1M7R A;  4H8S A;  2OTX A;  1EAZ A;  5C5B B;  2ELA A;  5J3T A;  1U5F A;  1XOD A;  2MWN B;  2P8V A;  2Q13 A;  2I5C A;  2COD A;  5GOW B;  2QKL A;  1DBH A;  1DRO A;  2E2X A;  2I1K A;  1V5P A;  4F7G A;  1V61 A;  2KCJ A;  2QKM A;  4HAT B;  5D3W A;  4B6H A;  5FI1 A;  3TVV A;  3G9W A;  4EJN A;  1WGQ A;  4HAU B;  1UNQ A;  5CLL B;  1Y5O A;  2GJY A;  1V89 A;  2DYQ A;  1WJM A;  3A8Q A;  2Y7B A;  2Y8F A;  2BCJ A;  2DN6 A;  1I7A A;  2GCL A;  2YS3 A;  1FAO A;  2Y8G A;  3D8D A;  3P7Z A;  4HB0 B;  3ULC A;  5JP4 A;  2DHI A;  2P0F A;  2AEH A;  5HE0 A;  5C79 A;  5L81 A;  5LON B;  4F7U P;  4TKN A;  4A6F B;  1FHX A;  3F5R A;  2LOZ A;  2Z0Q A;  4F7H A;  4IOY X;  5EFX A;  1NTV A;  3D8E A;  4TYZ A;  2GCJ A;  3X23 A;  3QIJ A;  2VSZ A;  1OMW A;  1RRP B;  4KHB B;  1MK9 B;  2OQB A;  1TJ6 A;  4L6E A;  3KRW A;  5D3X A;  1M7E A;  3ZVR A;  4DX9 0;  2DX5 A;  2D9Z A;  2I5F A;  2DHJ A;  3RCP A;  3P6A A;  3AJ4 A;  4IAP A;  3WA0 A;  2KUP A;  4K81 A;  1ZSQ A;  2W2X D;  2H7E A;  2DTC A;  1GC6 A;  5C5B A;  2L2I A;  1GC7 A;  1BTK A;  2NMB A;  2Z0P A;  2KGX B;  4MY6 A;  1PLS A;  1U5G A;  2CY4 A;  2D4Q A;  3AU4 A;  2CRF A;  2UZR A;  4DXA B;  1FHO A;  2FJL A;  4IFS A;  3PP2 A;  2K00 A;  1QQG A;  5KQ1 A;  3KSY A;  5D3Y A;  4Y94 A;  1SHC A;  1UPR A;  2YS5 A;  5HE3 A;  1FHW A;  1U2B A;  5DHA B;  5HE1 A;  2COF A;  4A5K A;  2NZ8 B;  1Q67 A;  3SO6 A;  1MKE A;  1LB1 A;  2RSG A;  2YT0 A;  1OY2 A;  2VKI A;  3VIA A;  2M38 A;  1BAK A;  5C16 A;  1XKE A;  3CIK A;  1NI2 A;  3A98 B;  1P3R A;  2J0K A;  4HHV A;  4MK0 A;  1W1G A;  1X1F A;  1ZVR A;  4GXB A;  3PEG A;  3ZDT A;  4HB2 B;  3TW1 A;  4K2O A;  1QC6 A;  3KZ1 A;  4EKU A;  1TXD A;  2UVM A;  2J59 M;  4HB4 B;  4GZU A;  2MFQ A;  5DI9 B;  4CYE A;  2CAY A;  1OQN A;  2YRY A;  4GN1 A;  1LW3 A;  3HQC A;  2EJ8 A;  3IVF A;  2L1C A;  1WJ1 A;  1XR0 B;  1Y19 B;  1NU2 A;  1PFJ A;  4YL8 A;  5DH9 B;  1EGX A;  3QBV B;  5D3V A;  5KCV A;  1TQZ A;  2H7D A;  2N0Y A;  1E5W A;  3CXB B;  2X18 A;  2K2U A;  2ROV A;  2RGN B;  2RUK B;  3BIN A;  2IFS A;  1KZ7 A;  1MIX A;  1PMS A;  2YSZ A;  2PZ1 A;  3D8F A;  2DA0 A;  1U5D A;  1EF1 A;  1BWN A;  1U5E A;  1AWE A;  2Z0O A;  1FGZ A;  2W2W A;  2D9Y A;  3DXE A;  2DFK A;  5HE2 A;  4GPT B;  1P6S A;  4NY0 A;  4A6K A;  4BBK A;  1DDW A;  2HE7 A;  4GMX B;  5FI0 A;  3GYP A;  2K2J A;  2EC1 A;  4YON A;  5DHF B;  2YT1 A;  3MPX A;  2JP2 A;  3TFM A;  2RNR B;  2LOX A;  2EMS A;  1UNR A;  1DYN A;  1MAI A;  1WGU A;  1H10 A;  3FEH A;  3SV1 A;  2LG1 A;  1FGY A;  2M14 A;  1MK7 B;  4HDO A;  1XX0 A;  1XD4 A;  4NSW A;  3F0W A;  4K17 A;  4C0A A;  5D27 A;  4CHM A;  4XWX A;  4HAV B;  3BJI A;  3OAN A;  4DBB A;  2P0D A;  1MIZ B;  1WG7 A;  3FM8 C;  1V5M A;  2J0M A;  1ZC3 B;  3PG7 A;  1X11 A;  1IRS A;  3V5W A;  2LUL A;  2DX1 A;  4K2P A;  1KI1 B;  2COC A;  2MKR A;  5JHG A;  4HAX B;  3ODW A;  3PVW A;  1J19 A;  2G35 A;  4HAZ B;  1NTY A;  1V88 A;  4MT7 A;  2N23 A;  2D9X A;  4HAW B;  3SUZ A;  4Z2M B;  2EMT A;  1RJ2 A;  3VOQ A;  1H4R A;  3ODO A;  4ZRI A;  5C6R A;  3HW2 B;  3PSC A;  3WYF B;  1W1H A;  5JLJ B;  1ISN A;  2DYN A;  2D2Q A;  1DDM A;  2P0H A;  1WVH A;  4KVG B;  3KRX A;  3SNH A;  2DKQ A;  4ZRK A;  4KAX B;  2RLO A;  4WJ7 A;  4D0N B;  2DLW A;  3UZT A;  1V5U A;  4A6F A;  2W2X C;  1P5T A;  1I2H A;  4WVF B;  3MDB C;  2VRW B;  3ODX A;  2YVC A;  3U8Z A;  3TO1 A;  5JHH A;  3FSS A;  4ZRJ A;  1K5D B;  3GYO A;  3T06 A;  2R0D A;  2RVB B;  3PVU A;  1UPQ A;  5J3Y A;  4PNK A;  2ROZ B;  1W1D A;  1X86 A;  1SGH A;  2D9W A;  2YF0 A;  1X1G A;  1X05 A;  1FOE A;  2AL6 A;  1N3H A;  3DXD A;  4HB3 B;  3PVL A;  2I1J A;  2DKP A;  1J0W A;  3KY9 A;  3M1I B;  1U27 A;  1Z87 A;  2J0J A;  4PQ0 A;  3AU5 A;  2D11 A;  3ULB A;  1U29 A;  2CY5 A;  2MDX A;  1FB8 A;  1GG3 A; 
#chains in the Genus database with same CATH topology
 1ZC4 B;  4Z2N A;  2D9V A;  1BTN A;  4L1R A;  4CHJ A;  5J3Q A;  2IYB A;  5DIF B;  4KHA A;  5I2S A;  2UZS A;  3HK0 A;  2R09 A;  2RRF A;  2XQN M;  5KQ4 A;  2LYD A;  1UNP A;  1K5G B;  2ELB A;  1B55 A;  2YS1 A;  4A6H A;  2COA A;  2Z14 A;  3ML4 A;  2GS0 A;  4EMO A;  4KHO A;  2V76 A;  1UEF A;  2LKO A;  3A8P A;  1WI1 A;  4WSF A;  4QXA B;  1KZG A;  1MPH A;  3PZD A;  5LOP B;  3HIE A;  1ZM0 A;  2ADZ A;  2ZPY A;  5CLQ B;  3DCX A;  3TCA A;  1DDV A;  4GMV A;  1EVH A;  3O96 A;  4HDQ A;  2HTH B;  3SYX A;  3NSU A;  4P7I A;  3DXC A;  1XCG A;  1AQC A;  2DHK A;  3LJU X;  3N7C A;  3U7D A;  4HAY B;  3QWM A;  4DX8 A;  2D10 A;  1M7R A;  4H8S A;  5LG4 B;  2OTX A;  1EAZ A;  5M4Y B;  5C5B B;  2ELA A;  2YT2 A;  5J3T A;  1U5F A;  1XOD A;  2MWN B;  2P8V A;  2Q13 A;  2I5C A;  2COD A;  5GOW B;  2QKL A;  1DBH A;  1DRO A;  2E2X A;  2I1K A;  3OHM B;  1V5P A;  4F7G A;  4QJ3 B;  1V61 A;  2KCJ A;  2QKM A;  4HAT B;  5D3W A;  4B6H A;  5FI1 A;  3TVV A;  3G9W A;  4QJ5 B;  4EJN A;  1WGQ A;  4HAU B;  1UNQ A;  5CLL B;  1Y5O A;  2GJY A;  1V89 A;  2DYQ A;  1WJM A;  3A8Q A;  2Y7B A;  2Y8F A;  2BCJ A;  2DN6 A;  1I7A A;  2GCL A;  2YS3 A;  1FAO A;  2Y8G A;  3D8D A;  3P7Z A;  4HB0 B;  3ULC A;  5JP4 A;  2DHI A;  2P0F A;  2AEH A;  4CSQ A;  5HE0 A;  5C79 A;  5L81 A;  5LON B;  4F7U P;  4TKN A;  4A6F B;  3NWF A;  2R2Y A;  1FHX A;  3F5R A;  2Z59 A;  2LOZ A;  2Z0Q A;  4F7H A;  2Z4D A;  4IOY X;  5EFX A;  1NTV A;  3D8E A;  4TYZ A;  2GCJ A;  1MI1 A;  3X23 A;  3QIJ A;  2KUQ A;  2VSZ A;  1OMW A;  1RRP B;  4KHB B;  4DIX A;  1MK9 B;  2OQB A;  1TJ6 A;  4L6E A;  3KRW A;  5D3X A;  1M7E A;  3ZVR A;  4DX9 0;  3NWA A;  2KIG A;  2DX5 A;  2D9Z A;  2I5F A;  2DHJ A;  3RCP A;  3P6A A;  3AJ4 A;  4IAP A;  3WA0 A;  2KUP A;  4K81 A;  1ZSQ A;  3NWD A;  2W2X D;  2H7E A;  2DTC A;  1GC6 A;  2ZKM X;  5C5B A;  2L2I A;  1GC7 A;  1BTK A;  2NMB A;  2Z0P A;  2KGX B;  4MY6 A;  1PLS A;  1U5G A;  2CY4 A;  2D4Q A;  3AU4 A;  2CRF A;  2UZR A;  4DXA B;  1FHO A;  2FJL A;  4IFS A;  1ZYI A;  3PP2 A;  2K00 A;  1QQG A;  5KQ1 A;  3KSY A;  5D3Y A;  4Y94 A;  1SHC A;  1UPR A;  2YS5 A;  4OT1 A;  5HE3 A;  1FHW A;  1U2B A;  5DHA B;  5HE1 A;  2COF A;  4A5K A;  2NZ8 B;  1Q67 A;  3SO6 A;  4OSN A;  1MKE A;  1LB1 A;  2RSG A;  2YT0 A;  1OY2 A;  2VKI A;  3VIA A;  2M38 A;  1BAK A;  4GOU A;  5C16 A;  1XKE A;  2NBV A;  3FVC A;  3CIK A;  1NI2 A;  3A98 B;  1P3R A;  2J0K A;  4HHV A;  4MK0 A;  1W1G A;  1X1F A;  1ZVR A;  4GXB A;  3PEG A;  3ZDT A;  4HB2 B;  5IRS A;  3TW1 A;  4K2O A;  1QC6 A;  3KZ1 A;  4EKU A;  1TXD A;  2UVM A;  2J59 M;  4HB4 B;  4GZU A;  2MFQ A;  2Z13 A;  5DI9 B;  4CYE A;  2CAY A;  1OQN A;  2YRY A;  4GN1 A;  1LW3 A;  4KHB A;  3HQC A;  2EJ8 A;  3A58 A;  2K8E A;  3IVF A;  2KR0 A;  2L1C A;  1WJ1 A;  1XR0 B;  1Y19 B;  1NU2 A;  1PFJ A;  4YL8 A;  5DH9 B;  1EGX A;  3QBV B;  5D3V A;  5KCV A;  1TQZ A;  2H7D A;  3NW8 A;  4QJ4 B;  2N0Y A;  1E5W A;  3CXB B;  2X18 A;  2K2U A;  2ROV A;  2RGN B;  2RUK B;  3BIN A;  2IFS A;  1KZ7 A;  1MIX A;  1PMS A;  2YSZ A;  2PZ1 A;  3D8F A;  4D6W A;  2DA0 A;  1U5D A;  1EF1 A;  1BWN A;  3HSA A;  1U5E A;  1AWE A;  2Z0O A;  1FGZ A;  2W2W A;  2D9Y A;  3DXE A;  2DFK A;  5HE2 A;  4GPT B;  1P6S A;  4NY0 A;  4A6K A;  4BBK A;  1DDW A;  2HE7 A;  4GMX B;  5FI0 A;  3GYP A;  2K2J A;  2EC1 A;  4YON A;  5DHF B;  2YT1 A;  3MPX A;  1T77 A;  2JP2 A;  3TFM A;  2RNR B;  2LOX A;  2EMS A;  1UNR A;  1DYN A;  1MAI A;  1WGU A;  1H10 A;  3FEH A;  3SV1 A;  2LG1 A;  1FGY A;  2M14 A;  1MK7 B;  4HDO A;  1XX0 A;  1XD4 A;  4NSW A;  3F0W A;  4K17 A;  4C0A A;  5D27 A;  4CHM A;  4XWX A;  4HAV B;  3BJI A;  3OAN A;  4DBB A;  2P0D A;  1MIZ B;  1WG7 A;  3FM8 C;  1V5M A;  2J0M A;  1ZC3 B;  3PG7 A;  1X11 A;  2GUM A;  1IRS A;  3V5W A;  2LUL A;  2DX1 A;  4K2P A;  1KI1 B;  2COC A;  2MKR A;  5JHG A;  2KIE A;  4HAX B;  3ODW A;  3PVW A;  1J19 A;  2G35 A;  4HAZ B;  1NTY A;  1V88 A;  4MT7 A;  2N23 A;  2D9X A;  4HAW B;  3SUZ A;  4Z2M B;  3U12 A;  2EMT A;  1RJ2 A;  3VOQ A;  3B77 A;  1H4R A;  3ODO A;  4ZRI A;  5C6R A;  3HW2 B;  3PSC A;  3WYF B;  1W1H A;  5JLJ B;  1ISN A;  2DYN A;  2D2Q A;  2FJU B;  5I2M A;  2P0H A;  1DDM A;  1WVH A;  4KVG B;  3KRX A;  3SNH A;  2DKQ A;  4ZRK A;  4KAX B;  2RLO A;  4WJ7 A;  4D0N B;  2DLW A;  3UZT A;  1V5U A;  4A6F A;  2W2X C;  1P5T A;  1I2H A;  4WVF B;  3MDB C;  2VRW B;  3ODX A;  2YVC A;  3U8Z A;  3TO1 A;  5JHH A;  3FSS A;  4ZRJ A;  1K5D B;  3GYO A;  3T06 A;  2R0D A;  2RVB B;  3PVU A;  1UPQ A;  5J3Y A;  4PNK A;  2ROZ B;  1W1D A;  1X86 A;  1SGH A;  2D9W A;  2YF0 A;  1X1G A;  4HSI A;  1X05 A;  1FOE A;  2AL6 A;  1N3H A;  3DXD A;  4HB3 B;  3PVL A;  2I1J A;  2DKP A;  2K49 A;  1J0W A;  3KY9 A;  3M1I B;  1U27 A;  1Z87 A;  2J0J A;  4GNK B;  4PQ0 A;  3AU5 A;  2D11 A;  3ULB A;  1U29 A;  2CY5 A;  2MDX A;  1FB8 A;  1GG3 A; 
#chains in the Genus database with same CATH homology
 1ZC4 B;  4Z2N A;  2D9V A;  1BTN A;  5J3Q A;  4CHJ A;  2IYB A;  5DIF B;  4KHA A;  2UZS A;  3HK0 A;  2R09 A;  2XQN M;  5KQ4 A;  2LYD A;  1UNP A;  1K5G B;  2ELB A;  1B55 A;  2YS1 A;  4A6H A;  2COA A;  3ML4 A;  2GS0 A;  4EMO A;  4KHO A;  2V76 A;  1UEF A;  2LKO A;  3A8P A;  1WI1 A;  4WSF A;  1KZG A;  1MPH A;  3PZD A;  5LOP B;  1ZM0 A;  2ADZ A;  2ZPY A;  5CLQ B;  3TCA A;  1DDV A;  4GMV A;  1EVH A;  3O96 A;  4HDQ A;  2HTH B;  3SYX A;  3NSU A;  4P7I A;  3DXC A;  1XCG A;  1AQC A;  2DHK A;  3LJU X;  3N7C A;  3U7D A;  4HAY B;  3QWM A;  4DX8 A;  2D10 A;  1M7R A;  4H8S A;  2OTX A;  1EAZ A;  5C5B B;  2ELA A;  5J3T A;  1U5F A;  1XOD A;  2MWN B;  2P8V A;  2Q13 A;  2I5C A;  2COD A;  5GOW B;  2QKL A;  1DBH A;  1DRO A;  2E2X A;  2I1K A;  1V5P A;  4F7G A;  1V61 A;  2KCJ A;  2QKM A;  4HAT B;  5D3W A;  4B6H A;  5FI1 A;  3TVV A;  3G9W A;  4EJN A;  1WGQ A;  4HAU B;  1UNQ A;  5CLL B;  1Y5O A;  2GJY A;  1V89 A;  2DYQ A;  1WJM A;  3A8Q A;  2Y7B A;  2Y8F A;  2BCJ A;  2DN6 A;  1I7A A;  2GCL A;  2YS3 A;  1FAO A;  2Y8G A;  3D8D A;  3P7Z A;  4HB0 B;  3ULC A;  5JP4 A;  2DHI A;  2P0F A;  2AEH A;  5HE0 A;  5C79 A;  5L81 A;  5LON B;  4F7U P;  4TKN A;  4A6F B;  1FHX A;  3F5R A;  2LOZ A;  2Z0Q A;  4F7H A;  4IOY X;  5EFX A;  1NTV A;  3D8E A;  4TYZ A;  2GCJ A;  3X23 A;  3QIJ A;  2VSZ A;  1OMW A;  1RRP B;  4KHB B;  1MK9 B;  2OQB A;  1TJ6 A;  4L6E A;  3KRW A;  5D3X A;  1M7E A;  3ZVR A;  4DX9 0;  2DX5 A;  2D9Z A;  2I5F A;  2DHJ A;  3RCP A;  3P6A A;  3AJ4 A;  4IAP A;  3WA0 A;  2KUP A;  4K81 A;  1ZSQ A;  2W2X D;  2H7E A;  2DTC A;  1GC6 A;  5C5B A;  2L2I A;  1GC7 A;  1BTK A;  2NMB A;  2Z0P A;  2KGX B;  4MY6 A;  1PLS A;  1U5G A;  2CY4 A;  2D4Q A;  3AU4 A;  2CRF A;  2UZR A;  4DXA B;  1FHO A;  2FJL A;  4IFS A;  3PP2 A;  2K00 A;  1QQG A;  5KQ1 A;  3KSY A;  5D3Y A;  4Y94 A;  1SHC A;  1UPR A;  2YS5 A;  5HE3 A;  1FHW A;  1U2B A;  5DHA B;  5HE1 A;  2COF A;  4A5K A;  2NZ8 B;  1Q67 A;  3SO6 A;  1MKE A;  1LB1 A;  2RSG A;  2YT0 A;  1OY2 A;  2VKI A;  3VIA A;  2M38 A;  1BAK A;  5C16 A;  1XKE A;  3CIK A;  1NI2 A;  3A98 B;  1P3R A;  2J0K A;  4HHV A;  4MK0 A;  1W1G A;  1X1F A;  1ZVR A;  4GXB A;  3PEG A;  3ZDT A;  4HB2 B;  3TW1 A;  4K2O A;  1QC6 A;  3KZ1 A;  4EKU A;  1TXD A;  2UVM A;  2J59 M;  4HB4 B;  4GZU A;  2MFQ A;  5DI9 B;  4CYE A;  2CAY A;  1OQN A;  2YRY A;  4GN1 A;  1LW3 A;  3HQC A;  2EJ8 A;  3IVF A;  2L1C A;  1WJ1 A;  1XR0 B;  1Y19 B;  1NU2 A;  1PFJ A;  4YL8 A;  5DH9 B;  1EGX A;  3QBV B;  5D3V A;  5KCV A;  1TQZ A;  2H7D A;  2N0Y A;  1E5W A;  3CXB B;  2X18 A;  2K2U A;  2ROV A;  2RGN B;  2RUK B;  3BIN A;  2IFS A;  1KZ7 A;  1MIX A;  1PMS A;  2YSZ A;  2PZ1 A;  3D8F A;  2DA0 A;  1U5D A;  1EF1 A;  1BWN A;  1U5E A;  1AWE A;  2Z0O A;  1FGZ A;  2W2W A;  2D9Y A;  3DXE A;  2DFK A;  5HE2 A;  4GPT B;  1P6S A;  4NY0 A;  4A6K A;  4BBK A;  1DDW A;  2HE7 A;  4GMX B;  5FI0 A;  3GYP A;  2K2J A;  2EC1 A;  4YON A;  5DHF B;  2YT1 A;  3MPX A;  2JP2 A;  3TFM A;  2RNR B;  2LOX A;  2EMS A;  1UNR A;  1DYN A;  1MAI A;  1WGU A;  1H10 A;  3FEH A;  3SV1 A;  2LG1 A;  1FGY A;  2M14 A;  1MK7 B;  4HDO A;  1XX0 A;  1XD4 A;  4NSW A;  3F0W A;  4K17 A;  4C0A A;  5D27 A;  4CHM A;  4XWX A;  4HAV B;  3BJI A;  3OAN A;  4DBB A;  2P0D A;  1MIZ B;  1WG7 A;  3FM8 C;  1V5M A;  2J0M A;  1ZC3 B;  3PG7 A;  1X11 A;  1IRS A;  3V5W A;  2LUL A;  2DX1 A;  4K2P A;  1KI1 B;  2COC A;  2MKR A;  5JHG A;  4HAX B;  3ODW A;  3PVW A;  1J19 A;  2G35 A;  4HAZ B;  1NTY A;  1V88 A;  4MT7 A;  2N23 A;  2D9X A;  4HAW B;  3SUZ A;  4Z2M B;  2EMT A;  1RJ2 A;  3VOQ A;  1H4R A;  3ODO A;  4ZRI A;  5C6R A;  3HW2 B;  3PSC A;  3WYF B;  1W1H A;  5JLJ B;  1ISN A;  2DYN A;  2D2Q A;  1DDM A;  2P0H A;  1WVH A;  4KVG B;  3KRX A;  3SNH A;  2DKQ A;  4ZRK A;  4KAX B;  2RLO A;  4WJ7 A;  4D0N B;  2DLW A;  3UZT A;  1V5U A;  4A6F A;  2W2X C;  1P5T A;  1I2H A;  4WVF B;  3MDB C;  2VRW B;  3ODX A;  2YVC A;  3U8Z A;  3TO1 A;  5JHH A;  3FSS A;  4ZRJ A;  1K5D B;  3GYO A;  3T06 A;  2R0D A;  2RVB B;  3PVU A;  1UPQ A;  5J3Y A;  4PNK A;  2ROZ B;  1W1D A;  1X86 A;  1SGH A;  2D9W A;  2YF0 A;  1X1G A;  1X05 A;  1FOE A;  2AL6 A;  1N3H A;  3DXD A;  4HB3 B;  3PVL A;  2I1J A;  2DKP A;  1J0W A;  3KY9 A;  3M1I B;  1U27 A;  1Z87 A;  2J0J A;  4PQ0 A;  3AU5 A;  2D11 A;  3ULB A;  1U29 A;  2CY5 A;  2MDX A;  1FB8 A;  1GG3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...