2Z11A

Crystal structure of putative acetyltransferase
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
188
structure length
187
Chain Sequence
MWAFPERFEGRHVRLEPLALAHLPAFLRHYDPEVYRFLSRAPVAPTEEALRAHLEGLLGEPGRVNWAILFGKEVAGRISVIAPEPEHAKLELGTMLFKPFWGSPANKEAKLLLRHAFEVLRAERVQFKVDLRNERSQRALEALGAVREGVLRKNRRLPDGAFRDDVVYSVLKEEWPGVKARLEARLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of putative acetyltransferase
rcsb
source organism Thermus thermophilus
molecule tags Transferase
molecule keywords Ribosomal-protein-alanine acetyltransferase
total genus 60
structure length 187
sequence length 188
ec nomenclature ec 2.3.1.128: Transferred entry: 2.3.1.267.
pdb deposition date 2007-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13302 Acetyltransf_3 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2z11A00
2J8RA 3DR6A 4MY0A 1N71A 4AB7A 1IIDA 4MY3A 3T90A 2Q44A 1PU9A 1I21A 3EY5A 3R9GA 3IGRA 4QC6A 2ZW7A 2VI7A 2HV2A 3SXOA 4E0AA 2R7HA 2ZW6A 5HH1A 3OWCA 2BUEA 2Y0MA 2G0BA 2Q04A 1K4JA 2ZW5A 2ZPAA 2F5IA 2ATRA 1KUXA 2VZZA 3PGPA 2FE7A 1MJAA 4NEXA 4KUBA 1YR0A 4OLLA 3S6KA 1M1DA 5CNPA 1YREA 4PK2A 4CAVA 4M85A 5C82A 4QBJA 2FCKA 1SQHA 3D8PA 1U6MA 4KZTA 3W6SA 2PRBA 2WPXA 3S6GA 2QECA 2P6FA 4KOTA 1B6BA 2VXKA 4J3GA 3VWDA 2FL4A 5FVJA 3SHPA 1KZFA 1IYLA 4UBRA 4E8OA 4M3SA 5F47A 3R9EA 1ON0A 1TIQA 4KVME 5DWMA 2H5MA 3F8KA 4FD6A 2CNSA 4KOWA 3GKRA 4RI1A 4OADA 3FIXA 3PP9A 2B5GB 2D4PA 1XE4A 1YLEA 1VHSA 2B3UA 1IICA 3EC4A 3W91A 1BO4A 2BL1A 1R57A 3T9YA 4XNHB 5F49A 5H84A 2GE3A 3DR8A 3F5BA 2Q0YA 3TOBA 4AG9A 4NCZA 1XEBA 4CAWA 2VZYA 4OAEA 2P6GA 1GHEA 4IUSA 1I1DA 3TE4A 3R1KA 1WK4A 1S7LA 4JJXA 1Y9WA 3I3GA 4JD6A 2ARHA 1S3ZA 3UY5A 2QMLA 2BEIA 2P6EA 3E0KA 2PSWA 4KVXA 4UWJA 2OH1A 4E2AA 1RXTA 4JXQA 1QSRA 3FB3A 2P0WA 3LODA 4CS0B 1YVOA 3LD2A 3WR7A 1LRZA 3TT2A 1P4NA 2Q4YA 5EC4A 5JPHA 4R3KA 1CJWA 1WWZA 3C26A 1Y9KA 3VWEA 5F46A 2O28A 4FD7A 3TCVA 2PC1A 3KKWA 4MJ8A 1FY7A 1Q2YA 4BMHA 1XIXA 1BOBA 2OB0A 2GIVA 4XPLA 1Z9UA 2NMTA 3EFAA 2FT0A 2B3VA 2FIWA 4H6ZA 3FRMA 4B5OA 3QB8A 4ONUA 4PV6A 5EBVA 3S6HA 4YRHA 4NF1A 5J8CA 3I9SA 3DSBA 3BJ8A 3GYAA 2EUIA 1YGHA 4AVAA 2AE6A 4H6UA 2OZGA 2G3AA 4KOUA 3QAHA 2B4DB 5DWNA 2Z0ZA 3ZZIA 2Z11A 1NE9A 1S5KA 1V0CA 4IF5A 5IB0A 1XF8A 1QSNA 3D3SA 2JDDA 2B58A 2HUZA 4F6AA 4HNWB 1M4DA 2R1IA 3G8WA 1Q2DA 4UA3A 4LUAA 2ZXVA 1KUVA 2K5TA 2B4DA 2IL4A 2BSWA 4B5PA 3CXQA 4FD4A 3EXNA 1YX0A 2WPWA 5GCNA 4EVYA 1MK4A 2R8VA 2OU2A 1P0HA 1S7NA 2PR8A 3FYNA 2B5GA 1KUYA 2RC4A 2EVNA 4QB9A 4JWPA 1PUAA 4AG7A 2REFA 1IB1E 1Z4EA 3TO7A 3F0AA 3N7ZA 1RO5A 4NXYA 4U5YA 4XPDC 4F0YA 4KUAA 2JEVA 5KTAA 4B5PB 1QSMA 5C88A 3TFYA 5JQ4A 4JLYA 3P2FA 4CAXA 3JUWA 1QSOA 2I79A 4KORA 3R95A 3B8GA 4MI4A 4KOYA 3V8IA 2QIRA 1YK3A 2Q4VA 1QSTA 2HQYA 4ZBGA 4XPDB 4XNHC 4KOXA 3DNSA 5ISVA 3H4QA 4R57A 3FNCA 2ZW4A 1UFHA 3R9FA 4KLVA 4L8AA 2JDCA 4L89A 4PSWA 3R96A 3S6FA 2VEZA 1MJ9A 1S7KA 2I00A 4YFJA 4UWIA 1CM0A 5J8FA 3BLNA 2OZHA 4HKFA 4U9ZA 4I49A 4CRYB 3P2HA 4HNXB 5IX3A 3TTHA 3FBUA 3D2PA 3G3SA 1M4GA 3TOAA 3W6XA 2JLMA 2VBQA 2GANA 4X5KA 4R9MA 5E96A 4FD5A 4AVBA 4LX9A 4KOSA 3IWGA 2DXQA 3BJ7A 3RYOA 1XMTA 1IYKA 4DNCA 4KLWA 1VKCA 3EO4A 2FS5A 2CNMA 2G3TA 4U9YA 1OZPA 1I12A 2FXFA 2KCWA 1B87A 2D4OA 4KVOE 2PR1A 4II9A 4Y49B 5HMNA 1NSLA 4ORFA 3CXPA 1S60A 2VQYA 3TO9A 1MJBA 5F48A 1Z4RA 1Y7RA 3ZJ0A 2CNTA 1L0CA 4JXRA 5H86A 4CRZB 3JVNA 2FSRA 3D2MA 3DDDA 3TO6A 4QVTA 2B4BA 3GY9A 3MGDA 2REEA 4AVCA 4Y49C 4K30A 4NSQA 2X7BA 2OZUA 1YVKA 4RS2A 5IV0A 1M44A 2J8MA 1S7FA 2CY2A 1M4IA 5I0CA 4YGOA 4XPKA 2Q7BA 4PK3A 2A4NA 3NE7A 3PZJA 4R3LA 2C27A 2AJ6A 5KTCA 4H89A 2PQ8A 3FXTA 2R98A 1NMTA 2J8NA 3CXSA 5KTDA 4MHDA 4R87A 1J4JA 4KOVA 2FIAA 4GS4A 4HNYB 3SXNA 4MBUA 2PDOA 1Q2CA 4QUSA 3K9UA 4PSXA 2Z10A
chains in the Genus database with same CATH superfamily
3FF3A 4TWEA 3B3TA 2J8RA 2ZELA 3DR6A 4KSAA 4MY0A 1N71A 4AB7A 1IIDA 4MY3A 1BPNA 3H8GA 1Z8LA 1ZLIA 3T90A 3KR5A 3PB9X 3S9MA 2Q44A 4A94A 3B3VA 1PU9A 4IHMA 3KASA 8CPAA 1I21A 5AGEA 3EY5A 4NGSA 4B10A 3R9GA 3WC7A 2WYRA 3IGRA 4QC6A 2ZW7A 2HB6A 2VI7A 2HV2A 4WWVA 3SXOA 4E0AA 4W9YA 2R7HA 4C7IA 3H8EA 2ZW6A 2PJ1A 1NSAA 5HH1A 4UCMA 2Q4ZA 3OWCA 4A38A 2JEWA 2CTBA 2BUEA 2Y0MA 2G0BA 2Q04A 1K4JA 4MFPA 4NGTA 4BD9A 2ABZA 2ZW5A 3WT4A 4C2ZA 4P10A 4EWTA 2ZPAA 4NJQA 4IK2A 3IEHA 3RBUA 1KWMA 1Y7EA 4F0XA 2J9AA 1LFWA 1VHEA 3BXMA 4UCNA 4CGMA 1ELMP 2F5IA 4NGPA 2ATRA 4P45A 5G21A 1IGBA 1KUXA 2VZZA 3PGPA 4MHNA 2GLFA 2FE7A 1MJAA 4FBEA 1YSJA 4NEXA 4KUBA 1CBXA 2QJ8A 4P4IA 2V8VA 4H2KA 3K2KA 1YR0A 4OLLA 2OOTA 3IJ3A 3S6KA 1M1DA 5CNPA 3SI0A 1A2ZA 1YREA 1FNOA 5D8NA 1F2PA 4PK2A 4CAVA 3SI2A 1BAVA 3A9LA 2ZEEA 4M85A 4NJRA 5C82A 4QBJA 4A32A 1HDUA 2FCKA 2CF4A 1YQEA 3B2YA 5K8NA 1SQHA 1XMBA 1U6MA 2PJ8A 3D8PA 2PRBA 2WPXA 3ISZA 2QECA 4KZTA 3BI1A 2P6FA 3S6GA 4KOTA 2C6GA 2CTCA 1B6BA 2VXKA 4J3GA 3VWDA 2CIJA 2EK9A 5K8OA 2FL4A 5FVJA 3SHPA 1KZFA 2DPTA 3S9NA 1IYLA 3ISXA 4UBRA 4E8OA 4M3SA 5F47A 1CG2A 1ON0A 2YNCC 3PBEA 4TNUA 5LRGA 3R9EA 3RZAA 1TIQA 3MRUA 3KR4A 4KVME 4PXBA 1VHOA 2EO8A 1DE4C 2PJ0A 5DWMA 5LYIA 2JBJA 2H5MA 4A31A 3F8KA 4FD6A 5G1ZA 5HVFA 3RNZA 1Z2LA 3D68A 4UF4A 2CNSA 2PJAA 4P4FA 4KOWA 3GKRA 4MMOA 4RI1A 4UFXA 4OADA 1ZG9A 4OC1A 3FIXA 1Y0YA 4MCRA 2EWBA 2PJCA 4C2YA 2Q43A 3FEEA 1X10A 2BCOA 1XJOA 3B3CA 3PP9A 1ZG8A 1IY7A 2B5GB 2D4PA 1XE4A 1YLEA 5HVGA 1VHSA 4B13A 2B3UA 1IICA 3EC4A 3KQZA 3W91A 1BO4A 2BL1A 4OKOA 1R57A 2CXAA 5DS0A 4XNHB 5F49A 3T9YA 3GLJA 4PXDA 5H84A 5ELYA 4OMEA 2GE3A 3DR8A 3IO1A 4MCSA 3F5BA 5A28A 2Q0YA 3PBBA 3TOBA 4P4EA 4AG9A 4NCZA 2YNEA 2XEFA 1XEBA 2WUUA 4CAWA 2VZYA 3HUVA 2V8DA 2XEGA 3QAYA 4OAEA 2P6GA 4FAIA 1GHEA 2PJ9A 1I1DA 4IUSA 3FEDA 3TE4A 1ARLA 3R1KA 4B14A 3NFZA 1IU8A 1WK4A 1F57A 4LQGA 1LAPA 2Z3NA 1S7LA 2Q51A 3IFEA 4YU9A 1TF9A 4JJXA 1Y9WA 3I3GA 3SI1A 4JD6A 1CP7A 4CYNA 4A30A 4A95A 2ARHA 2G9DA 2FVGA 3IWEA 3PB4X 1S3ZA 3PRTA 3UY5A 1LAMA 4C2XA 2QMLA 3PFOA 4B12A 4Q38A 5LYDA 2BEIA 2P6EA 3D7DA 3E0KA 2PSWA 4OIWA 3SJXA 4KVXA 5THWA 4UWJA 4GM5A 3QNVA 2YNDA 2OH1A 4P4DA 1BLLE 1RXTA 1QSRA 3FB3A 4JXQA 4E2AA 1Z8XA 3SJFA 2P0WA 4OC3A 3D7HA 3LODA 4M6GA 4CS0B 1YVOA 3LD2A 3WR7A 3I1UA 4YWYA 4CGNA 1LRZA 1Z8TA 4AXVA 3TT2A 2ANPA 1P4NA 2I3CA 2Q4YA 5EC4A 3V38A 2GLJA 4ZX9A 2EBJA 4UFVA 3PFEA 4R3KA 5JPHA 1CJWA 4Z65A 1WWZA 3C26A 5LYLA 2DEAA 1Y9KA 3VWEA 3FECA 5F46A 2O28A 4DUKA 3CPXA 1LCPA 2QYVA 3LWUA 2AFZA 4FD7A 3TCVA 1AUGA 1TKFA 2PVWA 4F9VA 2PC1A 3KKWA 4OIDA 4OC0A 3PB7X 2ZEHA 2ZENA 4MJ8A 1FY7A 2IQ6A 2XEJA 3PEIA 2C6CA 4P4JA 4B11A 1Q2YA 4BMHA 1CX8A 1XIXA 3L2NA 1BOBA 3FJUA 2OB0A 3IIBA 4MCQA 4R76A 4OP4A 3V7ZA 2AFUA 2GIVA 3PB8X 1XRYA 1XBUA 2AFSA 2PJ4A 4OC2A 4XPLA 3VATA 1Z9UA 4B6ZA 5JM6A 2NMTA 1AYEA 3EFAA 4UEEA 3NA6A 2FT0A 3DGVA 5A27A 2PJ6A 2B3VA 2FIWA 4H6ZA 3FRMA 4B5OA 1YW4A 4CGPA 3W6SA 3QB8A 4ONUA 4PV6A 2QVPA 1FT7A 3KZWA 4ZYQA 4JYWA 5EBVA 2YNCA 1RTQA 4YRHA 3S6HA 4NF1A 5J8CA 1TKHA 3I9SA 4UEZA 2PJ5A 3DSBA 4PXCA 3BJ8A 1QMUA 4PXEA 3GYAA 2EUIA 2C1CA 3D66A 4A37A 1IOIA 1YGHA 6CPAA 4MHYA 3WABA 3B35A 3SJGA 2PIZA 4AVAA 2PJ2A 3RAMA 3D67A 2AE6A 2RB7A 1XFOA 1H8LA 4H6UA 4MFKA 2OZGA 2G3AA 5I4MA 4NGMA 4KOUA 2ZOFA 4CAEA 2Q7SA 2PIYA 2V77A 3QAHA 2B4DB 5DWNA 4CGLA 2Z0ZA 2Z3MA 2WZNA 3DLJA 1PCAA 3HLPA 1GYTA 3ZZIA 2Z11A 1NE9A 1S5KA 1V0CA 4IF5A 2NYQA 3GB0A 3NH5A 1HDQA 1VIXA 5IB0A 5G20A 5LYFA 1XF8A 1QSNA 3D3SA 4JZ0A 2HC9A 1BPMA 2GU2A 2JDDA 2B58A 5AG6A 5D29A 2HUZA 3KGQA 4F6AA 4P44A 4HNWB 1M4DA 1EE3P 1TF8A 1ARMA 2ZEPA 4R7MA 4EMEA 3KHZA 1YLOA 4KS9A 2Z3PA 2R1IA 7CPAA 2IMOA 4MXUA 3G8WA 1Q2DA 1LANA 4UA3A 4LUAA 2ZXVA 2Z10A 1KUVA 1R3NA 2K5TA 3D7FA 4IAVA 4MHPA 4UCPA 5AG5A 2B4DA 5LRKA 2EK8A 2IL4A 2BSWA 4B5PA 2F8HA 3CXQA 5EMIA 4FD4A 1F2OA 1IOFA 1YX0A 1CPSA 2C6PA 2WPWA 3EXNA 4HPSA 4PPZA 5GCNA 4C68A 4EVYA 2PVVA 3CPAA 5HVHA 1MK4A 2R8VA 4RUHA 2OU2A 4EFDA 1P0HA 4CAFA 3N5FA 1S7NA 4P6YA 4G1PA 1JQGA 4M6IA 2PR8A 3FYNA 2NSMA 2WSAA 2B5GA 1KUYA 2GREA 2EVNA 2RC4A 3IU2A 3H5ZA 2PJ3A 4JWPA 4QB9A 4ZY2A 5JH9A 1PUAA 4AG7A 2REFA 4MHZA 1IB1E 1Z4EA 3S9LA 3TO7A 3F0AA 3N7ZA 3KQXA 1RO5A 4NXYA 4O23A 4U5YA 4XPDC 4C7HA 4DJLA 3WC5A 3D4UA 4F0YA 4KUAA 3MN8A 2JEVA 5KTAA 4B5PB 1QSMA 5C88A 3TFYA 2PCUA 2RFHA 5JQ4A 4JLYA 3JTKA 3P2FA 4CAXA 3LMSA 4KSIA 5BWAB 1Z5RA 3JUWA 1QSOA 5CPAA 2I79A 5CBMA 1ZG7A 4KORA 3R95A 2OR4A 3B8GA 4MI4A 4KOYA 3CT9A 3V8IA 2QIRA 4RN7A 1YK3A 4MFQA 2Q4VA 1QSTA 1R43A 1ZO0A 2ZEMA 2HQYA 3B3WA 3B7IA 4NFRA 4ZBGA 4XPDB 4XNHC 5LRJA 3FVLA 4KOXA 2PE3A 3DNSA 5ISVA 3H4QA 4R57A 4CYOA 3FNCA 2ZW4A 1UFHA 1YW6A 3R9FA 4BINA 4WJBA 4KLVA 4L8AA 2JDCA 2DF5A 4L89A 4PSWA 1X12A 3R96A 3S6FA 5K8MA 2VEZA 2VL1A 1MJ9A 3TX8A 2PJBA 1S7KA 4ZI6A 2I00A 4YFJA 4UWIA 4ZY0A 1CM0A 2O53A 4F8ZA 5K8PA 5J8FA 3BLNA 4OC5A 3PB6X 2OZHA 4HKFA 4U9ZA 4I49A 2V8GA 4UEFA 4CRYB 3P2HA 4ZY1A 1JWQA 3FMCA 4HNXB 2YGWA 5IX3A 3CZXA 4X2TA 4GXHA 3FBUA 3D2PA 3TTHA 4DYOA 4F9UA 3G3SA 1M4GA 1M4LA 3TOAA 5HXDA 1PYTB 4MFZA 3W6XA 2JLMA 2VBQA 2AFWA 2GANA 3IU1A 4X5KA 3CDXA 3NE8A 2ZEDA 4Q36A 2O4HA 4R9MA 5E96A 4KSFA 1Z8WA 3BHXA 4FD5A 1ZLHA 3FX6A 5JGFA 3IWWA 4AVBA 1QQ9A 5G22A 2ODFA 3B3SA 1OBRA 4LX9A 4NGNA 2AFOA 2PRQA 4KOSA 3IWGA 2ZOGA 2AFXA 1LOKA 2DXQA 3BJ7A 3FH4A 3RYOA 4MCPA 1XMTA 1IYKA 2JBKA 4DNCA 4KLWA 1VKCA 3EO4A 2PJ7A 1XOVA 4K3NA 3VARA 4A33A 5F09A 4NGQA 2FS5A 4MFJA 3NH4A 2CNMA 2G3TA 3IC1A 4U9YA 3VH9A 1OZPA 3KL9A 1I12A 2FXFA 2KCWA 1B87A 1TXRA 2ZEFA 2D4OA 2XEIA 4KVOE 2PR1A 4II9A 3LACA 4Y49B 2IJZA 5HMNA 1NSLA 2GFQA 5J1QA 1Q7LA 4ORFA 4ONWA 4UIAA 4ZGYB 4BBHA 1TKJA 3CXPA 3TC8A 1S60A 2VQYA 2Z3OA 4CPAA 3TO9A 1AMPA 1Y0RA 1MJBA 5F48A 1Z4RA 1Y7RA 3ZJ0A 1CPXA 2CNTA 1CP6A 1L0CA 3H8FA 4JXRA 4P4BA 5H86A 4CRZB 3JVNA 3GIUA 2FSRA 4ZX8A 3D2MA 3JRUA 3DDDA 3GUXA 5IB9A 4FUUA 3TO6A 4QVTA 4R8FA 4Q7AA 4PQAA 2B4BA 4NGRA 3K9TA 1YMEA 3GY9A 3MGDA 2REEA 2ZEGA 2BO9A 1HEEA 4MFLA 4Y49C 4AVCA 4K30A 4M6HA 4NSQA 2X7BA 2OZUA 1YVKA 4RS2A 5IV0A 1M44A 2J8MA 1S7FA 2CY2A 4LQ6A 1M4IA 4UFWA 3D7GA 1ELLP 5I0CA 2BOAA 4YGOA 4XPKA 2Q7BA 4A2ZA 4PK3A 2A4NA 3NE7A 3PZJA 4R3LA 2C27A 2AJ6A 5KTCA 3KI9A 4H89A 2PQ8A 2Z3LA 3FXTA 2DPSA 2R98A 2V8HA 1NMTA 2J8NA 3RO0A 3BI0A 3CXSA 5AG4A 4A39A 4MHDA 4R6TA 5KTDA 4UIBA 1VGYA 4X3RA 3NH8A 4MRIA 4OC4A 4R87A 3SJEA 1DTDA 4X8IA 1J4JA 5AG7A 4KOVA 2F7VA 2FIAA 4GS4A 4HNYB 4FWUA 3T8WA 3SXNA 4MBUA 2PDOA 4CGOA 3WC6A 2ZEOA 4CYPA 1Q2CA 4QUSA 2Z3KA 3K9UA 1UWYA 4PSXA 2POKA 2AFMA 3KHXA 4CYQA
chains in the Genus database with same CATH topology
2J8RA 3DR6A 4MY0A 4KSAA 1N71A 4AB7A 1IIDA 4MY3A 3T90A 2Q44A 1PU9A 1I21A 5AGEA 3EY5A 4B10A 3R9GA 3IGRA 4QC6A 2ZW7A 2VI7A 2HV2A 3SXOA 4E0AA 2R7HA 4C7IA 2ZW6A 5HH1A 4UCMA 3OWCA 2BUEA 2Y0MA 2G0BA 2Q04A 1K4JA 4MFPA 2ZW5A 4C2ZA 2ZPAA 4F0XA 4UCNA 4CGMA 2F5IA 2ATRA 5G21A 1KUXA 2VZZA 3PGPA 2FE7A 1MJAA 4NEXA 4KUBA 1YR0A 4OLLA 3S6KA 1M1DA 5CNPA 1YREA 4PK2A 4CAVA 3A9LA 4M85A 5C82A 4QBJA 4A32A 2FCKA 1SQHA 3D8PA 1U6MA 4KZTA 3W6SA 2PRBA 2WPXA 3S6GA 2QECA 2P6FA 4KOTA 1B6BA 2VXKA 4J3GA 3VWDA 2FL4A 5FVJA 3SHPA 1KZFA 2DPTA 1IYLA 4UBRA 4E8OA 4M3SA 5F47A 2YNCC 1ON0A 3R9EA 1TIQA 4KVME 5DWMA 4A31A 2H5MA 3F8KA 4FD6A 5G1ZA 2CNSA 4KOWA 3GKRA 4RI1A 4UFXA 4OADA 3FIXA 4C2YA 3PP9A 2B5GB 2D4PA 1XE4A 1YLEA 1VHSA 4B13A 2B3UA 1IICA 3EC4A 3W91A 1BO4A 2BL1A 1R57A 2CXAA 3T9YA 4XNHB 5F49A 5H84A 2GE3A 3DR8A 3F5BA 5A28A 2Q0YA 3TOBA 4AG9A 4NCZA 2YNEA 1XEBA 2WUUA 4CAWA 2VZYA 4OAEA 2P6GA 1GHEA 4IUSA 1I1DA 3TE4A 3R1KA 4B14A 1WK4A 2Z3NA 1S7LA 4JJXA 1Y9WA 3I3GA 4JD6A 4CYNA 4A30A 4A95A 2ARHA 3IWEA 1S3ZA 3UY5A 4C2XA 2QMLA 4B12A 4Q38A 2BEIA 2P6EA 3E0KA 2PSWA 4KVXA 4UWJA 2YNDA 2OH1A 4E2AA 1RXTA 4JXQA 1QSRA 3FB3A 2P0WA 3LODA 4CS0B 1YVOA 3LD2A 3WR7A 4CGNA 1LRZA 3TT2A 1P4NA 2Q4YA 5EC4A 5JPHA 4UFVA 4R3KA 1CJWA 1WWZA 3C26A 1Y9KA 3VWEA 5F46A 2O28A 4FD7A 3TCVA 2PC1A 3KKWA 4MJ8A 1FY7A 4B11A 1Q2YA 4BMHA 1XIXA 1BOBA 2OB0A 2GIVA 4XPLA 1Z9UA 2NMTA 3EFAA 2FT0A 5A27A 4H6ZA 2B3VA 2FIWA 3FRMA 4B5OA 4CGPA 3QB8A 4ONUA 4PV6A 5EBVA 2YNCA 3S6HA 4YRHA 4NF1A 5J8CA 3I9SA 3DSBA 3BJ8A 3GYAA 2EUIA 1YGHA 4AVAA 2AE6A 4H6UA 4MFKA 2OZGA 2G3AA 4KOUA 4CAEA 3QAHA 2B4DB 5DWNA 4CGLA 2Z0ZA 2Z3MA 3ZZIA 2Z11A 1NE9A 1S5KA 1V0CA 4IF5A 5IB0A 5G20A 1XF8A 1QSNA 3D3SA 2JDDA 2B58A 5AG6A 2HUZA 4F6AA 4HNWB 1M4DA 4KS9A 2Z3PA 2R1IA 3G8WA 1Q2DA 4UA3A 4LUAA 2ZXVA 1KUVA 2K5TA 4UCPA 5AG5A 2B4DA 2IL4A 2BSWA 4B5PA 3CXQA 4FD4A 3EXNA 1YX0A 2WPWA 5GCNA 4EVYA 4C68A 1MK4A 2R8VA 2OU2A 1P0HA 4CAFA 1S7NA 2PR8A 3FYNA 2WSAA 2B5GA 1KUYA 2RC4A 2EVNA 3IU2A 4QB9A 3H5ZA 4JWPA 1PUAA 4AG7A 2REFA 1IB1E 1Z4EA 3TO7A 3F0AA 3N7ZA 1RO5A 4NXYA 4U5YA 4XPDC 4C7HA 4F0YA 4KUAA 2JEVA 5KTAA 4B5PB 1QSMA 5C88A 3TFYA 5JQ4A 4JLYA 3JTKA 3P2FA 4CAXA 5BWAB 3JUWA 1QSOA 2I79A 4KORA 3R95A 3B8GA 4MI4A 4KOYA 3V8IA 2QIRA 1YK3A 4MFQA 2Q4VA 1QSTA 1ZO0A 2HQYA 4ZBGA 4XPDB 4XNHC 4KOXA 3DNSA 5ISVA 3H4QA 4R57A 4CYOA 3FNCA 2ZW4A 1UFHA 3R9FA 4KLVA 4L8AA 2JDCA 4L89A 4PSWA 3R96A 3S6FA 2VEZA 1MJ9A 1S7KA 2I00A 4YFJA 4UWIA 1CM0A 5J8FA 3BLNA 2OZHA 4HKFA 4U9ZA 4I49A 4CRYB 3P2HA 4HNXB 2YGWA 5IX3A 3TTHA 3FBUA 3D2PA 3G3SA 1M4GA 3TOAA 3W6XA 4MFZA 2JLMA 2VBQA 2GANA 3IU1A 4X5KA 4Q36A 4R9MA 5E96A 4KSFA 4FD5A 4AVBA 5G22A 4LX9A 4KOSA 3IWGA 2DXQA 3BJ7A 3RYOA 1XMTA 1IYKA 4DNCA 4KLWA 1VKCA 3EO4A 4A33A 2FS5A 4MFJA 2CNMA 2G3TA 4U9YA 1OZPA 1I12A 2FXFA 2KCWA 1B87A 2D4OA 4KVOE 2PR1A 4II9A 4Y49B 5HMNA 1NSLA 4ORFA 4ZGYB 4BBHA 3CXPA 1S60A 2VQYA 2Z3OA 3TO9A 1MJBA 5F48A 1Z4RA 1Y7RA 3ZJ0A 2CNTA 1L0CA 4JXRA 5H86A 4CRZB 3JVNA 2FSRA 3D2MA 3DDDA 3TO6A 4QVTA 2B4BA 3GY9A 3MGDA 2REEA 4AVCA 4MFLA 4Y49C 4K30A 4NSQA 2X7BA 2OZUA 1YVKA 4RS2A 5IV0A 1M44A 2J8MA 1S7FA 2CY2A 1M4IA 4UFWA 5I0CA 4YGOA 4XPKA 2Q7BA 4A2ZA 4PK3A 2A4NA 3NE7A 3PZJA 4R3LA 2C27A 2AJ6A 5KTCA 4H89A 2PQ8A 2Z3LA 3FXTA 2DPSA 2R98A 1NMTA 2J8NA 3CXSA 5AG4A 5KTDA 4MHDA 4R87A 1J4JA 5AG7A 4KOVA 2FIAA 4GS4A 4HNYB 3SXNA 4MBUA 2PDOA 4CGOA 4CYPA 1Q2CA 4QUSA 2Z3KA 3K9UA 4PSXA 2Z10A 4CYQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J8R A;  3DR6 A;  4MY0 A;  1N71 A;  4AB7 A;  1IID A;  4MY3 A;  3T90 A;  2Q44 A;  1PU9 A;  1I21 A;  3EY5 A;  3R9G A;  3IGR A;  4QC6 A;  2ZW7 A;  2VI7 A;  2HV2 A;  3SXO A;  4E0A A;  2R7H A;  2ZW6 A;  5HH1 A;  3OWC A;  2BUE A;  2Y0M A;  2G0B A;  2Q04 A;  1K4J A;  2ZW5 A;  2ZPA A;  2F5I A;  2ATR A;  1KUX A;  2VZZ A;  3PGP A;  2FE7 A;  1MJA A;  4NEX A;  4KUB A;  1YR0 A;  4OLL A;  3S6K A;  1M1D A;  5CNP A;  1YRE A;  4PK2 A;  4CAV A;  4M85 A;  5C82 A;  4QBJ A;  2FCK A;  1SQH A;  3D8P A;  1U6M A;  4KZT A;  3W6S A;  2PRB A;  2WPX A;  3S6G A;  2QEC A;  2P6F A;  4KOT A;  1B6B A;  2VXK A;  4J3G A;  3VWD A;  2FL4 A;  5FVJ A;  3SHP A;  1KZF A;  1IYL A;  4UBR A;  4E8O A;  4M3S A;  5F47 A;  3R9E A;  1ON0 A;  1TIQ A;  4KVM E;  5DWM A;  2H5M A;  3F8K A;  4FD6 A;  2CNS A;  4KOW A;  3GKR A;  4RI1 A;  4OAD A;  3FIX A;  3PP9 A;  2B5G B;  2D4P A;  1XE4 A;  1YLE A;  1VHS A;  2B3U A;  1IIC A;  3EC4 A;  3W91 A;  1BO4 A;  2BL1 A;  1R57 A;  3T9Y A;  4XNH B;  5F49 A;  5H84 A;  2GE3 A;  3DR8 A;  3F5B A;  2Q0Y A;  3TOB A;  4AG9 A;  4NCZ A;  1XEB A;  4CAW A;  2VZY A;  4OAE A;  2P6G A;  1GHE A;  4IUS A;  1I1D A;  3TE4 A;  3R1K A;  1WK4 A;  1S7L A;  4JJX A;  1Y9W A;  3I3G A;  4JD6 A;  2ARH A;  1S3Z A;  3UY5 A;  2QML A;  2BEI A;  2P6E A;  3E0K A;  2PSW A;  4KVX A;  4UWJ A;  2OH1 A;  4E2A A;  1RXT A;  4JXQ A;  1QSR A;  3FB3 A;  2P0W A;  3LOD A;  4CS0 B;  1YVO A;  3LD2 A;  3WR7 A;  1LRZ A;  3TT2 A;  1P4N A;  2Q4Y A;  5EC4 A;  5JPH A;  4R3K A;  1CJW A;  1WWZ A;  3C26 A;  1Y9K A;  3VWE A;  5F46 A;  2O28 A;  4FD7 A;  3TCV A;  2PC1 A;  3KKW A;  4MJ8 A;  1FY7 A;  1Q2Y A;  4BMH A;  1XIX A;  1BOB A;  2OB0 A;  2GIV A;  4XPL A;  1Z9U A;  2NMT A;  3EFA A;  2FT0 A;  2B3V A;  2FIW A;  4H6Z A;  3FRM A;  4B5O A;  3QB8 A;  4ONU A;  4PV6 A;  5EBV A;  3S6H A;  4YRH A;  4NF1 A;  5J8C A;  3I9S A;  3DSB A;  3BJ8 A;  3GYA A;  2EUI A;  1YGH A;  4AVA A;  2AE6 A;  4H6U A;  2OZG A;  2G3A A;  4KOU A;  3QAH A;  2B4D B;  5DWN A;  2Z0Z A;  3ZZI A;  2Z11 A;  1NE9 A;  1S5K A;  1V0C A;  4IF5 A;  5IB0 A;  1XF8 A;  1QSN A;  3D3S A;  2JDD A;  2B58 A;  2HUZ A;  4F6A A;  4HNW B;  1M4D A;  2R1I A;  3G8W A;  1Q2D A;  4UA3 A;  4LUA A;  2ZXV A;  1KUV A;  2K5T A;  2B4D A;  2IL4 A;  2BSW A;  4B5P A;  3CXQ A;  4FD4 A;  3EXN A;  1YX0 A;  2WPW A;  5GCN A;  4EVY A;  1MK4 A;  2R8V A;  2OU2 A;  1P0H A;  1S7N A;  2PR8 A;  3FYN A;  2B5G A;  1KUY A;  2RC4 A;  2EVN A;  4QB9 A;  4JWP A;  1PUA A;  4AG7 A;  2REF A;  1IB1 E;  1Z4E A;  3TO7 A;  3F0A A;  3N7Z A;  1RO5 A;  4NXY A;  4U5Y A;  4XPD C;  4F0Y A;  4KUA A;  2JEV A;  5KTA A;  4B5P B;  1QSM A;  5C88 A;  3TFY A;  5JQ4 A;  4JLY A;  3P2F A;  4CAX A;  3JUW A;  1QSO A;  2I79 A;  4KOR A;  3R95 A;  3B8G A;  4MI4 A;  4KOY A;  3V8I A;  2QIR A;  1YK3 A;  2Q4V A;  1QST A;  2HQY A;  4ZBG A;  4XPD B;  4XNH C;  4KOX A;  3DNS A;  5ISV A;  3H4Q A;  4R57 A;  3FNC A;  2ZW4 A;  1UFH A;  3R9F A;  4KLV A;  4L8A A;  2JDC A;  4L89 A;  4PSW A;  3R96 A;  3S6F A;  2VEZ A;  1MJ9 A;  1S7K A;  2I00 A;  4YFJ A;  4UWI A;  1CM0 A;  5J8F A;  3BLN A;  2OZH A;  4HKF A;  4U9Z A;  4I49 A;  4CRY B;  3P2H A;  4HNX B;  5IX3 A;  3TTH A;  3FBU A;  3D2P A;  3G3S A;  1M4G A;  3TOA A;  3W6X A;  2JLM A;  2VBQ A;  2GAN A;  4X5K A;  4R9M A;  5E96 A;  4FD5 A;  4AVB A;  4LX9 A;  4KOS A;  3IWG A;  2DXQ A;  3BJ7 A;  3RYO A;  1XMT A;  1IYK A;  4DNC A;  4KLW A;  1VKC A;  3EO4 A;  2FS5 A;  2CNM A;  2G3T A;  4U9Y A;  1OZP A;  1I12 A;  2FXF A;  2KCW A;  1B87 A;  2D4O A;  4KVO E;  2PR1 A;  4II9 A;  4Y49 B;  5HMN A;  1NSL A;  4ORF A;  3CXP A;  1S60 A;  2VQY A;  3TO9 A;  1MJB A;  5F48 A;  1Z4R A;  1Y7R A;  3ZJ0 A;  2CNT A;  1L0C A;  4JXR A;  5H86 A;  4CRZ B;  3JVN A;  2FSR A;  3D2M A;  3DDD A;  3TO6 A;  4QVT A;  2B4B A;  3GY9 A;  3MGD A;  2REE A;  4AVC A;  4Y49 C;  4K30 A;  4NSQ A;  2X7B A;  2OZU A;  1YVK A;  4RS2 A;  5IV0 A;  1M44 A;  2J8M A;  1S7F A;  2CY2 A;  1M4I A;  5I0C A;  4YGO A;  4XPK A;  2Q7B A;  4PK3 A;  2A4N A;  3NE7 A;  3PZJ A;  4R3L A;  2C27 A;  2AJ6 A;  5KTC A;  4H89 A;  2PQ8 A;  3FXT A;  2R98 A;  1NMT A;  2J8N A;  3CXS A;  5KTD A;  4MHD A;  4R87 A;  1J4J A;  4KOV A;  2FIA A;  4GS4 A;  4HNY B;  3SXN A;  4MBU A;  2PDO A;  1Q2C A;  4QUS A;  3K9U A;  4PSX A;  2Z10 A; 
#chains in the Genus database with same CATH topology
 3FF3 A;  4TWE A;  3B3T A;  2J8R A;  2ZEL A;  3DR6 A;  4KSA A;  4MY0 A;  1N71 A;  4AB7 A;  1IID A;  4MY3 A;  1BPN A;  3H8G A;  1Z8L A;  1ZLI A;  3T90 A;  3KR5 A;  3PB9 X;  3S9M A;  2Q44 A;  4A94 A;  3B3V A;  1PU9 A;  4IHM A;  3KAS A;  8CPA A;  1I21 A;  5AGE A;  3EY5 A;  4NGS A;  4B10 A;  3R9G A;  3WC7 A;  2WYR A;  3IGR A;  4QC6 A;  2ZW7 A;  2HB6 A;  2VI7 A;  2HV2 A;  4WWV A;  3SXO A;  4E0A A;  4W9Y A;  2R7H A;  4C7I A;  3H8E A;  2ZW6 A;  2PJ1 A;  1NSA A;  5HH1 A;  4UCM A;  2Q4Z A;  3OWC A;  4A38 A;  2JEW A;  2CTB A;  2BUE A;  2Y0M A;  2G0B A;  2Q04 A;  1K4J A;  4MFP A;  4NGT A;  4BD9 A;  2ABZ A;  2ZW5 A;  3WT4 A;  4C2Z A;  4P10 A;  4EWT A;  2ZPA A;  4NJQ A;  4IK2 A;  3IEH A;  3RBU A;  1KWM A;  1Y7E A;  4F0X A;  2J9A A;  1LFW A;  1VHE A;  3BXM A;  4UCN A;  4CGM A;  1ELM P;  2F5I A;  4NGP A;  2ATR A;  4P45 A;  5G21 A;  1IGB A;  1KUX A;  2VZZ A;  3PGP A;  4MHN A;  2GLF A;  2FE7 A;  1MJA A;  4FBE A;  1YSJ A;  4NEX A;  4KUB A;  1CBX A;  2QJ8 A;  4P4I A;  2V8V A;  4H2K A;  3K2K A;  1YR0 A;  4OLL A;  2OOT A;  3IJ3 A;  3S6K A;  1M1D A;  5CNP A;  3SI0 A;  1A2Z A;  1YRE A;  1FNO A;  5D8N A;  1F2P A;  4PK2 A;  4CAV A;  3SI2 A;  1BAV A;  3A9L A;  2ZEE A;  4M85 A;  4NJR A;  5C82 A;  4QBJ A;  4A32 A;  1HDU A;  2FCK A;  2CF4 A;  1YQE A;  3B2Y A;  5K8N A;  1SQH A;  1XMB A;  1U6M A;  2PJ8 A;  3D8P A;  2PRB A;  2WPX A;  3ISZ A;  2QEC A;  4KZT A;  3BI1 A;  2P6F A;  3S6G A;  4KOT A;  2C6G A;  2CTC A;  1B6B A;  2VXK A;  4J3G A;  3VWD A;  2CIJ A;  2EK9 A;  5K8O A;  2FL4 A;  5FVJ A;  3SHP A;  1KZF A;  2DPT A;  3S9N A;  1IYL A;  3ISX A;  4UBR A;  4E8O A;  4M3S A;  5F47 A;  1CG2 A;  1ON0 A;  2YNC C;  3PBE A;  4TNU A;  5LRG A;  3R9E A;  3RZA A;  1TIQ A;  3MRU A;  3KR4 A;  4KVM E;  4PXB A;  1VHO A;  2EO8 A;  1DE4 C;  2PJ0 A;  5DWM A;  5LYI A;  2JBJ A;  2H5M A;  4A31 A;  3F8K A;  4FD6 A;  5G1Z A;  5HVF A;  3RNZ A;  1Z2L A;  3D68 A;  4UF4 A;  2CNS A;  2PJA A;  4P4F A;  4KOW A;  3GKR A;  4MMO A;  4RI1 A;  4UFX A;  4OAD A;  1ZG9 A;  4OC1 A;  3FIX A;  1Y0Y A;  4MCR A;  2EWB A;  2PJC A;  4C2Y A;  2Q43 A;  3FEE A;  1X10 A;  2BCO A;  1XJO A;  3B3C A;  3PP9 A;  1ZG8 A;  1IY7 A;  2B5G B;  2D4P A;  1XE4 A;  1YLE A;  5HVG A;  1VHS A;  4B13 A;  2B3U A;  1IIC A;  3EC4 A;  3KQZ A;  3W91 A;  1BO4 A;  2BL1 A;  4OKO A;  1R57 A;  2CXA A;  5DS0 A;  4XNH B;  5F49 A;  3T9Y A;  3GLJ A;  4PXD A;  5H84 A;  5ELY A;  4OME A;  2GE3 A;  3DR8 A;  3IO1 A;  4MCS A;  3F5B A;  5A28 A;  2Q0Y A;  3PBB A;  3TOB A;  4P4E A;  4AG9 A;  4NCZ A;  2YNE A;  2XEF A;  1XEB A;  2WUU A;  4CAW A;  2VZY A;  3HUV A;  2V8D A;  2XEG A;  3QAY A;  4OAE A;  2P6G A;  4FAI A;  1GHE A;  2PJ9 A;  1I1D A;  4IUS A;  3FED A;  3TE4 A;  1ARL A;  3R1K A;  4B14 A;  3NFZ A;  1IU8 A;  1WK4 A;  1F57 A;  4LQG A;  1LAP A;  2Z3N A;  1S7L A;  2Q51 A;  3IFE A;  4YU9 A;  1TF9 A;  4JJX A;  1Y9W A;  3I3G A;  3SI1 A;  4JD6 A;  1CP7 A;  4CYN A;  4A30 A;  4A95 A;  2ARH A;  2G9D A;  2FVG A;  3IWE A;  3PB4 X;  1S3Z A;  3PRT A;  3UY5 A;  1LAM A;  4C2X A;  2QML A;  3PFO A;  4B12 A;  4Q38 A;  5LYD A;  2BEI A;  2P6E A;  3D7D A;  3E0K A;  2PSW A;  4OIW A;  3SJX A;  4KVX A;  5THW A;  4UWJ A;  4GM5 A;  3QNV A;  2YND A;  2OH1 A;  4P4D A;  1BLL E;  1RXT A;  1QSR A;  3FB3 A;  4JXQ A;  4E2A A;  1Z8X A;  3SJF A;  2P0W A;  4OC3 A;  3D7H A;  3LOD A;  4M6G A;  4CS0 B;  1YVO A;  3LD2 A;  3WR7 A;  3I1U A;  4YWY A;  4CGN A;  1LRZ A;  1Z8T A;  4AXV A;  3TT2 A;  2ANP A;  1P4N A;  2I3C A;  2Q4Y A;  5EC4 A;  3V38 A;  2GLJ A;  4ZX9 A;  2EBJ A;  4UFV A;  3PFE A;  4R3K A;  5JPH A;  1CJW A;  4Z65 A;  1WWZ A;  3C26 A;  5LYL A;  2DEA A;  1Y9K A;  3VWE A;  3FEC A;  5F46 A;  2O28 A;  4DUK A;  3CPX A;  1LCP A;  2QYV A;  3LWU A;  2AFZ A;  4FD7 A;  3TCV A;  1AUG A;  1TKF A;  2PVW A;  4F9V A;  2PC1 A;  3KKW A;  4OID A;  4OC0 A;  3PB7 X;  2ZEH A;  2ZEN A;  4MJ8 A;  1FY7 A;  2IQ6 A;  2XEJ A;  3PEI A;  2C6C A;  4P4J A;  4B11 A;  1Q2Y A;  4BMH A;  1CX8 A;  1XIX A;  3L2N A;  1BOB A;  3FJU A;  2OB0 A;  3IIB A;  4MCQ A;  4R76 A;  4OP4 A;  3V7Z A;  2AFU A;  2GIV A;  3PB8 X;  1XRY A;  1XBU A;  2AFS A;  2PJ4 A;  4OC2 A;  4XPL A;  3VAT A;  1Z9U A;  4B6Z A;  5JM6 A;  2NMT A;  1AYE A;  3EFA A;  4UEE A;  3NA6 A;  2FT0 A;  3DGV A;  5A27 A;  2PJ6 A;  2B3V A;  2FIW A;  4H6Z A;  3FRM A;  4B5O A;  1YW4 A;  4CGP A;  3W6S A;  3QB8 A;  4ONU A;  4PV6 A;  2QVP A;  1FT7 A;  3KZW A;  4ZYQ A;  4JYW A;  5EBV A;  2YNC A;  1RTQ A;  4YRH A;  3S6H A;  4NF1 A;  5J8C A;  1TKH A;  3I9S A;  4UEZ A;  2PJ5 A;  3DSB A;  4PXC A;  3BJ8 A;  1QMU A;  4PXE A;  3GYA A;  2EUI A;  2C1C A;  3D66 A;  4A37 A;  1IOI A;  1YGH A;  6CPA A;  4MHY A;  3WAB A;  3B35 A;  3SJG A;  2PIZ A;  4AVA A;  2PJ2 A;  3RAM A;  3D67 A;  2AE6 A;  2RB7 A;  1XFO A;  1H8L A;  4H6U A;  4MFK A;  2OZG A;  2G3A A;  5I4M A;  4NGM A;  4KOU A;  2ZOF A;  4CAE A;  2Q7S A;  2PIY A;  2V77 A;  3QAH A;  2B4D B;  5DWN A;  4CGL A;  2Z0Z A;  2Z3M A;  2WZN A;  3DLJ A;  1PCA A;  3HLP A;  1GYT A;  3ZZI A;  2Z11 A;  1NE9 A;  1S5K A;  1V0C A;  4IF5 A;  2NYQ A;  3GB0 A;  3NH5 A;  1HDQ A;  1VIX A;  5IB0 A;  5G20 A;  5LYF A;  1XF8 A;  1QSN A;  3D3S A;  4JZ0 A;  2HC9 A;  1BPM A;  2GU2 A;  2JDD A;  2B58 A;  5AG6 A;  5D29 A;  2HUZ A;  3KGQ A;  4F6A A;  4P44 A;  4HNW B;  1M4D A;  1EE3 P;  1TF8 A;  1ARM A;  2ZEP A;  4R7M A;  4EME A;  3KHZ A;  1YLO A;  4KS9 A;  2Z3P A;  2R1I A;  7CPA A;  2IMO A;  4MXU A;  3G8W A;  1Q2D A;  1LAN A;  4UA3 A;  4LUA A;  2ZXV A;  2Z10 A;  1KUV A;  1R3N A;  2K5T A;  3D7F A;  4IAV A;  4MHP A;  4UCP A;  5AG5 A;  2B4D A;  5LRK A;  2EK8 A;  2IL4 A;  2BSW A;  4B5P A;  2F8H A;  3CXQ A;  5EMI A;  4FD4 A;  1F2O A;  1IOF A;  1YX0 A;  1CPS A;  2C6P A;  2WPW A;  3EXN A;  4HPS A;  4PPZ A;  5GCN A;  4C68 A;  4EVY A;  2PVV A;  3CPA A;  5HVH A;  1MK4 A;  2R8V A;  4RUH A;  2OU2 A;  4EFD A;  1P0H A;  4CAF A;  3N5F A;  1S7N A;  4P6Y A;  4G1P A;  1JQG A;  4M6I A;  2PR8 A;  3FYN A;  2NSM A;  2WSA A;  2B5G A;  1KUY A;  2GRE A;  2EVN A;  2RC4 A;  3IU2 A;  3H5Z A;  2PJ3 A;  4JWP A;  4QB9 A;  4ZY2 A;  5JH9 A;  1PUA A;  4AG7 A;  2REF A;  4MHZ A;  1IB1 E;  1Z4E A;  3S9L A;  3TO7 A;  3F0A A;  3N7Z A;  3KQX A;  1RO5 A;  4NXY A;  4O23 A;  4U5Y A;  4XPD C;  4C7H A;  4DJL A;  3WC5 A;  3D4U A;  4F0Y A;  4KUA A;  3MN8 A;  2JEV A;  5KTA A;  4B5P B;  1QSM A;  5C88 A;  3TFY A;  2PCU A;  2RFH A;  5JQ4 A;  4JLY A;  3JTK A;  3P2F A;  4CAX A;  3LMS A;  4KSI A;  5BWA B;  1Z5R A;  3JUW A;  1QSO A;  5CPA A;  2I79 A;  5CBM A;  1ZG7 A;  4KOR A;  3R95 A;  2OR4 A;  3B8G A;  4MI4 A;  4KOY A;  3CT9 A;  3V8I A;  2QIR A;  4RN7 A;  1YK3 A;  4MFQ A;  2Q4V A;  1QST A;  1R43 A;  1ZO0 A;  2ZEM A;  2HQY A;  3B3W A;  3B7I A;  4NFR A;  4ZBG A;  4XPD B;  4XNH C;  5LRJ A;  3FVL A;  4KOX A;  2PE3 A;  3DNS A;  5ISV A;  3H4Q A;  4R57 A;  4CYO A;  3FNC A;  2ZW4 A;  1UFH A;  1YW6 A;  3R9F A;  4BIN A;  4WJB A;  4KLV A;  4L8A A;  2JDC A;  2DF5 A;  4L89 A;  4PSW A;  1X12 A;  3R96 A;  3S6F A;  5K8M A;  2VEZ A;  2VL1 A;  1MJ9 A;  3TX8 A;  2PJB A;  1S7K A;  4ZI6 A;  2I00 A;  4YFJ A;  4UWI A;  4ZY0 A;  1CM0 A;  2O53 A;  4F8Z A;  5K8P A;  5J8F A;  3BLN A;  4OC5 A;  3PB6 X;  2OZH A;  4HKF A;  4U9Z A;  4I49 A;  2V8G A;  4UEF A;  4CRY B;  3P2H A;  4ZY1 A;  1JWQ A;  3FMC A;  4HNX B;  2YGW A;  5IX3 A;  3CZX A;  4X2T A;  4GXH A;  3FBU A;  3D2P A;  3TTH A;  4DYO A;  4F9U A;  3G3S A;  1M4G A;  1M4L A;  3TOA A;  5HXD A;  1PYT B;  4MFZ A;  3W6X A;  2JLM A;  2VBQ A;  2AFW A;  2GAN A;  3IU1 A;  4X5K A;  3CDX A;  3NE8 A;  2ZED A;  4Q36 A;  2O4H A;  4R9M A;  5E96 A;  4KSF A;  1Z8W A;  3BHX A;  4FD5 A;  1ZLH A;  3FX6 A;  5JGF A;  3IWW A;  4AVB A;  1QQ9 A;  5G22 A;  2ODF A;  3B3S A;  1OBR A;  4LX9 A;  4NGN A;  2AFO A;  2PRQ A;  4KOS A;  3IWG A;  2ZOG A;  2AFX A;  1LOK A;  2DXQ A;  3BJ7 A;  3FH4 A;  3RYO A;  4MCP A;  1XMT A;  1IYK A;  2JBK A;  4DNC A;  4KLW A;  1VKC A;  3EO4 A;  2PJ7 A;  1XOV A;  4K3N A;  3VAR A;  4A33 A;  5F09 A;  4NGQ A;  2FS5 A;  4MFJ A;  3NH4 A;  2CNM A;  2G3T A;  3IC1 A;  4U9Y A;  3VH9 A;  1OZP A;  3KL9 A;  1I12 A;  2FXF A;  2KCW A;  1B87 A;  1TXR A;  2ZEF A;  2D4O A;  2XEI A;  4KVO E;  2PR1 A;  4II9 A;  3LAC A;  4Y49 B;  2IJZ A;  5HMN A;  1NSL A;  2GFQ A;  5J1Q A;  1Q7L A;  4ORF A;  4ONW A;  4UIA A;  4ZGY B;  4BBH A;  1TKJ A;  3CXP A;  3TC8 A;  1S60 A;  2VQY A;  2Z3O A;  4CPA A;  3TO9 A;  1AMP A;  1Y0R A;  1MJB A;  5F48 A;  1Z4R A;  1Y7R A;  3ZJ0 A;  1CPX A;  2CNT A;  1CP6 A;  1L0C A;  3H8F A;  4JXR A;  4P4B A;  5H86 A;  4CRZ B;  3JVN A;  3GIU A;  2FSR A;  4ZX8 A;  3D2M A;  3JRU A;  3DDD A;  3GUX A;  5IB9 A;  4FUU A;  3TO6 A;  4QVT A;  4R8F A;  4Q7A A;  4PQA A;  2B4B A;  4NGR A;  3K9T A;  1YME A;  3GY9 A;  3MGD A;  2REE A;  2ZEG A;  2BO9 A;  1HEE A;  4MFL A;  4Y49 C;  4AVC A;  4K30 A;  4M6H A;  4NSQ A;  2X7B A;  2OZU A;  1YVK A;  4RS2 A;  5IV0 A;  1M44 A;  2J8M A;  1S7F A;  2CY2 A;  4LQ6 A;  1M4I A;  4UFW A;  3D7G A;  1ELL P;  5I0C A;  2BOA A;  4YGO A;  4XPK A;  2Q7B A;  4A2Z A;  4PK3 A;  2A4N A;  3NE7 A;  3PZJ A;  4R3L A;  2C27 A;  2AJ6 A;  5KTC A;  3KI9 A;  4H89 A;  2PQ8 A;  2Z3L A;  3FXT A;  2DPS A;  2R98 A;  2V8H A;  1NMT A;  2J8N A;  3RO0 A;  3BI0 A;  3CXS A;  5AG4 A;  4A39 A;  4MHD A;  4R6T A;  5KTD A;  4UIB A;  1VGY A;  4X3R A;  3NH8 A;  4MRI A;  4OC4 A;  4R87 A;  3SJE A;  1DTD A;  4X8I A;  1J4J A;  5AG7 A;  4KOV A;  2F7V A;  2FIA A;  4GS4 A;  4HNY B;  4FWU A;  3T8W A;  3SXN A;  4MBU A;  2PDO A;  4CGO A;  3WC6 A;  2ZEO A;  4CYP A;  1Q2C A;  4QUS A;  2Z3K A;  3K9U A;  1UWY A;  4PSX A;  2POK A;  2AFM A;  3KHX A;  4CYQ A; 
#chains in the Genus database with same CATH homology
 2J8R A;  3DR6 A;  4MY0 A;  4KSA A;  1N71 A;  4AB7 A;  1IID A;  4MY3 A;  3T90 A;  2Q44 A;  1PU9 A;  1I21 A;  5AGE A;  3EY5 A;  4B10 A;  3R9G A;  3IGR A;  4QC6 A;  2ZW7 A;  2VI7 A;  2HV2 A;  3SXO A;  4E0A A;  2R7H A;  4C7I A;  2ZW6 A;  5HH1 A;  4UCM A;  3OWC A;  2BUE A;  2Y0M A;  2G0B A;  2Q04 A;  1K4J A;  4MFP A;  2ZW5 A;  4C2Z A;  2ZPA A;  4F0X A;  4UCN A;  4CGM A;  2F5I A;  2ATR A;  5G21 A;  1KUX A;  2VZZ A;  3PGP A;  2FE7 A;  1MJA A;  4NEX A;  4KUB A;  1YR0 A;  4OLL A;  3S6K A;  1M1D A;  5CNP A;  1YRE A;  4PK2 A;  4CAV A;  3A9L A;  4M85 A;  5C82 A;  4QBJ A;  4A32 A;  2FCK A;  1SQH A;  3D8P A;  1U6M A;  4KZT A;  3W6S A;  2PRB A;  2WPX A;  3S6G A;  2QEC A;  2P6F A;  4KOT A;  1B6B A;  2VXK A;  4J3G A;  3VWD A;  2FL4 A;  5FVJ A;  3SHP A;  1KZF A;  2DPT A;  1IYL A;  4UBR A;  4E8O A;  4M3S A;  5F47 A;  2YNC C;  1ON0 A;  3R9E A;  1TIQ A;  4KVM E;  5DWM A;  4A31 A;  2H5M A;  3F8K A;  4FD6 A;  5G1Z A;  2CNS A;  4KOW A;  3GKR A;  4RI1 A;  4UFX A;  4OAD A;  3FIX A;  4C2Y A;  3PP9 A;  2B5G B;  2D4P A;  1XE4 A;  1YLE A;  1VHS A;  4B13 A;  2B3U A;  1IIC A;  3EC4 A;  3W91 A;  1BO4 A;  2BL1 A;  1R57 A;  2CXA A;  3T9Y A;  4XNH B;  5F49 A;  5H84 A;  2GE3 A;  3DR8 A;  3F5B A;  5A28 A;  2Q0Y A;  3TOB A;  4AG9 A;  4NCZ A;  2YNE A;  1XEB A;  2WUU A;  4CAW A;  2VZY A;  4OAE A;  2P6G A;  1GHE A;  4IUS A;  1I1D A;  3TE4 A;  3R1K A;  4B14 A;  1WK4 A;  2Z3N A;  1S7L A;  4JJX A;  1Y9W A;  3I3G A;  4JD6 A;  4CYN A;  4A30 A;  4A95 A;  2ARH A;  3IWE A;  1S3Z A;  3UY5 A;  4C2X A;  2QML A;  4B12 A;  4Q38 A;  2BEI A;  2P6E A;  3E0K A;  2PSW A;  4KVX A;  4UWJ A;  2YND A;  2OH1 A;  4E2A A;  1RXT A;  4JXQ A;  1QSR A;  3FB3 A;  2P0W A;  3LOD A;  4CS0 B;  1YVO A;  3LD2 A;  3WR7 A;  4CGN A;  1LRZ A;  3TT2 A;  1P4N A;  2Q4Y A;  5EC4 A;  5JPH A;  4UFV A;  4R3K A;  1CJW A;  1WWZ A;  3C26 A;  1Y9K A;  3VWE A;  5F46 A;  2O28 A;  4FD7 A;  3TCV A;  2PC1 A;  3KKW A;  4MJ8 A;  1FY7 A;  4B11 A;  1Q2Y A;  4BMH A;  1XIX A;  1BOB A;  2OB0 A;  2GIV A;  4XPL A;  1Z9U A;  2NMT A;  3EFA A;  2FT0 A;  5A27 A;  4H6Z A;  2B3V A;  2FIW A;  3FRM A;  4B5O A;  4CGP A;  3QB8 A;  4ONU A;  4PV6 A;  5EBV A;  2YNC A;  3S6H A;  4YRH A;  4NF1 A;  5J8C A;  3I9S A;  3DSB A;  3BJ8 A;  3GYA A;  2EUI A;  1YGH A;  4AVA A;  2AE6 A;  4H6U A;  4MFK A;  2OZG A;  2G3A A;  4KOU A;  4CAE A;  3QAH A;  2B4D B;  5DWN A;  4CGL A;  2Z0Z A;  2Z3M A;  3ZZI A;  2Z11 A;  1NE9 A;  1S5K A;  1V0C A;  4IF5 A;  5IB0 A;  5G20 A;  1XF8 A;  1QSN A;  3D3S A;  2JDD A;  2B58 A;  5AG6 A;  2HUZ A;  4F6A A;  4HNW B;  1M4D A;  4KS9 A;  2Z3P A;  2R1I A;  3G8W A;  1Q2D A;  4UA3 A;  4LUA A;  2ZXV A;  1KUV A;  2K5T A;  4UCP A;  5AG5 A;  2B4D A;  2IL4 A;  2BSW A;  4B5P A;  3CXQ A;  4FD4 A;  3EXN A;  1YX0 A;  2WPW A;  5GCN A;  4EVY A;  4C68 A;  1MK4 A;  2R8V A;  2OU2 A;  1P0H A;  4CAF A;  1S7N A;  2PR8 A;  3FYN A;  2WSA A;  2B5G A;  1KUY A;  2RC4 A;  2EVN A;  3IU2 A;  4QB9 A;  3H5Z A;  4JWP A;  1PUA A;  4AG7 A;  2REF A;  1IB1 E;  1Z4E A;  3TO7 A;  3F0A A;  3N7Z A;  1RO5 A;  4NXY A;  4U5Y A;  4XPD C;  4C7H A;  4F0Y A;  4KUA A;  2JEV A;  5KTA A;  4B5P B;  1QSM A;  5C88 A;  3TFY A;  5JQ4 A;  4JLY A;  3JTK A;  3P2F A;  4CAX A;  5BWA B;  3JUW A;  1QSO A;  2I79 A;  4KOR A;  3R95 A;  3B8G A;  4MI4 A;  4KOY A;  3V8I A;  2QIR A;  1YK3 A;  4MFQ A;  2Q4V A;  1QST A;  1ZO0 A;  2HQY A;  4ZBG A;  4XPD B;  4XNH C;  4KOX A;  3DNS A;  5ISV A;  3H4Q A;  4R57 A;  4CYO A;  3FNC A;  2ZW4 A;  1UFH A;  3R9F A;  4KLV A;  4L8A A;  2JDC A;  4L89 A;  4PSW A;  3R96 A;  3S6F A;  2VEZ A;  1MJ9 A;  1S7K A;  2I00 A;  4YFJ A;  4UWI A;  1CM0 A;  5J8F A;  3BLN A;  2OZH A;  4HKF A;  4U9Z A;  4I49 A;  4CRY B;  3P2H A;  4HNX B;  2YGW A;  5IX3 A;  3TTH A;  3FBU A;  3D2P A;  3G3S A;  1M4G A;  3TOA A;  3W6X A;  4MFZ A;  2JLM A;  2VBQ A;  2GAN A;  3IU1 A;  4X5K A;  4Q36 A;  4R9M A;  5E96 A;  4KSF A;  4FD5 A;  4AVB A;  5G22 A;  4LX9 A;  4KOS A;  3IWG A;  2DXQ A;  3BJ7 A;  3RYO A;  1XMT A;  1IYK A;  4DNC A;  4KLW A;  1VKC A;  3EO4 A;  4A33 A;  2FS5 A;  4MFJ A;  2CNM A;  2G3T A;  4U9Y A;  1OZP A;  1I12 A;  2FXF A;  2KCW A;  1B87 A;  2D4O A;  4KVO E;  2PR1 A;  4II9 A;  4Y49 B;  5HMN A;  1NSL A;  4ORF A;  4ZGY B;  4BBH A;  3CXP A;  1S60 A;  2VQY A;  2Z3O A;  3TO9 A;  1MJB A;  5F48 A;  1Z4R A;  1Y7R A;  3ZJ0 A;  2CNT A;  1L0C A;  4JXR A;  5H86 A;  4CRZ B;  3JVN A;  2FSR A;  3D2M A;  3DDD A;  3TO6 A;  4QVT A;  2B4B A;  3GY9 A;  3MGD A;  2REE A;  4AVC A;  4MFL A;  4Y49 C;  4K30 A;  4NSQ A;  2X7B A;  2OZU A;  1YVK A;  4RS2 A;  5IV0 A;  1M44 A;  2J8M A;  1S7F A;  2CY2 A;  1M4I A;  4UFW A;  5I0C A;  4YGO A;  4XPK A;  2Q7B A;  4A2Z A;  4PK3 A;  2A4N A;  3NE7 A;  3PZJ A;  4R3L A;  2C27 A;  2AJ6 A;  5KTC A;  4H89 A;  2PQ8 A;  2Z3L A;  3FXT A;  2DPS A;  2R98 A;  1NMT A;  2J8N A;  3CXS A;  5AG4 A;  5KTD A;  4MHD A;  4R87 A;  1J4J A;  5AG7 A;  4KOV A;  2FIA A;  4GS4 A;  4HNY B;  3SXN A;  4MBU A;  2PDO A;  4CGO A;  4CYP A;  1Q2C A;  4QUS A;  2Z3K A;  3K9U A;  4PSX A;  2Z10 A;  4CYQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...