2Z0TA

Crystal structure of hypothetical protein ph0355
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
109
structure length
109
Chain Sequence
MKWEMGLQEEYIELIKAGKKKIEGRLYDEKRRQIKPGDIIIFEGGKLKVKVKGIRVYSSFKEMLEKEGIENVLPGVKSIEEGVKVYRQFYDEEREKKYGVVAIEIEPIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein PH0355
publication title Crystal structure of hypothetical protein PH0355
rcsb
source organism Pyrococcus horikoshii
molecule tags Rna binding protein
total genus 37
structure length 109
sequence length 109
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04266 ASCH ASCH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.130.30 Mainly Beta Roll Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4 Hypothetical protein. 2z0tA00
1XNEA 2E5OA 2KKUA 2DP9A 1TE7A 1S04A 2Z0TA 1WK2A 3IUWA
chains in the Genus database with same CATH superfamily
1Q7HA 2AUSA 3VSEA 3UAIA 4DMGA 3HJYA 2APOA 1ZE1A 1TE7A 3M6UA 4TZ4C 4Q1TA 3M4XA 3U28A 4CI1B 3HJWA 2ANEA 1WXXA 3M6WA 1R3EA 3C0KA 1ZE2A 3LWPA 1XNEA 3LDFA 3LJCA 2P38A 1IT8A 1IQ8A 1ZS7A 2KKUA 1IT7A 1T5YA 3LWOA 2CX1A 2RFKA 2J5VA 2J5TA 2AS0A 1ZL3A 2HVYA 2E5OA 2CX0A 2FRXA 1J2BA 2DP9A 3MQKA 3M6XA 1SGVA 1K8WA 2Z0TA 3LWRA 2B78A 1WK2A 3M65A 3LWQA 1UOYA 1SQWA 2CWWA 3D79A 3LWVA 2AB4A 1R3FA 3ZV0C 1S04A 2EY4A 1ZBOA 3M6VA 4CI3B 3HAXA 4CI2B 2Q07A 1WXWA 3IUWA
chains in the Genus database with same CATH topology
1XNEA 2E5OA 4C26A 1WK2A 2KKUA 2DP9A 1TE7A 1S04A 2Z0TA 4P78C 1WHZA 3IUWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XNE A;  2E5O A;  2KKU A;  2DP9 A;  1TE7 A;  1S04 A;  2Z0T A;  1WK2 A;  3IUW A; 
#chains in the Genus database with same CATH topology
 1Q7H A;  2AUS A;  3VSE A;  3UAI A;  4DMG A;  3HJY A;  2APO A;  1ZE1 A;  1TE7 A;  3M6U A;  4TZ4 C;  4Q1T A;  3M4X A;  3U28 A;  4CI1 B;  3HJW A;  2ANE A;  1WXX A;  3M6W A;  1R3E A;  3C0K A;  1ZE2 A;  3LWP A;  1XNE A;  3LDF A;  3LJC A;  2P38 A;  1IT8 A;  1IQ8 A;  1ZS7 A;  2KKU A;  1IT7 A;  1T5Y A;  3LWO A;  2CX1 A;  2RFK A;  2J5V A;  2J5T A;  2AS0 A;  1ZL3 A;  2HVY A;  2E5O A;  2CX0 A;  2FRX A;  1J2B A;  2DP9 A;  3MQK A;  3M6X A;  1SGV A;  1K8W A;  2Z0T A;  3LWR A;  2B78 A;  1WK2 A;  3M65 A;  3LWQ A;  1UOY A;  1SQW A;  2CWW A;  3D79 A;  3LWV A;  2AB4 A;  1R3F A;  3ZV0 C;  1S04 A;  2EY4 A;  1ZBO A;  3M6V A;  4CI3 B;  3HAX A;  4CI2 B;  2Q07 A;  1WXW A;  3IUW A; 
#chains in the Genus database with same CATH homology
 1XNE A;  2E5O A;  4C26 A;  1WK2 A;  2KKU A;  2DP9 A;  1TE7 A;  1S04 A;  2Z0T A;  4P78 C;  1WHZ A;  3IUW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...