2Z0PA

Crystal structure of ph domain of bruton's tyrosine kinase
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
167
structure length
158
Chain Sequence
AAVILESIFLKRSQQKKKTSPLNFKKRLFLLTVHKLSYYEYDFERGRRGSKKGSIDVEKITCVETVVPEKNPPPERQIMEQISIIERFPYPFQVVYDEGPLYVFSPTEELRKRWIHQLKNVIRYNSDLVQKYHPCFWIDGQYLCCSQTAKNAMGCQIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tyrosine-protein kinase BTK
publication title Crystal structure of the Bruton's tyrosine kinase PH domain with phosphatidylinositol
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 34
structure length 158
sequence length 167
chains with identical sequence B, C, D
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2007-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
A PF00779 BTK BTK motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2z0pA00
4CYEA 4IOYX 2LKOA 4Z2NA 1EVHA 1H10A 1PFJA 1MK7B 2LOZA 4EMOA 2DYQA 5GOWB 1LB1A 3ULBA 1FAOA 1RRPB 2IYBA 2J59M 2DX5A 2L2IA 2H7DA 1M7RA 2N0YA 4DX90 3TW1A 2VRWB 1WVHA 2XQNM 4HAYB 4H8SA 1WI1A 2I5CA 1SGHA 2YS1A 2LOXA 1EF1A 1NTVA 4WSFA 5DHFB 1ZM0A 5DIFB 1WJ1A 3AJ4A 1WGUA 5FI1A 1X1GA 1P5TA 3ULCA 4HAUB 3TO1A 2YF0A 1NTYA 1WG7A 2MKRA 1KI1B 4DBBA 2H7EA 2YRYA 2OTXA 1E5WA 5FI0A 2GJYA 3SO6A 5CLQB 3ODWA 2J0MA 1UNRA 3FEHA 3M1IB 1W1GA 5D3VA 1BTNA 2UVMA 1X86A 4HDOA 1Z87A 3BINA 3SUZA 3MPXA 1Y5OA 3UZTA 1DROA 3ODXA 2RUKB 1W1DA 2HE7A 5L81A 2UZSA 3GYPA 2Z0PA 3DXDA 1PMSA 2D9YA 2LG1A 3D8EA 3ZDTA 2JP2A 1I2HA 1ZVRA 2COAA 1ZC4B 3U8ZA 2I1JA 1V88A 3KZ1A 1V61A 2DN6A 3GYOA 2CAYA 1U2BA 2D4QA 3P7ZA 1NU2A 1N3HA 2IFSA 4MT7A 2RGNB 3MDBC 2W2WA 2D9VA 5C79A 3VIAA 3QWMA 2RVBB 2ELBA 3PVWA 4A5KA 5LOPB 1PLSA 1UEFA 3D8FA 1UNQA 4HATB 1MAIA 2DX1A 2ADZA 3PVLA 3A8PA 4A6FA 4GXBA 1BTKA 2DFKA 4WJ7A 1XD4A 2QKLA 4K2OA 4GMXB 5C16A 5D3WA 1XODA 1J19A 2AEHA 2ELAA 1DYNA 2KUPA 1FOEA 4MK0A 4GPTB 2DYNA 1XKEA 2COFA 3G9WA 4A6FB 2P0FA 4PQ0A 2V76A 3SV1A 5JLJB 1DBHA 1IRSA 3LJUX 4IFSA 5J3QA 2R09A 3FSSA 3IVFA 1FB8A 2EMSA 3X23A 2L1CA 2J0JA 5J3TA 5KQ1A 5JHGA 4HB4B 2I1KA 1P3RA 1QC6A 2ROZB 3ZVRA 3RCPA 3KSYA 3SNHA 1FHXA 3O96A 1U27A 4K81A 1DDMA 2CODA 4YONA 4L6EA 2I5FA 4HB0B 3OANA 1I7AA 1UPQA 2Z0OA 1TQZA 5EFXA 1V5UA 4F7UP 5C6RA 1P6SA 2P0HA 3PZDA 2MDXA 1X05A 1MPHA 1OY2A 2PZ1A 2CRFA 5D27A 2NMBA 3V5WA 4HB3B 5HE2A 2D10A 1FHOA 2KCJA 3BJIA 2DKQA 4KHAA 5C5BA 4EJNA 1ZSQA 1FGYA 1XR0B 5D3YA 5JHHA 2YSZA 3HK0A 2W2XD 4HDQA 3TFMA 1MKEA 1U5EA 1GC7A 2OQBA 3A8QA 3N7CA 3PG7A 3WA0A 2D2QA 1MK9B 2LULA 4MY6A 2HTHB 4TYZA 2UZRA 4KVGB 3TCAA 1KZ7A 5DH9B 4PNKA 1EAZA 3QBVB 2EC1A 3CXBB 4NY0A 5HE1A 4HAXB 4Z2MB 2MWNB 1MIZB 4C0AA 2N23A 2FJLA 2R0DA 3ODOA 1WJMA 1UPRA 5D3XA 3VOQA 2DA0A 2CY4A 2DHKA 4ZRKA 3HQCA 1ZC3B 2RLOA 4P7IA 3KRWA 4CHMA 5KQ4A 1TJ6A 4A6KA 4K2PA 2COCA 2D9XA 3WYFB 3TVVA 4HAVB 2Q13A 1AQCA 1B55A 2VKIA 3PEGA 2K2JA 1M7EA 4HAWB 1SHCA 2RNRB 4KAXB 2BCJA 3AU4A 1KZGA 4KHOA 3ML4A 4CHJA 2M14A 1U29A 1AWEA 4HB2B 2LYDA 2ZPYA 4ZRIA 1DDVA 1W1HA 4IAPA 2E2XA 4WVFB 2YS5A 3AU5A 1TXDA 2DTCA 1RJ2A 2GCLA 1V5MA 4D0NB 1J0WA 1EGXA 2W2XC 1GG3A 5HE3A 4KHBB 3A98B 2DLWA 3FM8C 1H4RA 1Y19B 1U5DA 5DHAB 2K00A 3T06A 2Z0QA 2YS3A 2EMTA 3F0WA 3PSCA 2K2UA 1DDWA 1MIXA 4F7HA 1WGQA 3KY9A 1X1FA 3CIKA 2J0KA 4GZUA 4A6HA 4BBKA 1XCGA 1UNPA 3QIJA 5LONB 5DI9B 2AL6A 1FGZA 1V5PA 2D9ZA 5J3YA 2Y7BA 3NSUA 3KRXA 5CLLB 2EJ8A 1OMWA 1QQGA 4HHVA 1XX0A 5C5BB 3P6AA 4GMVA 4EKUA 2NZ8B 4TKNA 3PVUA 2D11A 3SYXA 2YT0A 1U5GA 2GS0A 4XWXA 4YL8A 4HAZB 1FHWA 2YT1A 2DKPA 2RSGA 1K5GB 2KGXB 1NI2A 1BWNA 2DHJA 5HE0A 2MFQA 1LW3A 1OQNA 2ROVA 4ZRJA 2GCJA 3F5RA 3HW2B 1ISNA 4B6HA 4DX8A 4DXAB 1Q67A 2P8VA 1GC6A 1K5DB 4Y94A 1BAKA 2YVCA 3U7DA 2X18A 5KCVA 2D9WA 2VSZA 1X11A 4K17A 2P0DA 3DXEA 1U5FA 1V89A 2Y8FA 5JP4A 3PP2A 3D8DA 2M38A 2G35A 4GN1A 4NSWA 2Y8GA 2DHIA 4F7GA 3DXCA 2CY5A 2QKMA
chains in the Genus database with same CATH superfamily
4CYEA 4IOYX 2LKOA 4Z2NA 1EVHA 1H10A 1PFJA 1MK7B 2LOZA 4EMOA 2DYQA 5GOWB 1LB1A 3ULBA 2YT2A 1FAOA 1RRPB 2IYBA 2J59M 2DX5A 2L2IA 2H7DA 1M7RA 2N0YA 4DX90 3TW1A 2VRWB 1WVHA 2XQNM 4HAYB 4H8SA 1WI1A 2I5CA 4OSNA 4CSQA 2RRFA 1SGHA 2YS1A 2LOXA 1EF1A 1NTVA 3HIEA 4WSFA 2GUMA 5DHFB 1ZM0A 5DIFB 4L1RA 1WJ1A 3AJ4A 1WGUA 5FI1A 1X1GA 1P5TA 2K8EA 3ULCA 4HAUB 3TO1A 2YF0A 1NTYA 1WG7A 2MKRA 1KI1B 4GNKB 2H7EA 4DBBA 2YRYA 2OTXA 1E5WA 2KIGA 5FI0A 4QJ4B 2GJYA 3SO6A 5CLQB 3ODWA 4QXAB 2J0MA 1UNRA 5IRSA 3FEHA 3M1IB 1W1GA 3U12A 5D3VA 1BTNA 2UVMA 1X86A 4HDOA 1Z87A 3BINA 3SUZA 3MPXA 1Y5OA 3UZTA 1DROA 3ODXA 2RUKB 1W1DA 2HE7A 5L81A 2UZSA 3GYPA 2Z0PA 3DXDA 1PMSA 2D9YA 2LG1A 3D8EA 3ZDTA 2JP2A 1I2HA 1ZVRA 2COAA 1ZC4B 3U8ZA 4DIXA 2I1JA 1V88A 3KZ1A 1V61A 5M4YB 2DN6A 3GYOA 2CAYA 1U2BA 2D4QA 3P7ZA 1NU2A 1N3HA 2IFSA 4GOUA 4MT7A 2RGNB 3MDBC 3NWDA 2W2WA 2D9VA 5C79A 3VIAA 3QWMA 2RVBB 2ELBA 3PVWA 4A5KA 5LOPB 1PLSA 1UEFA 3D8FA 1UNQA 4HATB 1MAIA 2DX1A 2ADZA 3PVLA 2Z59A 3A8PA 4A6FA 4GXBA 1BTKA 2DFKA 2K49A 4WJ7A 1XD4A 2QKLA 4K2OA 4GMXB 5C16A 5D3WA 1XODA 1J19A 2AEHA 2ELAA 1DYNA 2KUPA 1FOEA 4MK0A 4GPTB 2DYNA 1XKEA 4QJ5B 2COFA 3G9WA 4A6FB 2P0FA 4PQ0A 2V76A 3SV1A 5JLJB 1DBHA 1IRSA 3LJUX 4IFSA 5J3QA 2R09A 3FSSA 3IVFA 1FB8A 2EMSA 3X23A 2L1CA 2J0JA 5J3TA 5KQ1A 5JHGA 4HB4B 2I1KA 1P3RA 1QC6A 2ROZB 3ZVRA 3RCPA 3KSYA 3SNHA 1FHXA 3O96A 1U27A 4K81A 1DDMA 2CODA 4YONA 4L6EA 1T77A 2I5FA 4HB0B 3OANA 1I7AA 1UPQA 2Z0OA 1TQZA 5EFXA 1V5UA 4F7UP 5C6RA 1P6SA 2P0HA 3PZDA 2MDXA 1X05A 1MPHA 1OY2A 2PZ1A 2CRFA 5D27A 2NMBA 3V5WA 4HB3B 5HE2A 2D10A 1FHOA 2KCJA 3BJIA 2DKQA 4KHAA 5C5BA 2Z4DA 4EJNA 1ZSQA 1FGYA 1XR0B 5D3YA 5JHHA 2YSZA 3HK0A 2W2XD 4HDQA 3TFMA 1MKEA 1U5EA 1GC7A 2OQBA 3A8QA 3NW8A 4OT1A 3N7CA 3PG7A 3WA0A 2D2QA 1MK9B 2LULA 4MY6A 2HTHB 4TYZA 2UZRA 4KVGB 3TCAA 1KZ7A 5DH9B 4PNKA 1EAZA 3QBVB 2EC1A 3CXBB 4NY0A 3NWAA 5HE1A 4HAXB 4HSIA 4Z2MB 2MWNB 1MIZB 4C0AA 1ZYIA 2N23A 2FJLA 2R0DA 3ODOA 1WJMA 1UPRA 5D3XA 3VOQA 1MI1A 2DA0A 2FJUB 2CY4A 2DHKA 4ZRKA 3HQCA 1ZC3B 2RLOA 4P7IA 3KRWA 4CHMA 5KQ4A 1TJ6A 4A6KA 2Z13A 4K2PA 2COCA 2D9XA 3WYFB 3TVVA 4HAVB 2Q13A 5I2MA 1AQCA 1B55A 4D6WA 2VKIA 3PEGA 2K2JA 1M7EA 4HAWB 4KHBA 1SHCA 2RNRB 4KAXB 2BCJA 3AU4A 1KZGA 4KHOA 3ML4A 4CHJA 2M14A 1U29A 1AWEA 4HB2B 2LYDA 2ZPYA 4ZRIA 3B77A 1DDVA 1W1HA 4IAPA 2E2XA 4WVFB 2YS5A 3AU5A 1TXDA 2DTCA 1RJ2A 2GCLA 1V5MA 4D0NB 1J0WA 1EGXA 2W2XC 1GG3A 5HE3A 4KHBB 3A98B 3FVCA 3NWFA 2DLWA 3FM8C 1H4RA 1Y19B 1U5DA 5DHAB 2R2YA 2K00A 3T06A 2Z0QA 2YS3A 2EMTA 3F0WA 3PSCA 2K2UA 1DDWA 1MIXA 4F7HA 1WGQA 3KY9A 1X1FA 3CIKA 2J0KA 4GZUA 4A6HA 4BBKA 1XCGA 1UNPA 3QIJA 5LONB 4QJ3B 5DI9B 2AL6A 1FGZA 1V5PA 2D9ZA 5J3YA 3HSAA 3A58A 2Y7BA 2ZKMX 3NSUA 3KRXA 5CLLB 2EJ8A 1OMWA 1QQGA 4HHVA 1XX0A 5C5BB 3P6AA 4GMVA 4EKUA 2NZ8B 4TKNA 3PVUA 2D11A 3SYXA 2YT0A 1U5GA 2GS0A 4XWXA 4YL8A 4HAZB 1FHWA 2YT1A 2DKPA 2RSGA 1K5GB 2KGXB 1NI2A 2KR0A 1BWNA 2DHJA 5HE0A 2MFQA 1LW3A 1OQNA 2ROVA 4ZRJA 2GCJA 2NBVA 3F5RA 1ISNA 3HW2B 4B6HA 4DX8A 4DXAB 1Q67A 2P8VA 1GC6A 1K5DB 4Y94A 1BAKA 2YVCA 3OHMB 3U7DA 2X18A 5LG4B 5KCVA 2D9WA 2VSZA 1X11A 4K17A 2KIEA 5I2SA 3DCXA 2P0DA 3DXEA 1U5FA 1V89A 2Y8FA 5JP4A 3PP2A 3D8DA 2M38A 2G35A 4GN1A 2KUQA 4NSWA 2Y8GA 2DHIA 4F7GA 3DXCA 2Z14A 2CY5A 2QKMA
chains in the Genus database with same CATH topology
4CYEA 4IOYX 2LKOA 4Z2NA 1EVHA 1H10A 1PFJA 1MK7B 2LOZA 4EMOA 2DYQA 5GOWB 1LB1A 3ULBA 1FAOA 1RRPB 2IYBA 2J59M 2DX5A 2L2IA 2H7DA 1M7RA 2N0YA 4DX90 3TW1A 2VRWB 1WVHA 2XQNM 4HAYB 4H8SA 1WI1A 2I5CA 1SGHA 2YS1A 2LOXA 1EF1A 1NTVA 4WSFA 5DHFB 1ZM0A 5DIFB 1WJ1A 3AJ4A 1WGUA 5FI1A 1X1GA 1P5TA 3ULCA 4HAUB 3TO1A 2YF0A 1NTYA 1WG7A 2MKRA 1KI1B 4DBBA 2H7EA 2YRYA 2OTXA 1E5WA 5FI0A 2GJYA 3SO6A 5CLQB 3ODWA 2J0MA 1UNRA 3FEHA 3M1IB 1W1GA 5D3VA 1BTNA 2UVMA 1X86A 4HDOA 1Z87A 3BINA 3SUZA 3MPXA 1Y5OA 3UZTA 1DROA 3ODXA 2RUKB 1W1DA 2HE7A 5L81A 2UZSA 3GYPA 2Z0PA 3DXDA 1PMSA 2D9YA 2LG1A 3D8EA 3ZDTA 2JP2A 1I2HA 1ZVRA 2COAA 1ZC4B 3U8ZA 2I1JA 1V88A 3KZ1A 1V61A 2DN6A 3GYOA 2CAYA 1U2BA 2D4QA 3P7ZA 1NU2A 1N3HA 2IFSA 4MT7A 2RGNB 3MDBC 2W2WA 2D9VA 5C79A 3VIAA 3QWMA 2RVBB 2ELBA 3PVWA 4A5KA 5LOPB 1PLSA 1UEFA 3D8FA 1UNQA 4HATB 1MAIA 2DX1A 2ADZA 3PVLA 3A8PA 4A6FA 4GXBA 1BTKA 2DFKA 4WJ7A 1XD4A 2QKLA 4K2OA 4GMXB 5C16A 5D3WA 1XODA 1J19A 2AEHA 2ELAA 1DYNA 2KUPA 1FOEA 4MK0A 4GPTB 2DYNA 1XKEA 2COFA 3G9WA 4A6FB 2P0FA 4PQ0A 2V76A 3SV1A 5JLJB 1DBHA 1IRSA 3LJUX 4IFSA 5J3QA 2R09A 3FSSA 3IVFA 1FB8A 2EMSA 3X23A 2L1CA 2J0JA 5J3TA 5KQ1A 5JHGA 4HB4B 2I1KA 1P3RA 1QC6A 2ROZB 3ZVRA 3RCPA 3KSYA 3SNHA 1FHXA 3O96A 1U27A 4K81A 1DDMA 2CODA 4YONA 4L6EA 2I5FA 4HB0B 3OANA 1I7AA 1UPQA 2Z0OA 1TQZA 5EFXA 1V5UA 4F7UP 5C6RA 1P6SA 2P0HA 3PZDA 2MDXA 1X05A 1MPHA 1OY2A 2PZ1A 2CRFA 5D27A 2NMBA 3V5WA 4HB3B 5HE2A 2D10A 1FHOA 2KCJA 3BJIA 2DKQA 4KHAA 5C5BA 4EJNA 1ZSQA 1FGYA 1XR0B 5D3YA 5JHHA 2YSZA 3HK0A 2W2XD 4HDQA 3TFMA 1MKEA 1U5EA 1GC7A 2OQBA 3A8QA 3N7CA 3PG7A 3WA0A 2D2QA 1MK9B 2LULA 4MY6A 2HTHB 4TYZA 2UZRA 4KVGB 3TCAA 1KZ7A 5DH9B 4PNKA 1EAZA 3QBVB 2EC1A 3CXBB 4NY0A 5HE1A 4HAXB 4Z2MB 2MWNB 1MIZB 4C0AA 2N23A 2FJLA 2R0DA 3ODOA 1WJMA 1UPRA 5D3XA 3VOQA 2DA0A 2CY4A 2DHKA 4ZRKA 3HQCA 1ZC3B 2RLOA 4P7IA 3KRWA 4CHMA 5KQ4A 1TJ6A 4A6KA 4K2PA 2COCA 2D9XA 3WYFB 3TVVA 4HAVB 2Q13A 1AQCA 1B55A 2VKIA 3PEGA 2K2JA 1M7EA 4HAWB 1SHCA 2RNRB 4KAXB 2BCJA 3AU4A 1KZGA 4KHOA 3ML4A 4CHJA 2M14A 1U29A 1AWEA 4HB2B 2LYDA 2ZPYA 4ZRIA 1DDVA 1W1HA 4IAPA 2E2XA 4WVFB 2YS5A 3AU5A 1TXDA 2DTCA 1RJ2A 2GCLA 1V5MA 4D0NB 1J0WA 1EGXA 2W2XC 1GG3A 5HE3A 4KHBB 3A98B 2DLWA 3FM8C 1H4RA 1Y19B 1U5DA 5DHAB 2K00A 3T06A 2Z0QA 2YS3A 2EMTA 3F0WA 3PSCA 2K2UA 1DDWA 1MIXA 4F7HA 1WGQA 3KY9A 1X1FA 3CIKA 2J0KA 4GZUA 4A6HA 4BBKA 1XCGA 1UNPA 3QIJA 5LONB 5DI9B 2AL6A 1FGZA 1V5PA 2D9ZA 5J3YA 2Y7BA 3NSUA 3KRXA 5CLLB 2EJ8A 1OMWA 1QQGA 4HHVA 1XX0A 5C5BB 3P6AA 4GMVA 4EKUA 2NZ8B 4TKNA 3PVUA 2D11A 3SYXA 2YT0A 1U5GA 2GS0A 4XWXA 4YL8A 4HAZB 1FHWA 2YT1A 2DKPA 2RSGA 1K5GB 2KGXB 1NI2A 1BWNA 2DHJA 5HE0A 2MFQA 1LW3A 1OQNA 2ROVA 4ZRJA 2GCJA 3F5RA 3HW2B 1ISNA 4B6HA 4DX8A 4DXAB 1Q67A 2P8VA 1GC6A 1K5DB 4Y94A 1BAKA 2YVCA 3U7DA 2X18A 5KCVA 2D9WA 2VSZA 1X11A 4K17A 2P0DA 3DXEA 1U5FA 1V89A 2Y8FA 5JP4A 3PP2A 3D8DA 2M38A 2G35A 4GN1A 4NSWA 2Y8GA 2DHIA 4F7GA 3DXCA 2CY5A 2QKMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CYE A;  4IOY X;  2LKO A;  4Z2N A;  1EVH A;  1H10 A;  1PFJ A;  1MK7 B;  2LOZ A;  4EMO A;  2DYQ A;  5GOW B;  1LB1 A;  3ULB A;  1FAO A;  1RRP B;  2IYB A;  2J59 M;  2DX5 A;  2L2I A;  2H7D A;  1M7R A;  2N0Y A;  4DX9 0;  3TW1 A;  2VRW B;  1WVH A;  2XQN M;  4HAY B;  4H8S A;  1WI1 A;  2I5C A;  1SGH A;  2YS1 A;  2LOX A;  1EF1 A;  1NTV A;  4WSF A;  5DHF B;  1ZM0 A;  5DIF B;  1WJ1 A;  3AJ4 A;  1WGU A;  5FI1 A;  1X1G A;  1P5T A;  3ULC A;  4HAU B;  3TO1 A;  2YF0 A;  1NTY A;  1WG7 A;  2MKR A;  1KI1 B;  4DBB A;  2H7E A;  2YRY A;  2OTX A;  1E5W A;  5FI0 A;  2GJY A;  3SO6 A;  5CLQ B;  3ODW A;  2J0M A;  1UNR A;  3FEH A;  3M1I B;  1W1G A;  5D3V A;  1BTN A;  2UVM A;  1X86 A;  4HDO A;  1Z87 A;  3BIN A;  3SUZ A;  3MPX A;  1Y5O A;  3UZT A;  1DRO A;  3ODX A;  2RUK B;  1W1D A;  2HE7 A;  5L81 A;  2UZS A;  3GYP A;  2Z0P A;  3DXD A;  1PMS A;  2D9Y A;  2LG1 A;  3D8E A;  3ZDT A;  2JP2 A;  1I2H A;  1ZVR A;  2COA A;  1ZC4 B;  3U8Z A;  2I1J A;  1V88 A;  3KZ1 A;  1V61 A;  2DN6 A;  3GYO A;  2CAY A;  1U2B A;  2D4Q A;  3P7Z A;  1NU2 A;  1N3H A;  2IFS A;  4MT7 A;  2RGN B;  3MDB C;  2W2W A;  2D9V A;  5C79 A;  3VIA A;  3QWM A;  2RVB B;  2ELB A;  3PVW A;  4A5K A;  5LOP B;  1PLS A;  1UEF A;  3D8F A;  1UNQ A;  4HAT B;  1MAI A;  2DX1 A;  2ADZ A;  3PVL A;  3A8P A;  4A6F A;  4GXB A;  1BTK A;  2DFK A;  4WJ7 A;  1XD4 A;  2QKL A;  4K2O A;  4GMX B;  5C16 A;  5D3W A;  1XOD A;  1J19 A;  2AEH A;  2ELA A;  1DYN A;  2KUP A;  1FOE A;  4MK0 A;  4GPT B;  2DYN A;  1XKE A;  2COF A;  3G9W A;  4A6F B;  2P0F A;  4PQ0 A;  2V76 A;  3SV1 A;  5JLJ B;  1DBH A;  1IRS A;  3LJU X;  4IFS A;  5J3Q A;  2R09 A;  3FSS A;  3IVF A;  1FB8 A;  2EMS A;  3X23 A;  2L1C A;  2J0J A;  5J3T A;  5KQ1 A;  5JHG A;  4HB4 B;  2I1K A;  1P3R A;  1QC6 A;  2ROZ B;  3ZVR A;  3RCP A;  3KSY A;  3SNH A;  1FHX A;  3O96 A;  1U27 A;  4K81 A;  1DDM A;  2COD A;  4YON A;  4L6E A;  2I5F A;  4HB0 B;  3OAN A;  1I7A A;  1UPQ A;  2Z0O A;  1TQZ A;  5EFX A;  1V5U A;  4F7U P;  5C6R A;  1P6S A;  2P0H A;  3PZD A;  2MDX A;  1X05 A;  1MPH A;  1OY2 A;  2PZ1 A;  2CRF A;  5D27 A;  2NMB A;  3V5W A;  4HB3 B;  5HE2 A;  2D10 A;  1FHO A;  2KCJ A;  3BJI A;  2DKQ A;  4KHA A;  5C5B A;  4EJN A;  1ZSQ A;  1FGY A;  1XR0 B;  5D3Y A;  5JHH A;  2YSZ A;  3HK0 A;  2W2X D;  4HDQ A;  3TFM A;  1MKE A;  1U5E A;  1GC7 A;  2OQB A;  3A8Q A;  3N7C A;  3PG7 A;  3WA0 A;  2D2Q A;  1MK9 B;  2LUL A;  4MY6 A;  2HTH B;  4TYZ A;  2UZR A;  4KVG B;  3TCA A;  1KZ7 A;  5DH9 B;  4PNK A;  1EAZ A;  3QBV B;  2EC1 A;  3CXB B;  4NY0 A;  5HE1 A;  4HAX B;  4Z2M B;  2MWN B;  1MIZ B;  4C0A A;  2N23 A;  2FJL A;  2R0D A;  3ODO A;  1WJM A;  1UPR A;  5D3X A;  3VOQ A;  2DA0 A;  2CY4 A;  2DHK A;  4ZRK A;  3HQC A;  1ZC3 B;  2RLO A;  4P7I A;  3KRW A;  4CHM A;  5KQ4 A;  1TJ6 A;  4A6K A;  4K2P A;  2COC A;  2D9X A;  3WYF B;  3TVV A;  4HAV B;  2Q13 A;  1AQC A;  1B55 A;  2VKI A;  3PEG A;  2K2J A;  1M7E A;  4HAW B;  1SHC A;  2RNR B;  4KAX B;  2BCJ A;  3AU4 A;  1KZG A;  4KHO A;  3ML4 A;  4CHJ A;  2M14 A;  1U29 A;  1AWE A;  4HB2 B;  2LYD A;  2ZPY A;  4ZRI A;  1DDV A;  1W1H A;  4IAP A;  2E2X A;  4WVF B;  2YS5 A;  3AU5 A;  1TXD A;  2DTC A;  1RJ2 A;  2GCL A;  1V5M A;  4D0N B;  1J0W A;  1EGX A;  2W2X C;  1GG3 A;  5HE3 A;  4KHB B;  3A98 B;  2DLW A;  3FM8 C;  1H4R A;  1Y19 B;  1U5D A;  5DHA B;  2K00 A;  3T06 A;  2Z0Q A;  2YS3 A;  2EMT A;  3F0W A;  3PSC A;  2K2U A;  1DDW A;  1MIX A;  4F7H A;  1WGQ A;  3KY9 A;  1X1F A;  3CIK A;  2J0K A;  4GZU A;  4A6H A;  4BBK A;  1XCG A;  1UNP A;  3QIJ A;  5LON B;  5DI9 B;  2AL6 A;  1FGZ A;  1V5P A;  2D9Z A;  5J3Y A;  2Y7B A;  3NSU A;  3KRX A;  5CLL B;  2EJ8 A;  1OMW A;  1QQG A;  4HHV A;  1XX0 A;  5C5B B;  3P6A A;  4GMV A;  4EKU A;  2NZ8 B;  4TKN A;  3PVU A;  2D11 A;  3SYX A;  2YT0 A;  1U5G A;  2GS0 A;  4XWX A;  4YL8 A;  4HAZ B;  1FHW A;  2YT1 A;  2DKP A;  2RSG A;  1K5G B;  2KGX B;  1NI2 A;  1BWN A;  2DHJ A;  5HE0 A;  2MFQ A;  1LW3 A;  1OQN A;  2ROV A;  4ZRJ A;  2GCJ A;  3F5R A;  3HW2 B;  1ISN A;  4B6H A;  4DX8 A;  4DXA B;  1Q67 A;  2P8V A;  1GC6 A;  1K5D B;  4Y94 A;  1BAK A;  2YVC A;  3U7D A;  2X18 A;  5KCV A;  2D9W A;  2VSZ A;  1X11 A;  4K17 A;  2P0D A;  3DXE A;  1U5F A;  1V89 A;  2Y8F A;  5JP4 A;  3PP2 A;  3D8D A;  2M38 A;  2G35 A;  4GN1 A;  4NSW A;  2Y8G A;  2DHI A;  4F7G A;  3DXC A;  2CY5 A;  2QKM A; 
#chains in the Genus database with same CATH topology
 4CYE A;  4IOY X;  2LKO A;  4Z2N A;  1EVH A;  1H10 A;  1PFJ A;  1MK7 B;  2LOZ A;  4EMO A;  2DYQ A;  5GOW B;  1LB1 A;  3ULB A;  2YT2 A;  1FAO A;  1RRP B;  2IYB A;  2J59 M;  2DX5 A;  2L2I A;  2H7D A;  1M7R A;  2N0Y A;  4DX9 0;  3TW1 A;  2VRW B;  1WVH A;  2XQN M;  4HAY B;  4H8S A;  1WI1 A;  2I5C A;  4OSN A;  4CSQ A;  2RRF A;  1SGH A;  2YS1 A;  2LOX A;  1EF1 A;  1NTV A;  3HIE A;  4WSF A;  2GUM A;  5DHF B;  1ZM0 A;  5DIF B;  4L1R A;  1WJ1 A;  3AJ4 A;  1WGU A;  5FI1 A;  1X1G A;  1P5T A;  2K8E A;  3ULC A;  4HAU B;  3TO1 A;  2YF0 A;  1NTY A;  1WG7 A;  2MKR A;  1KI1 B;  4GNK B;  2H7E A;  4DBB A;  2YRY A;  2OTX A;  1E5W A;  2KIG A;  5FI0 A;  4QJ4 B;  2GJY A;  3SO6 A;  5CLQ B;  3ODW A;  4QXA B;  2J0M A;  1UNR A;  5IRS A;  3FEH A;  3M1I B;  1W1G A;  3U12 A;  5D3V A;  1BTN A;  2UVM A;  1X86 A;  4HDO A;  1Z87 A;  3BIN A;  3SUZ A;  3MPX A;  1Y5O A;  3UZT A;  1DRO A;  3ODX A;  2RUK B;  1W1D A;  2HE7 A;  5L81 A;  2UZS A;  3GYP A;  2Z0P A;  3DXD A;  1PMS A;  2D9Y A;  2LG1 A;  3D8E A;  3ZDT A;  2JP2 A;  1I2H A;  1ZVR A;  2COA A;  1ZC4 B;  3U8Z A;  4DIX A;  2I1J A;  1V88 A;  3KZ1 A;  1V61 A;  5M4Y B;  2DN6 A;  3GYO A;  2CAY A;  1U2B A;  2D4Q A;  3P7Z A;  1NU2 A;  1N3H A;  2IFS A;  4GOU A;  4MT7 A;  2RGN B;  3MDB C;  3NWD A;  2W2W A;  2D9V A;  5C79 A;  3VIA A;  3QWM A;  2RVB B;  2ELB A;  3PVW A;  4A5K A;  5LOP B;  1PLS A;  1UEF A;  3D8F A;  1UNQ A;  4HAT B;  1MAI A;  2DX1 A;  2ADZ A;  3PVL A;  2Z59 A;  3A8P A;  4A6F A;  4GXB A;  1BTK A;  2DFK A;  2K49 A;  4WJ7 A;  1XD4 A;  2QKL A;  4K2O A;  4GMX B;  5C16 A;  5D3W A;  1XOD A;  1J19 A;  2AEH A;  2ELA A;  1DYN A;  2KUP A;  1FOE A;  4MK0 A;  4GPT B;  2DYN A;  1XKE A;  4QJ5 B;  2COF A;  3G9W A;  4A6F B;  2P0F A;  4PQ0 A;  2V76 A;  3SV1 A;  5JLJ B;  1DBH A;  1IRS A;  3LJU X;  4IFS A;  5J3Q A;  2R09 A;  3FSS A;  3IVF A;  1FB8 A;  2EMS A;  3X23 A;  2L1C A;  2J0J A;  5J3T A;  5KQ1 A;  5JHG A;  4HB4 B;  2I1K A;  1P3R A;  1QC6 A;  2ROZ B;  3ZVR A;  3RCP A;  3KSY A;  3SNH A;  1FHX A;  3O96 A;  1U27 A;  4K81 A;  1DDM A;  2COD A;  4YON A;  4L6E A;  1T77 A;  2I5F A;  4HB0 B;  3OAN A;  1I7A A;  1UPQ A;  2Z0O A;  1TQZ A;  5EFX A;  1V5U A;  4F7U P;  5C6R A;  1P6S A;  2P0H A;  3PZD A;  2MDX A;  1X05 A;  1MPH A;  1OY2 A;  2PZ1 A;  2CRF A;  5D27 A;  2NMB A;  3V5W A;  4HB3 B;  5HE2 A;  2D10 A;  1FHO A;  2KCJ A;  3BJI A;  2DKQ A;  4KHA A;  5C5B A;  2Z4D A;  4EJN A;  1ZSQ A;  1FGY A;  1XR0 B;  5D3Y A;  5JHH A;  2YSZ A;  3HK0 A;  2W2X D;  4HDQ A;  3TFM A;  1MKE A;  1U5E A;  1GC7 A;  2OQB A;  3A8Q A;  3NW8 A;  4OT1 A;  3N7C A;  3PG7 A;  3WA0 A;  2D2Q A;  1MK9 B;  2LUL A;  4MY6 A;  2HTH B;  4TYZ A;  2UZR A;  4KVG B;  3TCA A;  1KZ7 A;  5DH9 B;  4PNK A;  1EAZ A;  3QBV B;  2EC1 A;  3CXB B;  4NY0 A;  3NWA A;  5HE1 A;  4HAX B;  4HSI A;  4Z2M B;  2MWN B;  1MIZ B;  4C0A A;  1ZYI A;  2N23 A;  2FJL A;  2R0D A;  3ODO A;  1WJM A;  1UPR A;  5D3X A;  3VOQ A;  1MI1 A;  2DA0 A;  2FJU B;  2CY4 A;  2DHK A;  4ZRK A;  3HQC A;  1ZC3 B;  2RLO A;  4P7I A;  3KRW A;  4CHM A;  5KQ4 A;  1TJ6 A;  4A6K A;  2Z13 A;  4K2P A;  2COC A;  2D9X A;  3WYF B;  3TVV A;  4HAV B;  2Q13 A;  5I2M A;  1AQC A;  1B55 A;  4D6W A;  2VKI A;  3PEG A;  2K2J A;  1M7E A;  4HAW B;  4KHB A;  1SHC A;  2RNR B;  4KAX B;  2BCJ A;  3AU4 A;  1KZG A;  4KHO A;  3ML4 A;  4CHJ A;  2M14 A;  1U29 A;  1AWE A;  4HB2 B;  2LYD A;  2ZPY A;  4ZRI A;  3B77 A;  1DDV A;  1W1H A;  4IAP A;  2E2X A;  4WVF B;  2YS5 A;  3AU5 A;  1TXD A;  2DTC A;  1RJ2 A;  2GCL A;  1V5M A;  4D0N B;  1J0W A;  1EGX A;  2W2X C;  1GG3 A;  5HE3 A;  4KHB B;  3A98 B;  3FVC A;  3NWF A;  2DLW A;  3FM8 C;  1H4R A;  1Y19 B;  1U5D A;  5DHA B;  2R2Y A;  2K00 A;  3T06 A;  2Z0Q A;  2YS3 A;  2EMT A;  3F0W A;  3PSC A;  2K2U A;  1DDW A;  1MIX A;  4F7H A;  1WGQ A;  3KY9 A;  1X1F A;  3CIK A;  2J0K A;  4GZU A;  4A6H A;  4BBK A;  1XCG A;  1UNP A;  3QIJ A;  5LON B;  4QJ3 B;  5DI9 B;  2AL6 A;  1FGZ A;  1V5P A;  2D9Z A;  5J3Y A;  3HSA A;  3A58 A;  2Y7B A;  2ZKM X;  3NSU A;  3KRX A;  5CLL B;  2EJ8 A;  1OMW A;  1QQG A;  4HHV A;  1XX0 A;  5C5B B;  3P6A A;  4GMV A;  4EKU A;  2NZ8 B;  4TKN A;  3PVU A;  2D11 A;  3SYX A;  2YT0 A;  1U5G A;  2GS0 A;  4XWX A;  4YL8 A;  4HAZ B;  1FHW A;  2YT1 A;  2DKP A;  2RSG A;  1K5G B;  2KGX B;  1NI2 A;  2KR0 A;  1BWN A;  2DHJ A;  5HE0 A;  2MFQ A;  1LW3 A;  1OQN A;  2ROV A;  4ZRJ A;  2GCJ A;  2NBV A;  3F5R A;  1ISN A;  3HW2 B;  4B6H A;  4DX8 A;  4DXA B;  1Q67 A;  2P8V A;  1GC6 A;  1K5D B;  4Y94 A;  1BAK A;  2YVC A;  3OHM B;  3U7D A;  2X18 A;  5LG4 B;  5KCV A;  2D9W A;  2VSZ A;  1X11 A;  4K17 A;  2KIE A;  5I2S A;  3DCX A;  2P0D A;  3DXE A;  1U5F A;  1V89 A;  2Y8F A;  5JP4 A;  3PP2 A;  3D8D A;  2M38 A;  2G35 A;  4GN1 A;  2KUQ A;  4NSW A;  2Y8G A;  2DHI A;  4F7G A;  3DXC A;  2Z14 A;  2CY5 A;  2QKM A; 
#chains in the Genus database with same CATH homology
 4CYE A;  4IOY X;  2LKO A;  4Z2N A;  1EVH A;  1H10 A;  1PFJ A;  1MK7 B;  2LOZ A;  4EMO A;  2DYQ A;  5GOW B;  1LB1 A;  3ULB A;  1FAO A;  1RRP B;  2IYB A;  2J59 M;  2DX5 A;  2L2I A;  2H7D A;  1M7R A;  2N0Y A;  4DX9 0;  3TW1 A;  2VRW B;  1WVH A;  2XQN M;  4HAY B;  4H8S A;  1WI1 A;  2I5C A;  1SGH A;  2YS1 A;  2LOX A;  1EF1 A;  1NTV A;  4WSF A;  5DHF B;  1ZM0 A;  5DIF B;  1WJ1 A;  3AJ4 A;  1WGU A;  5FI1 A;  1X1G A;  1P5T A;  3ULC A;  4HAU B;  3TO1 A;  2YF0 A;  1NTY A;  1WG7 A;  2MKR A;  1KI1 B;  4DBB A;  2H7E A;  2YRY A;  2OTX A;  1E5W A;  5FI0 A;  2GJY A;  3SO6 A;  5CLQ B;  3ODW A;  2J0M A;  1UNR A;  3FEH A;  3M1I B;  1W1G A;  5D3V A;  1BTN A;  2UVM A;  1X86 A;  4HDO A;  1Z87 A;  3BIN A;  3SUZ A;  3MPX A;  1Y5O A;  3UZT A;  1DRO A;  3ODX A;  2RUK B;  1W1D A;  2HE7 A;  5L81 A;  2UZS A;  3GYP A;  2Z0P A;  3DXD A;  1PMS A;  2D9Y A;  2LG1 A;  3D8E A;  3ZDT A;  2JP2 A;  1I2H A;  1ZVR A;  2COA A;  1ZC4 B;  3U8Z A;  2I1J A;  1V88 A;  3KZ1 A;  1V61 A;  2DN6 A;  3GYO A;  2CAY A;  1U2B A;  2D4Q A;  3P7Z A;  1NU2 A;  1N3H A;  2IFS A;  4MT7 A;  2RGN B;  3MDB C;  2W2W A;  2D9V A;  5C79 A;  3VIA A;  3QWM A;  2RVB B;  2ELB A;  3PVW A;  4A5K A;  5LOP B;  1PLS A;  1UEF A;  3D8F A;  1UNQ A;  4HAT B;  1MAI A;  2DX1 A;  2ADZ A;  3PVL A;  3A8P A;  4A6F A;  4GXB A;  1BTK A;  2DFK A;  4WJ7 A;  1XD4 A;  2QKL A;  4K2O A;  4GMX B;  5C16 A;  5D3W A;  1XOD A;  1J19 A;  2AEH A;  2ELA A;  1DYN A;  2KUP A;  1FOE A;  4MK0 A;  4GPT B;  2DYN A;  1XKE A;  2COF A;  3G9W A;  4A6F B;  2P0F A;  4PQ0 A;  2V76 A;  3SV1 A;  5JLJ B;  1DBH A;  1IRS A;  3LJU X;  4IFS A;  5J3Q A;  2R09 A;  3FSS A;  3IVF A;  1FB8 A;  2EMS A;  3X23 A;  2L1C A;  2J0J A;  5J3T A;  5KQ1 A;  5JHG A;  4HB4 B;  2I1K A;  1P3R A;  1QC6 A;  2ROZ B;  3ZVR A;  3RCP A;  3KSY A;  3SNH A;  1FHX A;  3O96 A;  1U27 A;  4K81 A;  1DDM A;  2COD A;  4YON A;  4L6E A;  2I5F A;  4HB0 B;  3OAN A;  1I7A A;  1UPQ A;  2Z0O A;  1TQZ A;  5EFX A;  1V5U A;  4F7U P;  5C6R A;  1P6S A;  2P0H A;  3PZD A;  2MDX A;  1X05 A;  1MPH A;  1OY2 A;  2PZ1 A;  2CRF A;  5D27 A;  2NMB A;  3V5W A;  4HB3 B;  5HE2 A;  2D10 A;  1FHO A;  2KCJ A;  3BJI A;  2DKQ A;  4KHA A;  5C5B A;  4EJN A;  1ZSQ A;  1FGY A;  1XR0 B;  5D3Y A;  5JHH A;  2YSZ A;  3HK0 A;  2W2X D;  4HDQ A;  3TFM A;  1MKE A;  1U5E A;  1GC7 A;  2OQB A;  3A8Q A;  3N7C A;  3PG7 A;  3WA0 A;  2D2Q A;  1MK9 B;  2LUL A;  4MY6 A;  2HTH B;  4TYZ A;  2UZR A;  4KVG B;  3TCA A;  1KZ7 A;  5DH9 B;  4PNK A;  1EAZ A;  3QBV B;  2EC1 A;  3CXB B;  4NY0 A;  5HE1 A;  4HAX B;  4Z2M B;  2MWN B;  1MIZ B;  4C0A A;  2N23 A;  2FJL A;  2R0D A;  3ODO A;  1WJM A;  1UPR A;  5D3X A;  3VOQ A;  2DA0 A;  2CY4 A;  2DHK A;  4ZRK A;  3HQC A;  1ZC3 B;  2RLO A;  4P7I A;  3KRW A;  4CHM A;  5KQ4 A;  1TJ6 A;  4A6K A;  4K2P A;  2COC A;  2D9X A;  3WYF B;  3TVV A;  4HAV B;  2Q13 A;  1AQC A;  1B55 A;  2VKI A;  3PEG A;  2K2J A;  1M7E A;  4HAW B;  1SHC A;  2RNR B;  4KAX B;  2BCJ A;  3AU4 A;  1KZG A;  4KHO A;  3ML4 A;  4CHJ A;  2M14 A;  1U29 A;  1AWE A;  4HB2 B;  2LYD A;  2ZPY A;  4ZRI A;  1DDV A;  1W1H A;  4IAP A;  2E2X A;  4WVF B;  2YS5 A;  3AU5 A;  1TXD A;  2DTC A;  1RJ2 A;  2GCL A;  1V5M A;  4D0N B;  1J0W A;  1EGX A;  2W2X C;  1GG3 A;  5HE3 A;  4KHB B;  3A98 B;  2DLW A;  3FM8 C;  1H4R A;  1Y19 B;  1U5D A;  5DHA B;  2K00 A;  3T06 A;  2Z0Q A;  2YS3 A;  2EMT A;  3F0W A;  3PSC A;  2K2U A;  1DDW A;  1MIX A;  4F7H A;  1WGQ A;  3KY9 A;  1X1F A;  3CIK A;  2J0K A;  4GZU A;  4A6H A;  4BBK A;  1XCG A;  1UNP A;  3QIJ A;  5LON B;  5DI9 B;  2AL6 A;  1FGZ A;  1V5P A;  2D9Z A;  5J3Y A;  2Y7B A;  3NSU A;  3KRX A;  5CLL B;  2EJ8 A;  1OMW A;  1QQG A;  4HHV A;  1XX0 A;  5C5B B;  3P6A A;  4GMV A;  4EKU A;  2NZ8 B;  4TKN A;  3PVU A;  2D11 A;  3SYX A;  2YT0 A;  1U5G A;  2GS0 A;  4XWX A;  4YL8 A;  4HAZ B;  1FHW A;  2YT1 A;  2DKP A;  2RSG A;  1K5G B;  2KGX B;  1NI2 A;  1BWN A;  2DHJ A;  5HE0 A;  2MFQ A;  1LW3 A;  1OQN A;  2ROV A;  4ZRJ A;  2GCJ A;  3F5R A;  3HW2 B;  1ISN A;  4B6H A;  4DX8 A;  4DXA B;  1Q67 A;  2P8V A;  1GC6 A;  1K5D B;  4Y94 A;  1BAK A;  2YVC A;  3U7D A;  2X18 A;  5KCV A;  2D9W A;  2VSZ A;  1X11 A;  4K17 A;  2P0D A;  3DXE A;  1U5F A;  1V89 A;  2Y8F A;  5JP4 A;  3PP2 A;  3D8D A;  2M38 A;  2G35 A;  4GN1 A;  4NSW A;  2Y8G A;  2DHI A;  4F7G A;  3DXC A;  2CY5 A;  2QKM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...