2Z11A

Crystal structure of putative acetyltransferase
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
188
structure length
187
Chain Sequence
MWAFPERFEGRHVRLEPLALAHLPAFLRHYDPEVYRFLSRAPVAPTEEALRAHLEGLLGEPGRVNWAILFGKEVAGRISVIAPEPEHAKLELGTMLFKPFWGSPANKEAKLLLRHAFEVLRAERVQFKVDLRNERSQRALEALGAVREGVLRKNRRLPDGAFRDDVVYSVLKEEWPGVKARLEARLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribosomal-protein-alanine acetyltransferase
publication title Crystal structure of putative acetyltransferase
rcsb
source organism Thermus thermophilus
molecule tags Transferase
total genus 60
structure length 187
sequence length 188
ec nomenclature ec 2.3.1.128: Transferred entry: 2.3.1.267.
pdb deposition date 2007-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13302 Acetyltransf_3 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2z11A00
3R9EA 2FE7A 1YVKA 3BJ7A 5FVJA 2A4NA 4PSWA 3VWEA 2OB0A 3H4QA 3DSBA 4BMHA 2RC4A 2Q04A 3DR6A 5HH1A 3BJ8A 1RXTA 3V8IA 4K30A 3I9SA 2D4PA 1M4IA 2O28A 5J8CA 2PSWA 2G0BA 1PU9A 3K9UA 2OZUA 4KOVA 2Q44A 2FL4A 1Y7RA 2FSRA 1Z4RA 4CRYB 1R57A 3PGPA 3BLNA 2PC1A 3W6XA 3D2MA 3ZJ0A 1I1DA 2VQYA 4KOSA 1Z9UA 2VEZA 2Z11A 3F0AA 2C27A 3D3SA 5DWMA 2ZW7A 4KLVA 1IYLA 4QBJA 4XPDB 2OH1A 1IB1E 1Q2YA 2OU2A 4M85A 5IB0A 4MHDA 5C82A 2BEIA 2D4OA 2VZZA 5IX3A 3GKRA 2REFA 1ON0A 4E8OA 2J8RA 1QSOA 3SXOA 2B5GA 1S7FA 3S6FA 1VHSA 4XPKA 4L89A 1Y9KA 3SXNA 2FIAA 4Y49C 4PK3A 3GYAA 4KVXA 2Q7BA 3OWCA 1J4JA 5IV0A 2FIWA 2Q4YA 4L8AA 2H5MA 5H84A 1S60A 4JWPA 3TT2A 4FD4A 1TIQA 4AG7A 3GY9A 3JUWA 1K4JA 3PP9A 1S7LA 4M3SA 3LD2A 1B6BA 3G8WA 1QSRA 4FD7A 5GCNA 2X7BA 4IUSA 3EXNA 1MJAA 2KCWA 1U6MA 1KZFA 2IL4A 3ZZIA 4LX9A 1S5KA 2CNMA 4IF5A 3EC4A 2B5GB 2R8VA 3E0KA 2F5IA 1Q2CA 1M44A 1M4GA 4PSXA 4KZTA 3UY5A 2QMLA 3DR8A 3NE7A 4FD6A 4OADA 1NE9A 5KTDA 2J8NA 1MJBA 2ATRA 1QSMA 2Q4VA 3DDDA 4MY0A 1FY7A 4HNXB 2GANA 3D8PA 3SHPA 5C88A 5KTCA 1NSLA 4MY3A 3TCVA 1XMTA 2PR8A 4NCZA 2G3AA 4UWIA 2VXKA 4XNHC 4QVTA 2J8MA 4RS2A 3TO7A 1QSNA 5I0CA 1SQHA 1VKCA 4HKFA 5KTAA 4HNYB 4F6AA 3N7ZA 2VBQA 2FCKA 2G3TA 2ZW6A 4KUBA 4AVCA 2B3UA 1XE4A 3QAHA 5ISVA 1P4NA 3R9GA 2PRBA 1YR0A 4JD6A 1UFHA 4AG9A 2JEVA 4JJXA 2CY2A 3CXSA 5H86A 4CRZB 4DNCA 1S7NA 4CS0B 4OLLA 3TE4A 2FT0A 2B4DA 3PZJA 2P6FA 4E2AA 4QC6A 4H89A 3EFAA 4MI4A 4R57A 2PQ8A 5JPHA 1M1DA 5F47A 3FNCA 3KKWA 2P6GA 3B8GA 4NEXA 3TOAA 2Z0ZA 1WWZA 1L0CA 4KOXA 2FXFA 3FIXA 2VZYA 2REEA 3TFYA 3I3GA 4U5YA 4ZBGA 2AE6A 2I79A 4UBRA 2EVNA 4I49A 1PUAA 4H6UA 1XIXA 1I21A 2AJ6A 3FBUA 1MK4A 3P2HA 4CAWA 4GS4A 3JVNA 5HMNA 1OZPA 3CXQA 3MGDA 2PDOA 2CNSA 4JXQA 1GHEA 2BUEA 4HNWB 3IGRA 2VI7A 2B4DB 4KOUA 1YVOA 4KUAA 1LRZA 3CXPA 2JDCA 3F5BA 1YK3A 2FS5A 1Y9WA 4PV6A 1YLEA 4UA3A 4X5KA 1WK4A 2HQYA 3FXTA 4XPLA 3TO6A 4KVME 1N71A 4RI1A 3QB8A 1B87A 4R9MA 2B58A 3EY5A 2JDDA 2R7HA 3C26A 2QIRA 1YREA 5EBVA 4QUSA 3T9YA 4B5PA 3T90A 5F49A 1IICA 4CAXA 2Y0MA 2QECA 4KOWA 3TOBA 2CNTA 4ONUA 3R9FA 2ZW4A 1YX0A 1NMTA 1Q2DA 1P0HA 3IWGA 2BL1A 4R3KA 5F46A 3TTHA 2R98A 1I12A 3FYNA 2K5TA 4R3LA 2OZGA 1XEBA 4XNHB 5E96A 1QSTA 1Z4EA 4H6ZA 1XF8A 2P6EA 4AB7A 4ORFA 4NF1A 1KUYA 2ZXVA 3VWDA 4KLWA 4EVYA 2HV2A 1CM0A 4J3GA 2NMTA 1BOBA 4XPDC 4B5PB 3S6HA 4II9A 1S3ZA 4KORA 3FB3A 4PK2A 4CAVA 1S7KA 2WPWA 5EC4A 5JQ4A 2P0WA 1CJWA 4U9YA 4KOTA 3S6GA 2R1IA 2GE3A 2ARHA 4YRHA 3R1KA 4AVAA 4E0AA 2DXQA 3G3SA 2ZPAA 2Q0YA 3S6KA 1MJ9A 4NXYA 4LUAA 3EO4A 2I00A 2BSWA 4KVOE 3W6SA 3F8KA 3WR7A 2HUZA 4AVBA 4NSQA 2B4BA 5CNPA 3D2PA 2WPXA 4Y49B 4YFJA 4KOYA 1M4DA 4B5OA 3R96A 1KUXA 2B3VA 4MBUA 2EUIA 4OAEA 5J8FA 1IIDA 3LODA 4JLYA 4QB9A 3P2FA 3R95A 1IYKA 1YGHA 4F0YA 2ZW5A 5F48A 3W91A 2OZHA 4UWJA 3RYOA 3TO9A 5DWNA 2JLMA 4MJ8A 1V0CA 2GIVA 3DNSA 4FD5A 1RO5A 1KUVA 4JXRA 4R87A 4U9ZA 2Z10A 3FRMA 2PR1A 4YGOA 1BO4A
chains in the Genus database with same CATH superfamily
4MMOA 2ZEFA 5AG5A 3R9EA 2DPTA 2FE7A 1YVKA 3H8EA 3BJ7A 1GYTA 4PXBA 2YNCC 1LAPA 2PJ4A 2AFOA 1Z5RA 5FVJA 2A4NA 4PSWA 3RBUA 3VWEA 2OB0A 1UWYA 3H4QA 1Z8TA 2FVGA 3DSBA 4JZ0A 4R7MA 5K8MA 4BMHA 1QQ9A 2RC4A 3KQZA 3IWWA 1ARLA 2Q04A 3GIUA 4MFKA 3DR6A 5HH1A 2OR4A 3BJ8A 5K8NA 1RXTA 3V8IA 4CYPA 4PQAA 1LCPA 2XEIA 4K30A 5THWA 3I9SA 2I3CA 4LQ6A 2ZEDA 2D4PA 3V7ZA 1M4IA 4CYQA 4DYOA 2O28A 4MFQA 3DGVA 5J8CA 3KQXA 1TKHA 3MRUA 5JGFA 2PSWA 2G0BA 4ZYQA 1PU9A 5LRKA 2G9DA 1CP6A 2OZUA 3K9UA 4KOVA 2V8HA 2Q44A 1VHOA 2FL4A 4B13A 1Y7RA 2FSRA 2O53A 2WSAA 3LMSA 4A2ZA 4M6HA 3MN8A 1Z4RA 5HVGA 4CRYB 5LRGA 2IMOA 1R57A 3PGPA 4ZY2A 2BCOA 2Q4ZA 3BLNA 4P4IA 2PC1A 4A94A 3W6XA 5K8PA 2HB6A 4EFDA 1HDQA 2JBKA 3N5FA 4PXDA 3D2MA 3ZJ0A 3BI1A 1A2ZA 2CXAA 1I1DA 2VQYA 4CYNA 4KOSA 1Z9UA 5A28A 2VEZA 3QNVA 4H2KA 4FWUA 4P4FA 2Z11A 3F0AA 2XEGA 2C27A 3FVLA 3D3SA 2V8DA 5DWMA 2ZW7A 1VHEA 3KZWA 2Z3NA 4KLVA 1IYLA 5I4MA 4QBJA 3KI9A 5IB9A 2EK8A 4PXEA 4XPDB 2OH1A 1IB1E 1Q2YA 4X2TA 2NYQA 1OBRA 2OU2A 3RNZA 4M85A 3B3SA 5IB0A 4MHDA 5CBMA 5HVFA 5C82A 1Y0RA 4GM5A 4WWVA 2BEIA 2D4OA 3ISXA 2VZZA 5IX3A 4A30A 1NSAA 4C2YA 3GKRA 8CPAA 4R76A 2REFA 4M6GA 1ON0A 4MFJA 4E8OA 1BAVA 2J8RA 1QSOA 3SXOA 2B5GA 3D68A 4R8FA 4CPAA 1S7FA 4P6YA 3S6FA 1VHSA 1ELLP 1YW6A 4XPKA 1IGBA 4L89A 1Y9KA 3SXNA 4OC1A 3FJUA 3JTKA 2FIAA 1YMEA 4Y49C 4PK3A 3SI1A 3GYAA 4KVXA 2Q7BA 3CPXA 3OWCA 1J4JA 1X12A 5IV0A 3KR4A 4P10A 2FIWA 2Q4YA 4L8AA 2H5MA 5H84A 4UFWA 4A31A 2YNCA 1S60A 4JWPA 3TT2A 4FD4A 1TIQA 2C1CA 1BPNA 4AG7A 1TF8A 3GY9A 1TXRA 2Z3PA 3JUWA 1FT7A 1K4JA 2DEAA 3NH8A 3PP9A 1S7LA 4M3SA 3LD2A 1B6BA 1DE4C 1QSRA 3B2YA 2PCUA 3G8WA 4FD7A 2CIJA 5GCNA 2X7BA 2ZEEA 4IUSA 3EXNA 1MJAA 2KCWA 3S9MA 1U6MA 1KZFA 1ZLHA 2GREA 3B35A 3B3CA 2QVPA 3IU1A 3NH4A 2IL4A 2Q7SA 4UF4A 4EWTA 3ZZIA 2YNEA 3SJGA 1BLLE 4LX9A 4C68A 1S5KA 2CNMA 4B12A 2PJAA 2WYRA 4YWYA 4IF5A 3D4UA 4OC0A 4NGNA 3LACA 3EC4A 1LFWA 2B5GB 2EK9A 3PFOA 2ZELA 2R8VA 3E0KA 4OKOA 4BINA 2F5IA 1Q2CA 1M44A 1M4GA 4PSXA 4Z65A 1IOIA 4ZI6A 3FMCA 3WC7A 3H5ZA 1YLOA 4KZTA 3UY5A 4DUKA 2QMLA 3DR8A 4A33A 3NE7A 3PEIA 4FD6A 4NGPA 4OADA 4UIBA 4A32A 1NE9A 5KTDA 5D8NA 3FEDA 5CPAA 2J8NA 5G21A 1MJBA 2AFZA 2ATRA 2PE3A 1QSMA 2Q4VA 2ZOFA 3DDDA 4MY0A 4MFPA 1FY7A 3H8GA 4HNXB 1JQGA 3FH4A 2GANA 4FUUA 3D8PA 3SHPA 5C88A 5KTCA 1NSLA 4MY3A 3TCVA 4CGLA 1XMTA 2PR8A 3HLPA 2G3AA 4NCZA 2O4HA 3CZXA 4UWIA 2VXKA 4XNHC 4QVTA 2J8MA 4RS2A 3TO7A 1QSNA 1VGYA 2PJ2A 4PXCA 3VATA 4MXUA 5I0CA 1SQHA 1VKCA 2GLFA 3DLJA 4HKFA 3SJFA 5KTAA 3JRUA 3IEHA 4HNYB 4F6AA 3FECA 3N7ZA 5EMIA 2IQ6A 2FCKA 2VBQA 4M6IA 2G3TA 4TWEA 4R6TA 4MHNA 2C6GA 2ZW6A 4KUBA 4AVCA 4P4EA 4ONWA 2B3UA 4YU9A 1XE4A 3B3WA 2AFUA 3QAHA 4Q36A 3RAMA 4B11A 2GU2A 5ISVA 1P4NA 3R9GA 2PRBA 1YR0A 3K9TA 2PJ5A 4JD6A 1UFHA 2Z3MA 4AG9A 2JEVA 4JJXA 5G1ZA 5JH9A 1CPSA 1Q7LA 1XFOA 2CY2A 3CXSA 5H86A 4CRZB 4DNCA 2AFSA 1BPMA 1R43A 3NFZA 4C2XA 1S7NA 2CTCA 1RTQA 1XMBA 1DTDA 4NGSA 4CS0B 4OLLA 3TE4A 2FT0A 4PPZA 3SI2A 2B4DA 3PZJA 2P6FA 3D7HA 4E2AA 2BO9A 4CGMA 4QC6A 2AFXA 4EMEA 5HVHA 4H89A 1LANA 4KSFA 3EFAA 4C7HA 4B14A 4MI4A 4R57A 2PQ8A 3FF3A 5JPHA 2ZEPA 4OIDA 4WJBA 1M1DA 2J9AA 2GFQA 1XBUA 2DF5A 3FNCA 2P6GA 3KKWA 5F47A 5LRJA 1M4LA 3B8GA 4NEXA 4P4JA 3TOAA 3D66A 2Z0ZA 1WWZA 4MCRA 1L0CA 4KOXA 2GLJA 2EBJA 2FXFA 5LYIA 3FIXA 2VZYA 2REEA 4K3NA 4C2ZA 3TFYA 3I3GA 2ANPA 4U5YA 2Q51A 3RO0A 4ZBGA 2AE6A 4B10A 5F09A 1CPXA 2I79A 4MFZA 4UBRA 5LYLA 2EVNA 4I49A 4P4BA 4ZX9A 1Y7EA 1PUAA 4H6UA 2EWBA 1XIXA 2ZEHA 4TNUA 1I21A 2ZEOA 1ARMA 2AJ6A 3FBUA 3I1UA 1MK4A 3P2HA 2ZEMA 4GS4A 4MCQA 3PBBA 4CAWA 4MHYA 3JVNA 2PJ8A 5HMNA 5K8OA 1YSJA 3CT9A 4P4DA 1OZPA 2OOTA 3IO1A 3PB6X 2C6PA 3CXQA 2PJ9A 2PDOA 2WZNA 3MGDA 2CNSA 1XJOA 4JXQA 1GHEA 1TKFA 5D29A 2BUEA 4HNWB 1F2OA 3IGRA 4ZGYB 2VI7A 2B4DB 2JBJA 4KOUA 1YVOA 3GUXA 4UCNA 3B3VA 4KSAA 3IC1A 2PJ0A 2IJZA 3CDXA 4KUAA 1LRZA 4CGNA 3TX8A 3CXPA 3IJ3A 2JDCA 3F5BA 1YK3A 2FS5A 3IIBA 2AFWA 3WT4A 4B6ZA 1Y9WA 2PRQA 1YLEA 1Z2LA 4PV6A 4UA3A 3GB0A 4X5KA 1WK4A 3WC5A 2HQYA 3FXTA 3KHXA 4XPLA 3TO6A 4KVME 1N71A 4RI1A 2HC9A 3QB8A 4MHPA 3WC6A 1XOVA 1HEEA 1YQEA 1B87A 4IK2A 4MRIA 1ZLIA 2V8VA 3BHXA 2B58A 3EY5A 4R9MA 4FAIA 4UEFA 2JDDA 2R7HA 3H8FA 3C26A 2QIRA 2PJBA 7CPAA 1YREA 5EBVA 4QUSA 3PB9X 4UCMA 3T9YA 1CP7A 3LWUA 4UFXA 4B5PA 3T90A 2POKA 3PB8X 1X10A 3S9LA 4P45A 5F49A 4NJRA 5ELYA 1IICA 5LYDA 4CAXA 2Y0MA 1ELMP 1Z8WA 3NH5A 1AUGA 2PJ3A 2QECA 4IHMA 4OC3A 4KOWA 4MCSA 3HUVA 4X3RA 1FNOA 4NGRA 3CPAA 3TOBA 3VH9A 4JYWA 2CNTA 4IAVA 4ONUA 3R9FA 2ZW4A 4OC5A 4F9UA 1CBXA 1YX0A 3QAYA 4OMEA 1CX8A 4OIWA 1NMTA 2PJ6A 1Q2DA 3BI0A 2QYVA 4X8IA 1P0HA 3BXMA 1R3NA 3IWGA 1AMPA 4Q7AA 4UEEA 2BL1A 3SJXA 4R3KA 5F46A 3TTHA 1TKJA 5G22A 4CAFA 2NSMA 2R98A 4O23A 1I12A 2CTBA 3FYNA 3SJEA 1PCAA 2K5TA 4R3LA 3D7GA 2OZGA 3V38A 1XEBA 1ZG8A 4KSIA 4XNHB 5AG6A 5E96A 4A39A 1QSTA 2DPSA 4F8ZA 3D7DA 3RZAA 5HXDA 4ZY0A 1VIXA 1Z4EA 4H6ZA 1XRYA 1XF8A 2P6EA 4AB7A 3KGQA 4ORFA 3D7FA 3ISZA 3IFEA 4KS9A 4NF1A 1KUYA 2ZXVA 4P44A 4BD9A 3K2KA 3KASA 3FX6A 4KLWA 3VWDA 3PB7X 1EE3P 1IOFA 4EVYA 2HV2A 4NGTA 4G1PA 4CYOA 1CM0A 1Y0YA 4J3GA 2NMTA 1BOBA 1TF9A 4XPDC 3S6HA 4B5PB 5AG4A 4II9A 1QMUA 2CF4A 1HDUA 1AYEA 1S3ZA 4OC4A 2BOAA 4KORA 3FB3A 4PK2A 4CAVA 4FBEA 1S7KA 2WPWA 2C6CA 5EC4A 2PIZA 4NGMA 5JM6A 4NGQA 3KL9A 2PVWA 5JQ4A 3KR5A 2P0WA 1CJWA 4U9YA 4KOTA 3S6GA 2R1IA 2GE3A 2XEJA 2ARHA 2RB7A 2Z3OA 5AGEA 4YRHA 6CPAA 3R1KA 3PBEA 4AVAA 2EO8A 1IU8A 4A95A 4E0AA 3D67A 3WABA 2DXQA 2YGWA 3G3SA 4C7IA 2ZPAA 2Q0YA 3S9NA 2ABZA 4UFVA 3S6KA 1MJ9A 4NXYA 2QJ8A 4LQGA 4LUAA 4NFRA 3T8WA 2PJ7A 2V8GA 2PJ1A 3EO4A 2I00A 4A38A 2BSWA 4KVOE 3W6SA 3F8KA 3WR7A 2HUZA 4AVBA 4NSQA 4CAEA 1ZG7A 2B4BA 2Z3LA 3A9LA 1YW4A 3B3TA 5LYFA 3L2NA 5CNPA 2Z3KA 2JEWA 1ZO0A 3D2PA 4BBHA 2ZOGA 2YNDA 4NJQA 2VL1A 2WPXA 4Y49B 3PFEA 3VARA 4F0XA 4KOYA 1M4DA 4YFJA 3KHZA 1F2PA 4B5OA 4DJLA 5J1QA 3IU2A 1LAMA 4Q38A 3R96A 1KUXA 4UIAA 3B7IA 2B3VA 3NE8A 4RN7A 4F9VA 4MBUA 2EUIA 5AG7A 1KWMA 2V77A 4OAEA 1ZG9A 4ZX8A 5J8FA 1Z8XA 5DS0A 1LOKA 3NA6A 3SI0A 4OC2A 1IIDA 3LODA 4JLYA 1PYTB 3PRTA 3TC8A 3FEEA 4MFLA 4QB9A 5BWAB 5A27A 3P2FA 3R95A 2ODFA 4ZY1A 1IYKA 1YGHA 2Q43A 2WUUA 2XEFA 4UEZA 2ZEGA 4OP4A 4F0YA 2PVVA 3GLJA 2ZW5A 4MHZA 1H8LA 5F48A 3W91A 2OZHA 1JWQA 4UWJA 4RUHA 4AXVA 4UCPA 3RYOA 3PB4X 1Z8LA 3TO9A 4A37A 1IY7A 2JLMA 2PIYA 4MJ8A 2PJCA 2ZENA 5DWNA 1V0CA 2GIVA 2RFHA 3DNSA 4FD5A 1CG2A 1RO5A 4GXHA 1KUVA 3IWEA 4JXRA 4R87A 4CGPA 4CGOA 2F7VA 1F57A 4U9ZA 2Z10A 2F8HA 3FRMA 4MCPA 2PR1A 5G20A 4W9YA 4YGOA 4HPSA 1BO4A 2AFMA
chains in the Genus database with same CATH topology
5AG5A 3R9EA 2DPTA 2FE7A 1YVKA 3BJ7A 2YNCC 5FVJA 2A4NA 4PSWA 3VWEA 2OB0A 3H4QA 3DSBA 4BMHA 2RC4A 2Q04A 4MFKA 3DR6A 5HH1A 3BJ8A 1RXTA 3V8IA 4CYPA 4K30A 3I9SA 2D4PA 1M4IA 4CYQA 2O28A 4MFQA 5J8CA 2PSWA 2G0BA 1PU9A 3K9UA 2OZUA 4KOVA 2Q44A 4B13A 2FL4A 1Y7RA 2FSRA 2WSAA 4A2ZA 1Z4RA 4CRYB 1R57A 3PGPA 3BLNA 2PC1A 3W6XA 3D2MA 3ZJ0A 2CXAA 1I1DA 2VQYA 4CYNA 4KOSA 1Z9UA 5A28A 2VEZA 2Z11A 3F0AA 2C27A 3D3SA 5DWMA 2ZW7A 2Z3NA 4KLVA 1IYLA 4QBJA 4XPDB 2OH1A 1IB1E 1Q2YA 2OU2A 4M85A 5IB0A 4MHDA 5C82A 2BEIA 2D4OA 2VZZA 5IX3A 4A30A 4C2YA 3GKRA 2REFA 1ON0A 4MFJA 4E8OA 2J8RA 1QSOA 3SXOA 2B5GA 1S7FA 3S6FA 1VHSA 4XPKA 4L89A 1Y9KA 3SXNA 3JTKA 2FIAA 4Y49C 4PK3A 3GYAA 4KVXA 2Q7BA 3OWCA 1J4JA 5IV0A 2FIWA 2Q4YA 4L8AA 2H5MA 5H84A 4UFWA 4A31A 2YNCA 1S60A 4JWPA 3TT2A 4FD4A 1TIQA 4AG7A 3GY9A 2Z3PA 3JUWA 1K4JA 3PP9A 1S7LA 4M3SA 3LD2A 1B6BA 3G8WA 1QSRA 4FD7A 5GCNA 2X7BA 4IUSA 3EXNA 1MJAA 2KCWA 1U6MA 1KZFA 3IU1A 2IL4A 3ZZIA 2YNEA 4LX9A 4C68A 1S5KA 2CNMA 4B12A 4IF5A 3EC4A 2B5GB 2R8VA 3E0KA 2F5IA 1Q2CA 1M44A 1M4GA 4PSXA 3H5ZA 4KZTA 3UY5A 2QMLA 3DR8A 4A33A 3NE7A 4FD6A 4OADA 4A32A 1NE9A 5KTDA 5G21A 2J8NA 1MJBA 2ATRA 1QSMA 2Q4VA 3DDDA 4MY0A 4MFPA 1FY7A 4HNXB 2GANA 3D8PA 3SHPA 5C88A 5KTCA 1NSLA 4MY3A 3TCVA 4CGLA 1XMTA 2PR8A 4NCZA 2G3AA 4UWIA 2VXKA 4XNHC 4QVTA 2J8MA 4RS2A 3TO7A 1QSNA 5I0CA 1SQHA 1VKCA 4HKFA 5KTAA 4HNYB 4F6AA 3N7ZA 2VBQA 2FCKA 2G3TA 2ZW6A 4KUBA 4AVCA 2B3UA 1XE4A 3QAHA 4Q36A 4B11A 5ISVA 1P4NA 3R9GA 2PRBA 1YR0A 4JD6A 1UFHA 2Z3MA 4AG9A 2JEVA 4JJXA 5G1ZA 2CY2A 3CXSA 5H86A 4CRZB 4DNCA 4C2XA 1S7NA 4CS0B 4OLLA 3TE4A 2FT0A 2B4DA 3PZJA 2P6FA 4E2AA 4CGMA 4QC6A 4H89A 4KSFA 3EFAA 4C7HA 4B14A 4MI4A 4R57A 2PQ8A 5JPHA 1M1DA 5F47A 3FNCA 3KKWA 2P6GA 3B8GA 4NEXA 3TOAA 2Z0ZA 1WWZA 1L0CA 4KOXA 2FXFA 3FIXA 2VZYA 2REEA 3TFYA 4C2ZA 3I3GA 4U5YA 4ZBGA 2AE6A 4B10A 2I79A 4MFZA 4UBRA 2EVNA 4I49A 1PUAA 4H6UA 1XIXA 1I21A 2AJ6A 3FBUA 1MK4A 3P2HA 4CAWA 4GS4A 3JVNA 5HMNA 1OZPA 3CXQA 3MGDA 2PDOA 2CNSA 4JXQA 1GHEA 2BUEA 4HNWB 3IGRA 4ZGYB 2VI7A 2B4DB 4KOUA 1YVOA 4UCNA 4KSAA 4KUAA 1LRZA 4CGNA 3CXPA 2JDCA 3F5BA 1YK3A 2FS5A 1Y9WA 4PV6A 1YLEA 4UA3A 4X5KA 1WK4A 2HQYA 3FXTA 4XPLA 3TO6A 4KVME 1N71A 4RI1A 3QB8A 1B87A 4R9MA 2B58A 3EY5A 2JDDA 2R7HA 3C26A 2QIRA 1YREA 5EBVA 4QUSA 4UCMA 3T9YA 4UFXA 4B5PA 3T90A 5F49A 1IICA 4CAXA 2Y0MA 2QECA 4KOWA 3TOBA 2CNTA 4ONUA 3R9FA 2ZW4A 1YX0A 1NMTA 1Q2DA 1P0HA 3IWGA 2BL1A 4R3KA 5F46A 3TTHA 5G22A 4CAFA 2R98A 1I12A 3FYNA 2K5TA 4R3LA 2OZGA 1XEBA 4XNHB 5AG6A 5E96A 1QSTA 2DPSA 1Z4EA 4H6ZA 1XF8A 2P6EA 4AB7A 4ORFA 4KS9A 4NF1A 1KUYA 2ZXVA 3VWDA 4KLWA 4EVYA 2HV2A 4CYOA 1CM0A 4J3GA 2NMTA 1BOBA 4XPDC 4B5PB 3S6HA 5AG4A 4II9A 1S3ZA 4KORA 3FB3A 4PK2A 4CAVA 1S7KA 2WPWA 5EC4A 5JQ4A 2P0WA 1CJWA 4U9YA 4KOTA 3S6GA 2R1IA 2GE3A 2ARHA 5AGEA 2Z3OA 4YRHA 3R1KA 4AVAA 4A95A 4E0AA 2DXQA 2YGWA 3G3SA 4C7IA 2ZPAA 2Q0YA 4UFVA 3S6KA 1MJ9A 4NXYA 4LUAA 3EO4A 2I00A 2BSWA 4KVOE 3W6SA 3F8KA 3WR7A 2HUZA 4AVBA 4NSQA 4CAEA 2B4BA 2Z3LA 3A9LA 5CNPA 2Z3KA 4BBHA 1ZO0A 3D2PA 2YNDA 2WPXA 4Y49B 4F0XA 4YFJA 4KOYA 1M4DA 4B5OA 3IU2A 3R96A 4Q38A 1KUXA 2B3VA 4MBUA 2EUIA 5AG7A 4OAEA 5J8FA 1IIDA 3LODA 4JLYA 4QB9A 4MFLA 5BWAB 5A27A 3P2FA 3R95A 1IYKA 1YGHA 2WUUA 4F0YA 2ZW5A 5F48A 3W91A 2OZHA 4UWJA 4UCPA 3RYOA 3TO9A 5DWNA 2JLMA 4MJ8A 1V0CA 2GIVA 3DNSA 4FD5A 1RO5A 1KUVA 3IWEA 4JXRA 4R87A 4CGPA 4CGOA 4U9ZA 2Z10A 3FRMA 2PR1A 5G20A 4YGOA 1BO4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R9E A;  2FE7 A;  1YVK A;  3BJ7 A;  5FVJ A;  2A4N A;  4PSW A;  3VWE A;  2OB0 A;  3H4Q A;  3DSB A;  4BMH A;  2RC4 A;  2Q04 A;  3DR6 A;  5HH1 A;  3BJ8 A;  1RXT A;  3V8I A;  4K30 A;  3I9S A;  2D4P A;  1M4I A;  2O28 A;  5J8C A;  2PSW A;  2G0B A;  1PU9 A;  3K9U A;  2OZU A;  4KOV A;  2Q44 A;  2FL4 A;  1Y7R A;  2FSR A;  1Z4R A;  4CRY B;  1R57 A;  3PGP A;  3BLN A;  2PC1 A;  3W6X A;  3D2M A;  3ZJ0 A;  1I1D A;  2VQY A;  4KOS A;  1Z9U A;  2VEZ A;  2Z11 A;  3F0A A;  2C27 A;  3D3S A;  5DWM A;  2ZW7 A;  4KLV A;  1IYL A;  4QBJ A;  4XPD B;  2OH1 A;  1IB1 E;  1Q2Y A;  2OU2 A;  4M85 A;  5IB0 A;  4MHD A;  5C82 A;  2BEI A;  2D4O A;  2VZZ A;  5IX3 A;  3GKR A;  2REF A;  1ON0 A;  4E8O A;  2J8R A;  1QSO A;  3SXO A;  2B5G A;  1S7F A;  3S6F A;  1VHS A;  4XPK A;  4L89 A;  1Y9K A;  3SXN A;  2FIA A;  4Y49 C;  4PK3 A;  3GYA A;  4KVX A;  2Q7B A;  3OWC A;  1J4J A;  5IV0 A;  2FIW A;  2Q4Y A;  4L8A A;  2H5M A;  5H84 A;  1S60 A;  4JWP A;  3TT2 A;  4FD4 A;  1TIQ A;  4AG7 A;  3GY9 A;  3JUW A;  1K4J A;  3PP9 A;  1S7L A;  4M3S A;  3LD2 A;  1B6B A;  3G8W A;  1QSR A;  4FD7 A;  5GCN A;  2X7B A;  4IUS A;  3EXN A;  1MJA A;  2KCW A;  1U6M A;  1KZF A;  2IL4 A;  3ZZI A;  4LX9 A;  1S5K A;  2CNM A;  4IF5 A;  3EC4 A;  2B5G B;  2R8V A;  3E0K A;  2F5I A;  1Q2C A;  1M44 A;  1M4G A;  4PSX A;  4KZT A;  3UY5 A;  2QML A;  3DR8 A;  3NE7 A;  4FD6 A;  4OAD A;  1NE9 A;  5KTD A;  2J8N A;  1MJB A;  2ATR A;  1QSM A;  2Q4V A;  3DDD A;  4MY0 A;  1FY7 A;  4HNX B;  2GAN A;  3D8P A;  3SHP A;  5C88 A;  5KTC A;  1NSL A;  4MY3 A;  3TCV A;  1XMT A;  2PR8 A;  4NCZ A;  2G3A A;  4UWI A;  2VXK A;  4XNH C;  4QVT A;  2J8M A;  4RS2 A;  3TO7 A;  1QSN A;  5I0C A;  1SQH A;  1VKC A;  4HKF A;  5KTA A;  4HNY B;  4F6A A;  3N7Z A;  2VBQ A;  2FCK A;  2G3T A;  2ZW6 A;  4KUB A;  4AVC A;  2B3U A;  1XE4 A;  3QAH A;  5ISV A;  1P4N A;  3R9G A;  2PRB A;  1YR0 A;  4JD6 A;  1UFH A;  4AG9 A;  2JEV A;  4JJX A;  2CY2 A;  3CXS A;  5H86 A;  4CRZ B;  4DNC A;  1S7N A;  4CS0 B;  4OLL A;  3TE4 A;  2FT0 A;  2B4D A;  3PZJ A;  2P6F A;  4E2A A;  4QC6 A;  4H89 A;  3EFA A;  4MI4 A;  4R57 A;  2PQ8 A;  5JPH A;  1M1D A;  5F47 A;  3FNC A;  3KKW A;  2P6G A;  3B8G A;  4NEX A;  3TOA A;  2Z0Z A;  1WWZ A;  1L0C A;  4KOX A;  2FXF A;  3FIX A;  2VZY A;  2REE A;  3TFY A;  3I3G A;  4U5Y A;  4ZBG A;  2AE6 A;  2I79 A;  4UBR A;  2EVN A;  4I49 A;  1PUA A;  4H6U A;  1XIX A;  1I21 A;  2AJ6 A;  3FBU A;  1MK4 A;  3P2H A;  4CAW A;  4GS4 A;  3JVN A;  5HMN A;  1OZP A;  3CXQ A;  3MGD A;  2PDO A;  2CNS A;  4JXQ A;  1GHE A;  2BUE A;  4HNW B;  3IGR A;  2VI7 A;  2B4D B;  4KOU A;  1YVO A;  4KUA A;  1LRZ A;  3CXP A;  2JDC A;  3F5B A;  1YK3 A;  2FS5 A;  1Y9W A;  4PV6 A;  1YLE A;  4UA3 A;  4X5K A;  1WK4 A;  2HQY A;  3FXT A;  4XPL A;  3TO6 A;  4KVM E;  1N71 A;  4RI1 A;  3QB8 A;  1B87 A;  4R9M A;  2B58 A;  3EY5 A;  2JDD A;  2R7H A;  3C26 A;  2QIR A;  1YRE A;  5EBV A;  4QUS A;  3T9Y A;  4B5P A;  3T90 A;  5F49 A;  1IIC A;  4CAX A;  2Y0M A;  2QEC A;  4KOW A;  3TOB A;  2CNT A;  4ONU A;  3R9F A;  2ZW4 A;  1YX0 A;  1NMT A;  1Q2D A;  1P0H A;  3IWG A;  2BL1 A;  4R3K A;  5F46 A;  3TTH A;  2R98 A;  1I12 A;  3FYN A;  2K5T A;  4R3L A;  2OZG A;  1XEB A;  4XNH B;  5E96 A;  1QST A;  1Z4E A;  4H6Z A;  1XF8 A;  2P6E A;  4AB7 A;  4ORF A;  4NF1 A;  1KUY A;  2ZXV A;  3VWD A;  4KLW A;  4EVY A;  2HV2 A;  1CM0 A;  4J3G A;  2NMT A;  1BOB A;  4XPD C;  4B5P B;  3S6H A;  4II9 A;  1S3Z A;  4KOR A;  3FB3 A;  4PK2 A;  4CAV A;  1S7K A;  2WPW A;  5EC4 A;  5JQ4 A;  2P0W A;  1CJW A;  4U9Y A;  4KOT A;  3S6G A;  2R1I A;  2GE3 A;  2ARH A;  4YRH A;  3R1K A;  4AVA A;  4E0A A;  2DXQ A;  3G3S A;  2ZPA A;  2Q0Y A;  3S6K A;  1MJ9 A;  4NXY A;  4LUA A;  3EO4 A;  2I00 A;  2BSW A;  4KVO E;  3W6S A;  3F8K A;  3WR7 A;  2HUZ A;  4AVB A;  4NSQ A;  2B4B A;  5CNP A;  3D2P A;  2WPX A;  4Y49 B;  4YFJ A;  4KOY A;  1M4D A;  4B5O A;  3R96 A;  1KUX A;  2B3V A;  4MBU A;  2EUI A;  4OAE A;  5J8F A;  1IID A;  3LOD A;  4JLY A;  4QB9 A;  3P2F A;  3R95 A;  1IYK A;  1YGH A;  4F0Y A;  2ZW5 A;  5F48 A;  3W91 A;  2OZH A;  4UWJ A;  3RYO A;  3TO9 A;  5DWN A;  2JLM A;  4MJ8 A;  1V0C A;  2GIV A;  3DNS A;  4FD5 A;  1RO5 A;  1KUV A;  4JXR A;  4R87 A;  4U9Z A;  2Z10 A;  3FRM A;  2PR1 A;  4YGO A;  1BO4 A; 
#chains in the Genus database with same CATH topology
 4MMO A;  2ZEF A;  5AG5 A;  3R9E A;  2DPT A;  2FE7 A;  1YVK A;  3H8E A;  3BJ7 A;  1GYT A;  4PXB A;  2YNC C;  1LAP A;  2PJ4 A;  2AFO A;  1Z5R A;  5FVJ A;  2A4N A;  4PSW A;  3RBU A;  3VWE A;  2OB0 A;  1UWY A;  3H4Q A;  1Z8T A;  2FVG A;  3DSB A;  4JZ0 A;  4R7M A;  5K8M A;  4BMH A;  1QQ9 A;  2RC4 A;  3KQZ A;  3IWW A;  1ARL A;  2Q04 A;  3GIU A;  4MFK A;  3DR6 A;  5HH1 A;  2OR4 A;  3BJ8 A;  5K8N A;  1RXT A;  3V8I A;  4CYP A;  4PQA A;  1LCP A;  2XEI A;  4K30 A;  5THW A;  3I9S A;  2I3C A;  4LQ6 A;  2ZED A;  2D4P A;  3V7Z A;  1M4I A;  4CYQ A;  4DYO A;  2O28 A;  4MFQ A;  3DGV A;  5J8C A;  3KQX A;  1TKH A;  3MRU A;  5JGF A;  2PSW A;  2G0B A;  4ZYQ A;  1PU9 A;  5LRK A;  2G9D A;  1CP6 A;  2OZU A;  3K9U A;  4KOV A;  2V8H A;  2Q44 A;  1VHO A;  2FL4 A;  4B13 A;  1Y7R A;  2FSR A;  2O53 A;  2WSA A;  3LMS A;  4A2Z A;  4M6H A;  3MN8 A;  1Z4R A;  5HVG A;  4CRY B;  5LRG A;  2IMO A;  1R57 A;  3PGP A;  4ZY2 A;  2BCO A;  2Q4Z A;  3BLN A;  4P4I A;  2PC1 A;  4A94 A;  3W6X A;  5K8P A;  2HB6 A;  4EFD A;  1HDQ A;  2JBK A;  3N5F A;  4PXD A;  3D2M A;  3ZJ0 A;  3BI1 A;  1A2Z A;  2CXA A;  1I1D A;  2VQY A;  4CYN A;  4KOS A;  1Z9U A;  5A28 A;  2VEZ A;  3QNV A;  4H2K A;  4FWU A;  4P4F A;  2Z11 A;  3F0A A;  2XEG A;  2C27 A;  3FVL A;  3D3S A;  2V8D A;  5DWM A;  2ZW7 A;  1VHE A;  3KZW A;  2Z3N A;  4KLV A;  1IYL A;  5I4M A;  4QBJ A;  3KI9 A;  5IB9 A;  2EK8 A;  4PXE A;  4XPD B;  2OH1 A;  1IB1 E;  1Q2Y A;  4X2T A;  2NYQ A;  1OBR A;  2OU2 A;  3RNZ A;  4M85 A;  3B3S A;  5IB0 A;  4MHD A;  5CBM A;  5HVF A;  5C82 A;  1Y0R A;  4GM5 A;  4WWV A;  2BEI A;  2D4O A;  3ISX A;  2VZZ A;  5IX3 A;  4A30 A;  1NSA A;  4C2Y A;  3GKR A;  8CPA A;  4R76 A;  2REF A;  4M6G A;  1ON0 A;  4MFJ A;  4E8O A;  1BAV A;  2J8R A;  1QSO A;  3SXO A;  2B5G A;  3D68 A;  4R8F A;  4CPA A;  1S7F A;  4P6Y A;  3S6F A;  1VHS A;  1ELL P;  1YW6 A;  4XPK A;  1IGB A;  4L89 A;  1Y9K A;  3SXN A;  4OC1 A;  3FJU A;  3JTK A;  2FIA A;  1YME A;  4Y49 C;  4PK3 A;  3SI1 A;  3GYA A;  4KVX A;  2Q7B A;  3CPX A;  3OWC A;  1J4J A;  1X12 A;  5IV0 A;  3KR4 A;  4P10 A;  2FIW A;  2Q4Y A;  4L8A A;  2H5M A;  5H84 A;  4UFW A;  4A31 A;  2YNC A;  1S60 A;  4JWP A;  3TT2 A;  4FD4 A;  1TIQ A;  2C1C A;  1BPN A;  4AG7 A;  1TF8 A;  3GY9 A;  1TXR A;  2Z3P A;  3JUW A;  1FT7 A;  1K4J A;  2DEA A;  3NH8 A;  3PP9 A;  1S7L A;  4M3S A;  3LD2 A;  1B6B A;  1DE4 C;  1QSR A;  3B2Y A;  2PCU A;  3G8W A;  4FD7 A;  2CIJ A;  5GCN A;  2X7B A;  2ZEE A;  4IUS A;  3EXN A;  1MJA A;  2KCW A;  3S9M A;  1U6M A;  1KZF A;  1ZLH A;  2GRE A;  3B35 A;  3B3C A;  2QVP A;  3IU1 A;  3NH4 A;  2IL4 A;  2Q7S A;  4UF4 A;  4EWT A;  3ZZI A;  2YNE A;  3SJG A;  1BLL E;  4LX9 A;  4C68 A;  1S5K A;  2CNM A;  4B12 A;  2PJA A;  2WYR A;  4YWY A;  4IF5 A;  3D4U A;  4OC0 A;  4NGN A;  3LAC A;  3EC4 A;  1LFW A;  2B5G B;  2EK9 A;  3PFO A;  2ZEL A;  2R8V A;  3E0K A;  4OKO A;  4BIN A;  2F5I A;  1Q2C A;  1M44 A;  1M4G A;  4PSX A;  4Z65 A;  1IOI A;  4ZI6 A;  3FMC A;  3WC7 A;  3H5Z A;  1YLO A;  4KZT A;  3UY5 A;  4DUK A;  2QML A;  3DR8 A;  4A33 A;  3NE7 A;  3PEI A;  4FD6 A;  4NGP A;  4OAD A;  4UIB A;  4A32 A;  1NE9 A;  5KTD A;  5D8N A;  3FED A;  5CPA A;  2J8N A;  5G21 A;  1MJB A;  2AFZ A;  2ATR A;  2PE3 A;  1QSM A;  2Q4V A;  2ZOF A;  3DDD A;  4MY0 A;  4MFP A;  1FY7 A;  3H8G A;  4HNX B;  1JQG A;  3FH4 A;  2GAN A;  4FUU A;  3D8P A;  3SHP A;  5C88 A;  5KTC A;  1NSL A;  4MY3 A;  3TCV A;  4CGL A;  1XMT A;  2PR8 A;  3HLP A;  2G3A A;  4NCZ A;  2O4H A;  3CZX A;  4UWI A;  2VXK A;  4XNH C;  4QVT A;  2J8M A;  4RS2 A;  3TO7 A;  1QSN A;  1VGY A;  2PJ2 A;  4PXC A;  3VAT A;  4MXU A;  5I0C A;  1SQH A;  1VKC A;  2GLF A;  3DLJ A;  4HKF A;  3SJF A;  5KTA A;  3JRU A;  3IEH A;  4HNY B;  4F6A A;  3FEC A;  3N7Z A;  5EMI A;  2IQ6 A;  2FCK A;  2VBQ A;  4M6I A;  2G3T A;  4TWE A;  4R6T A;  4MHN A;  2C6G A;  2ZW6 A;  4KUB A;  4AVC A;  4P4E A;  4ONW A;  2B3U A;  4YU9 A;  1XE4 A;  3B3W A;  2AFU A;  3QAH A;  4Q36 A;  3RAM A;  4B11 A;  2GU2 A;  5ISV A;  1P4N A;  3R9G A;  2PRB A;  1YR0 A;  3K9T A;  2PJ5 A;  4JD6 A;  1UFH A;  2Z3M A;  4AG9 A;  2JEV A;  4JJX A;  5G1Z A;  5JH9 A;  1CPS A;  1Q7L A;  1XFO A;  2CY2 A;  3CXS A;  5H86 A;  4CRZ B;  4DNC A;  2AFS A;  1BPM A;  1R43 A;  3NFZ A;  4C2X A;  1S7N A;  2CTC A;  1RTQ A;  1XMB A;  1DTD A;  4NGS A;  4CS0 B;  4OLL A;  3TE4 A;  2FT0 A;  4PPZ A;  3SI2 A;  2B4D A;  3PZJ A;  2P6F A;  3D7H A;  4E2A A;  2BO9 A;  4CGM A;  4QC6 A;  2AFX A;  4EME A;  5HVH A;  4H89 A;  1LAN A;  4KSF A;  3EFA A;  4C7H A;  4B14 A;  4MI4 A;  4R57 A;  2PQ8 A;  3FF3 A;  5JPH A;  2ZEP A;  4OID A;  4WJB A;  1M1D A;  2J9A A;  2GFQ A;  1XBU A;  2DF5 A;  3FNC A;  2P6G A;  3KKW A;  5F47 A;  5LRJ A;  1M4L A;  3B8G A;  4NEX A;  4P4J A;  3TOA A;  3D66 A;  2Z0Z A;  1WWZ A;  4MCR A;  1L0C A;  4KOX A;  2GLJ A;  2EBJ A;  2FXF A;  5LYI A;  3FIX A;  2VZY A;  2REE A;  4K3N A;  4C2Z A;  3TFY A;  3I3G A;  2ANP A;  4U5Y A;  2Q51 A;  3RO0 A;  4ZBG A;  2AE6 A;  4B10 A;  5F09 A;  1CPX A;  2I79 A;  4MFZ A;  4UBR A;  5LYL A;  2EVN A;  4I49 A;  4P4B A;  4ZX9 A;  1Y7E A;  1PUA A;  4H6U A;  2EWB A;  1XIX A;  2ZEH A;  4TNU A;  1I21 A;  2ZEO A;  1ARM A;  2AJ6 A;  3FBU A;  3I1U A;  1MK4 A;  3P2H A;  2ZEM A;  4GS4 A;  4MCQ A;  3PBB A;  4CAW A;  4MHY A;  3JVN A;  2PJ8 A;  5HMN A;  5K8O A;  1YSJ A;  3CT9 A;  4P4D A;  1OZP A;  2OOT A;  3IO1 A;  3PB6 X;  2C6P A;  3CXQ A;  2PJ9 A;  2PDO A;  2WZN A;  3MGD A;  2CNS A;  1XJO A;  4JXQ A;  1GHE A;  1TKF A;  5D29 A;  2BUE A;  4HNW B;  1F2O A;  3IGR A;  4ZGY B;  2VI7 A;  2B4D B;  2JBJ A;  4KOU A;  1YVO A;  3GUX A;  4UCN A;  3B3V A;  4KSA A;  3IC1 A;  2PJ0 A;  2IJZ A;  3CDX A;  4KUA A;  1LRZ A;  4CGN A;  3TX8 A;  3CXP A;  3IJ3 A;  2JDC A;  3F5B A;  1YK3 A;  2FS5 A;  3IIB A;  2AFW A;  3WT4 A;  4B6Z A;  1Y9W A;  2PRQ A;  1YLE A;  1Z2L A;  4PV6 A;  4UA3 A;  3GB0 A;  4X5K A;  1WK4 A;  3WC5 A;  2HQY A;  3FXT A;  3KHX A;  4XPL A;  3TO6 A;  4KVM E;  1N71 A;  4RI1 A;  2HC9 A;  3QB8 A;  4MHP A;  3WC6 A;  1XOV A;  1HEE A;  1YQE A;  1B87 A;  4IK2 A;  4MRI A;  1ZLI A;  2V8V A;  3BHX A;  2B58 A;  3EY5 A;  4R9M A;  4FAI A;  4UEF A;  2JDD A;  2R7H A;  3H8F A;  3C26 A;  2QIR A;  2PJB A;  7CPA A;  1YRE A;  5EBV A;  4QUS A;  3PB9 X;  4UCM A;  3T9Y A;  1CP7 A;  3LWU A;  4UFX A;  4B5P A;  3T90 A;  2POK A;  3PB8 X;  1X10 A;  3S9L A;  4P45 A;  5F49 A;  4NJR A;  5ELY A;  1IIC A;  5LYD A;  4CAX A;  2Y0M A;  1ELM P;  1Z8W A;  3NH5 A;  1AUG A;  2PJ3 A;  2QEC A;  4IHM A;  4OC3 A;  4KOW A;  4MCS A;  3HUV A;  4X3R A;  1FNO A;  4NGR A;  3CPA A;  3TOB A;  3VH9 A;  4JYW A;  2CNT A;  4IAV A;  4ONU A;  3R9F A;  2ZW4 A;  4OC5 A;  4F9U A;  1CBX A;  1YX0 A;  3QAY A;  4OME A;  1CX8 A;  4OIW A;  1NMT A;  2PJ6 A;  1Q2D A;  3BI0 A;  2QYV A;  4X8I A;  1P0H A;  3BXM A;  1R3N A;  3IWG A;  1AMP A;  4Q7A A;  4UEE A;  2BL1 A;  3SJX A;  4R3K A;  5F46 A;  3TTH A;  1TKJ A;  5G22 A;  4CAF A;  2NSM A;  2R98 A;  4O23 A;  1I12 A;  2CTB A;  3FYN A;  3SJE A;  1PCA A;  2K5T A;  4R3L A;  3D7G A;  2OZG A;  3V38 A;  1XEB A;  1ZG8 A;  4KSI A;  4XNH B;  5AG6 A;  5E96 A;  4A39 A;  1QST A;  2DPS A;  4F8Z A;  3D7D A;  3RZA A;  5HXD A;  4ZY0 A;  1VIX A;  1Z4E A;  4H6Z A;  1XRY A;  1XF8 A;  2P6E A;  4AB7 A;  3KGQ A;  4ORF A;  3D7F A;  3ISZ A;  3IFE A;  4KS9 A;  4NF1 A;  1KUY A;  2ZXV A;  4P44 A;  4BD9 A;  3K2K A;  3KAS A;  3FX6 A;  4KLW A;  3VWD A;  3PB7 X;  1EE3 P;  1IOF A;  4EVY A;  2HV2 A;  4NGT A;  4G1P A;  4CYO A;  1CM0 A;  1Y0Y A;  4J3G A;  2NMT A;  1BOB A;  1TF9 A;  4XPD C;  3S6H A;  4B5P B;  5AG4 A;  4II9 A;  1QMU A;  2CF4 A;  1HDU A;  1AYE A;  1S3Z A;  4OC4 A;  2BOA A;  4KOR A;  3FB3 A;  4PK2 A;  4CAV A;  4FBE A;  1S7K A;  2WPW A;  2C6C A;  5EC4 A;  2PIZ A;  4NGM A;  5JM6 A;  4NGQ A;  3KL9 A;  2PVW A;  5JQ4 A;  3KR5 A;  2P0W A;  1CJW A;  4U9Y A;  4KOT A;  3S6G A;  2R1I A;  2GE3 A;  2XEJ A;  2ARH A;  2RB7 A;  2Z3O A;  5AGE A;  4YRH A;  6CPA A;  3R1K A;  3PBE A;  4AVA A;  2EO8 A;  1IU8 A;  4A95 A;  4E0A A;  3D67 A;  3WAB A;  2DXQ A;  2YGW A;  3G3S A;  4C7I A;  2ZPA A;  2Q0Y A;  3S9N A;  2ABZ A;  4UFV A;  3S6K A;  1MJ9 A;  4NXY A;  2QJ8 A;  4LQG A;  4LUA A;  4NFR A;  3T8W A;  2PJ7 A;  2V8G A;  2PJ1 A;  3EO4 A;  2I00 A;  4A38 A;  2BSW A;  4KVO E;  3W6S A;  3F8K A;  3WR7 A;  2HUZ A;  4AVB A;  4NSQ A;  4CAE A;  1ZG7 A;  2B4B A;  2Z3L A;  3A9L A;  1YW4 A;  3B3T A;  5LYF A;  3L2N A;  5CNP A;  2Z3K A;  2JEW A;  1ZO0 A;  3D2P A;  4BBH A;  2ZOG A;  2YND A;  4NJQ A;  2VL1 A;  2WPX A;  4Y49 B;  3PFE A;  3VAR A;  4F0X A;  4KOY A;  1M4D A;  4YFJ A;  3KHZ A;  1F2P A;  4B5O A;  4DJL A;  5J1Q A;  3IU2 A;  1LAM A;  4Q38 A;  3R96 A;  1KUX A;  4UIA A;  3B7I A;  2B3V A;  3NE8 A;  4RN7 A;  4F9V A;  4MBU A;  2EUI A;  5AG7 A;  1KWM A;  2V77 A;  4OAE A;  1ZG9 A;  4ZX8 A;  5J8F A;  1Z8X A;  5DS0 A;  1LOK A;  3NA6 A;  3SI0 A;  4OC2 A;  1IID A;  3LOD A;  4JLY A;  1PYT B;  3PRT A;  3TC8 A;  3FEE A;  4MFL A;  4QB9 A;  5BWA B;  5A27 A;  3P2F A;  3R95 A;  2ODF A;  4ZY1 A;  1IYK A;  1YGH A;  2Q43 A;  2WUU A;  2XEF A;  4UEZ A;  2ZEG A;  4OP4 A;  4F0Y A;  2PVV A;  3GLJ A;  2ZW5 A;  4MHZ A;  1H8L A;  5F48 A;  3W91 A;  2OZH A;  1JWQ A;  4UWJ A;  4RUH A;  4AXV A;  4UCP A;  3RYO A;  3PB4 X;  1Z8L A;  3TO9 A;  4A37 A;  1IY7 A;  2JLM A;  2PIY A;  4MJ8 A;  2PJC A;  2ZEN A;  5DWN A;  1V0C A;  2GIV A;  2RFH A;  3DNS A;  4FD5 A;  1CG2 A;  1RO5 A;  4GXH A;  1KUV A;  3IWE A;  4JXR A;  4R87 A;  4CGP A;  4CGO A;  2F7V A;  1F57 A;  4U9Z A;  2Z10 A;  2F8H A;  3FRM A;  4MCP A;  2PR1 A;  5G20 A;  4W9Y A;  4YGO A;  4HPS A;  1BO4 A;  2AFM A; 
#chains in the Genus database with same CATH homology
 5AG5 A;  3R9E A;  2DPT A;  2FE7 A;  1YVK A;  3BJ7 A;  2YNC C;  5FVJ A;  2A4N A;  4PSW A;  3VWE A;  2OB0 A;  3H4Q A;  3DSB A;  4BMH A;  2RC4 A;  2Q04 A;  4MFK A;  3DR6 A;  5HH1 A;  3BJ8 A;  1RXT A;  3V8I A;  4CYP A;  4K30 A;  3I9S A;  2D4P A;  1M4I A;  4CYQ A;  2O28 A;  4MFQ A;  5J8C A;  2PSW A;  2G0B A;  1PU9 A;  3K9U A;  2OZU A;  4KOV A;  2Q44 A;  4B13 A;  2FL4 A;  1Y7R A;  2FSR A;  2WSA A;  4A2Z A;  1Z4R A;  4CRY B;  1R57 A;  3PGP A;  3BLN A;  2PC1 A;  3W6X A;  3D2M A;  3ZJ0 A;  2CXA A;  1I1D A;  2VQY A;  4CYN A;  4KOS A;  1Z9U A;  5A28 A;  2VEZ A;  2Z11 A;  3F0A A;  2C27 A;  3D3S A;  5DWM A;  2ZW7 A;  2Z3N A;  4KLV A;  1IYL A;  4QBJ A;  4XPD B;  2OH1 A;  1IB1 E;  1Q2Y A;  2OU2 A;  4M85 A;  5IB0 A;  4MHD A;  5C82 A;  2BEI A;  2D4O A;  2VZZ A;  5IX3 A;  4A30 A;  4C2Y A;  3GKR A;  2REF A;  1ON0 A;  4MFJ A;  4E8O A;  2J8R A;  1QSO A;  3SXO A;  2B5G A;  1S7F A;  3S6F A;  1VHS A;  4XPK A;  4L89 A;  1Y9K A;  3SXN A;  3JTK A;  2FIA A;  4Y49 C;  4PK3 A;  3GYA A;  4KVX A;  2Q7B A;  3OWC A;  1J4J A;  5IV0 A;  2FIW A;  2Q4Y A;  4L8A A;  2H5M A;  5H84 A;  4UFW A;  4A31 A;  2YNC A;  1S60 A;  4JWP A;  3TT2 A;  4FD4 A;  1TIQ A;  4AG7 A;  3GY9 A;  2Z3P A;  3JUW A;  1K4J A;  3PP9 A;  1S7L A;  4M3S A;  3LD2 A;  1B6B A;  3G8W A;  1QSR A;  4FD7 A;  5GCN A;  2X7B A;  4IUS A;  3EXN A;  1MJA A;  2KCW A;  1U6M A;  1KZF A;  3IU1 A;  2IL4 A;  3ZZI A;  2YNE A;  4LX9 A;  4C68 A;  1S5K A;  2CNM A;  4B12 A;  4IF5 A;  3EC4 A;  2B5G B;  2R8V A;  3E0K A;  2F5I A;  1Q2C A;  1M44 A;  1M4G A;  4PSX A;  3H5Z A;  4KZT A;  3UY5 A;  2QML A;  3DR8 A;  4A33 A;  3NE7 A;  4FD6 A;  4OAD A;  4A32 A;  1NE9 A;  5KTD A;  5G21 A;  2J8N A;  1MJB A;  2ATR A;  1QSM A;  2Q4V A;  3DDD A;  4MY0 A;  4MFP A;  1FY7 A;  4HNX B;  2GAN A;  3D8P A;  3SHP A;  5C88 A;  5KTC A;  1NSL A;  4MY3 A;  3TCV A;  4CGL A;  1XMT A;  2PR8 A;  4NCZ A;  2G3A A;  4UWI A;  2VXK A;  4XNH C;  4QVT A;  2J8M A;  4RS2 A;  3TO7 A;  1QSN A;  5I0C A;  1SQH A;  1VKC A;  4HKF A;  5KTA A;  4HNY B;  4F6A A;  3N7Z A;  2VBQ A;  2FCK A;  2G3T A;  2ZW6 A;  4KUB A;  4AVC A;  2B3U A;  1XE4 A;  3QAH A;  4Q36 A;  4B11 A;  5ISV A;  1P4N A;  3R9G A;  2PRB A;  1YR0 A;  4JD6 A;  1UFH A;  2Z3M A;  4AG9 A;  2JEV A;  4JJX A;  5G1Z A;  2CY2 A;  3CXS A;  5H86 A;  4CRZ B;  4DNC A;  4C2X A;  1S7N A;  4CS0 B;  4OLL A;  3TE4 A;  2FT0 A;  2B4D A;  3PZJ A;  2P6F A;  4E2A A;  4CGM A;  4QC6 A;  4H89 A;  4KSF A;  3EFA A;  4C7H A;  4B14 A;  4MI4 A;  4R57 A;  2PQ8 A;  5JPH A;  1M1D A;  5F47 A;  3FNC A;  3KKW A;  2P6G A;  3B8G A;  4NEX A;  3TOA A;  2Z0Z A;  1WWZ A;  1L0C A;  4KOX A;  2FXF A;  3FIX A;  2VZY A;  2REE A;  3TFY A;  4C2Z A;  3I3G A;  4U5Y A;  4ZBG A;  2AE6 A;  4B10 A;  2I79 A;  4MFZ A;  4UBR A;  2EVN A;  4I49 A;  1PUA A;  4H6U A;  1XIX A;  1I21 A;  2AJ6 A;  3FBU A;  1MK4 A;  3P2H A;  4CAW A;  4GS4 A;  3JVN A;  5HMN A;  1OZP A;  3CXQ A;  3MGD A;  2PDO A;  2CNS A;  4JXQ A;  1GHE A;  2BUE A;  4HNW B;  3IGR A;  4ZGY B;  2VI7 A;  2B4D B;  4KOU A;  1YVO A;  4UCN A;  4KSA A;  4KUA A;  1LRZ A;  4CGN A;  3CXP A;  2JDC A;  3F5B A;  1YK3 A;  2FS5 A;  1Y9W A;  4PV6 A;  1YLE A;  4UA3 A;  4X5K A;  1WK4 A;  2HQY A;  3FXT A;  4XPL A;  3TO6 A;  4KVM E;  1N71 A;  4RI1 A;  3QB8 A;  1B87 A;  4R9M A;  2B58 A;  3EY5 A;  2JDD A;  2R7H A;  3C26 A;  2QIR A;  1YRE A;  5EBV A;  4QUS A;  4UCM A;  3T9Y A;  4UFX A;  4B5P A;  3T90 A;  5F49 A;  1IIC A;  4CAX A;  2Y0M A;  2QEC A;  4KOW A;  3TOB A;  2CNT A;  4ONU A;  3R9F A;  2ZW4 A;  1YX0 A;  1NMT A;  1Q2D A;  1P0H A;  3IWG A;  2BL1 A;  4R3K A;  5F46 A;  3TTH A;  5G22 A;  4CAF A;  2R98 A;  1I12 A;  3FYN A;  2K5T A;  4R3L A;  2OZG A;  1XEB A;  4XNH B;  5AG6 A;  5E96 A;  1QST A;  2DPS A;  1Z4E A;  4H6Z A;  1XF8 A;  2P6E A;  4AB7 A;  4ORF A;  4KS9 A;  4NF1 A;  1KUY A;  2ZXV A;  3VWD A;  4KLW A;  4EVY A;  2HV2 A;  4CYO A;  1CM0 A;  4J3G A;  2NMT A;  1BOB A;  4XPD C;  4B5P B;  3S6H A;  5AG4 A;  4II9 A;  1S3Z A;  4KOR A;  3FB3 A;  4PK2 A;  4CAV A;  1S7K A;  2WPW A;  5EC4 A;  5JQ4 A;  2P0W A;  1CJW A;  4U9Y A;  4KOT A;  3S6G A;  2R1I A;  2GE3 A;  2ARH A;  5AGE A;  2Z3O A;  4YRH A;  3R1K A;  4AVA A;  4A95 A;  4E0A A;  2DXQ A;  2YGW A;  3G3S A;  4C7I A;  2ZPA A;  2Q0Y A;  4UFV A;  3S6K A;  1MJ9 A;  4NXY A;  4LUA A;  3EO4 A;  2I00 A;  2BSW A;  4KVO E;  3W6S A;  3F8K A;  3WR7 A;  2HUZ A;  4AVB A;  4NSQ A;  4CAE A;  2B4B A;  2Z3L A;  3A9L A;  5CNP A;  2Z3K A;  4BBH A;  1ZO0 A;  3D2P A;  2YND A;  2WPX A;  4Y49 B;  4F0X A;  4YFJ A;  4KOY A;  1M4D A;  4B5O A;  3IU2 A;  3R96 A;  4Q38 A;  1KUX A;  2B3V A;  4MBU A;  2EUI A;  5AG7 A;  4OAE A;  5J8F A;  1IID A;  3LOD A;  4JLY A;  4QB9 A;  4MFL A;  5BWA B;  5A27 A;  3P2F A;  3R95 A;  1IYK A;  1YGH A;  2WUU A;  4F0Y A;  2ZW5 A;  5F48 A;  3W91 A;  2OZH A;  4UWJ A;  4UCP A;  3RYO A;  3TO9 A;  5DWN A;  2JLM A;  4MJ8 A;  1V0C A;  2GIV A;  3DNS A;  4FD5 A;  1RO5 A;  1KUV A;  3IWE A;  4JXR A;  4R87 A;  4CGP A;  4CGO A;  4U9Z A;  2Z10 A;  3FRM A;  2PR1 A;  5G20 A;  4YGO A;  1BO4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...