2Z11A

Crystal structure of putative acetyltransferase
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
188
structure length
187
Chain Sequence
MWAFPERFEGRHVRLEPLALAHLPAFLRHYDPEVYRFLSRAPVAPTEEALRAHLEGLLGEPGRVNWAILFGKEVAGRISVIAPEPEHAKLELGTMLFKPFWGSPANKEAKLLLRHAFEVLRAERVQFKVDLRNERSQRALEALGAVREGVLRKNRRLPDGAFRDDVVYSVLKEEWPGVKARLEARLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribosomal-protein-alanine acetyltransferase
publication title Crystal structure of putative acetyltransferase
rcsb
source organism Thermus thermophilus
molecule tags Transferase
total genus 60
structure length 187
sequence length 188
ec nomenclature ec 2.3.1.128: Transferred entry: 2.3.1.267.
pdb deposition date 2007-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13302 Acetyltransf_3 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2z11A00
4MBUA 2HQYA 1XIXA 4HKFA 3F8KA 3FXTA 1I1DA 1KUVA 5F48A 4ZBGA 2OH1A 1YGHA 3SXNA 3D2MA 1YVOA 4JWPA 3ZJ0A 3TO6A 4OLLA 4PSXA 1M4DA 1WK4A 1CJWA 1Z9UA 2Q04A 3MGDA 4QVTA 5GCNA 4H6UA 1S60A 3TT2A 1M44A 1Q2CA 1MJAA 3W6SA 4QB9A 3T90A 4XPDB 1IYLA 5H86A 3IWGA 1NMTA 1V0CA 4E0AA 4AG7A 2FIAA 3DR8A 1Q2DA 3LD2A 3H4QA 4CRZB 2R7HA 4U9ZA 2PR1A 3R9FA 3C26A 5IB0A 3K9UA 2Q4VA 1PU9A 2BEIA 3S6KA 5KTAA 1Y9WA 2OZHA 2CNSA 3EY5A 1S5KA 4DNCA 4MY0A 4IF5A 3R9EA 1KUXA 3QAHA 2C27A 3I9SA 4NSQA 3TO7A 3F0AA 3CXPA 2VZZA 4U9YA 2O28A 4CAXA 4RI1A 3QB8A 2R8VA 5JQ4A 2HUZA 1IIDA 2OZUA 1NSLA 1WWZA 4R87A 3F5BA 3S6FA 1SQHA 4E2AA 2OB0A 3B8GA 4R3KA 4AG9A 2G0BA 3TOAA 5C82A 5F49A 2B3VA 4XPDC 3OWCA 4KORA 4XPLA 3DDDA 5CNPA 1KZFA 1QSMA 2VBQA 4U5YA 2PRBA 2Z11A 1P4NA 2J8MA 1IICA 4QBJA 2ZW6A 1QSOA 2FS5A 4JXRA 1IYKA 4J3GA 2GANA 2EVNA 2FIWA 2PR8A 1J4JA 4MY3A 2VQYA 2FL4A 2PQ8A 1LRZA 3EC4A 3W91A 4Y49C 2BUEA 3RYOA 3SHPA 1IB1E 3GKRA 2ZPAA 1VKCA 4FD7A 2PDOA 4M85A 1PUAA 1S7LA 5JPHA 3TTHA 4L8AA 1Z4RA 1QSRA 2X7BA 3E0KA 2VI7A 3CXSA 4FD6A 4KOYA 3D3SA 1QSTA 2REEA 2PC1A 5DWNA 1ON0A 2HV2A 4KUBA 2ZXVA 3D2PA 2ZW7A 4CRYB 4KLVA 1Y7RA 4KOVA 1YR0A 2WPWA 3TOBA 2BL1A 4MJ8A 1N71A 3KKWA 2B4DB 2B3UA 2Y0MA 4FD4A 2RC4A 4JJXA 2D4OA 4L89A 4PK2A 4NXYA 2CNMA 2ARHA 1U6MA 3SXOA 1R57A 4YGOA 3R95A 3V8IA 4F6AA 3FRMA 3FNCA 4AVAA 5FVJA 3DNSA 2JDDA 4EVYA 3W6XA 4YFJA 1GHEA 2QECA 2Q0YA 4B5PB 2GIVA 1L0CA 4AB7A 3FIXA 4H89A 4NCZA 3GYAA 4QUSA 4JLYA 3NE7A 1P0HA 2ATRA 4Y49B 5EC4A 1VHSA 3N7ZA 4UA3A 2I79A 2J8NA 4UWIA 3BJ7A 3GY9A 2P0WA 2J8RA 2FCKA 5KTDA 4UWJA 4BMHA 1NE9A 4JD6A 4KOXA 2Q7BA 1MJBA 4CAVA 2FT0A 3PGPA 4ONUA 5KTCA 3ZZIA 4KVXA 3S6HA 2NMTA 3JUWA 4KUAA 1Y9KA 2IL4A 4PV6A 3PP9A 1KUYA 3BJ8A 2R98A 3G3SA 1M1DA 2F5IA 4MI4A 5J8FA 4AVCA 2R1IA 4FD5A 2FXFA 4QC6A 3CXQA 3JVNA 5I0CA 3DR6A 4OAEA 4F0YA 4XNHB 1OZPA 4IUSA 1UFHA 5EBVA 3VWDA 4LX9A 2JEVA 2VZYA 2CNTA 1K4JA 2P6GA 2PSWA 2CY2A 4KOWA 4KVOE 1Z4EA 5ISVA 3EXNA 3BLNA 4KOUA 1BO4A 4E8OA 5IV0A 4KZTA 2VXKA 3TCVA 3EO4A 1QSNA 3FB3A 2FE7A 2D4PA 4I49A 1MJ9A 1YVKA 2VEZA 4X5KA 3P2FA 4JXQA 2P6FA 4R3LA 1S7KA 1S7NA 2B4BA 3EFAA 4XNHC 2B4DA 4MHDA 3WR7A 3TE4A 5F46A 4AVBA 2P6EA 1TIQA 1I12A 4R57A 5E96A 1Q2YA 4R9MA 2ZW4A 1YK3A 2AE6A 4HNYB 3TO9A 4KOTA 1RO5A 4XPKA 4CS0B 4B5PA 1YX0A 2Q44A 1FY7A 1B6BA 4ORFA 2KCWA 4UBRA 4HNWB 4K30A 3VWEA 2OU2A 2QMLA 2B58A 4NF1A 4PK3A 4GS4A 1S3ZA 3G8WA 1XEBA 1M4GA 1S7FA 1CM0A 1M4IA 3TFYA 4RS2A 4H6ZA 4HNXB 3UY5A 1I21A 1XF8A 1RXTA 2OZGA 5DWMA 2WPXA 3I3GA 5H84A 5J8CA 2Z0ZA 2G3AA 2H5MA 4NEXA 4II9A 3D8PA 3IGRA 1B87A 4OADA 3S6GA 2GE3A 2B5GB 5HH1A 3T9YA 2QIRA 1MK4A 3P2HA 1YLEA 2G3TA 4LUAA 2Z10A 2B5GA 5C88A 2FSRA 2K5TA 2DXQA 2I00A 1BOBA 2EUIA 3FYNA 5HMNA 1YREA 4M3SA 4PSWA 2A4NA 3R9GA 5F47A 1XE4A 3R1KA 2BSWA 2ZW5A 4B5OA 1XMTA 3LODA 2Q4YA 2JDCA 4KOSA 5IX3A 4CAWA 2REFA 3PZJA 4KLWA 3FBUA 2AJ6A 3R96A 4YRHA 4KVME 3DSBA 2JLMA
chains in the Genus database with same CATH superfamily
2BCOA 2HQYA 1XIXA 4MBUA 2PRQA 3B3SA 4HKFA 4NJQA 3F8KA 2RB7A 1Z8LA 3FMCA 3PRTA 2Z3NA 1JWQA 3FXTA 1HDQA 1I1DA 1F57A 1KUVA 2AFOA 1R3NA 2IJZA 5F48A 2OH1A 1YGHA 4O23A 4ZBGA 3SXNA 1Y7EA 3PBEA 3D66A 3D2MA 1YVOA 4B10A 4JWPA 3ZJ0A 3SJEA 1DE4C 3TO6A 1EE3P 1YLOA 1M4DA 1BLLE 4OLLA 1WK4A 4PSXA 2CTBA 1OBRA 5DS0A 4CAEA 1CJWA 1Z9UA 1YMEA 2Q04A 3MGDA 4NGSA 2ZEPA 4QVTA 5GCNA 2EWBA 8CPAA 5EMIA 4HPSA 4H6UA 1S60A 3TT2A 5LYDA 2O53A 3ISZA 5G20A 1M44A 1M4LA 1Q2CA 1CP6A 1MJAA 4MFLA 3W6SA 1LAMA 2WYRA 4C2XA 4MFQA 4QB9A 3T90A 2Z3KA 4MRIA 3GLJA 4XPDB 1IYLA 4DYOA 2PJAA 5H86A 4UFWA 1XFOA 1NMTA 1V0CA 2XEFA 3IWGA 4E0AA 1LAPA 4AG7A 2FIAA 4GXHA 3DR8A 1Q2DA 4IK2A 3LD2A 1BPMA 3H4QA 4CRZB 2R7HA 4U9ZA 4WWVA 2OOTA 3KQZA 1Z8XA 2PR1A 3R9FA 3C26A 3D7DA 2Z3OA 4UEFA 5IB0A 1TF9A 3K9UA 2Q4VA 4X2TA 1PU9A 2BEIA 4MHYA 3S6KA 4CGLA 5KTAA 1Y9WA 1TKHA 2CNSA 2OZHA 3EY5A 1S5KA 1ZG7A 3NE8A 3D4UA 3BXMA 4MCQA 5HVFA 4DNCA 1YQEA 4MY0A 4X3RA 4IF5A 3RO0A 4R6TA 4A95A 2YNDA 1KUXA 3QAHA 4MFPA 2C27A 3R9EA 7CPAA 5HVGA 3I9SA 4YWYA 3S9LA 3GUXA 4NSQA 3TO7A 3F0AA 1CPXA 5JM6A 3CXPA 2VZZA 4U9YA 2O28A 4CAXA 2JBKA 4RI1A 4YU9A 3B3VA 3NA6A 3QB8A 2R8VA 2AFZA 2EK8A 2HUZA 5JQ4A 1IIDA 2OZUA 2DEAA 2PE3A 3IJ3A 4A37A 5BWAB 3H5ZA 4X8IA 3TX8A 3B3CA 2C6GA 2PJ8A 1NSLA 1WWZA 4IAVA 4R87A 4P10A 4NGQA 3F5BA 3S6FA 1SQHA 4E2AA 2OB0A 5AG5A 4JZ0A 4MCPA 3H8FA 3PFOA 1XBUA 3B8GA 2AFSA 3IC1A 4R3KA 4AG9A 2G0BA 3KGQA 3TOAA 5C82A 4NGMA 5F49A 3BI1A 2B3VA 4XPDC 4A38A 3OWCA 2BO9A 4KORA 3SI2A 4XPLA 3DDDA 1LOKA 5CNPA 4OMEA 1KZFA 3B3TA 1QSMA 5J1QA 2PJCA 3GIUA 4MCSA 5LYIA 4W9YA 3LMSA 4C2ZA 5K8NA 5LRJA 4TWEA 2V8GA 2VBQA 4U5YA 1H8LA 2PRBA 2Z11A 2ODFA 2ZEMA 1P4NA 2J8MA 2ZOFA 1IICA 4QBJA 3D68A 2ZW6A 2Q7SA 4MFJA 1QSOA 1Z8TA 4CGNA 2FS5A 4JXRA 2GFQA 1IYKA 2VL1A 4J3GA 3SI1A 2GANA 4P44A 5I4MA 4G1PA 2CF4A 2EVNA 2AFWA 2FIWA 3V7ZA 3H8GA 1LANA 4B13A 2PR8A 3K2KA 1J4JA 4KSIA 4MY3A 5G1ZA 4F9UA 2QJ8A 2ZEEA 4KS9A 3MRUA 4B6ZA 3CPXA 2VQYA 5K8MA 1VIXA 2FL4A 3MN8A 2PQ8A 5JGFA 1LRZA 4CYQA 3EC4A 3W91A 2XEIA 2BUEA 4Y49C 3RYOA 3SHPA 2DPTA 1IB1E 5ELYA 4PXEA 3GKRA 4TNUA 3BI0A 2ZPAA 1VKCA 2AFMA 4FD7A 1QQ9A 2F8HA 2PDOA 4C7IA 4Q36A 4M85A 4P4DA 1PUAA 4NGPA 4C68A 5JPHA 4OC1A 2JBJA 3CT9A 2FVGA 4FAIA 4ZI6A 2GLFA 1RTQA 3TTHA 4L8AA 2DPSA 1Z2LA 1Z4RA 1QSRA 2X7BA 3E0KA 2VI7A 3CXSA 3FX6A 4FD6A 1VHEA 4KOYA 4GM5A 4OP4A 3D3SA 1ARLA 1QSTA 2REEA 4OKOA 2PC1A 3LWUA 4UEEA 5DWNA 1ON0A 1LCPA 4UEZA 4R7MA 2HV2A 4KUBA 2ZXVA 4MFZA 3D2PA 2ZW7A 2PJ1A 4PQAA 4CRYB 2G9DA 4KLVA 4M6HA 3KHXA 5F09A 1Y7RA 4KOVA 1YR0A 2WPWA 4K3NA 4R76A 3TOBA 4DUKA 6CPAA 2BL1A 3PB9X 4MJ8A 1N71A 3KKWA 2PIYA 4JYWA 4EMEA 2B4DB 2B3UA 1XMBA 2Q51A 2RC4A 2Y0MA 4FD4A 1XRYA 4JJXA 2D4OA 4CYNA 4UFVA 1IOIA 4A94A 4ZX8A 3IWWA 4L89A 4PK2A 1YW6A 3IIBA 2C6PA 4NXYA 1UWYA 2CNMA 2PCUA 4LQGA 3WC7A 2ARHA 1U6MA 2Q4ZA 2ZEFA 3SXOA 5LYFA 1FNOA 4UCPA 2PJ6A 1R57A 3GB0A 4YGOA 3R95A 3V8IA 4F6AA 3NH4A 2WZNA 3TC8A 3FRMA 3RZAA 3FNCA 3D7HA 4AVAA 5FVJA 2EO8A 2JDDA 3DNSA 4DJLA 3N5FA 4A32A 4BINA 4FUUA 4MFKA 3VARA 1ZLHA 5G22A 1TXRA 1Y0YA 4ZGYB 4EVYA 2NSMA 3W6XA 2PVVA 1GHEA 2QECA 2Q0YA 3D7GA 4B5PB 4YFJA 2GIVA 1L0CA 2PJ7A 5K8PA 2ZENA 3KZWA 5D8NA 4AB7A 3FIXA 2PVWA 4H89A 4UIAA 5IB9A 2PIZA 4NCZA 3WABA 4CGMA 3GYAA 4QUSA 4JLYA 3NE7A 1P0HA 5AG7A 2ATRA 4Y49B 5EC4A 5THWA 1VHSA 3IO1A 2DF5A 3N7ZA 2I79A 4P4FA 3B7IA 4UA3A 5CBMA 2J8NA 3BHXA 4UWIA 4KSAA 3VH9A 3BJ7A 3GY9A 4A33A 2QYVA 4MHNA 2C6CA 2ZEOA 4MCRA 2P0WA 2J8RA 5LRKA 2FCKA 5KTDA 4UWJA 4MHZA 4BMHA 1X12A 3NFZA 1NE9A 5HXDA 1ARMA 4B11A 2V8VA 4NGNA 4JD6A 4KOXA 2Q7BA 1MJBA 4CAVA 2FT0A 2ZOGA 3PGPA 4ONUA 5KTCA 3ZZIA 4KVXA 5K8OA 1QMUA 5AGEA 2IQ6A 3S6HA 4EFDA 2ANPA 2NMTA 3JUWA 4B14A 3S9NA 4F8ZA 1F2PA 4KUAA 4PXBA 1Y9KA 2O4HA 2IL4A 3T8WA 4PV6A 3PP9A 1KUYA 4Z65A 4P6YA 4PXCA 4ZYQA 3BJ8A 2R98A 3G3SA 1M1DA 1ELMP 2GLJA 4FWUA 2F5IA 4MI4A 1Z8WA 5J8FA 1Y0RA 4AVCA 4ZY1A 1CBXA 2R1IA 4FD5A 4ZY0A 3CPAA 2FXFA 4QC6A 4F0XA 1IY7A 3CXQA 3PB6X 4EWTA 1BAVA 3NH5A 1YSJA 4OC0A 3JVNA 2PJBA 1ZO0A 5I0CA 1ZG9A 2Z3MA 3DR6A 4OAEA 4F0YA 4WJBA 4KSFA 4XNHB 1OZPA 1LFWA 4IUSA 1KWMA 1UFHA 5HVHA 5EBVA 4A31A 3KQXA 4UCMA 3D7FA 3VWDA 4LX9A 4KVME 4P4JA 2JEVA 2VZYA 1TKFA 2CNTA 1K4JA 2XEGA 3PFEA 2P6GA 2PSWA 4PPZA 4A39A 4ZY2A 4LQ6A 1TF8A 2HB6A 2CY2A 4KOWA 2PJ3A 3WC5A 4KVOE 4MMOA 4CGPA 1Z4EA 5ISVA 3D67A 3EXNA 4OIWA 2WSAA 1F2OA 3SJXA 5CPAA 3FJUA 1TKJA 3BLNA 4KOUA 1BO4A 4E8OA 4MHPA 5IV0A 4KZTA 2VXKA 5D29A 2PJ5A 3FF3A 1DTDA 1R43A 3EO4A 3KR4A 3TCVA 1QSNA 3HLPA 3JTKA 1PYTB 3FB3A 5A27A 2FE7A 2D4PA 2RFHA 2Z3PA 4CPAA 3IWEA 4I49A 1MJ9A 1YVKA 3DGVA 2VEZA 4X5KA 2GU2A 3IEHA 3P2FA 4UFXA 4JXQA 2P6FA 4Q7AA 4P4IA 4R3LA 1JQGA 1IGBA 2V8HA 1VGYA 2YGWA 3KL9A 1S7KA 2OR4A 1S7NA 2B4BA 2F7VA 2YNCC 3EFAA 4XNHC 2B4DA 2CTCA 3H8EA 4MHDA 3WR7A 4M6GA 4UCNA 3CDXA 4OIDA 3TE4A 5F46A 4AVBA 3S9MA 2P6EA 2ZEDA 4UF4A 4CYOA 2PJ0A 3FEEA 2PJ9A 4A2ZA 1TIQA 1CG2A 2XEJA 1I12A 4R57A 5E96A 3RNZA 1Q2YA 3SJGA 4RN7A 2IMOA 4R9MA 3QNVA 1CP7A 3SJFA 2POKA 4AXVA 4CGOA 2ZW4A 3LACA 1YK3A 2AE6A 2PJ4A 4HNYB 3TO9A 4KOTA 4FBEA 1RO5A 3FECA 3PEIA 4XPKA 3KASA 4CS0B 2AFUA 3CZXA 2ZEHA 3VATA 3KHZA 4B5PA 1YX0A 2Q44A 1XOVA 1Z5RA 1FY7A 1HEEA 3IU2A 4NJRA 2ZEGA 3B3WA 3NH8A 4MXUA 4ORFA 1ZLIA 4P45A 4UIBA 2WUUA 1YW4A 1VHOA 4Q38A 2KCWA 4UBRA 2CIJA 3WT4A 3SI0A 4HNWB 4K30A 3VWEA 2OU2A 2QMLA 4B12A 2B58A 4NF1A 1AMPA 2BOAA 4GS4A 4PK3A 1S3ZA 3G8WA 3QAYA 1XEBA 1IOFA 1M4GA 1CM0A 1S7FA 4NGRA 1M4IA 4R8FA 3TFYA 4RS2A 1GYTA 3B35A 4H6ZA 4HNXB 2V77A 3UY5A 2ABZA 4ZX9A 2EBJA 3ISXA 1XJOA 3FVLA 3JRUA 1I21A 2Z3LA 1XF8A 4BBHA 5A28A 1RXTA 3IU1A 3RBUA 2OZGA 5DWMA 4P4BA 5LRGA 3HUVA 4OC2A 2WPXA 3I3GA 3L2NA 5H84A 2Z0ZA 4C2YA 5J8CA 2G3AA 4NGTA 2H5MA 4RUHA 4NEXA 2GREA 4CYPA 3DLJA 4II9A 3D8PA 5JH9A 3IGRA 1PCAA 4PXDA 1B87A 4OADA 3S6GA 2GE3A 2B5GB 3KI9A 4IHMA 5HH1A 4OC4A 2QIRA 3T9YA 1MK4A 3KR5A 1FT7A 2CXAA 1ZG8A 3P2HA 1YLEA 1X10A 2G3TA 4ONWA 5LYLA 3FH4A 3PB4X 4LUAA 2Z10A 2B5GA 4NFRA 5AG6A 5C88A 2FSRA 2K5TA 2DXQA 2I00A 1BOBA 2EUIA 3FYNA 4OC5A 5HMNA 1YREA 1IU8A 4C7HA 2YNCA 3DSBA 2PJ2A 3A9LA 1CPSA 2V8DA 3PBBA 4M3SA 5AG4A 3V38A 3K9TA 4PSWA 2A4NA 3I1UA 5G21A 2NYQA 3R9GA 1AYEA 4BD9A 5F47A 3IFEA 3PB7X 4F9VA 1A2ZA 2J9AA 3PB8X 1XE4A 3R1KA 2BSWA 2ZW5A 4B5OA 1XMTA 3LODA 3RAMA 2Q43A 2Q4YA 2JDCA 4KOSA 2YNEA 5IX3A 4CAWA 2I3CA 2REFA 3B2YA 4OC3A 1CX8A 4H2KA 4M6IA 4P4EA 4A30A 4CAFA 2C1CA 3PZJA 2JEWA 4KLWA 3FBUA 3FEDA 1ELLP 3WC6A 1AUGA 2AJ6A 2HC9A 2ZELA 3R96A 2EK9A 2QVPA 1Q7LA 2AFXA 4YRHA 1S7LA 1B6BA 2JLMA 1HDUA 1BPNA 1NSAA
chains in the Genus database with same CATH topology
4MBUA 2HQYA 1XIXA 4HKFA 3F8KA 2Z3NA 3FXTA 1I1DA 1KUVA 5F48A 4ZBGA 2OH1A 1YGHA 3SXNA 3D2MA 1YVOA 4B10A 4JWPA 3ZJ0A 3TO6A 4OLLA 4PSXA 1M4DA 1WK4A 4CAEA 1CJWA 1Z9UA 2Q04A 3MGDA 4QVTA 5GCNA 4H6UA 1S60A 3TT2A 5G20A 1M44A 1Q2CA 1MJAA 4MFLA 3W6SA 4C2XA 4MFQA 4QB9A 3T90A 2Z3KA 4XPDB 1IYLA 5H86A 4UFWA 3IWGA 1NMTA 1V0CA 4E0AA 4AG7A 2FIAA 3DR8A 1Q2DA 3LD2A 3H4QA 4CRZB 2R7HA 4U9ZA 2PR1A 3R9FA 3C26A 2Z3OA 5IB0A 3K9UA 2Q4VA 1PU9A 2BEIA 3S6KA 4CGLA 5KTAA 1Y9WA 2OZHA 2CNSA 3EY5A 1S5KA 4DNCA 4MY0A 4IF5A 4A95A 2YNDA 1KUXA 3QAHA 4MFPA 2C27A 3R9EA 3I9SA 4NSQA 3TO7A 3F0AA 3CXPA 2VZZA 4U9YA 2O28A 4CAXA 4RI1A 3QB8A 2R8VA 5JQ4A 2HUZA 1IIDA 2OZUA 5BWAB 3H5ZA 1NSLA 1WWZA 4R87A 3F5BA 3S6FA 1SQHA 4E2AA 2OB0A 5AG5A 3B8GA 4R3KA 4AG9A 2G0BA 3TOAA 5C82A 5F49A 2B3VA 4XPDC 3OWCA 4KORA 4XPLA 3DDDA 5CNPA 1KZFA 1QSMA 4C2ZA 2VBQA 4U5YA 2PRBA 2Z11A 1P4NA 2J8MA 1IICA 4QBJA 2ZW6A 4MFJA 1QSOA 4CGNA 2FS5A 4JXRA 1IYKA 4J3GA 2GANA 2EVNA 2FIWA 4B13A 2PR8A 1J4JA 4MY3A 5G1ZA 4KS9A 2VQYA 2FL4A 2PQ8A 1LRZA 4CYQA 3EC4A 3W91A 4Y49C 2BUEA 3RYOA 3SHPA 2DPTA 1IB1E 3GKRA 2ZPAA 1VKCA 4FD7A 4C7IA 2PDOA 4Q36A 4M85A 1PUAA 4C68A 5JPHA 3TTHA 4L8AA 2DPSA 1Z4RA 1QSRA 2X7BA 3E0KA 2VI7A 3CXSA 4FD6A 4KOYA 3D3SA 1QSTA 2REEA 2PC1A 5DWNA 1ON0A 2HV2A 4KUBA 2ZXVA 4MFZA 3D2PA 2ZW7A 4CRYB 4KLVA 1Y7RA 4KOVA 1YR0A 2WPWA 3TOBA 2BL1A 4MJ8A 1N71A 3KKWA 2B4DB 2B3UA 2Y0MA 4FD4A 2RC4A 4CYNA 4JJXA 2D4OA 4UFVA 4L89A 4PK2A 4NXYA 2CNMA 2ARHA 1U6MA 3SXOA 4UCPA 1R57A 4YGOA 3R95A 3V8IA 4F6AA 3FRMA 3FNCA 4AVAA 5FVJA 3DNSA 2JDDA 4A32A 4MFKA 5G22A 4ZGYB 4EVYA 3W6XA 4YFJA 1GHEA 2QECA 2Q0YA 4B5PB 2GIVA 1L0CA 4AB7A 3FIXA 4H89A 4NCZA 4CGMA 3GYAA 4QUSA 4JLYA 3NE7A 1P0HA 5AG7A 2ATRA 4Y49B 5EC4A 1VHSA 3N7ZA 4UA3A 2I79A 2J8NA 4UWIA 4KSAA 3BJ7A 3GY9A 4A33A 2P0WA 2J8RA 2FCKA 5KTDA 4UWJA 4BMHA 1NE9A 4B11A 4JD6A 4KOXA 2Q7BA 1MJBA 4CAVA 2FT0A 3PGPA 4ONUA 5KTCA 3ZZIA 4KVXA 5AGEA 3S6HA 2NMTA 3JUWA 4B14A 4KUAA 1Y9KA 2IL4A 4PV6A 3PP9A 1KUYA 3BJ8A 2R98A 3G3SA 1M1DA 2F5IA 4MI4A 5J8FA 4AVCA 2R1IA 4FD5A 2FXFA 4QC6A 4F0XA 3CXQA 3JVNA 1ZO0A 5I0CA 2Z3MA 3DR6A 4OAEA 4F0YA 4KSFA 4XNHB 1OZPA 4IUSA 1UFHA 5EBVA 4A31A 4UCMA 3VWDA 4LX9A 4KVME 2JEVA 2VZYA 2CNTA 1K4JA 2P6GA 2PSWA 2CY2A 4KOWA 4KVOE 4CGPA 1Z4EA 5ISVA 3EXNA 2WSAA 3BLNA 4KOUA 1BO4A 4E8OA 5IV0A 4KZTA 2VXKA 3TCVA 3EO4A 1QSNA 3JTKA 3FB3A 5A27A 2FE7A 2D4PA 2Z3PA 3IWEA 4I49A 1MJ9A 1YVKA 2VEZA 4X5KA 3P2FA 4UFXA 4JXQA 2P6FA 4R3LA 2YGWA 1S7KA 1S7NA 2B4BA 3EFAA 2YNCC 4XNHC 2B4DA 4MHDA 3WR7A 4UCNA 3TE4A 5F46A 4AVBA 2P6EA 4CYOA 4A2ZA 1TIQA 1I12A 4R57A 5E96A 1Q2YA 4R9MA 4CGOA 2ZW4A 1YK3A 2AE6A 4HNYB 3TO9A 4KOTA 1RO5A 4XPKA 4CS0B 4B5PA 1YX0A 2Q44A 1FY7A 3IU2A 1B6BA 4ORFA 2WUUA 4Q38A 2KCWA 4UBRA 4HNWB 4K30A 3VWEA 2OU2A 2QMLA 4B12A 2B58A 4NF1A 4PK3A 4GS4A 1S3ZA 3G8WA 1XEBA 1M4GA 1S7FA 1CM0A 1M4IA 3TFYA 4RS2A 4H6ZA 4HNXB 3UY5A 1I21A 2Z3LA 1XF8A 4BBHA 5A28A 1RXTA 3IU1A 2OZGA 5DWMA 2WPXA 3I3GA 5H84A 4C2YA 2Z0ZA 5J8CA 2G3AA 2H5MA 4NEXA 4CYPA 4II9A 3D8PA 3IGRA 1B87A 4OADA 3S6GA 2GE3A 2B5GB 5HH1A 3T9YA 2QIRA 1MK4A 2CXAA 3P2HA 1YLEA 2G3TA 4LUAA 2Z10A 2B5GA 5AG6A 5C88A 2FSRA 2K5TA 2DXQA 2I00A 1BOBA 2EUIA 3FYNA 5HMNA 1YREA 4C7HA 2YNCA 3A9LA 4M3SA 5AG4A 4PSWA 2A4NA 5G21A 3R9GA 5F47A 1XE4A 3R1KA 2BSWA 2ZW5A 4B5OA 1XMTA 3LODA 2Q4YA 2JDCA 4KOSA 2YNEA 5IX3A 4CAWA 2REFA 4A30A 4CAFA 3PZJA 4KLWA 3FBUA 2AJ6A 3R96A 4YRHA 1S7LA 3DSBA 2JLMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MBU A;  2HQY A;  1XIX A;  4HKF A;  3F8K A;  3FXT A;  1I1D A;  1KUV A;  5F48 A;  4ZBG A;  2OH1 A;  1YGH A;  3SXN A;  3D2M A;  1YVO A;  4JWP A;  3ZJ0 A;  3TO6 A;  4OLL A;  4PSX A;  1M4D A;  1WK4 A;  1CJW A;  1Z9U A;  2Q04 A;  3MGD A;  4QVT A;  5GCN A;  4H6U A;  1S60 A;  3TT2 A;  1M44 A;  1Q2C A;  1MJA A;  3W6S A;  4QB9 A;  3T90 A;  4XPD B;  1IYL A;  5H86 A;  3IWG A;  1NMT A;  1V0C A;  4E0A A;  4AG7 A;  2FIA A;  3DR8 A;  1Q2D A;  3LD2 A;  3H4Q A;  4CRZ B;  2R7H A;  4U9Z A;  2PR1 A;  3R9F A;  3C26 A;  5IB0 A;  3K9U A;  2Q4V A;  1PU9 A;  2BEI A;  3S6K A;  5KTA A;  1Y9W A;  2OZH A;  2CNS A;  3EY5 A;  1S5K A;  4DNC A;  4MY0 A;  4IF5 A;  3R9E A;  1KUX A;  3QAH A;  2C27 A;  3I9S A;  4NSQ A;  3TO7 A;  3F0A A;  3CXP A;  2VZZ A;  4U9Y A;  2O28 A;  4CAX A;  4RI1 A;  3QB8 A;  2R8V A;  5JQ4 A;  2HUZ A;  1IID A;  2OZU A;  1NSL A;  1WWZ A;  4R87 A;  3F5B A;  3S6F A;  1SQH A;  4E2A A;  2OB0 A;  3B8G A;  4R3K A;  4AG9 A;  2G0B A;  3TOA A;  5C82 A;  5F49 A;  2B3V A;  4XPD C;  3OWC A;  4KOR A;  4XPL A;  3DDD A;  5CNP A;  1KZF A;  1QSM A;  2VBQ A;  4U5Y A;  2PRB A;  2Z11 A;  1P4N A;  2J8M A;  1IIC A;  4QBJ A;  2ZW6 A;  1QSO A;  2FS5 A;  4JXR A;  1IYK A;  4J3G A;  2GAN A;  2EVN A;  2FIW A;  2PR8 A;  1J4J A;  4MY3 A;  2VQY A;  2FL4 A;  2PQ8 A;  1LRZ A;  3EC4 A;  3W91 A;  4Y49 C;  2BUE A;  3RYO A;  3SHP A;  1IB1 E;  3GKR A;  2ZPA A;  1VKC A;  4FD7 A;  2PDO A;  4M85 A;  1PUA A;  1S7L A;  5JPH A;  3TTH A;  4L8A A;  1Z4R A;  1QSR A;  2X7B A;  3E0K A;  2VI7 A;  3CXS A;  4FD6 A;  4KOY A;  3D3S A;  1QST A;  2REE A;  2PC1 A;  5DWN A;  1ON0 A;  2HV2 A;  4KUB A;  2ZXV A;  3D2P A;  2ZW7 A;  4CRY B;  4KLV A;  1Y7R A;  4KOV A;  1YR0 A;  2WPW A;  3TOB A;  2BL1 A;  4MJ8 A;  1N71 A;  3KKW A;  2B4D B;  2B3U A;  2Y0M A;  4FD4 A;  2RC4 A;  4JJX A;  2D4O A;  4L89 A;  4PK2 A;  4NXY A;  2CNM A;  2ARH A;  1U6M A;  3SXO A;  1R57 A;  4YGO A;  3R95 A;  3V8I A;  4F6A A;  3FRM A;  3FNC A;  4AVA A;  5FVJ A;  3DNS A;  2JDD A;  4EVY A;  3W6X A;  4YFJ A;  1GHE A;  2QEC A;  2Q0Y A;  4B5P B;  2GIV A;  1L0C A;  4AB7 A;  3FIX A;  4H89 A;  4NCZ A;  3GYA A;  4QUS A;  4JLY A;  3NE7 A;  1P0H A;  2ATR A;  4Y49 B;  5EC4 A;  1VHS A;  3N7Z A;  4UA3 A;  2I79 A;  2J8N A;  4UWI A;  3BJ7 A;  3GY9 A;  2P0W A;  2J8R A;  2FCK A;  5KTD A;  4UWJ A;  4BMH A;  1NE9 A;  4JD6 A;  4KOX A;  2Q7B A;  1MJB A;  4CAV A;  2FT0 A;  3PGP A;  4ONU A;  5KTC A;  3ZZI A;  4KVX A;  3S6H A;  2NMT A;  3JUW A;  4KUA A;  1Y9K A;  2IL4 A;  4PV6 A;  3PP9 A;  1KUY A;  3BJ8 A;  2R98 A;  3G3S A;  1M1D A;  2F5I A;  4MI4 A;  5J8F A;  4AVC A;  2R1I A;  4FD5 A;  2FXF A;  4QC6 A;  3CXQ A;  3JVN A;  5I0C A;  3DR6 A;  4OAE A;  4F0Y A;  4XNH B;  1OZP A;  4IUS A;  1UFH A;  5EBV A;  3VWD A;  4LX9 A;  2JEV A;  2VZY A;  2CNT A;  1K4J A;  2P6G A;  2PSW A;  2CY2 A;  4KOW A;  4KVO E;  1Z4E A;  5ISV A;  3EXN A;  3BLN A;  4KOU A;  1BO4 A;  4E8O A;  5IV0 A;  4KZT A;  2VXK A;  3TCV A;  3EO4 A;  1QSN A;  3FB3 A;  2FE7 A;  2D4P A;  4I49 A;  1MJ9 A;  1YVK A;  2VEZ A;  4X5K A;  3P2F A;  4JXQ A;  2P6F A;  4R3L A;  1S7K A;  1S7N A;  2B4B A;  3EFA A;  4XNH C;  2B4D A;  4MHD A;  3WR7 A;  3TE4 A;  5F46 A;  4AVB A;  2P6E A;  1TIQ A;  1I12 A;  4R57 A;  5E96 A;  1Q2Y A;  4R9M A;  2ZW4 A;  1YK3 A;  2AE6 A;  4HNY B;  3TO9 A;  4KOT A;  1RO5 A;  4XPK A;  4CS0 B;  4B5P A;  1YX0 A;  2Q44 A;  1FY7 A;  1B6B A;  4ORF A;  2KCW A;  4UBR A;  4HNW B;  4K30 A;  3VWE A;  2OU2 A;  2QML A;  2B58 A;  4NF1 A;  4PK3 A;  4GS4 A;  1S3Z A;  3G8W A;  1XEB A;  1M4G A;  1S7F A;  1CM0 A;  1M4I A;  3TFY A;  4RS2 A;  4H6Z A;  4HNX B;  3UY5 A;  1I21 A;  1XF8 A;  1RXT A;  2OZG A;  5DWM A;  2WPX A;  3I3G A;  5H84 A;  5J8C A;  2Z0Z A;  2G3A A;  2H5M A;  4NEX A;  4II9 A;  3D8P A;  3IGR A;  1B87 A;  4OAD A;  3S6G A;  2GE3 A;  2B5G B;  5HH1 A;  3T9Y A;  2QIR A;  1MK4 A;  3P2H A;  1YLE A;  2G3T A;  4LUA A;  2Z10 A;  2B5G A;  5C88 A;  2FSR A;  2K5T A;  2DXQ A;  2I00 A;  1BOB A;  2EUI A;  3FYN A;  5HMN A;  1YRE A;  4M3S A;  4PSW A;  2A4N A;  3R9G A;  5F47 A;  1XE4 A;  3R1K A;  2BSW A;  2ZW5 A;  4B5O A;  1XMT A;  3LOD A;  2Q4Y A;  2JDC A;  4KOS A;  5IX3 A;  4CAW A;  2REF A;  3PZJ A;  4KLW A;  3FBU A;  2AJ6 A;  3R96 A;  4YRH A;  4KVM E;  3DSB A;  2JLM A; 
#chains in the Genus database with same CATH topology
 2BCO A;  2HQY A;  1XIX A;  4MBU A;  2PRQ A;  3B3S A;  4HKF A;  4NJQ A;  3F8K A;  2RB7 A;  1Z8L A;  3FMC A;  3PRT A;  2Z3N A;  1JWQ A;  3FXT A;  1HDQ A;  1I1D A;  1F57 A;  1KUV A;  2AFO A;  1R3N A;  2IJZ A;  5F48 A;  2OH1 A;  1YGH A;  4O23 A;  4ZBG A;  3SXN A;  1Y7E A;  3PBE A;  3D66 A;  3D2M A;  1YVO A;  4B10 A;  4JWP A;  3ZJ0 A;  3SJE A;  1DE4 C;  3TO6 A;  1EE3 P;  1YLO A;  1M4D A;  1BLL E;  4OLL A;  1WK4 A;  4PSX A;  2CTB A;  1OBR A;  5DS0 A;  4CAE A;  1CJW A;  1Z9U A;  1YME A;  2Q04 A;  3MGD A;  4NGS A;  2ZEP A;  4QVT A;  5GCN A;  2EWB A;  8CPA A;  5EMI A;  4HPS A;  4H6U A;  1S60 A;  3TT2 A;  5LYD A;  2O53 A;  3ISZ A;  5G20 A;  1M44 A;  1M4L A;  1Q2C A;  1CP6 A;  1MJA A;  4MFL A;  3W6S A;  1LAM A;  2WYR A;  4C2X A;  4MFQ A;  4QB9 A;  3T90 A;  2Z3K A;  4MRI A;  3GLJ A;  4XPD B;  1IYL A;  4DYO A;  2PJA A;  5H86 A;  4UFW A;  1XFO A;  1NMT A;  1V0C A;  2XEF A;  3IWG A;  4E0A A;  1LAP A;  4AG7 A;  2FIA A;  4GXH A;  3DR8 A;  1Q2D A;  4IK2 A;  3LD2 A;  1BPM A;  3H4Q A;  4CRZ B;  2R7H A;  4U9Z A;  4WWV A;  2OOT A;  3KQZ A;  1Z8X A;  2PR1 A;  3R9F A;  3C26 A;  3D7D A;  2Z3O A;  4UEF A;  5IB0 A;  1TF9 A;  3K9U A;  2Q4V A;  4X2T A;  1PU9 A;  2BEI A;  4MHY A;  3S6K A;  4CGL A;  5KTA A;  1Y9W A;  1TKH A;  2CNS A;  2OZH A;  3EY5 A;  1S5K A;  1ZG7 A;  3NE8 A;  3D4U A;  3BXM A;  4MCQ A;  5HVF A;  4DNC A;  1YQE A;  4MY0 A;  4X3R A;  4IF5 A;  3RO0 A;  4R6T A;  4A95 A;  2YND A;  1KUX A;  3QAH A;  4MFP A;  2C27 A;  3R9E A;  7CPA A;  5HVG A;  3I9S A;  4YWY A;  3S9L A;  3GUX A;  4NSQ A;  3TO7 A;  3F0A A;  1CPX A;  5JM6 A;  3CXP A;  2VZZ A;  4U9Y A;  2O28 A;  4CAX A;  2JBK A;  4RI1 A;  4YU9 A;  3B3V A;  3NA6 A;  3QB8 A;  2R8V A;  2AFZ A;  2EK8 A;  2HUZ A;  5JQ4 A;  1IID A;  2OZU A;  2DEA A;  2PE3 A;  3IJ3 A;  4A37 A;  5BWA B;  3H5Z A;  4X8I A;  3TX8 A;  3B3C A;  2C6G A;  2PJ8 A;  1NSL A;  1WWZ A;  4IAV A;  4R87 A;  4P10 A;  4NGQ A;  3F5B A;  3S6F A;  1SQH A;  4E2A A;  2OB0 A;  5AG5 A;  4JZ0 A;  4MCP A;  3H8F A;  3PFO A;  1XBU A;  3B8G A;  2AFS A;  3IC1 A;  4R3K A;  4AG9 A;  2G0B A;  3KGQ A;  3TOA A;  5C82 A;  4NGM A;  5F49 A;  3BI1 A;  2B3V A;  4XPD C;  4A38 A;  3OWC A;  2BO9 A;  4KOR A;  3SI2 A;  4XPL A;  3DDD A;  1LOK A;  5CNP A;  4OME A;  1KZF A;  3B3T A;  1QSM A;  5J1Q A;  2PJC A;  3GIU A;  4MCS A;  5LYI A;  4W9Y A;  3LMS A;  4C2Z A;  5K8N A;  5LRJ A;  4TWE A;  2V8G A;  2VBQ A;  4U5Y A;  1H8L A;  2PRB A;  2Z11 A;  2ODF A;  2ZEM A;  1P4N A;  2J8M A;  2ZOF A;  1IIC A;  4QBJ A;  3D68 A;  2ZW6 A;  2Q7S A;  4MFJ A;  1QSO A;  1Z8T A;  4CGN A;  2FS5 A;  4JXR A;  2GFQ A;  1IYK A;  2VL1 A;  4J3G A;  3SI1 A;  2GAN A;  4P44 A;  5I4M A;  4G1P A;  2CF4 A;  2EVN A;  2AFW A;  2FIW A;  3V7Z A;  3H8G A;  1LAN A;  4B13 A;  2PR8 A;  3K2K A;  1J4J A;  4KSI A;  4MY3 A;  5G1Z A;  4F9U A;  2QJ8 A;  2ZEE A;  4KS9 A;  3MRU A;  4B6Z A;  3CPX A;  2VQY A;  5K8M A;  1VIX A;  2FL4 A;  3MN8 A;  2PQ8 A;  5JGF A;  1LRZ A;  4CYQ A;  3EC4 A;  3W91 A;  2XEI A;  2BUE A;  4Y49 C;  3RYO A;  3SHP A;  2DPT A;  1IB1 E;  5ELY A;  4PXE A;  3GKR A;  4TNU A;  3BI0 A;  2ZPA A;  1VKC A;  2AFM A;  4FD7 A;  1QQ9 A;  2F8H A;  2PDO A;  4C7I A;  4Q36 A;  4M85 A;  4P4D A;  1PUA A;  4NGP A;  4C68 A;  5JPH A;  4OC1 A;  2JBJ A;  3CT9 A;  2FVG A;  4FAI A;  4ZI6 A;  2GLF A;  1RTQ A;  3TTH A;  4L8A A;  2DPS A;  1Z2L A;  1Z4R A;  1QSR A;  2X7B A;  3E0K A;  2VI7 A;  3CXS A;  3FX6 A;  4FD6 A;  1VHE A;  4KOY A;  4GM5 A;  4OP4 A;  3D3S A;  1ARL A;  1QST A;  2REE A;  4OKO A;  2PC1 A;  3LWU A;  4UEE A;  5DWN A;  1ON0 A;  1LCP A;  4UEZ A;  4R7M A;  2HV2 A;  4KUB A;  2ZXV A;  4MFZ A;  3D2P A;  2ZW7 A;  2PJ1 A;  4PQA A;  4CRY B;  2G9D A;  4KLV A;  4M6H A;  3KHX A;  5F09 A;  1Y7R A;  4KOV A;  1YR0 A;  2WPW A;  4K3N A;  4R76 A;  3TOB A;  4DUK A;  6CPA A;  2BL1 A;  3PB9 X;  4MJ8 A;  1N71 A;  3KKW A;  2PIY A;  4JYW A;  4EME A;  2B4D B;  2B3U A;  1XMB A;  2Q51 A;  2RC4 A;  2Y0M A;  4FD4 A;  1XRY A;  4JJX A;  2D4O A;  4CYN A;  4UFV A;  1IOI A;  4A94 A;  4ZX8 A;  3IWW A;  4L89 A;  4PK2 A;  1YW6 A;  3IIB A;  2C6P A;  4NXY A;  1UWY A;  2CNM A;  2PCU A;  4LQG A;  3WC7 A;  2ARH A;  1U6M A;  2Q4Z A;  2ZEF A;  3SXO A;  5LYF A;  1FNO A;  4UCP A;  2PJ6 A;  1R57 A;  3GB0 A;  4YGO A;  3R95 A;  3V8I A;  4F6A A;  3NH4 A;  2WZN A;  3TC8 A;  3FRM A;  3RZA A;  3FNC A;  3D7H A;  4AVA A;  5FVJ A;  2EO8 A;  2JDD A;  3DNS A;  4DJL A;  3N5F A;  4A32 A;  4BIN A;  4FUU A;  4MFK A;  3VAR A;  1ZLH A;  5G22 A;  1TXR A;  1Y0Y A;  4ZGY B;  4EVY A;  2NSM A;  3W6X A;  2PVV A;  1GHE A;  2QEC A;  2Q0Y A;  3D7G A;  4B5P B;  4YFJ A;  2GIV A;  1L0C A;  2PJ7 A;  5K8P A;  2ZEN A;  3KZW A;  5D8N A;  4AB7 A;  3FIX A;  2PVW A;  4H89 A;  4UIA A;  5IB9 A;  2PIZ A;  4NCZ A;  3WAB A;  4CGM A;  3GYA A;  4QUS A;  4JLY A;  3NE7 A;  1P0H A;  5AG7 A;  2ATR A;  4Y49 B;  5EC4 A;  5THW A;  1VHS A;  3IO1 A;  2DF5 A;  3N7Z A;  2I79 A;  4P4F A;  3B7I A;  4UA3 A;  5CBM A;  2J8N A;  3BHX A;  4UWI A;  4KSA A;  3VH9 A;  3BJ7 A;  3GY9 A;  4A33 A;  2QYV A;  4MHN A;  2C6C A;  2ZEO A;  4MCR A;  2P0W A;  2J8R A;  5LRK A;  2FCK A;  5KTD A;  4UWJ A;  4MHZ A;  4BMH A;  1X12 A;  3NFZ A;  1NE9 A;  5HXD A;  1ARM A;  4B11 A;  2V8V A;  4NGN A;  4JD6 A;  4KOX A;  2Q7B A;  1MJB A;  4CAV A;  2FT0 A;  2ZOG A;  3PGP A;  4ONU A;  5KTC A;  3ZZI A;  4KVX A;  5K8O A;  1QMU A;  5AGE A;  2IQ6 A;  3S6H A;  4EFD A;  2ANP A;  2NMT A;  3JUW A;  4B14 A;  3S9N A;  4F8Z A;  1F2P A;  4KUA A;  4PXB A;  1Y9K A;  2O4H A;  2IL4 A;  3T8W A;  4PV6 A;  3PP9 A;  1KUY A;  4Z65 A;  4P6Y A;  4PXC A;  4ZYQ A;  3BJ8 A;  2R98 A;  3G3S A;  1M1D A;  1ELM P;  2GLJ A;  4FWU A;  2F5I A;  4MI4 A;  1Z8W A;  5J8F A;  1Y0R A;  4AVC A;  4ZY1 A;  1CBX A;  2R1I A;  4FD5 A;  4ZY0 A;  3CPA A;  2FXF A;  4QC6 A;  4F0X A;  1IY7 A;  3CXQ A;  3PB6 X;  4EWT A;  1BAV A;  3NH5 A;  1YSJ A;  4OC0 A;  3JVN A;  2PJB A;  1ZO0 A;  5I0C A;  1ZG9 A;  2Z3M A;  3DR6 A;  4OAE A;  4F0Y A;  4WJB A;  4KSF A;  4XNH B;  1OZP A;  1LFW A;  4IUS A;  1KWM A;  1UFH A;  5HVH A;  5EBV A;  4A31 A;  3KQX A;  4UCM A;  3D7F A;  3VWD A;  4LX9 A;  4KVM E;  4P4J A;  2JEV A;  2VZY A;  1TKF A;  2CNT A;  1K4J A;  2XEG A;  3PFE A;  2P6G A;  2PSW A;  4PPZ A;  4A39 A;  4ZY2 A;  4LQ6 A;  1TF8 A;  2HB6 A;  2CY2 A;  4KOW A;  2PJ3 A;  3WC5 A;  4KVO E;  4MMO A;  4CGP A;  1Z4E A;  5ISV A;  3D67 A;  3EXN A;  4OIW A;  2WSA A;  1F2O A;  3SJX A;  5CPA A;  3FJU A;  1TKJ A;  3BLN A;  4KOU A;  1BO4 A;  4E8O A;  4MHP A;  5IV0 A;  4KZT A;  2VXK A;  5D29 A;  2PJ5 A;  3FF3 A;  1DTD A;  1R43 A;  3EO4 A;  3KR4 A;  3TCV A;  1QSN A;  3HLP A;  3JTK A;  1PYT B;  3FB3 A;  5A27 A;  2FE7 A;  2D4P A;  2RFH A;  2Z3P A;  4CPA A;  3IWE A;  4I49 A;  1MJ9 A;  1YVK A;  3DGV A;  2VEZ A;  4X5K A;  2GU2 A;  3IEH A;  3P2F A;  4UFX A;  4JXQ A;  2P6F A;  4Q7A A;  4P4I A;  4R3L A;  1JQG A;  1IGB A;  2V8H A;  1VGY A;  2YGW A;  3KL9 A;  1S7K A;  2OR4 A;  1S7N A;  2B4B A;  2F7V A;  2YNC C;  3EFA A;  4XNH C;  2B4D A;  2CTC A;  3H8E A;  4MHD A;  3WR7 A;  4M6G A;  4UCN A;  3CDX A;  4OID A;  3TE4 A;  5F46 A;  4AVB A;  3S9M A;  2P6E A;  2ZED A;  4UF4 A;  4CYO A;  2PJ0 A;  3FEE A;  2PJ9 A;  4A2Z A;  1TIQ A;  1CG2 A;  2XEJ A;  1I12 A;  4R57 A;  5E96 A;  3RNZ A;  1Q2Y A;  3SJG A;  4RN7 A;  2IMO A;  4R9M A;  3QNV A;  1CP7 A;  3SJF A;  2POK A;  4AXV A;  4CGO A;  2ZW4 A;  3LAC A;  1YK3 A;  2AE6 A;  2PJ4 A;  4HNY B;  3TO9 A;  4KOT A;  4FBE A;  1RO5 A;  3FEC A;  3PEI A;  4XPK A;  3KAS A;  4CS0 B;  2AFU A;  3CZX A;  2ZEH A;  3VAT A;  3KHZ A;  4B5P A;  1YX0 A;  2Q44 A;  1XOV A;  1Z5R A;  1FY7 A;  1HEE A;  3IU2 A;  4NJR A;  2ZEG A;  3B3W A;  3NH8 A;  4MXU A;  4ORF A;  1ZLI A;  4P45 A;  4UIB A;  2WUU A;  1YW4 A;  1VHO A;  4Q38 A;  2KCW A;  4UBR A;  2CIJ A;  3WT4 A;  3SI0 A;  4HNW B;  4K30 A;  3VWE A;  2OU2 A;  2QML A;  4B12 A;  2B58 A;  4NF1 A;  1AMP A;  2BOA A;  4GS4 A;  4PK3 A;  1S3Z A;  3G8W A;  3QAY A;  1XEB A;  1IOF A;  1M4G A;  1CM0 A;  1S7F A;  4NGR A;  1M4I A;  4R8F A;  3TFY A;  4RS2 A;  1GYT A;  3B35 A;  4H6Z A;  4HNX B;  2V77 A;  3UY5 A;  2ABZ A;  4ZX9 A;  2EBJ A;  3ISX A;  1XJO A;  3FVL A;  3JRU A;  1I21 A;  2Z3L A;  1XF8 A;  4BBH A;  5A28 A;  1RXT A;  3IU1 A;  3RBU A;  2OZG A;  5DWM A;  4P4B A;  5LRG A;  3HUV A;  4OC2 A;  2WPX A;  3I3G A;  3L2N A;  5H84 A;  2Z0Z A;  4C2Y A;  5J8C A;  2G3A A;  4NGT A;  2H5M A;  4RUH A;  4NEX A;  2GRE A;  4CYP A;  3DLJ A;  4II9 A;  3D8P A;  5JH9 A;  3IGR A;  1PCA A;  4PXD A;  1B87 A;  4OAD A;  3S6G A;  2GE3 A;  2B5G B;  3KI9 A;  4IHM A;  5HH1 A;  4OC4 A;  2QIR A;  3T9Y A;  1MK4 A;  3KR5 A;  1FT7 A;  2CXA A;  1ZG8 A;  3P2H A;  1YLE A;  1X10 A;  2G3T A;  4ONW A;  5LYL A;  3FH4 A;  3PB4 X;  4LUA A;  2Z10 A;  2B5G A;  4NFR A;  5AG6 A;  5C88 A;  2FSR A;  2K5T A;  2DXQ A;  2I00 A;  1BOB A;  2EUI A;  3FYN A;  4OC5 A;  5HMN A;  1YRE A;  1IU8 A;  4C7H A;  2YNC A;  3DSB A;  2PJ2 A;  3A9L A;  1CPS A;  2V8D A;  3PBB A;  4M3S A;  5AG4 A;  3V38 A;  3K9T A;  4PSW A;  2A4N A;  3I1U A;  5G21 A;  2NYQ A;  3R9G A;  1AYE A;  4BD9 A;  5F47 A;  3IFE A;  3PB7 X;  4F9V A;  1A2Z A;  2J9A A;  3PB8 X;  1XE4 A;  3R1K A;  2BSW A;  2ZW5 A;  4B5O A;  1XMT A;  3LOD A;  3RAM A;  2Q43 A;  2Q4Y A;  2JDC A;  4KOS A;  2YNE A;  5IX3 A;  4CAW A;  2I3C A;  2REF A;  3B2Y A;  4OC3 A;  1CX8 A;  4H2K A;  4M6I A;  4P4E A;  4A30 A;  4CAF A;  2C1C A;  3PZJ A;  2JEW A;  4KLW A;  3FBU A;  3FED A;  1ELL P;  3WC6 A;  1AUG A;  2AJ6 A;  2HC9 A;  2ZEL A;  3R96 A;  2EK9 A;  2QVP A;  1Q7L A;  2AFX A;  4YRH A;  1S7L A;  1B6B A;  2JLM A;  1HDU A;  1BPN A;  1NSA A; 
#chains in the Genus database with same CATH homology
 4MBU A;  2HQY A;  1XIX A;  4HKF A;  3F8K A;  2Z3N A;  3FXT A;  1I1D A;  1KUV A;  5F48 A;  4ZBG A;  2OH1 A;  1YGH A;  3SXN A;  3D2M A;  1YVO A;  4B10 A;  4JWP A;  3ZJ0 A;  3TO6 A;  4OLL A;  4PSX A;  1M4D A;  1WK4 A;  4CAE A;  1CJW A;  1Z9U A;  2Q04 A;  3MGD A;  4QVT A;  5GCN A;  4H6U A;  1S60 A;  3TT2 A;  5G20 A;  1M44 A;  1Q2C A;  1MJA A;  4MFL A;  3W6S A;  4C2X A;  4MFQ A;  4QB9 A;  3T90 A;  2Z3K A;  4XPD B;  1IYL A;  5H86 A;  4UFW A;  3IWG A;  1NMT A;  1V0C A;  4E0A A;  4AG7 A;  2FIA A;  3DR8 A;  1Q2D A;  3LD2 A;  3H4Q A;  4CRZ B;  2R7H A;  4U9Z A;  2PR1 A;  3R9F A;  3C26 A;  2Z3O A;  5IB0 A;  3K9U A;  2Q4V A;  1PU9 A;  2BEI A;  3S6K A;  4CGL A;  5KTA A;  1Y9W A;  2OZH A;  2CNS A;  3EY5 A;  1S5K A;  4DNC A;  4MY0 A;  4IF5 A;  4A95 A;  2YND A;  1KUX A;  3QAH A;  4MFP A;  2C27 A;  3R9E A;  3I9S A;  4NSQ A;  3TO7 A;  3F0A A;  3CXP A;  2VZZ A;  4U9Y A;  2O28 A;  4CAX A;  4RI1 A;  3QB8 A;  2R8V A;  5JQ4 A;  2HUZ A;  1IID A;  2OZU A;  5BWA B;  3H5Z A;  1NSL A;  1WWZ A;  4R87 A;  3F5B A;  3S6F A;  1SQH A;  4E2A A;  2OB0 A;  5AG5 A;  3B8G A;  4R3K A;  4AG9 A;  2G0B A;  3TOA A;  5C82 A;  5F49 A;  2B3V A;  4XPD C;  3OWC A;  4KOR A;  4XPL A;  3DDD A;  5CNP A;  1KZF A;  1QSM A;  4C2Z A;  2VBQ A;  4U5Y A;  2PRB A;  2Z11 A;  1P4N A;  2J8M A;  1IIC A;  4QBJ A;  2ZW6 A;  4MFJ A;  1QSO A;  4CGN A;  2FS5 A;  4JXR A;  1IYK A;  4J3G A;  2GAN A;  2EVN A;  2FIW A;  4B13 A;  2PR8 A;  1J4J A;  4MY3 A;  5G1Z A;  4KS9 A;  2VQY A;  2FL4 A;  2PQ8 A;  1LRZ A;  4CYQ A;  3EC4 A;  3W91 A;  4Y49 C;  2BUE A;  3RYO A;  3SHP A;  2DPT A;  1IB1 E;  3GKR A;  2ZPA A;  1VKC A;  4FD7 A;  4C7I A;  2PDO A;  4Q36 A;  4M85 A;  1PUA A;  4C68 A;  5JPH A;  3TTH A;  4L8A A;  2DPS A;  1Z4R A;  1QSR A;  2X7B A;  3E0K A;  2VI7 A;  3CXS A;  4FD6 A;  4KOY A;  3D3S A;  1QST A;  2REE A;  2PC1 A;  5DWN A;  1ON0 A;  2HV2 A;  4KUB A;  2ZXV A;  4MFZ A;  3D2P A;  2ZW7 A;  4CRY B;  4KLV A;  1Y7R A;  4KOV A;  1YR0 A;  2WPW A;  3TOB A;  2BL1 A;  4MJ8 A;  1N71 A;  3KKW A;  2B4D B;  2B3U A;  2Y0M A;  4FD4 A;  2RC4 A;  4CYN A;  4JJX A;  2D4O A;  4UFV A;  4L89 A;  4PK2 A;  4NXY A;  2CNM A;  2ARH A;  1U6M A;  3SXO A;  4UCP A;  1R57 A;  4YGO A;  3R95 A;  3V8I A;  4F6A A;  3FRM A;  3FNC A;  4AVA A;  5FVJ A;  3DNS A;  2JDD A;  4A32 A;  4MFK A;  5G22 A;  4ZGY B;  4EVY A;  3W6X A;  4YFJ A;  1GHE A;  2QEC A;  2Q0Y A;  4B5P B;  2GIV A;  1L0C A;  4AB7 A;  3FIX A;  4H89 A;  4NCZ A;  4CGM A;  3GYA A;  4QUS A;  4JLY A;  3NE7 A;  1P0H A;  5AG7 A;  2ATR A;  4Y49 B;  5EC4 A;  1VHS A;  3N7Z A;  4UA3 A;  2I79 A;  2J8N A;  4UWI A;  4KSA A;  3BJ7 A;  3GY9 A;  4A33 A;  2P0W A;  2J8R A;  2FCK A;  5KTD A;  4UWJ A;  4BMH A;  1NE9 A;  4B11 A;  4JD6 A;  4KOX A;  2Q7B A;  1MJB A;  4CAV A;  2FT0 A;  3PGP A;  4ONU A;  5KTC A;  3ZZI A;  4KVX A;  5AGE A;  3S6H A;  2NMT A;  3JUW A;  4B14 A;  4KUA A;  1Y9K A;  2IL4 A;  4PV6 A;  3PP9 A;  1KUY A;  3BJ8 A;  2R98 A;  3G3S A;  1M1D A;  2F5I A;  4MI4 A;  5J8F A;  4AVC A;  2R1I A;  4FD5 A;  2FXF A;  4QC6 A;  4F0X A;  3CXQ A;  3JVN A;  1ZO0 A;  5I0C A;  2Z3M A;  3DR6 A;  4OAE A;  4F0Y A;  4KSF A;  4XNH B;  1OZP A;  4IUS A;  1UFH A;  5EBV A;  4A31 A;  4UCM A;  3VWD A;  4LX9 A;  4KVM E;  2JEV A;  2VZY A;  2CNT A;  1K4J A;  2P6G A;  2PSW A;  2CY2 A;  4KOW A;  4KVO E;  4CGP A;  1Z4E A;  5ISV A;  3EXN A;  2WSA A;  3BLN A;  4KOU A;  1BO4 A;  4E8O A;  5IV0 A;  4KZT A;  2VXK A;  3TCV A;  3EO4 A;  1QSN A;  3JTK A;  3FB3 A;  5A27 A;  2FE7 A;  2D4P A;  2Z3P A;  3IWE A;  4I49 A;  1MJ9 A;  1YVK A;  2VEZ A;  4X5K A;  3P2F A;  4UFX A;  4JXQ A;  2P6F A;  4R3L A;  2YGW A;  1S7K A;  1S7N A;  2B4B A;  3EFA A;  2YNC C;  4XNH C;  2B4D A;  4MHD A;  3WR7 A;  4UCN A;  3TE4 A;  5F46 A;  4AVB A;  2P6E A;  4CYO A;  4A2Z A;  1TIQ A;  1I12 A;  4R57 A;  5E96 A;  1Q2Y A;  4R9M A;  4CGO A;  2ZW4 A;  1YK3 A;  2AE6 A;  4HNY B;  3TO9 A;  4KOT A;  1RO5 A;  4XPK A;  4CS0 B;  4B5P A;  1YX0 A;  2Q44 A;  1FY7 A;  3IU2 A;  1B6B A;  4ORF A;  2WUU A;  4Q38 A;  2KCW A;  4UBR A;  4HNW B;  4K30 A;  3VWE A;  2OU2 A;  2QML A;  4B12 A;  2B58 A;  4NF1 A;  4PK3 A;  4GS4 A;  1S3Z A;  3G8W A;  1XEB A;  1M4G A;  1S7F A;  1CM0 A;  1M4I A;  3TFY A;  4RS2 A;  4H6Z A;  4HNX B;  3UY5 A;  1I21 A;  2Z3L A;  1XF8 A;  4BBH A;  5A28 A;  1RXT A;  3IU1 A;  2OZG A;  5DWM A;  2WPX A;  3I3G A;  5H84 A;  4C2Y A;  2Z0Z A;  5J8C A;  2G3A A;  2H5M A;  4NEX A;  4CYP A;  4II9 A;  3D8P A;  3IGR A;  1B87 A;  4OAD A;  3S6G A;  2GE3 A;  2B5G B;  5HH1 A;  3T9Y A;  2QIR A;  1MK4 A;  2CXA A;  3P2H A;  1YLE A;  2G3T A;  4LUA A;  2Z10 A;  2B5G A;  5AG6 A;  5C88 A;  2FSR A;  2K5T A;  2DXQ A;  2I00 A;  1BOB A;  2EUI A;  3FYN A;  5HMN A;  1YRE A;  4C7H A;  2YNC A;  3A9L A;  4M3S A;  5AG4 A;  4PSW A;  2A4N A;  5G21 A;  3R9G A;  5F47 A;  1XE4 A;  3R1K A;  2BSW A;  2ZW5 A;  4B5O A;  1XMT A;  3LOD A;  2Q4Y A;  2JDC A;  4KOS A;  2YNE A;  5IX3 A;  4CAW A;  2REF A;  4A30 A;  4CAF A;  3PZJ A;  4KLW A;  3FBU A;  2AJ6 A;  3R96 A;  4YRH A;  1S7L A;  3DSB A;  2JLM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...