2Z0PA

Crystal structure of ph domain of bruton's tyrosine kinase
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
167
structure length
158
Chain Sequence
b'AAVILESIFLKRSQQKKKTSPLNFKKRLFLLTVHKLSYYEYDFERGRRGSKKGSIDVEKITCVETVVPEKNPPPERQIMEQISIIERFPYPFQVVYDEGPLYVFSPTEELRKRWIHQLKNVIRYNSDLVQKYHPCFWIDGQYLCCSQTAKNAMGCQIL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tyrosine-protein kinase BTK
publication title Crystal structure of the Bruton's tyrosine kinase PH domain with phosphatidylinositol
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 34
structure length 158
sequence length 167
chains with identical sequence B, C, D
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2007-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
A PF00779 BTK BTK motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2z0pA00
2M14A 1WJ1A 4MT7A 3O96A 2CY5A 4HB0B 1DBHA 1EVHA 3ULCA 3PG7A 1ZM0A 2V76A 2D2QA 4CYEA 3KSYA 2GS0A 4WSFA 1DDVA 2NZ8B 2DYNA 2CY4A 2D9YA 3AJ4A 2YRYA 3BJIA 5D3XA 3F0WA 3CXBB 4PNKA 2LOXA 2UVMA 1KZ7A 2CODA 2DHKA 1J19A 2L2IA 2YS3A 2MDXA 1X1GA 1V5UA 1XX0A 2DKQA 1V88A 4CHJA 2ELAA 4F7UP 1ZVRA 3ULBA 1SGHA 1E5WA 1P5TA 2DX5A 1PMSA 1FGZA 1DROA 1Y19B 5HE0A 1P3RA 3KY9A 2ROZB 5D27A 3HQCA 4KAXB 2COAA 2G35A 1V89A 1W1DA 5C16A 1EGXA 2QKLA 2W2XD 1XKEA 2D9XA 1Z87A 2GCJA 1BTNA 3D8FA 3PZDA 3SUZA 4HB2B 1UNRA 3T06A 1BTKA 1NU2A 4DX90 4Z2MB 5JLJB 4A6FA 1U27A 1X86A 4KHAA 2LG1A 1B55A 3PVLA 2HTHB 1SHCA 1U5FA 1I7AA 3QWMA 1FHXA 1EF1A 2YF0A 2MFQA 1DYNA 5KQ1A 2Z0PA 2Z0QA 4NY0A 3PVUA 1M7EA 4HB3B 2VRWB 3ODXA 2IYBA 1Q67A 2K00A 1K5GB 2DHJA 1U5GA 3MDBC 4A5KA 4HAWB 1XCGA 4F7HA 3M1IB 4MK0A 2DLWA 4HAVB 1GC7A 5D3WA 2Y8GA 2K2JA 3HW2B 5LOPB 1WG7A 3P6AA 2ZPYA 3TW1A 5JP4A 3ODOA 3WA0A 1U29A 5C79A 3WYFB 2DA0A 2R0DA 4A6HA 1GG3A 2RLOA 5JHHA 5C6RA 3ODWA 5J3QA 1N3HA 3CIKA 4BBKA 4DX8A 2VSZA 4TKNA 4B6HA 3TFMA 4GPTB 2FJLA 3QIJA 2XQNM 2YSZA 1TXDA 3PP2A 5FI0A 4A6FB 2P0HA 3D8EA 4Z2NA 1AWEA 4TYZA 3D8DA 4KVGB 2D9VA 2K2UA 4HDQA 3DXDA 1UPQA 2DTCA 1ISNA 4IFSA 3P7ZA 5KQ4A 3A8PA 2YT0A 1PFJA 2CAYA 1H10A 1Y5OA 1RRPB 2M38A 1V5MA 2P0FA 1MPHA 2EJ8A 4GXBA 3SV1A 1WGUA 1H4RA 3SNHA 4IOYX 1U5DA 2H7DA 5C5BB 1MIZB 3U8ZA 2J0KA 4WVFB 5DHAB 3UZTA 4HAYB 2QKMA 4GZUA 4GN1A 3MPXA 2RNRB 3KRXA 1WVHA 2D10A 2KCJA 3A8QA 2EC1A 2Z0OA 3PEGA 2KUPA 2R09A 1FAOA 2GCLA 3SO6A 3DXCA 4ZRJA 2DHIA 2EMTA 5J3TA 1BAKA 1WJMA 2L1CA 1WI1A 2AL6A 2COFA 2I5FA 2RGNB 5FI1A 4KHOA 2UZSA 2D9WA 1MK9B 2CRFA 4MY6A 3PVWA 3KZ1A 2GJYA 1MK7B 2BCJA 3RCPA 2P8VA 1QC6A 2D4QA 2J59M 4H8SA 2JP2A 3QBVB 3FM8C 1OY2A 1EAZA 1V5PA 1FHWA 2I1KA 2J0JA 2Y8FA 2COCA 1UEFA 1KZGA 4DBBA 5DHFB 1X05A 2HE7A 2YT1A 2RSGA 1W1HA 3GYOA 2D11A 4HB4B 5HE2A 1LW3A 2KGXB 3SYXA 1ZC4B 2LULA 2ROVA 4GMVA 3F5RA 3VIAA 2YVCA 4HAXB 2P0DA 1BWNA 1UPRA 5DI9B 2VKIA 4EMOA 3AU5A 2OQBA 1OMWA 4HDOA 2D9ZA 4YONA 4PQ0A 4L6EA 4NSWA 1DDMA 1GC6A 1MKEA 4K81A 2DX1A 2LKOA 2N23A 3TO1A 2PZ1A 1QQGA 5EFXA 1J0WA 1PLSA 2E2XA 1RJ2A 1U5EA 1NTVA 2I1JA 3TCAA 4C0AA 1K5DB 1NTYA 4HAUB 4GMXB 1UNQA 3FEHA 4WJ7A 1XR0B 2ADZA 3FSSA 5HE3A 2OTXA 4CHMA 3N7CA 2DKPA 4HATB 4EKUA 3HK0A 2LYDA 2YS1A 4EJNA 1MAIA 2J0MA 5CLQB 3PSCA 4P7IA 5CLLB 2DYQA 3IVFA 2MKRA 1MIXA 5JHGA 4D0NB 3AU4A 5J3YA 1KI1B 2YS5A 1XD4A 3TVVA 1ZSQA 2DN6A 1FOEA 1TJ6A 1NI2A 4K2PA 1ZC3B 4Y94A 2ELBA 3G9WA 5HE1A 3U7DA 2LOZA 1I2HA 3DXEA 5GOWB 2W2WA 4DXAB 2IFSA 4KHBB 2I5CA 2DFKA 1X1FA 1FGYA 4XWXA 3OANA 4K17A 4F7GA 2N0YA 1UNPA 2MWNB 3KRWA 1TQZA 2NMBA 1FHOA 1AQCA 5D3VA 4YL8A 3ZDTA 2Q13A 5KCVA 4A6KA 3X23A 3ZVRA 2H7EA 1XODA 3V5WA 4ZRKA 5D3YA 1M7RA 3A98B 1WGQA 1FB8A 1LB1A 1P6SA 1W1GA 1V61A 4K2OA 1IRSA 4ZRIA 2RVBB 1U2BA 1DDWA 3VOQA 5C5BA 5L81A 3BINA 3NSUA 5DH9B 5LONB 2AEHA 2EMSA 1X11A 4IAPA 4HAZB 2W2XC 2UZRA 2Y7BA 2X18A 3ML4A 3LJUX 5DIFB 3GYPA 2RUKB 1OQNA 4HHVA
chains in the Genus database with same CATH superfamily
2M14A 1WJ1A 4MT7A 2NBVA 3O96A 2CY5A 4HB0B 1DBHA 1EVHA 3ULCA 3PG7A 1ZM0A 2V76A 2D2QA 4CYEA 3KSYA 2GS0A 4WSFA 1DDVA 2NZ8B 2DYNA 2CY4A 2D9YA 3NWAA 3AJ4A 2YRYA 2GUMA 2KIEA 3BJIA 5D3XA 3F0WA 3CXBB 4GNKB 4PNKA 2LOXA 2UVMA 1KZ7A 2CODA 2DHKA 1J19A 2L2IA 2YS3A 2MDXA 1X1GA 1V5UA 1XX0A 2Z4DA 2DKQA 1V88A 4CHJA 2ELAA 4F7UP 1ZVRA 3ULBA 1SGHA 1E5WA 1P5TA 2DX5A 3A58A 1PMSA 1FGZA 1DROA 1Y19B 5HE0A 1P3RA 3KY9A 2ROZB 5D27A 3HQCA 4KAXB 4D6WA 2COAA 2G35A 1V89A 1W1DA 5C16A 1EGXA 2QKLA 2W2XD 1XKEA 2D9XA 1Z87A 2GCJA 1BTNA 3D8FA 3PZDA 3SUZA 4HB2B 1UNRA 3T06A 1BTKA 1NU2A 4DX90 4Z2MB 5JLJB 4A6FA 1U27A 4CSQA 1X86A 4KHAA 2LG1A 1B55A 3PVLA 2HTHB 1SHCA 3HIEA 1U5FA 1I7AA 3QWMA 3OHMB 1FHXA 1EF1A 2YF0A 2MFQA 1DYNA 5KQ1A 2Z0PA 2Z0QA 4NY0A 3PVUA 1M7EA 4HB3B 2VRWB 2IYBA 3ODXA 1Q67A 2K00A 1K5GB 4OSNA 2DHJA 1U5GA 3MDBC 4A5KA 4HAWB 1XCGA 4F7HA 3M1IB 4MK0A 2DLWA 4HAVB 1GC7A 3HSAA 5D3WA 2RRFA 2Y8GA 2K2JA 3HW2B 5LOPB 1WG7A 3P6AA 2ZPYA 3B77A 3TW1A 5JP4A 3ODOA 3WA0A 2K8EA 5I2MA 1U29A 5C79A 3WYFB 2DA0A 2R2YA 2R0DA 4A6HA 1GG3A 2ZKMX 2K49A 2RLOA 5JHHA 5C6RA 3ODWA 5J3QA 1N3HA 3CIKA 4BBKA 4DX8A 2VSZA 4TKNA 4B6HA 3TFMA 4GPTB 2Z13A 2FJLA 3QIJA 2XQNM 2YSZA 1TXDA 3PP2A 5FI0A 4A6FB 2P0HA 3D8EA 4Z2NA 1AWEA 3NWFA 4TYZA 3D8DA 4KVGB 2D9VA 2K2UA 4HDQA 3DXDA 1UPQA 2DTCA 1ISNA 4IFSA 3P7ZA 5KQ4A 3A8PA 2YT0A 1PFJA 2CAYA 1H10A 1Y5OA 1MI1A 1RRPB 2M38A 1V5MA 2P0FA 1MPHA 2EJ8A 4GXBA 3SV1A 1WGUA 1H4RA 4L1RA 3SNHA 4IOYX 2KR0A 1U5DA 2H7DA 5C5BB 5I2SA 1MIZB 4DIXA 2Z59A 3U8ZA 2J0KA 4WVFB 5DHAB 3UZTA 4HAYB 2QKMA 4GZUA 2FJUB 4GN1A 3MPXA 2RNRB 3KRXA 1WVHA 2D10A 2KCJA 3A8QA 2EC1A 1ZYIA 2Z0OA 3PEGA 2KUPA 2R09A 1FAOA 2GCLA 3SO6A 3DXCA 4ZRJA 2DHIA 2EMTA 5J3TA 1BAKA 1WJMA 2L1CA 1WI1A 2AL6A 2COFA 2I5FA 2RGNB 5FI1A 4KHOA 4OT1A 2UZSA 2D9WA 1MK9B 5M4YB 2CRFA 4MY6A 3PVWA 3U12A 5IRSA 3KZ1A 2GJYA 1MK7B 2BCJA 3RCPA 2P8VA 1QC6A 2D4QA 2J59M 2KIGA 4H8SA 2JP2A 3QBVB 3FM8C 1OY2A 1EAZA 1V5PA 3DCXA 1FHWA 2I1KA 2J0JA 2Y8FA 2COCA 1UEFA 1KZGA 4DBBA 5DHFB 1X05A 2HE7A 2YT1A 2RSGA 1W1HA 3GYOA 2D11A 4HB4B 5HE2A 1LW3A 2KGXB 3SYXA 1ZC4B 2LULA 2ROVA 4GMVA 3F5RA 3VIAA 2YVCA 4HAXB 2P0DA 1BWNA 1UPRA 5DI9B 2VKIA 4KHBA 4HSIA 4EMOA 3AU5A 2OQBA 1OMWA 4HDOA 2D9ZA 4YONA 4PQ0A 4L6EA 4NSWA 4QJ5B 1DDMA 1GC6A 1MKEA 4K81A 2DX1A 2LKOA 2KUQA 2N23A 3TO1A 2PZ1A 4QJ3B 1QQGA 5EFXA 1J0WA 1PLSA 2E2XA 1RJ2A 1U5EA 1NTVA 2I1JA 3TCAA 4C0AA 1K5DB 1NTYA 4HAUB 4GMXB 4QXAB 1UNQA 3FEHA 4WJ7A 1XR0B 2ADZA 3FSSA 5HE3A 5LG4B 2OTXA 4CHMA 3N7CA 2DKPA 4HATB 4EKUA 3HK0A 2LYDA 2YS1A 4EJNA 1MAIA 2J0MA 5CLQB 3PSCA 4P7IA 5CLLB 2DYQA 3IVFA 2MKRA 1MIXA 5JHGA 1T77A 4D0NB 3AU4A 3NWDA 5J3YA 1KI1B 4GOUA 2YS5A 1XD4A 3TVVA 1ZSQA 2DN6A 1FOEA 2YT2A 1TJ6A 3NW8A 1NI2A 4K2PA 1ZC3B 4Y94A 2ELBA 3G9WA 5HE1A 3U7DA 2LOZA 1I2HA 3DXEA 5GOWB 2W2WA 4DXAB 2IFSA 4KHBB 2I5CA 3FVCA 2DFKA 1X1FA 1FGYA 4XWXA 3OANA 4K17A 4F7GA 2N0YA 1UNPA 2MWNB 3KRWA 1TQZA 2NMBA 1FHOA 1AQCA 5D3VA 4YL8A 3ZDTA 2Q13A 5KCVA 4A6KA 2Z14A 3X23A 3ZVRA 2H7EA 1XODA 3V5WA 4ZRKA 5D3YA 1M7RA 3A98B 1WGQA 1FB8A 1LB1A 1P6SA 1W1GA 1V61A 4K2OA 1IRSA 4ZRIA 2RVBB 1U2BA 1DDWA 3VOQA 5C5BA 5L81A 3BINA 3NSUA 5DH9B 5LONB 2AEHA 2EMSA 1X11A 4IAPA 4HAZB 4QJ4B 2W2XC 2UZRA 2Y7BA 2X18A 3ML4A 3LJUX 5DIFB 3GYPA 2RUKB 1OQNA 4HHVA
chains in the Genus database with same CATH topology
2M14A 1WJ1A 4MT7A 3O96A 2CY5A 4HB0B 1DBHA 1EVHA 3ULCA 3PG7A 1ZM0A 2V76A 2D2QA 4CYEA 3KSYA 2GS0A 4WSFA 1DDVA 2NZ8B 2DYNA 2CY4A 2D9YA 3AJ4A 2YRYA 3BJIA 5D3XA 3F0WA 3CXBB 4PNKA 2LOXA 2UVMA 1KZ7A 2CODA 2DHKA 1J19A 2L2IA 2YS3A 2MDXA 1X1GA 1V5UA 1XX0A 2DKQA 1V88A 4CHJA 2ELAA 4F7UP 1ZVRA 3ULBA 1SGHA 1E5WA 1P5TA 2DX5A 1PMSA 1FGZA 1DROA 1Y19B 5HE0A 1P3RA 3KY9A 2ROZB 5D27A 3HQCA 4KAXB 2COAA 2G35A 1V89A 1W1DA 5C16A 1EGXA 2QKLA 2W2XD 1XKEA 2D9XA 1Z87A 2GCJA 1BTNA 3D8FA 3PZDA 3SUZA 4HB2B 1UNRA 3T06A 1BTKA 1NU2A 4DX90 4Z2MB 5JLJB 4A6FA 1U27A 1X86A 4KHAA 2LG1A 1B55A 3PVLA 2HTHB 1SHCA 1U5FA 1I7AA 3QWMA 1FHXA 1EF1A 2YF0A 2MFQA 1DYNA 5KQ1A 2Z0PA 2Z0QA 4NY0A 3PVUA 1M7EA 4HB3B 2VRWB 3ODXA 2IYBA 1Q67A 2K00A 1K5GB 2DHJA 1U5GA 3MDBC 4A5KA 4HAWB 1XCGA 4F7HA 3M1IB 4MK0A 2DLWA 4HAVB 1GC7A 5D3WA 2Y8GA 2K2JA 3HW2B 5LOPB 1WG7A 3P6AA 2ZPYA 3TW1A 5JP4A 3ODOA 3WA0A 1U29A 5C79A 3WYFB 2DA0A 2R0DA 4A6HA 1GG3A 2RLOA 5JHHA 5C6RA 3ODWA 5J3QA 1N3HA 3CIKA 4BBKA 4DX8A 2VSZA 4TKNA 4B6HA 3TFMA 4GPTB 2FJLA 3QIJA 2XQNM 2YSZA 1TXDA 3PP2A 5FI0A 4A6FB 2P0HA 3D8EA 4Z2NA 1AWEA 4TYZA 3D8DA 4KVGB 2D9VA 2K2UA 4HDQA 3DXDA 1UPQA 2DTCA 1ISNA 4IFSA 3P7ZA 5KQ4A 3A8PA 2YT0A 1PFJA 2CAYA 1H10A 1Y5OA 1RRPB 2M38A 1V5MA 2P0FA 1MPHA 2EJ8A 4GXBA 3SV1A 1WGUA 1H4RA 3SNHA 4IOYX 1U5DA 2H7DA 5C5BB 1MIZB 3U8ZA 2J0KA 4WVFB 5DHAB 3UZTA 4HAYB 2QKMA 4GZUA 4GN1A 3MPXA 2RNRB 3KRXA 1WVHA 2D10A 2KCJA 3A8QA 2EC1A 2Z0OA 3PEGA 2KUPA 2R09A 1FAOA 2GCLA 3SO6A 3DXCA 4ZRJA 2DHIA 2EMTA 5J3TA 1BAKA 1WJMA 2L1CA 1WI1A 2AL6A 2COFA 2I5FA 2RGNB 5FI1A 4KHOA 2UZSA 2D9WA 1MK9B 2CRFA 4MY6A 3PVWA 3KZ1A 2GJYA 1MK7B 2BCJA 3RCPA 2P8VA 1QC6A 2D4QA 2J59M 4H8SA 2JP2A 3QBVB 3FM8C 1OY2A 1EAZA 1V5PA 1FHWA 2I1KA 2J0JA 2Y8FA 2COCA 1UEFA 1KZGA 4DBBA 5DHFB 1X05A 2HE7A 2YT1A 2RSGA 1W1HA 3GYOA 2D11A 4HB4B 5HE2A 1LW3A 2KGXB 3SYXA 1ZC4B 2LULA 2ROVA 4GMVA 3F5RA 3VIAA 2YVCA 4HAXB 2P0DA 1BWNA 1UPRA 5DI9B 2VKIA 4EMOA 3AU5A 2OQBA 1OMWA 4HDOA 2D9ZA 4YONA 4PQ0A 4L6EA 4NSWA 1DDMA 1GC6A 1MKEA 4K81A 2DX1A 2LKOA 2N23A 3TO1A 2PZ1A 1QQGA 5EFXA 1J0WA 1PLSA 2E2XA 1RJ2A 1U5EA 1NTVA 2I1JA 3TCAA 4C0AA 1K5DB 1NTYA 4HAUB 4GMXB 1UNQA 3FEHA 4WJ7A 1XR0B 2ADZA 3FSSA 5HE3A 2OTXA 4CHMA 3N7CA 2DKPA 4HATB 4EKUA 3HK0A 2LYDA 2YS1A 4EJNA 1MAIA 2J0MA 5CLQB 3PSCA 4P7IA 5CLLB 2DYQA 3IVFA 2MKRA 1MIXA 5JHGA 4D0NB 3AU4A 5J3YA 1KI1B 2YS5A 1XD4A 3TVVA 1ZSQA 2DN6A 1FOEA 1TJ6A 1NI2A 4K2PA 1ZC3B 4Y94A 2ELBA 3G9WA 5HE1A 3U7DA 2LOZA 1I2HA 3DXEA 5GOWB 2W2WA 4DXAB 2IFSA 4KHBB 2I5CA 2DFKA 1X1FA 1FGYA 4XWXA 3OANA 4K17A 4F7GA 2N0YA 1UNPA 2MWNB 3KRWA 1TQZA 2NMBA 1FHOA 1AQCA 5D3VA 4YL8A 3ZDTA 2Q13A 5KCVA 4A6KA 3X23A 3ZVRA 2H7EA 1XODA 3V5WA 4ZRKA 5D3YA 1M7RA 3A98B 1WGQA 1FB8A 1LB1A 1P6SA 1W1GA 1V61A 4K2OA 1IRSA 4ZRIA 2RVBB 1U2BA 1DDWA 3VOQA 5C5BA 5L81A 3BINA 3NSUA 5DH9B 5LONB 2AEHA 2EMSA 1X11A 4IAPA 4HAZB 2W2XC 2UZRA 2Y7BA 2X18A 3ML4A 3LJUX 5DIFB 3GYPA 2RUKB 1OQNA 4HHVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M14 A;  1WJ1 A;  4MT7 A;  3O96 A;  2CY5 A;  4HB0 B;  1DBH A;  1EVH A;  3ULC A;  3PG7 A;  1ZM0 A;  2V76 A;  2D2Q A;  4CYE A;  3KSY A;  2GS0 A;  4WSF A;  1DDV A;  2NZ8 B;  2DYN A;  2CY4 A;  2D9Y A;  3AJ4 A;  2YRY A;  3BJI A;  5D3X A;  3F0W A;  3CXB B;  4PNK A;  2LOX A;  2UVM A;  1KZ7 A;  2COD A;  2DHK A;  1J19 A;  2L2I A;  2YS3 A;  2MDX A;  1X1G A;  1V5U A;  1XX0 A;  2DKQ A;  1V88 A;  4CHJ A;  2ELA A;  4F7U P;  1ZVR A;  3ULB A;  1SGH A;  1E5W A;  1P5T A;  2DX5 A;  1PMS A;  1FGZ A;  1DRO A;  1Y19 B;  5HE0 A;  1P3R A;  3KY9 A;  2ROZ B;  5D27 A;  3HQC A;  4KAX B;  2COA A;  2G35 A;  1V89 A;  1W1D A;  5C16 A;  1EGX A;  2QKL A;  2W2X D;  1XKE A;  2D9X A;  1Z87 A;  2GCJ A;  1BTN A;  3D8F A;  3PZD A;  3SUZ A;  4HB2 B;  1UNR A;  3T06 A;  1BTK A;  1NU2 A;  4DX9 0;  4Z2M B;  5JLJ B;  4A6F A;  1U27 A;  1X86 A;  4KHA A;  2LG1 A;  1B55 A;  3PVL A;  2HTH B;  1SHC A;  1U5F A;  1I7A A;  3QWM A;  1FHX A;  1EF1 A;  2YF0 A;  2MFQ A;  1DYN A;  5KQ1 A;  2Z0P A;  2Z0Q A;  4NY0 A;  3PVU A;  1M7E A;  4HB3 B;  2VRW B;  3ODX A;  2IYB A;  1Q67 A;  2K00 A;  1K5G B;  2DHJ A;  1U5G A;  3MDB C;  4A5K A;  4HAW B;  1XCG A;  4F7H A;  3M1I B;  4MK0 A;  2DLW A;  4HAV B;  1GC7 A;  5D3W A;  2Y8G A;  2K2J A;  3HW2 B;  5LOP B;  1WG7 A;  3P6A A;  2ZPY A;  3TW1 A;  5JP4 A;  3ODO A;  3WA0 A;  1U29 A;  5C79 A;  3WYF B;  2DA0 A;  2R0D A;  4A6H A;  1GG3 A;  2RLO A;  5JHH A;  5C6R A;  3ODW A;  5J3Q A;  1N3H A;  3CIK A;  4BBK A;  4DX8 A;  2VSZ A;  4TKN A;  4B6H A;  3TFM A;  4GPT B;  2FJL A;  3QIJ A;  2XQN M;  2YSZ A;  1TXD A;  3PP2 A;  5FI0 A;  4A6F B;  2P0H A;  3D8E A;  4Z2N A;  1AWE A;  4TYZ A;  3D8D A;  4KVG B;  2D9V A;  2K2U A;  4HDQ A;  3DXD A;  1UPQ A;  2DTC A;  1ISN A;  4IFS A;  3P7Z A;  5KQ4 A;  3A8P A;  2YT0 A;  1PFJ A;  2CAY A;  1H10 A;  1Y5O A;  1RRP B;  2M38 A;  1V5M A;  2P0F A;  1MPH A;  2EJ8 A;  4GXB A;  3SV1 A;  1WGU A;  1H4R A;  3SNH A;  4IOY X;  1U5D A;  2H7D A;  5C5B B;  1MIZ B;  3U8Z A;  2J0K A;  4WVF B;  5DHA B;  3UZT A;  4HAY B;  2QKM A;  4GZU A;  4GN1 A;  3MPX A;  2RNR B;  3KRX A;  1WVH A;  2D10 A;  2KCJ A;  3A8Q A;  2EC1 A;  2Z0O A;  3PEG A;  2KUP A;  2R09 A;  1FAO A;  2GCL A;  3SO6 A;  3DXC A;  4ZRJ A;  2DHI A;  2EMT A;  5J3T A;  1BAK A;  1WJM A;  2L1C A;  1WI1 A;  2AL6 A;  2COF A;  2I5F A;  2RGN B;  5FI1 A;  4KHO A;  2UZS A;  2D9W A;  1MK9 B;  2CRF A;  4MY6 A;  3PVW A;  3KZ1 A;  2GJY A;  1MK7 B;  2BCJ A;  3RCP A;  2P8V A;  1QC6 A;  2D4Q A;  2J59 M;  4H8S A;  2JP2 A;  3QBV B;  3FM8 C;  1OY2 A;  1EAZ A;  1V5P A;  1FHW A;  2I1K A;  2J0J A;  2Y8F A;  2COC A;  1UEF A;  1KZG A;  4DBB A;  5DHF B;  1X05 A;  2HE7 A;  2YT1 A;  2RSG A;  1W1H A;  3GYO A;  2D11 A;  4HB4 B;  5HE2 A;  1LW3 A;  2KGX B;  3SYX A;  1ZC4 B;  2LUL A;  2ROV A;  4GMV A;  3F5R A;  3VIA A;  2YVC A;  4HAX B;  2P0D A;  1BWN A;  1UPR A;  5DI9 B;  2VKI A;  4EMO A;  3AU5 A;  2OQB A;  1OMW A;  4HDO A;  2D9Z A;  4YON A;  4PQ0 A;  4L6E A;  4NSW A;  1DDM A;  1GC6 A;  1MKE A;  4K81 A;  2DX1 A;  2LKO A;  2N23 A;  3TO1 A;  2PZ1 A;  1QQG A;  5EFX A;  1J0W A;  1PLS A;  2E2X A;  1RJ2 A;  1U5E A;  1NTV A;  2I1J A;  3TCA A;  4C0A A;  1K5D B;  1NTY A;  4HAU B;  4GMX B;  1UNQ A;  3FEH A;  4WJ7 A;  1XR0 B;  2ADZ A;  3FSS A;  5HE3 A;  2OTX A;  4CHM A;  3N7C A;  2DKP A;  4HAT B;  4EKU A;  3HK0 A;  2LYD A;  2YS1 A;  4EJN A;  1MAI A;  2J0M A;  5CLQ B;  3PSC A;  4P7I A;  5CLL B;  2DYQ A;  3IVF A;  2MKR A;  1MIX A;  5JHG A;  4D0N B;  3AU4 A;  5J3Y A;  1KI1 B;  2YS5 A;  1XD4 A;  3TVV A;  1ZSQ A;  2DN6 A;  1FOE A;  1TJ6 A;  1NI2 A;  4K2P A;  1ZC3 B;  4Y94 A;  2ELB A;  3G9W A;  5HE1 A;  3U7D A;  2LOZ A;  1I2H A;  3DXE A;  5GOW B;  2W2W A;  4DXA B;  2IFS A;  4KHB B;  2I5C A;  2DFK A;  1X1F A;  1FGY A;  4XWX A;  3OAN A;  4K17 A;  4F7G A;  2N0Y A;  1UNP A;  2MWN B;  3KRW A;  1TQZ A;  2NMB A;  1FHO A;  1AQC A;  5D3V A;  4YL8 A;  3ZDT A;  2Q13 A;  5KCV A;  4A6K A;  3X23 A;  3ZVR A;  2H7E A;  1XOD A;  3V5W A;  4ZRK A;  5D3Y A;  1M7R A;  3A98 B;  1WGQ A;  1FB8 A;  1LB1 A;  1P6S A;  1W1G A;  1V61 A;  4K2O A;  1IRS A;  4ZRI A;  2RVB B;  1U2B A;  1DDW A;  3VOQ A;  5C5B A;  5L81 A;  3BIN A;  3NSU A;  5DH9 B;  5LON B;  2AEH A;  2EMS A;  1X11 A;  4IAP A;  4HAZ B;  2W2X C;  2UZR A;  2Y7B A;  2X18 A;  3ML4 A;  3LJU X;  5DIF B;  3GYP A;  2RUK B;  1OQN A;  4HHV A; 
#chains in the Genus database with same CATH topology
 2M14 A;  1WJ1 A;  4MT7 A;  2NBV A;  3O96 A;  2CY5 A;  4HB0 B;  1DBH A;  1EVH A;  3ULC A;  3PG7 A;  1ZM0 A;  2V76 A;  2D2Q A;  4CYE A;  3KSY A;  2GS0 A;  4WSF A;  1DDV A;  2NZ8 B;  2DYN A;  2CY4 A;  2D9Y A;  3NWA A;  3AJ4 A;  2YRY A;  2GUM A;  2KIE A;  3BJI A;  5D3X A;  3F0W A;  3CXB B;  4GNK B;  4PNK A;  2LOX A;  2UVM A;  1KZ7 A;  2COD A;  2DHK A;  1J19 A;  2L2I A;  2YS3 A;  2MDX A;  1X1G A;  1V5U A;  1XX0 A;  2Z4D A;  2DKQ A;  1V88 A;  4CHJ A;  2ELA A;  4F7U P;  1ZVR A;  3ULB A;  1SGH A;  1E5W A;  1P5T A;  2DX5 A;  3A58 A;  1PMS A;  1FGZ A;  1DRO A;  1Y19 B;  5HE0 A;  1P3R A;  3KY9 A;  2ROZ B;  5D27 A;  3HQC A;  4KAX B;  4D6W A;  2COA A;  2G35 A;  1V89 A;  1W1D A;  5C16 A;  1EGX A;  2QKL A;  2W2X D;  1XKE A;  2D9X A;  1Z87 A;  2GCJ A;  1BTN A;  3D8F A;  3PZD A;  3SUZ A;  4HB2 B;  1UNR A;  3T06 A;  1BTK A;  1NU2 A;  4DX9 0;  4Z2M B;  5JLJ B;  4A6F A;  1U27 A;  4CSQ A;  1X86 A;  4KHA A;  2LG1 A;  1B55 A;  3PVL A;  2HTH B;  1SHC A;  3HIE A;  1U5F A;  1I7A A;  3QWM A;  3OHM B;  1FHX A;  1EF1 A;  2YF0 A;  2MFQ A;  1DYN A;  5KQ1 A;  2Z0P A;  2Z0Q A;  4NY0 A;  3PVU A;  1M7E A;  4HB3 B;  2VRW B;  2IYB A;  3ODX A;  1Q67 A;  2K00 A;  1K5G B;  4OSN A;  2DHJ A;  1U5G A;  3MDB C;  4A5K A;  4HAW B;  1XCG A;  4F7H A;  3M1I B;  4MK0 A;  2DLW A;  4HAV B;  1GC7 A;  3HSA A;  5D3W A;  2RRF A;  2Y8G A;  2K2J A;  3HW2 B;  5LOP B;  1WG7 A;  3P6A A;  2ZPY A;  3B77 A;  3TW1 A;  5JP4 A;  3ODO A;  3WA0 A;  2K8E A;  5I2M A;  1U29 A;  5C79 A;  3WYF B;  2DA0 A;  2R2Y A;  2R0D A;  4A6H A;  1GG3 A;  2ZKM X;  2K49 A;  2RLO A;  5JHH A;  5C6R A;  3ODW A;  5J3Q A;  1N3H A;  3CIK A;  4BBK A;  4DX8 A;  2VSZ A;  4TKN A;  4B6H A;  3TFM A;  4GPT B;  2Z13 A;  2FJL A;  3QIJ A;  2XQN M;  2YSZ A;  1TXD A;  3PP2 A;  5FI0 A;  4A6F B;  2P0H A;  3D8E A;  4Z2N A;  1AWE A;  3NWF A;  4TYZ A;  3D8D A;  4KVG B;  2D9V A;  2K2U A;  4HDQ A;  3DXD A;  1UPQ A;  2DTC A;  1ISN A;  4IFS A;  3P7Z A;  5KQ4 A;  3A8P A;  2YT0 A;  1PFJ A;  2CAY A;  1H10 A;  1Y5O A;  1MI1 A;  1RRP B;  2M38 A;  1V5M A;  2P0F A;  1MPH A;  2EJ8 A;  4GXB A;  3SV1 A;  1WGU A;  1H4R A;  4L1R A;  3SNH A;  4IOY X;  2KR0 A;  1U5D A;  2H7D A;  5C5B B;  5I2S A;  1MIZ B;  4DIX A;  2Z59 A;  3U8Z A;  2J0K A;  4WVF B;  5DHA B;  3UZT A;  4HAY B;  2QKM A;  4GZU A;  2FJU B;  4GN1 A;  3MPX A;  2RNR B;  3KRX A;  1WVH A;  2D10 A;  2KCJ A;  3A8Q A;  2EC1 A;  1ZYI A;  2Z0O A;  3PEG A;  2KUP A;  2R09 A;  1FAO A;  2GCL A;  3SO6 A;  3DXC A;  4ZRJ A;  2DHI A;  2EMT A;  5J3T A;  1BAK A;  1WJM A;  2L1C A;  1WI1 A;  2AL6 A;  2COF A;  2I5F A;  2RGN B;  5FI1 A;  4KHO A;  4OT1 A;  2UZS A;  2D9W A;  1MK9 B;  5M4Y B;  2CRF A;  4MY6 A;  3PVW A;  3U12 A;  5IRS A;  3KZ1 A;  2GJY A;  1MK7 B;  2BCJ A;  3RCP A;  2P8V A;  1QC6 A;  2D4Q A;  2J59 M;  2KIG A;  4H8S A;  2JP2 A;  3QBV B;  3FM8 C;  1OY2 A;  1EAZ A;  1V5P A;  3DCX A;  1FHW A;  2I1K A;  2J0J A;  2Y8F A;  2COC A;  1UEF A;  1KZG A;  4DBB A;  5DHF B;  1X05 A;  2HE7 A;  2YT1 A;  2RSG A;  1W1H A;  3GYO A;  2D11 A;  4HB4 B;  5HE2 A;  1LW3 A;  2KGX B;  3SYX A;  1ZC4 B;  2LUL A;  2ROV A;  4GMV A;  3F5R A;  3VIA A;  2YVC A;  4HAX B;  2P0D A;  1BWN A;  1UPR A;  5DI9 B;  2VKI A;  4KHB A;  4HSI A;  4EMO A;  3AU5 A;  2OQB A;  1OMW A;  4HDO A;  2D9Z A;  4YON A;  4PQ0 A;  4L6E A;  4NSW A;  4QJ5 B;  1DDM A;  1GC6 A;  1MKE A;  4K81 A;  2DX1 A;  2LKO A;  2KUQ A;  2N23 A;  3TO1 A;  2PZ1 A;  4QJ3 B;  1QQG A;  5EFX A;  1J0W A;  1PLS A;  2E2X A;  1RJ2 A;  1U5E A;  1NTV A;  2I1J A;  3TCA A;  4C0A A;  1K5D B;  1NTY A;  4HAU B;  4GMX B;  4QXA B;  1UNQ A;  3FEH A;  4WJ7 A;  1XR0 B;  2ADZ A;  3FSS A;  5HE3 A;  5LG4 B;  2OTX A;  4CHM A;  3N7C A;  2DKP A;  4HAT B;  4EKU A;  3HK0 A;  2LYD A;  2YS1 A;  4EJN A;  1MAI A;  2J0M A;  5CLQ B;  3PSC A;  4P7I A;  5CLL B;  2DYQ A;  3IVF A;  2MKR A;  1MIX A;  5JHG A;  1T77 A;  4D0N B;  3AU4 A;  3NWD A;  5J3Y A;  1KI1 B;  4GOU A;  2YS5 A;  1XD4 A;  3TVV A;  1ZSQ A;  2DN6 A;  1FOE A;  2YT2 A;  1TJ6 A;  3NW8 A;  1NI2 A;  4K2P A;  1ZC3 B;  4Y94 A;  2ELB A;  3G9W A;  5HE1 A;  3U7D A;  2LOZ A;  1I2H A;  3DXE A;  5GOW B;  2W2W A;  4DXA B;  2IFS A;  4KHB B;  2I5C A;  3FVC A;  2DFK A;  1X1F A;  1FGY A;  4XWX A;  3OAN A;  4K17 A;  4F7G A;  2N0Y A;  1UNP A;  2MWN B;  3KRW A;  1TQZ A;  2NMB A;  1FHO A;  1AQC A;  5D3V A;  4YL8 A;  3ZDT A;  2Q13 A;  5KCV A;  4A6K A;  2Z14 A;  3X23 A;  3ZVR A;  2H7E A;  1XOD A;  3V5W A;  4ZRK A;  5D3Y A;  1M7R A;  3A98 B;  1WGQ A;  1FB8 A;  1LB1 A;  1P6S A;  1W1G A;  1V61 A;  4K2O A;  1IRS A;  4ZRI A;  2RVB B;  1U2B A;  1DDW A;  3VOQ A;  5C5B A;  5L81 A;  3BIN A;  3NSU A;  5DH9 B;  5LON B;  2AEH A;  2EMS A;  1X11 A;  4IAP A;  4HAZ B;  4QJ4 B;  2W2X C;  2UZR A;  2Y7B A;  2X18 A;  3ML4 A;  3LJU X;  5DIF B;  3GYP A;  2RUK B;  1OQN A;  4HHV A; 
#chains in the Genus database with same CATH homology
 2M14 A;  1WJ1 A;  4MT7 A;  3O96 A;  2CY5 A;  4HB0 B;  1DBH A;  1EVH A;  3ULC A;  3PG7 A;  1ZM0 A;  2V76 A;  2D2Q A;  4CYE A;  3KSY A;  2GS0 A;  4WSF A;  1DDV A;  2NZ8 B;  2DYN A;  2CY4 A;  2D9Y A;  3AJ4 A;  2YRY A;  3BJI A;  5D3X A;  3F0W A;  3CXB B;  4PNK A;  2LOX A;  2UVM A;  1KZ7 A;  2COD A;  2DHK A;  1J19 A;  2L2I A;  2YS3 A;  2MDX A;  1X1G A;  1V5U A;  1XX0 A;  2DKQ A;  1V88 A;  4CHJ A;  2ELA A;  4F7U P;  1ZVR A;  3ULB A;  1SGH A;  1E5W A;  1P5T A;  2DX5 A;  1PMS A;  1FGZ A;  1DRO A;  1Y19 B;  5HE0 A;  1P3R A;  3KY9 A;  2ROZ B;  5D27 A;  3HQC A;  4KAX B;  2COA A;  2G35 A;  1V89 A;  1W1D A;  5C16 A;  1EGX A;  2QKL A;  2W2X D;  1XKE A;  2D9X A;  1Z87 A;  2GCJ A;  1BTN A;  3D8F A;  3PZD A;  3SUZ A;  4HB2 B;  1UNR A;  3T06 A;  1BTK A;  1NU2 A;  4DX9 0;  4Z2M B;  5JLJ B;  4A6F A;  1U27 A;  1X86 A;  4KHA A;  2LG1 A;  1B55 A;  3PVL A;  2HTH B;  1SHC A;  1U5F A;  1I7A A;  3QWM A;  1FHX A;  1EF1 A;  2YF0 A;  2MFQ A;  1DYN A;  5KQ1 A;  2Z0P A;  2Z0Q A;  4NY0 A;  3PVU A;  1M7E A;  4HB3 B;  2VRW B;  3ODX A;  2IYB A;  1Q67 A;  2K00 A;  1K5G B;  2DHJ A;  1U5G A;  3MDB C;  4A5K A;  4HAW B;  1XCG A;  4F7H A;  3M1I B;  4MK0 A;  2DLW A;  4HAV B;  1GC7 A;  5D3W A;  2Y8G A;  2K2J A;  3HW2 B;  5LOP B;  1WG7 A;  3P6A A;  2ZPY A;  3TW1 A;  5JP4 A;  3ODO A;  3WA0 A;  1U29 A;  5C79 A;  3WYF B;  2DA0 A;  2R0D A;  4A6H A;  1GG3 A;  2RLO A;  5JHH A;  5C6R A;  3ODW A;  5J3Q A;  1N3H A;  3CIK A;  4BBK A;  4DX8 A;  2VSZ A;  4TKN A;  4B6H A;  3TFM A;  4GPT B;  2FJL A;  3QIJ A;  2XQN M;  2YSZ A;  1TXD A;  3PP2 A;  5FI0 A;  4A6F B;  2P0H A;  3D8E A;  4Z2N A;  1AWE A;  4TYZ A;  3D8D A;  4KVG B;  2D9V A;  2K2U A;  4HDQ A;  3DXD A;  1UPQ A;  2DTC A;  1ISN A;  4IFS A;  3P7Z A;  5KQ4 A;  3A8P A;  2YT0 A;  1PFJ A;  2CAY A;  1H10 A;  1Y5O A;  1RRP B;  2M38 A;  1V5M A;  2P0F A;  1MPH A;  2EJ8 A;  4GXB A;  3SV1 A;  1WGU A;  1H4R A;  3SNH A;  4IOY X;  1U5D A;  2H7D A;  5C5B B;  1MIZ B;  3U8Z A;  2J0K A;  4WVF B;  5DHA B;  3UZT A;  4HAY B;  2QKM A;  4GZU A;  4GN1 A;  3MPX A;  2RNR B;  3KRX A;  1WVH A;  2D10 A;  2KCJ A;  3A8Q A;  2EC1 A;  2Z0O A;  3PEG A;  2KUP A;  2R09 A;  1FAO A;  2GCL A;  3SO6 A;  3DXC A;  4ZRJ A;  2DHI A;  2EMT A;  5J3T A;  1BAK A;  1WJM A;  2L1C A;  1WI1 A;  2AL6 A;  2COF A;  2I5F A;  2RGN B;  5FI1 A;  4KHO A;  2UZS A;  2D9W A;  1MK9 B;  2CRF A;  4MY6 A;  3PVW A;  3KZ1 A;  2GJY A;  1MK7 B;  2BCJ A;  3RCP A;  2P8V A;  1QC6 A;  2D4Q A;  2J59 M;  4H8S A;  2JP2 A;  3QBV B;  3FM8 C;  1OY2 A;  1EAZ A;  1V5P A;  1FHW A;  2I1K A;  2J0J A;  2Y8F A;  2COC A;  1UEF A;  1KZG A;  4DBB A;  5DHF B;  1X05 A;  2HE7 A;  2YT1 A;  2RSG A;  1W1H A;  3GYO A;  2D11 A;  4HB4 B;  5HE2 A;  1LW3 A;  2KGX B;  3SYX A;  1ZC4 B;  2LUL A;  2ROV A;  4GMV A;  3F5R A;  3VIA A;  2YVC A;  4HAX B;  2P0D A;  1BWN A;  1UPR A;  5DI9 B;  2VKI A;  4EMO A;  3AU5 A;  2OQB A;  1OMW A;  4HDO A;  2D9Z A;  4YON A;  4PQ0 A;  4L6E A;  4NSW A;  1DDM A;  1GC6 A;  1MKE A;  4K81 A;  2DX1 A;  2LKO A;  2N23 A;  3TO1 A;  2PZ1 A;  1QQG A;  5EFX A;  1J0W A;  1PLS A;  2E2X A;  1RJ2 A;  1U5E A;  1NTV A;  2I1J A;  3TCA A;  4C0A A;  1K5D B;  1NTY A;  4HAU B;  4GMX B;  1UNQ A;  3FEH A;  4WJ7 A;  1XR0 B;  2ADZ A;  3FSS A;  5HE3 A;  2OTX A;  4CHM A;  3N7C A;  2DKP A;  4HAT B;  4EKU A;  3HK0 A;  2LYD A;  2YS1 A;  4EJN A;  1MAI A;  2J0M A;  5CLQ B;  3PSC A;  4P7I A;  5CLL B;  2DYQ A;  3IVF A;  2MKR A;  1MIX A;  5JHG A;  4D0N B;  3AU4 A;  5J3Y A;  1KI1 B;  2YS5 A;  1XD4 A;  3TVV A;  1ZSQ A;  2DN6 A;  1FOE A;  1TJ6 A;  1NI2 A;  4K2P A;  1ZC3 B;  4Y94 A;  2ELB A;  3G9W A;  5HE1 A;  3U7D A;  2LOZ A;  1I2H A;  3DXE A;  5GOW B;  2W2W A;  4DXA B;  2IFS A;  4KHB B;  2I5C A;  2DFK A;  1X1F A;  1FGY A;  4XWX A;  3OAN A;  4K17 A;  4F7G A;  2N0Y A;  1UNP A;  2MWN B;  3KRW A;  1TQZ A;  2NMB A;  1FHO A;  1AQC A;  5D3V A;  4YL8 A;  3ZDT A;  2Q13 A;  5KCV A;  4A6K A;  3X23 A;  3ZVR A;  2H7E A;  1XOD A;  3V5W A;  4ZRK A;  5D3Y A;  1M7R A;  3A98 B;  1WGQ A;  1FB8 A;  1LB1 A;  1P6S A;  1W1G A;  1V61 A;  4K2O A;  1IRS A;  4ZRI A;  2RVB B;  1U2B A;  1DDW A;  3VOQ A;  5C5B A;  5L81 A;  3BIN A;  3NSU A;  5DH9 B;  5LON B;  2AEH A;  2EMS A;  1X11 A;  4IAP A;  4HAZ B;  2W2X C;  2UZR A;  2Y7B A;  2X18 A;  3ML4 A;  3LJU X;  5DIF B;  3GYP A;  2RUK B;  1OQN A;  4HHV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...