2Z15A

Crystal structure of human tob1 protein
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
119
structure length
119
Chain Sequence
SGMQLEIQVALNFIISYLYNKLPRRRVNIFGEELERLLKKKYEGHWYPEKPYKGSGFRCIHIGEKVDPVIEQASKESGLDIDDVRGNLPQDLSVWIDPFEVSYQIGEKGPVKVLYVDDN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of human Tob1 protein
rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Protein Tob1
total genus 36
structure length 119
sequence length 119
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07742 BTG BTG family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1120 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2z15A00
3DJNB 2D5RB 3E9VA 3DJUB 2Z15A 5CI9A 5CI8A
chains in the Genus database with same CATH superfamily
2EPLX 4N06A 3M79A 3N2ZB 5L0IA 2F22A 1S7ZA 2HFIA 1YYXA 3B0PA 4YL1A 5DLJA 2G62A 5A6AA 3K1HA 3GEIA 4Z9HA 1SR2A 5L3VA 2LCHA 1C17M 2XS8A 1L7CA 1M6TA 5KYWA 2BC5A 2WVQA 5D91A 4FESA 4U5CE 4EWCA 1A7VA 1BR4A 5KYUB 2PNOA 1NFOA 3MYIA 4YN0B 2I15A 4IARA 1LE4A 3ABMC 3QTHA 4U5HA 2O9XA 3SXMA 1XZQA 2Q9AA 2Q4FA 1H9TA 4C3DA 2NSFA 4IAQA 2R7QA 1RJ9B 3C8ZA 1RKEA 1V74B 4G0HA 5EK0A 3B71A 2Y3DA 2IBFA 2IYLD 2EIKC 3HLZA 4BEJA 3ATPA 2XLOA 3A11A 4C7OB 2ETSA 3T9OA 3EGDA 4Q7CA 3FAPB 3ZTMA 1K40A 3GEEA 2ZXRA 4MVQA 3QMKA 3RVZA 3RW0A 4BJ5A 2XRHA 4W8KA 5E3CA 1JPNA 1KU2A 3W2VA 1Z63A 5KYXB 1M57C 2XL4A 1Y4CA 1EQ1A 2L9JA 4JTCB 5DS5A 2IM8A 2B0HA 3TK0A 4I44A 4JJGA 3C62A 1SZIA 4KBLA 4LDKA 1ZW3A 4DVZA 3SXKA 2P1AA 3LS0A 4DVYP 2OJED 4PACA 3EG9A 4QI2A 1R5ID 2EILC 1NU7D 2PP4A 2BL2A 3F46A 3FDQA 3LAYA 3IQ5A 1T9KA 4OD4A 4P9TA 4QDLA 4E0HA 3O39A 2W45A 1OCCC 2J46A 2XS1A 2DGJA 1T6UA 4RD9A 3UMHA 5JT4A 2XLMA 4XTKA 5CI8A 4AK9A 3IQCA 5B1AC 4IRUA 1C02A 4EUKB 4LLCA 2R7OA 2R02A 2MYSA 1Q0MA 4U5DE 3FOOA 1OCOC 4KC9A 1E83A 2DB4A 4XLNF 4G7ZF 3C7JA 3U0CA 4OINF 2X0CA 2HMQA 3RQGA 3SYNA 2GA0A 5DVWA 3K1IC 2EIMC 3EGDB 1A7DA 1XWJA 3Q6MA 1EKYA 2WZFA 2GFHA 1TFKB 2TMVP 4O6MA 3RFYA 2EINC 5L3QA 3NKDA 1TWAA 2WB7A 1MMDA 2HUJA 4K7BA 4X0RA 1Y6DA 3DD7A 4O6NA 4CJGA 1D0YA 3HNIA 4WABA 4XPYA 1KNYA 4DRIB 2UUIA 3NDBB 3UMKA 1ZHTA 2Y3GA 3X2QC 5AC5A 3AGTA 4EKWA 2KQ9A 4BJ6A 3LLKA 2YWAA 4JEBA 5DS4A 1HY5A 2M4EA 4JRZA 3DAFA 3EH2A 4JCHA 4YJWA 5TJ5E 3IEEA 1BDJB 5KYNA 2W4BA 3NMJA 1ZYRF 4NCQA 2LIGA 4EBKA 1LKXA 4WJ0A 5JUAA 1HE1A 2L7AA 4PR9A 5L0HA 4CBEA 3C18A 3UR3C 1M2VB 3TJ6A 3MBGA 3TQOA 1FNTc 1Z7Qc 2IOQA 3SP1A 5DS6A 3KYIA 2CW0F 2KW3C 3LNMB 4WGZA 4MVMA 5B1BC 5K0IA 1TFOB 3WHNA 2HS5A 2QE9A 5A6JA 4YT8A 1NSGB 1QZXA 2H7OA 1T6QA 1ST6A 2A1DD 2YEVA 5JRAA 1N1CA 3ZC4A 3S28A 1OW7A 3CAXA 3H2UA 4KI2A 3ZIBA 3S0XA 1WGWA 3EH1A 4AX2A 3T6BA 4A4AA 2OKUA 2Q9CA 4CX9A 3MLGA 5EHHA 5HV9A 2D5RB 2EPMX 3ABKC 1ZZPA 2PBEA 4JEAA 1YA7O 3NG1A 1V55C 3LS1A 4LDRA 3GANA 3L1MA 1O87A 3W2WA 1CGOA 2MWQA 4PK4A 3US6A 3VM6A 1BR1A 2ZPAA 3EPVA 5AC4A 2VCBA 4OIOF 3TOLA 2J9BA 2HV7A 4OIQF 1K04A 2A6HF 4MTFA 3ZWIA 3LJBA 3ASNC 4CSAC 1HE9A 5JSLA 5JS5A 2LFDA 1OR3A 3S27A 4RBNA 4CDYA 3ECSA 2LD6A 2A0BA 4YT5A 3K6BA 2WVOA 1ORSC 3AOUA 1Q0GA 4ER9A 1LS4A 3DWWA 4XEFA 3U8PA 2XM0A 4MS2A 1FFHA 3A9CA 1BBHA 2P61A 2FFHA 2WZGA 3LEOA 2PF4E 1H9GA 2AWCA 2FGYA 2LK4A 3Q7GA 3VAYA 2H8AA 4CS7A 1ZW2A 2R9RB 3GORA 5GPGB 4HFKB 1I5NA 1OKKA 3FHDA 5DQZA 1T01A 2HMZA 2BE5F 3PMRA 4XPWA 1HMOA 5B3IA 1B68A 1Q0DA 1JR8A 1WOLA 1MMGA 5E2QA 4E17A 3TJ5A 2NPUA 1OCZC 1EI7A 2A68F 2C04A 1OW6A 4MVUA 4JIOA 2ZXPA 5BQGA 5A6BD 1FMVA 3ASOC 3JTLO 4JKVA 1H7IA 1PV3A 2RSEB 4Q5SF 4J30B 1SMYF 1AEPA 2P7VA 2YQYA 4K0DA 2WVNA 1RJ9A 3T6GB 3TOMA 3ITFA 5COGA 4F4BA 1SF8A 4KNVA 1A7EA 3DM5A 2HV6A 4O7GA 2J7PD 1IW7F 3PDMP 2R03A 4AL0A 2CGEA 4EHPA 3DAGA 3PCVA 4YT2A 1WWPA 3S29A 5IY5C 2A69F 1LS1A 2JPUA 4CDAA 2YL3A 4Z9JA 5KYWB 4BJ5C 2QLAA 1O5HA 2J8WA 4MQ9F 5KYYB 3K66A 3QVYA 1MQVA 5BQIA 3JRMO 1GS9A 3S84A 2P6VA 4G78A 3SNHA 3U8VA 1G8XA 2MHRA 2Q3TA 1TR2A 4CSAA 1LPEA 3V5XA 3JT1A 4OD5A 1KTMA 1ORYA 1VLTA 5JP7A 3NMKA 4YL0A 1NFNA 1OCRC 2Y69C 4AE4B 4CIHA 2R25A 5KYYA 4NTAA 3EFOB 2HJMA 1LI7A 2NUTA 3GODA 3POVA 2XSEA 3OWTA 1YZCA 3K1IA 3LEVA 4CS8C 3H65A 1F1MA 1VMAA 3OEOA 1J8YF 1VLSA 2C03A 3DJNB 3EGXA 1NU9C 2CCYA 3CSKA 4DRHB 3CEXA 1G5ZA 2CYDA 3IHUA 3K7DA 2KGOA 1WTYA 2PFDA 1D1BA 2XLDA 4J7TA 3B0UX 3RVYA 3AJMA 4UDVA 1LE2A 3EQLF 4MW8A 3KH2A 2XLWA 4D4XA 1MNEA 3Q7LA 1CPRA 1BZ4A 2OEXA 2JX0A 3X1OA 5D92A 3VRCA 3AG2C 1OW8A 4BJ6C 1PD0A 1D0XA 1PD1A 4JCZA 4CS9C 4JW1A 3GEHA 4LACB 3MX3A 1D1CA 1RXQA 4MVZA 2P0NA 2EPNA 4DRJB 3C63A 3JSZA 1QKRA 4OIRF 4N6CA 3HNKA 4EBBA 1TWCA 1HMDA 4YK5A 2VH3A 4JTDB 3EHMA 5AGFA 2V3CC 1OR2A 4JURI 3KYJA 4K1OA 2VASA 3LESA 4BG0A 4DOZA 2J7PA 4BJ1A 1EA8A 1I4ZA 2J9VA 3M1CB 2ZXOA 1VTMP 2HJ3A 3FOPA 3S9OA 1QSPA 2EPOA 4I3MA 4RDAA 1RCPA 4JJFA 3U3BA 4EBJA 5L0JA 1JRAA 3NYLA 1NLXA 1TKNA 5KYUA 2M64A 2GDCA 3RF3A 3RQEA 3UMIA 1E2XA 4XLPF 1Z5ZA 1ZHZA 2QNLA 3GM3A 2IXNA 3DZAA 1YARO 3EFOA 1RKCA 2JD3A 2NSGA 4U5BE 1E86A 2X51A 2W9YA 1S05A 4A2NB 1TWHA 1DOWA 2CDQA 2PX3A 3AG4C 2UUHA 4H4KC 3U2MA 4LLEA 4DXWA 3AQCA 2Y3BA 5A6BA 2R7XA 2H7BA 3GM1A 3HNLA 3JYYA 5T3WA 1FMWA 3B9QA 3BRJA 3Q6NA 2J0XA 3DE9A 1A41A 2ICWG 3AG1C 4XQ1A 3R7CA 1JOGA 4YL3A 4E7ZA 1BR2A 2Y39A 4Z9IA 4HFFB 3FXHA 4C7OA 2L81A 4ZLCA 3I5PA 4IGGA 3UNGC 1OXBA 1U89A 4MNDA 3I4UA 3GWLA 4AL1A 4MVRA 5T1DB 3DKAA 2XM4A 3PHF2 1G4US 1LI5A 1AUEA 1W2WA 2OG2A 3EGXB 3SZRA 4E0IA 3HNJA 1M2OA 2IXPA 5CIVA 1FR0A 4L6RA 1VB5A 3LLIA 3AQBA 3HJCA 2KYHA 1MMNA 2VB6A 3W4YA 3MFNA 2QY9A 3GM2A 1QPUA 4P6IC 1MMAA 3G50A 2DYSC 4W8PA 5T3TA 3U9JA 1FTSA 1Z23A 1NZEA 4ULWA 4AE4A 3IQ6A 1DOVA 2CNWA 2LFFA 3EJNA 1M2VA 2CNWD 2HSQA 2IXMA 1VOMA 1T6IA 3RH3A 2Q00A 3UGPA 2R7TA 1D1AA 3W8HA 3U5SA 4M63A 2PX0A 3FVYA 1IZMA 1Z3IX 1U6HA 1ZVZA 2YLDA 1ZHXA 3O10A 2YRFA 1ZU5A 4XEVA 2GWWA 2VCAA 2GAQA 2HKVA 1HW1A 2XLVA 4U5EE 5A69A 2XXAA 1APCA 1M56C 1YA9A 4FX5A 2WL8A 3DXJF 3ZVRA 2YL7A 3EZIA 3U2LA 4G7OF 1RKEB 3JCUQ 1LVKA 2EIJC 2DI3A 1JAFA 1ORJA 3GWNA 4KNWA 4GYTA 1CPQA 2YL0A 1O3UA 3AG3C 3SXYA 3G4ZA 4J7YA 2Q7RA 3SXZA 4ONSA 1AVOB 4PJNA 1NBBA 2OOCA 1V4AA 4YT4A 2AU5A 1JMWA 1YVIA 2KJGA 2OEVA 3JZ0A 1V54C 2XXAB 3CQZA 2ZXWC 1WASA 4NTFA 4CIPA 2OQMA 4OIPF 2XL6A 3RYLA 4GQHA 1LM3B 3VYWA 3R2PA 2R7VA 2KSFA 2B0JA 3FMSA 3H2VA 3U3FA 3LUTB 2J45A 4QI0A 3VF0A 1LIHA 2AVKA 3DI5A 1QLEC 3K33A 4R32A 4U9EA 1QQ3A 5F28E 3E70C 3QVZA 3ZSUA 2J9WA 3JSEO 3NYJA 4GEHA 1YYJA 1T5OA 3HTKC 2R05A 2Y3HA 1G4WR 3M4CA 5B3SC 2R7RA 3J06A 2YZSA 3OA1A 3E9VA 3DJUB 2KC3A 3QZCA 4JTAB 3TD7A 3SEOA 1UG7A 4ANJA 4CDVA 1E84A 5E3AA 3TULA 4U9DA 4HEAJ 4PFPA 4EIYA 2AP3A 1Q0KA 3QW1A 3LNRA 3ABLC 3EG9B 4N6HA 2YHSA 1YZAA 1OXKA 2YLGA 3DM9B 3IQTA 3RQFA 4CS8A 1XZPA 1Q0FA 1SYQA 2HZ8A 1OQCA 2WZLA 4IJJA 1FAPB 2OJQA 1Z6AA 2NUTB 3N0TA 4I1OB 1MNDA 3M4BA 5CI9A 4NQFA 3WAQA 4H54A 1YLMA 2H7VC 3KKBA 2D4UA 2KK1A 5HSWA 4LDQA 2AWYA 1J8MF 4XPXA 5A6KA 3CZ6A 2YLIA 4PJMA 5E33A 3MYFA 1CGME 3QW0A 5COMA 1PCXA 5L0DA 3UGOA 2KNHA 2OU6A 2EPKX 4P9FA 3S90A 4MTGA 5KYXA 2R7SA 1H6GA 2G3VA 5L0GA 1FFTC 2I8BA 3RKOF 2YVKA 4FWVA 1VYKA 2A0UA 2V26A 4MVOA 5COFA 5F5HA 1ZU4A 4C3EA 5FCLA 1A0BA 2J9UA 1I4YA 2VCCA 2RD9A 3O55A 5L0FA 2IXOA 4U5GA 2XLEA 2XL8A 3W8IA 4IB4A 5F5FA 3IPMO 4JC7A 4LERA 2NG1A 4E18A 2VC9A 4ULVA 3C8GD 3NYMA 5DQTA 2LSEA 4NTBA 3V5YA 2R7UA 3ZDLA 4PFOA 2DYRC 3O6XA 4NY3A 1HW2A 2YL1A 4CS9A 1WATA 3L8JA 4O6YA 4DJ9A 2J0WA 1GQAA 1K05A 3DMDA 4IAOA 256BA 2L6GA 2OCCC 2L6HA 3L34A 4O79A 3NMIA 1RMVA 3JRTA 4MTOA 5EGYA 3KPHA 2YKZA 1YJGA 1CGNA 2Q9BA 3NRHA 1TQGA 3C8GB 1YAUO 1QVXA 4E7SA 3WODF 1VK5A 4BJTA 1R4TA 4JZAA 5L0CA 2R7WA 4B6IA 4BEMJ 4BPMA 4MVSA 3EZHA 1U0BB 2ASRA 3HKKA 2W4MA 3RIPA 1VYIA 3I5QA 3U9MA 4CJOA 4ZLDA 2LQGA 3NKEA 4IWBA 5FZTA 2E87A 2HSBA 3F47A 4DBQA 2NUPA 2Z15A 2QUPA 4U5FE 1ZHWA 1L3PA 4PJJA 4XWJA 4MW3A 4NC3A 1WN0A 3KMIA 1D0ZA 3ZQVA 1GM5A 2A6EF 3KL4A 1NG1A 5JLIA 4C3BA 4N4WA 3B0VC 2NUPB 4HE8D 5BQHA 2FAPB 4I1MA 3T4RA 2XLHA 1TWGA 3V7OA 4D4NA 4XEKA 1YDIA 3M15A 2L6FA 3AGUA 1ZHYA 4PJLA 4WGYA 3V5ZA 1UFBA 3WG7C 4YWQA 5JVEA 1JPJA 3T6JA 2LP4A 3ZTZA 3BEHA 3B29A 3G4XA 1OKKD 2ZD9A 4Q4ZF 4G7HF 2QTVA 4JE9A 3C8GA 5BUOA 3ZQYA 4JVSA 3FAJA 1E85A 3JYHA 4DBRA 1GGQA 3EHNA 3ZG1A 3L8IA 3DE8A 3N24A 3L0IA 1C03A 2G3KA 4J32B 4FAPB
chains in the Genus database with same CATH topology
4N06A 3N2ZB 1S7ZA 3B0PA 5DLJA 2G62A 5L3VA 3K1HA 2V3CC 5KYWA 2WVQA 5D91A 4FESA 4U5CE 4EWCA 1BR4A 5KYUB 4YN0B 3ABMC 4U5HA 2O9XA 2Q9AA 4C3DA 2R7QA 1RJ9B 4G0HA 2Y3DA 2IYLD 2EIKC 3HLZA 4BEJA 3EGDA 4Q7CA 2ZXRA 3QMKA 4BJ5A 2XRHA 4W8KA 5E3CA 1JPNA 1KU2A 3W2VA 1Z63A 1M57C 2XL4A 2L9JA 5DS5A 4I44A 4JJGA 4KBLA 1SZIA 4DVZA 4DVYP 3LS0A 3EG9A 4QI2A 2EILC 1NU7D 2PP4A 3F46A 3FDQA 3LAYA 4QDLA 4OD4A 3O39A 2W45A 1OCCC 2J46A 2DGJA 4RD9A 3UMHA 4XTKA 5CI8A 4AK9A 5B1AC 4IRUA 4LLCA 2R7OA 2MYSA 4U5DE 1OCOC 4KC9A 4XLNF 4G7ZF 4OINF 3SYNA 5DVWA 3K1IC 2EIMC 3EGDB 3Q6MA 2WZFA 2GFHA 4O6MA 3RFYA 2EINC 5L3QA 3NKDA 1TWAA 2WB7A 1MMDA 4K7BA 4X0RA 3DD7A 4O6NA 1D0YA 3NDBB 3UMKA 1ZHTA 2Y3GA 3X2QC 2KQ9A 4BJ6A 3LLKA 5DS4A 2M4EA 4YJWA 3DAFA 3EH2A 4JCHA 5KYNA 3IEEA 2W4BA 1ZYRF 1LKXA 4WJ0A 4CBEA 3UR3C 1M2VB 2IOQA 3SP1A 5DS6A 2CW0F 2KW3C 5B1BC 4YT8A 1QZXA 2H7OA 1ST6A 2A1DD 2YEVA 1N1CA 3ZC4A 3S28A 4KI2A 3ZIBA 3S0XA 1WGWA 3EH1A 4AX2A 3T6BA 5EHHA 2Q9CA 3MLGA 2D5RB 3ABKC 3NG1A 1V55C 3LS1A 3GANA 1O87A 3W2WA 4PK4A 2MWQA 1BR1A 2ZPAA 3EPVA 4OIOF 2HV7A 4OIQF 2A6HF 3LJBA 3ASNC 4CSAC 3S27A 4RBNA 3ECSA 4YT5A 3K6BA 2WVOA 1FFHA 2FFHA 2WZGA 5KYXB 2PF4E 2FGYA 3Q7GA 3VAYA 4CS7A 4HFKB 1OKKA 3FHDA 5DQZA 3PMRA 2BE5F 5E2QA 1MMGA 1OCZC 2A68F 2C04A 2ZXPA 1FMVA 3ASOC 4Q5SF 4J30B 1SMYF 2P7VA 4K0DA 2WVNA 1RJ9A 3ITFA 4F4BA 1SF8A 4KNVA 3DM5A 4O7GA 2HV6A 2J7PD 1IW7F 2CGEA 4YT2A 3DAGA 3S29A 5IY5C 2A69F 1LS1A 5KYWB 4BJ5C 1O5HA 4MQ9F 5KYYB 3K66A 2P6VA 3SNHA 1G8XA 4CSAA 2Q3TA 1TR2A 3JT1A 4OD5A 1OCRC 2Y69C 4AE4B 4CIHA 5KYYA 2NUTA 3EFOB 3GODA 3POVA 2XSEA 3OWTA 3LEVA 4CS8C 3H65A 1VMAA 3OEOA 1J8YF 2C03A 3DJNB 3EGXA 1NU9C 3CSKA 3K7DA 2PFDA 2KGOA 3B0UX 1D1BA 3EQLF 3KH2A 1MNEA 3Q7LA 3X1OA 5D92A 3AG2C 4BJ6C 1PD0A 1D0XA 1PD1A 4CS9C 4JW1A 4LACB 3MX3A 1D1CA 4EBBA 3JSZA 4OIRF 1TWCA 2VH3A 3EHMA 4JURI 4BG0A 2VASA 3LESA 4DOZA 2J7PA 4BJ1A 2J9VA 3M1CB 2ZXOA 4RDAA 4I3MA 4JJFA 3NYLA 5KYUA 1TKNA 3UMIA 4XLPF 1Z5ZA 1ZHZA 2IXNA 3DZAA 3EFOA 2JD3A 4U5BE 2X51A 2W9YA 4A2NB 1TWHA 2CDQA 4H4KC 2PX3A 3AG4C 2R7SA 4LLEA 3AQCA 2Y3BA 2R7XA 2H7BA 5T3WA 1FMWA 3B9QA 3Q6NA 2J0XA 3AG1C 4E7ZA 1BR2A 2Y39A 4C7OA 4HFFB 2L81A 4ZLCA 3I5PA 3UNGC 4MNDA 3I4UA 5T1DB 3PHF2 2OG2A 1W2WA 3EGXB 3SZRA 1M2OA 2IXPA 3LLIA 3HJCA 3AQBA 1MMNA 2VB6A 2QY9A 4P6IC 1MMAA 5T3TA 2DYSC 4AE4A 1FTSA 1Z23A 1NZEA 4ULWA 2CNWA 3EJNA 1M2VA 2CNWD 2IXMA 1VOMA 3RH3A 2R7TA 3UGPA 1D1AA 3W8HA 4M63A 2PX0A 3FVYA 1Z3IX 1IZMA 1ZHXA 1ZU5A 2XXAA 4U5EE 1M56C 4FX5A 2WL8A 3DXJF 3ZVRA 3EZIA 4G7OF 3JCUQ 1LVKA 2EIJC 4KNWA 4GYTA 3AG3C 4PJNA 4YT4A 2KJGA 1V54C 2XXAB 3CQZA 2ZXWC 4OIPF 3RYLA 3VYWA 2R7VA 2B0JA 4QI0A 2J45A 3K33A 1QLEC 3E70C 3ZSUA 2J9WA 3NYJA 4GEHA 3HTKC 2Y3HA 5B3SC 2R7RA 2YZSA 3OA1A 3QZCA 3DJUB 3E9VA 3TD7A 4ANJA 3SEOA 5E3AA 4HEAJ 4PFPA 3LNRA 3ABLC 3EG9B 2YHSA 4CS8A 3DM9B 2WZLA 4IJJA 1Z6AA 2NUTB 3N0TA 4I1OB 1MNDA 5CI9A 2H7VC 3KKBA 5HSWA 1J8MF 3CZ6A 4PJMA 5E33A 1PCXA 3UGOA 2KNHA 5KYXA 2G3VA 1FFTC 2I8BA 3RKOF 4FWVA 4C3EA 1VYKA 2V26A 5F5HA 5FCLA 1ZU4A 2J9UA 2IXOA 4U5GA 3W8IA 5F5FA 4LERA 2NG1A 3NYMA 5DQTA 2LSEA 2R7UA 4PFOA 2DYRC 3O6XA 4NY3A 4CS9A 4O6YA 2J0WA 4IAOA 3DMDA 3L34A 2OCCC 4O79A 3JRTA 5EGYA 3NRHA 2Q9BA 4E7SA 3WODF 1VK5A 4BJTA 4JZAA 2R7WA 4B6IA 3EZHA 2W4MA 3RIPA 1VYIA 3I5QA 4ZLDA 3NKEA 4IWBA 2E87A 4DBQA 3F47A 2NUPA 2Z15A 4U5FE 1ZHWA 4PJJA 4XWJA 3KMIA 1D0ZA 2A6EF 3KL4A 1NG1A 4C3BA 3B0VC 2NUPB 4HE8D 4I1MA 3V7OA 3T4RA 1TWGA 4C7OB 4PJLA 1ZHYA 3WG7C 4YWQA 1JPJA 3T6JA 4Q4ZF 1OKKD 4G7HF 2QTVA 5BUOA 4JVSA 3FAJA 3JYHA 4DBRA 3EHNA 3ZG1A 3N24A 3L0IA 2G3KA 4J32B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DJN B;  2D5R B;  3E9V A;  3DJU B;  2Z15 A;  5CI9 A;  5CI8 A; 
#chains in the Genus database with same CATH topology
 2EPL X;  4N06 A;  3M79 A;  3N2Z B;  5L0I A;  2F22 A;  1S7Z A;  2HFI A;  1YYX A;  3B0P A;  4YL1 A;  5DLJ A;  2G62 A;  5A6A A;  3K1H A;  3GEI A;  4Z9H A;  1SR2 A;  5L3V A;  2LCH A;  1C17 M;  2XS8 A;  1L7C A;  1M6T A;  5KYW A;  2BC5 A;  2WVQ A;  5D91 A;  4FES A;  4U5C E;  4EWC A;  1A7V A;  1BR4 A;  5KYU B;  2PNO A;  1NFO A;  3MYI A;  4YN0 B;  2I15 A;  4IAR A;  1LE4 A;  3ABM C;  3QTH A;  4U5H A;  2O9X A;  3SXM A;  1XZQ A;  2Q9A A;  2Q4F A;  1H9T A;  4C3D A;  2NSF A;  4IAQ A;  2R7Q A;  1RJ9 B;  3C8Z A;  1RKE A;  1V74 B;  4G0H A;  5EK0 A;  3B71 A;  2Y3D A;  2IBF A;  2IYL D;  2EIK C;  3HLZ A;  4BEJ A;  3ATP A;  2XLO A;  3A11 A;  4C7O B;  2ETS A;  3T9O A;  3EGD A;  4Q7C A;  3FAP B;  3ZTM A;  1K40 A;  3GEE A;  2ZXR A;  4MVQ A;  3QMK A;  3RVZ A;  3RW0 A;  4BJ5 A;  2XRH A;  4W8K A;  5E3C A;  1JPN A;  1KU2 A;  3W2V A;  1Z63 A;  5KYX B;  1M57 C;  2XL4 A;  1Y4C A;  1EQ1 A;  2L9J A;  4JTC B;  5DS5 A;  2IM8 A;  2B0H A;  3TK0 A;  4I44 A;  4JJG A;  3C62 A;  1SZI A;  4KBL A;  4LDK A;  1ZW3 A;  4DVZ A;  3SXK A;  2P1A A;  3LS0 A;  4DVY P;  2OJE D;  4PAC A;  3EG9 A;  4QI2 A;  1R5I D;  2EIL C;  1NU7 D;  2PP4 A;  2BL2 A;  3F46 A;  3FDQ A;  3LAY A;  3IQ5 A;  1T9K A;  4OD4 A;  4P9T A;  4QDL A;  4E0H A;  3O39 A;  2W45 A;  1OCC C;  2J46 A;  2XS1 A;  2DGJ A;  1T6U A;  4RD9 A;  3UMH A;  5JT4 A;  2XLM A;  4XTK A;  5CI8 A;  4AK9 A;  3IQC A;  5B1A C;  4IRU A;  1C02 A;  4EUK B;  4LLC A;  2R7O A;  2R02 A;  2MYS A;  1Q0M A;  4U5D E;  3FOO A;  1OCO C;  4KC9 A;  1E83 A;  2DB4 A;  4XLN F;  4G7Z F;  3C7J A;  3U0C A;  4OIN F;  2X0C A;  2HMQ A;  3RQG A;  3SYN A;  2GA0 A;  5DVW A;  3K1I C;  2EIM C;  3EGD B;  1A7D A;  1XWJ A;  3Q6M A;  1EKY A;  2WZF A;  2GFH A;  1TFK B;  2TMV P;  4O6M A;  3RFY A;  2EIN C;  5L3Q A;  3NKD A;  1TWA A;  2WB7 A;  1MMD A;  2HUJ A;  4K7B A;  4X0R A;  1Y6D A;  3DD7 A;  4O6N A;  4CJG A;  1D0Y A;  3HNI A;  4WAB A;  4XPY A;  1KNY A;  4DRI B;  2UUI A;  3NDB B;  3UMK A;  1ZHT A;  2Y3G A;  3X2Q C;  5AC5 A;  3AGT A;  4EKW A;  2KQ9 A;  4BJ6 A;  3LLK A;  2YWA A;  4JEB A;  5DS4 A;  1HY5 A;  2M4E A;  4JRZ A;  3DAF A;  3EH2 A;  4JCH A;  4YJW A;  5TJ5 E;  3IEE A;  1BDJ B;  5KYN A;  2W4B A;  3NMJ A;  1ZYR F;  4NCQ A;  2LIG A;  4EBK A;  1LKX A;  4WJ0 A;  5JUA A;  1HE1 A;  2L7A A;  4PR9 A;  5L0H A;  4CBE A;  3C18 A;  3UR3 C;  1M2V B;  3TJ6 A;  3MBG A;  3TQO A;  1FNT c;  1Z7Q c;  2IOQ A;  3SP1 A;  5DS6 A;  3KYI A;  2CW0 F;  2KW3 C;  3LNM B;  4WGZ A;  4MVM A;  5B1B C;  5K0I A;  1TFO B;  3WHN A;  2HS5 A;  2QE9 A;  5A6J A;  4YT8 A;  1NSG B;  1QZX A;  2H7O A;  1T6Q A;  1ST6 A;  2A1D D;  2YEV A;  5JRA A;  1N1C A;  3ZC4 A;  3S28 A;  1OW7 A;  3CAX A;  3H2U A;  4KI2 A;  3ZIB A;  3S0X A;  1WGW A;  3EH1 A;  4AX2 A;  3T6B A;  4A4A A;  2OKU A;  2Q9C A;  4CX9 A;  3MLG A;  5EHH A;  5HV9 A;  2D5R B;  2EPM X;  3ABK C;  1ZZP A;  2PBE A;  4JEA A;  1YA7 O;  3NG1 A;  1V55 C;  3LS1 A;  4LDR A;  3GAN A;  3L1M A;  1O87 A;  3W2W A;  1CGO A;  2MWQ A;  4PK4 A;  3US6 A;  3VM6 A;  1BR1 A;  2ZPA A;  3EPV A;  5AC4 A;  2VCB A;  4OIO F;  3TOL A;  2J9B A;  2HV7 A;  4OIQ F;  1K04 A;  2A6H F;  4MTF A;  3ZWI A;  3LJB A;  3ASN C;  4CSA C;  1HE9 A;  5JSL A;  5JS5 A;  2LFD A;  1OR3 A;  3S27 A;  4RBN A;  4CDY A;  3ECS A;  2LD6 A;  2A0B A;  4YT5 A;  3K6B A;  2WVO A;  1ORS C;  3AOU A;  1Q0G A;  4ER9 A;  1LS4 A;  3DWW A;  4XEF A;  3U8P A;  2XM0 A;  4MS2 A;  1FFH A;  3A9C A;  1BBH A;  2P61 A;  2FFH A;  2WZG A;  3LEO A;  2PF4 E;  1H9G A;  2AWC A;  2FGY A;  2LK4 A;  3Q7G A;  3VAY A;  2H8A A;  4CS7 A;  1ZW2 A;  2R9R B;  3GOR A;  5GPG B;  4HFK B;  1I5N A;  1OKK A;  3FHD A;  5DQZ A;  1T01 A;  2HMZ A;  2BE5 F;  3PMR A;  4XPW A;  1HMO A;  5B3I A;  1B68 A;  1Q0D A;  1JR8 A;  1WOL A;  1MMG A;  5E2Q A;  4E17 A;  3TJ5 A;  2NPU A;  1OCZ C;  1EI7 A;  2A68 F;  2C04 A;  1OW6 A;  4MVU A;  4JIO A;  2ZXP A;  5BQG A;  5A6B D;  1FMV A;  3ASO C;  3JTL O;  4JKV A;  1H7I A;  1PV3 A;  2RSE B;  4Q5S F;  4J30 B;  1SMY F;  1AEP A;  2P7V A;  2YQY A;  4K0D A;  2WVN A;  1RJ9 A;  3T6G B;  3TOM A;  3ITF A;  5COG A;  4F4B A;  1SF8 A;  4KNV A;  1A7E A;  3DM5 A;  2HV6 A;  4O7G A;  2J7P D;  1IW7 F;  3PDM P;  2R03 A;  4AL0 A;  2CGE A;  4EHP A;  3DAG A;  3PCV A;  4YT2 A;  1WWP A;  3S29 A;  5IY5 C;  2A69 F;  1LS1 A;  2JPU A;  4CDA A;  2YL3 A;  4Z9J A;  5KYW B;  4BJ5 C;  2QLA A;  1O5H A;  2J8W A;  4MQ9 F;  5KYY B;  3K66 A;  3QVY A;  1MQV A;  5BQI A;  3JRM O;  1GS9 A;  3S84 A;  2P6V A;  4G78 A;  3SNH A;  3U8V A;  1G8X A;  2MHR A;  2Q3T A;  1TR2 A;  4CSA A;  1LPE A;  3V5X A;  3JT1 A;  4OD5 A;  1KTM A;  1ORY A;  1VLT A;  5JP7 A;  3NMK A;  4YL0 A;  1NFN A;  1OCR C;  2Y69 C;  4AE4 B;  4CIH A;  2R25 A;  5KYY A;  4NTA A;  3EFO B;  2HJM A;  1LI7 A;  2NUT A;  3GOD A;  3POV A;  2XSE A;  3OWT A;  1YZC A;  3K1I A;  3LEV A;  4CS8 C;  3H65 A;  1F1M A;  1VMA A;  3OEO A;  1J8Y F;  1VLS A;  2C03 A;  3DJN B;  3EGX A;  1NU9 C;  2CCY A;  3CSK A;  4DRH B;  3CEX A;  1G5Z A;  2CYD A;  3IHU A;  3K7D A;  2KGO A;  1WTY A;  2PFD A;  1D1B A;  2XLD A;  4J7T A;  3B0U X;  3RVY A;  3AJM A;  4UDV A;  1LE2 A;  3EQL F;  4MW8 A;  3KH2 A;  2XLW A;  4D4X A;  1MNE A;  3Q7L A;  1CPR A;  1BZ4 A;  2OEX A;  2JX0 A;  3X1O A;  5D92 A;  3VRC A;  3AG2 C;  1OW8 A;  4BJ6 C;  1PD0 A;  1D0X A;  1PD1 A;  4JCZ A;  4CS9 C;  4JW1 A;  3GEH A;  4LAC B;  3MX3 A;  1D1C A;  1RXQ A;  4MVZ A;  2P0N A;  2EPN A;  4DRJ B;  3C63 A;  3JSZ A;  1QKR A;  4OIR F;  4N6C A;  3HNK A;  4EBB A;  1TWC A;  1HMD A;  4YK5 A;  2VH3 A;  4JTD B;  3EHM A;  5AGF A;  2V3C C;  1OR2 A;  4JUR I;  3KYJ A;  4K1O A;  2VAS A;  3LES A;  4BG0 A;  4DOZ A;  2J7P A;  4BJ1 A;  1EA8 A;  1I4Z A;  2J9V A;  3M1C B;  2ZXO A;  1VTM P;  2HJ3 A;  3FOP A;  3S9O A;  1QSP A;  2EPO A;  4I3M A;  4RDA A;  1RCP A;  4JJF A;  3U3B A;  4EBJ A;  5L0J A;  1JRA A;  3NYL A;  1NLX A;  1TKN A;  5KYU A;  2M64 A;  2GDC A;  3RF3 A;  3RQE A;  3UMI A;  1E2X A;  4XLP F;  1Z5Z A;  1ZHZ A;  2QNL A;  3GM3 A;  2IXN A;  3DZA A;  1YAR O;  3EFO A;  1RKC A;  2JD3 A;  2NSG A;  4U5B E;  1E86 A;  2X51 A;  2W9Y A;  1S05 A;  4A2N B;  1TWH A;  1DOW A;  2CDQ A;  2PX3 A;  3AG4 C;  2UUH A;  4H4K C;  3U2M A;  4LLE A;  4DXW A;  3AQC A;  2Y3B A;  5A6B A;  2R7X A;  2H7B A;  3GM1 A;  3HNL A;  3JYY A;  5T3W A;  1FMW A;  3B9Q A;  3BRJ A;  3Q6N A;  2J0X A;  3DE9 A;  1A41 A;  2ICW G;  3AG1 C;  4XQ1 A;  3R7C A;  1JOG A;  4YL3 A;  4E7Z A;  1BR2 A;  2Y39 A;  4Z9I A;  4HFF B;  3FXH A;  4C7O A;  2L81 A;  4ZLC A;  3I5P A;  4IGG A;  3UNG C;  1OXB A;  1U89 A;  4MND A;  3I4U A;  3GWL A;  4AL1 A;  4MVR A;  5T1D B;  3DKA A;  2XM4 A;  3PHF 2;  1G4U S;  1LI5 A;  1AUE A;  1W2W A;  2OG2 A;  3EGX B;  3SZR A;  4E0I A;  3HNJ A;  1M2O A;  2IXP A;  5CIV A;  1FR0 A;  4L6R A;  1VB5 A;  3LLI A;  3AQB A;  3HJC A;  2KYH A;  1MMN A;  2VB6 A;  3W4Y A;  3MFN A;  2QY9 A;  3GM2 A;  1QPU A;  4P6I C;  1MMA A;  3G50 A;  2DYS C;  4W8P A;  5T3T A;  3U9J A;  1FTS A;  1Z23 A;  1NZE A;  4ULW A;  4AE4 A;  3IQ6 A;  1DOV A;  2CNW A;  2LFF A;  3EJN A;  1M2V A;  2CNW D;  2HSQ A;  2IXM A;  1VOM A;  1T6I A;  3RH3 A;  2Q00 A;  3UGP A;  2R7T A;  1D1A A;  3W8H A;  3U5S A;  4M63 A;  2PX0 A;  3FVY A;  1IZM A;  1Z3I X;  1U6H A;  1ZVZ A;  2YLD A;  1ZHX A;  3O10 A;  2YRF A;  1ZU5 A;  4XEV A;  2GWW A;  2VCA A;  2GAQ A;  2HKV A;  1HW1 A;  2XLV A;  4U5E E;  5A69 A;  2XXA A;  1APC A;  1M56 C;  1YA9 A;  4FX5 A;  2WL8 A;  3DXJ F;  3ZVR A;  2YL7 A;  3EZI A;  3U2L A;  4G7O F;  1RKE B;  3JCU Q;  1LVK A;  2EIJ C;  2DI3 A;  1JAF A;  1ORJ A;  3GWN A;  4KNW A;  4GYT A;  1CPQ A;  2YL0 A;  1O3U A;  3AG3 C;  3SXY A;  3G4Z A;  4J7Y A;  2Q7R A;  3SXZ A;  4ONS A;  1AVO B;  4PJN A;  1NBB A;  2OOC A;  1V4A A;  4YT4 A;  2AU5 A;  1JMW A;  1YVI A;  2KJG A;  2OEV A;  3JZ0 A;  1V54 C;  2XXA B;  3CQZ A;  2ZXW C;  1WAS A;  4NTF A;  4CIP A;  2OQM A;  4OIP F;  2XL6 A;  3RYL A;  4GQH A;  1LM3 B;  3VYW A;  3R2P A;  2R7V A;  2KSF A;  2B0J A;  3FMS A;  3H2V A;  3U3F A;  3LUT B;  2J45 A;  4QI0 A;  3VF0 A;  1LIH A;  2AVK A;  3DI5 A;  1QLE C;  3K33 A;  4R32 A;  4U9E A;  1QQ3 A;  5F28 E;  3E70 C;  3QVZ A;  3ZSU A;  2J9W A;  3JSE O;  3NYJ A;  4GEH A;  1YYJ A;  1T5O A;  3HTK C;  2R05 A;  2Y3H A;  1G4W R;  3M4C A;  5B3S C;  2R7R A;  3J06 A;  2YZS A;  3OA1 A;  3E9V A;  3DJU B;  2KC3 A;  3QZC A;  4JTA B;  3TD7 A;  3SEO A;  1UG7 A;  4ANJ A;  4CDV A;  1E84 A;  5E3A A;  3TUL A;  4U9D A;  4HEA J;  4PFP A;  4EIY A;  2AP3 A;  1Q0K A;  3QW1 A;  3LNR A;  3ABL C;  3EG9 B;  4N6H A;  2YHS A;  1YZA A;  1OXK A;  2YLG A;  3DM9 B;  3IQT A;  3RQF A;  4CS8 A;  1XZP A;  1Q0F A;  1SYQ A;  2HZ8 A;  1OQC A;  2WZL A;  4IJJ A;  1FAP B;  2OJQ A;  1Z6A A;  2NUT B;  3N0T A;  4I1O B;  1MND A;  3M4B A;  5CI9 A;  4NQF A;  3WAQ A;  4H54 A;  1YLM A;  2H7V C;  3KKB A;  2D4U A;  2KK1 A;  5HSW A;  4LDQ A;  2AWY A;  1J8M F;  4XPX A;  5A6K A;  3CZ6 A;  2YLI A;  4PJM A;  5E33 A;  3MYF A;  1CGM E;  3QW0 A;  5COM A;  1PCX A;  5L0D A;  3UGO A;  2KNH A;  2OU6 A;  2EPK X;  4P9F A;  3S90 A;  4MTG A;  5KYX A;  2R7S A;  1H6G A;  2G3V A;  5L0G A;  1FFT C;  2I8B A;  3RKO F;  2YVK A;  4FWV A;  1VYK A;  2A0U A;  2V26 A;  4MVO A;  5COF A;  5F5H A;  1ZU4 A;  4C3E A;  5FCL A;  1A0B A;  2J9U A;  1I4Y A;  2VCC A;  2RD9 A;  3O55 A;  5L0F A;  2IXO A;  4U5G A;  2XLE A;  2XL8 A;  3W8I A;  4IB4 A;  5F5F A;  3IPM O;  4JC7 A;  4LER A;  2NG1 A;  4E18 A;  2VC9 A;  4ULV A;  3C8G D;  3NYM A;  5DQT A;  2LSE A;  4NTB A;  3V5Y A;  2R7U A;  3ZDL A;  4PFO A;  2DYR C;  3O6X A;  4NY3 A;  1HW2 A;  2YL1 A;  4CS9 A;  1WAT A;  3L8J A;  4O6Y A;  4DJ9 A;  2J0W A;  1GQA A;  1K05 A;  3DMD A;  4IAO A;  256B A;  2L6G A;  2OCC C;  2L6H A;  3L34 A;  4O79 A;  3NMI A;  1RMV A;  3JRT A;  4MTO A;  5EGY A;  3KPH A;  2YKZ A;  1YJG A;  1CGN A;  2Q9B A;  3NRH A;  1TQG A;  3C8G B;  1YAU O;  1QVX A;  4E7S A;  3WOD F;  1VK5 A;  4BJT A;  1R4T A;  4JZA A;  5L0C A;  2R7W A;  4B6I A;  4BEM J;  4BPM A;  4MVS A;  3EZH A;  1U0B B;  2ASR A;  3HKK A;  2W4M A;  3RIP A;  1VYI A;  3I5Q A;  3U9M A;  4CJO A;  4ZLD A;  2LQG A;  3NKE A;  4IWB A;  5FZT A;  2E87 A;  2HSB A;  3F47 A;  4DBQ A;  2NUP A;  2Z15 A;  2QUP A;  4U5F E;  1ZHW A;  1L3P A;  4PJJ A;  4XWJ A;  4MW3 A;  4NC3 A;  1WN0 A;  3KMI A;  1D0Z A;  3ZQV A;  1GM5 A;  2A6E F;  3KL4 A;  1NG1 A;  5JLI A;  4C3B A;  4N4W A;  3B0V C;  2NUP B;  4HE8 D;  5BQH A;  2FAP B;  4I1M A;  3T4R A;  2XLH A;  1TWG A;  3V7O A;  4D4N A;  4XEK A;  1YDI A;  3M15 A;  2L6F A;  3AGU A;  1ZHY A;  4PJL A;  4WGY A;  3V5Z A;  1UFB A;  3WG7 C;  4YWQ A;  5JVE A;  1JPJ A;  3T6J A;  2LP4 A;  3ZTZ A;  3BEH A;  3B29 A;  3G4X A;  1OKK D;  2ZD9 A;  4Q4Z F;  4G7H F;  2QTV A;  4JE9 A;  3C8G A;  5BUO A;  3ZQY A;  4JVS A;  3FAJ A;  1E85 A;  3JYH A;  4DBR A;  1GGQ A;  3EHN A;  3ZG1 A;  3L8I A;  3DE8 A;  3N24 A;  3L0I A;  1C03 A;  2G3K A;  4J32 B;  4FAP B; 
#chains in the Genus database with same CATH homology
 4N06 A;  3N2Z B;  1S7Z A;  3B0P A;  5DLJ A;  2G62 A;  5L3V A;  3K1H A;  2V3C C;  5KYW A;  2WVQ A;  5D91 A;  4FES A;  4U5C E;  4EWC A;  1BR4 A;  5KYU B;  4YN0 B;  3ABM C;  4U5H A;  2O9X A;  2Q9A A;  4C3D A;  2R7Q A;  1RJ9 B;  4G0H A;  2Y3D A;  2IYL D;  2EIK C;  3HLZ A;  4BEJ A;  3EGD A;  4Q7C A;  2ZXR A;  3QMK A;  4BJ5 A;  2XRH A;  4W8K A;  5E3C A;  1JPN A;  1KU2 A;  3W2V A;  1Z63 A;  1M57 C;  2XL4 A;  2L9J A;  5DS5 A;  4I44 A;  4JJG A;  4KBL A;  1SZI A;  4DVZ A;  4DVY P;  3LS0 A;  3EG9 A;  4QI2 A;  2EIL C;  1NU7 D;  2PP4 A;  3F46 A;  3FDQ A;  3LAY A;  4QDL A;  4OD4 A;  3O39 A;  2W45 A;  1OCC C;  2J46 A;  2DGJ A;  4RD9 A;  3UMH A;  4XTK A;  5CI8 A;  4AK9 A;  5B1A C;  4IRU A;  4LLC A;  2R7O A;  2MYS A;  4U5D E;  1OCO C;  4KC9 A;  4XLN F;  4G7Z F;  4OIN F;  3SYN A;  5DVW A;  3K1I C;  2EIM C;  3EGD B;  3Q6M A;  2WZF A;  2GFH A;  4O6M A;  3RFY A;  2EIN C;  5L3Q A;  3NKD A;  1TWA A;  2WB7 A;  1MMD A;  4K7B A;  4X0R A;  3DD7 A;  4O6N A;  1D0Y A;  3NDB B;  3UMK A;  1ZHT A;  2Y3G A;  3X2Q C;  2KQ9 A;  4BJ6 A;  3LLK A;  5DS4 A;  2M4E A;  4YJW A;  3DAF A;  3EH2 A;  4JCH A;  5KYN A;  3IEE A;  2W4B A;  1ZYR F;  1LKX A;  4WJ0 A;  4CBE A;  3UR3 C;  1M2V B;  2IOQ A;  3SP1 A;  5DS6 A;  2CW0 F;  2KW3 C;  5B1B C;  4YT8 A;  1QZX A;  2H7O A;  1ST6 A;  2A1D D;  2YEV A;  1N1C A;  3ZC4 A;  3S28 A;  4KI2 A;  3ZIB A;  3S0X A;  1WGW A;  3EH1 A;  4AX2 A;  3T6B A;  5EHH A;  2Q9C A;  3MLG A;  2D5R B;  3ABK C;  3NG1 A;  1V55 C;  3LS1 A;  3GAN A;  1O87 A;  3W2W A;  4PK4 A;  2MWQ A;  1BR1 A;  2ZPA A;  3EPV A;  4OIO F;  2HV7 A;  4OIQ F;  2A6H F;  3LJB A;  3ASN C;  4CSA C;  3S27 A;  4RBN A;  3ECS A;  4YT5 A;  3K6B A;  2WVO A;  1FFH A;  2FFH A;  2WZG A;  5KYX B;  2PF4 E;  2FGY A;  3Q7G A;  3VAY A;  4CS7 A;  4HFK B;  1OKK A;  3FHD A;  5DQZ A;  3PMR A;  2BE5 F;  5E2Q A;  1MMG A;  1OCZ C;  2A68 F;  2C04 A;  2ZXP A;  1FMV A;  3ASO C;  4Q5S F;  4J30 B;  1SMY F;  2P7V A;  4K0D A;  2WVN A;  1RJ9 A;  3ITF A;  4F4B A;  1SF8 A;  4KNV A;  3DM5 A;  4O7G A;  2HV6 A;  2J7P D;  1IW7 F;  2CGE A;  4YT2 A;  3DAG A;  3S29 A;  5IY5 C;  2A69 F;  1LS1 A;  5KYW B;  4BJ5 C;  1O5H A;  4MQ9 F;  5KYY B;  3K66 A;  2P6V A;  3SNH A;  1G8X A;  4CSA A;  2Q3T A;  1TR2 A;  3JT1 A;  4OD5 A;  1OCR C;  2Y69 C;  4AE4 B;  4CIH A;  5KYY A;  2NUT A;  3EFO B;  3GOD A;  3POV A;  2XSE A;  3OWT A;  3LEV A;  4CS8 C;  3H65 A;  1VMA A;  3OEO A;  1J8Y F;  2C03 A;  3DJN B;  3EGX A;  1NU9 C;  3CSK A;  3K7D A;  2PFD A;  2KGO A;  3B0U X;  1D1B A;  3EQL F;  3KH2 A;  1MNE A;  3Q7L A;  3X1O A;  5D92 A;  3AG2 C;  4BJ6 C;  1PD0 A;  1D0X A;  1PD1 A;  4CS9 C;  4JW1 A;  4LAC B;  3MX3 A;  1D1C A;  4EBB A;  3JSZ A;  4OIR F;  1TWC A;  2VH3 A;  3EHM A;  4JUR I;  4BG0 A;  2VAS A;  3LES A;  4DOZ A;  2J7P A;  4BJ1 A;  2J9V A;  3M1C B;  2ZXO A;  4RDA A;  4I3M A;  4JJF A;  3NYL A;  5KYU A;  1TKN A;  3UMI A;  4XLP F;  1Z5Z A;  1ZHZ A;  2IXN A;  3DZA A;  3EFO A;  2JD3 A;  4U5B E;  2X51 A;  2W9Y A;  4A2N B;  1TWH A;  2CDQ A;  4H4K C;  2PX3 A;  3AG4 C;  2R7S A;  4LLE A;  3AQC A;  2Y3B A;  2R7X A;  2H7B A;  5T3W A;  1FMW A;  3B9Q A;  3Q6N A;  2J0X A;  3AG1 C;  4E7Z A;  1BR2 A;  2Y39 A;  4C7O A;  4HFF B;  2L81 A;  4ZLC A;  3I5P A;  3UNG C;  4MND A;  3I4U A;  5T1D B;  3PHF 2;  2OG2 A;  1W2W A;  3EGX B;  3SZR A;  1M2O A;  2IXP A;  3LLI A;  3HJC A;  3AQB A;  1MMN A;  2VB6 A;  2QY9 A;  4P6I C;  1MMA A;  5T3T A;  2DYS C;  4AE4 A;  1FTS A;  1Z23 A;  1NZE A;  4ULW A;  2CNW A;  3EJN A;  1M2V A;  2CNW D;  2IXM A;  1VOM A;  3RH3 A;  2R7T A;  3UGP A;  1D1A A;  3W8H A;  4M63 A;  2PX0 A;  3FVY A;  1Z3I X;  1IZM A;  1ZHX A;  1ZU5 A;  2XXA A;  4U5E E;  1M56 C;  4FX5 A;  2WL8 A;  3DXJ F;  3ZVR A;  3EZI A;  4G7O F;  3JCU Q;  1LVK A;  2EIJ C;  4KNW A;  4GYT A;  3AG3 C;  4PJN A;  4YT4 A;  2KJG A;  1V54 C;  2XXA B;  3CQZ A;  2ZXW C;  4OIP F;  3RYL A;  3VYW A;  2R7V A;  2B0J A;  4QI0 A;  2J45 A;  3K33 A;  1QLE C;  3E70 C;  3ZSU A;  2J9W A;  3NYJ A;  4GEH A;  3HTK C;  2Y3H A;  5B3S C;  2R7R A;  2YZS A;  3OA1 A;  3QZC A;  3DJU B;  3E9V A;  3TD7 A;  4ANJ A;  3SEO A;  5E3A A;  4HEA J;  4PFP A;  3LNR A;  3ABL C;  3EG9 B;  2YHS A;  4CS8 A;  3DM9 B;  2WZL A;  4IJJ A;  1Z6A A;  2NUT B;  3N0T A;  4I1O B;  1MND A;  5CI9 A;  2H7V C;  3KKB A;  5HSW A;  1J8M F;  3CZ6 A;  4PJM A;  5E33 A;  1PCX A;  3UGO A;  2KNH A;  5KYX A;  2G3V A;  1FFT C;  2I8B A;  3RKO F;  4FWV A;  4C3E A;  1VYK A;  2V26 A;  5F5H A;  5FCL A;  1ZU4 A;  2J9U A;  2IXO A;  4U5G A;  3W8I A;  5F5F A;  4LER A;  2NG1 A;  3NYM A;  5DQT A;  2LSE A;  2R7U A;  4PFO A;  2DYR C;  3O6X A;  4NY3 A;  4CS9 A;  4O6Y A;  2J0W A;  4IAO A;  3DMD A;  3L34 A;  2OCC C;  4O79 A;  3JRT A;  5EGY A;  3NRH A;  2Q9B A;  4E7S A;  3WOD F;  1VK5 A;  4BJT A;  4JZA A;  2R7W A;  4B6I A;  3EZH A;  2W4M A;  3RIP A;  1VYI A;  3I5Q A;  4ZLD A;  3NKE A;  4IWB A;  2E87 A;  4DBQ A;  3F47 A;  2NUP A;  2Z15 A;  4U5F E;  1ZHW A;  4PJJ A;  4XWJ A;  3KMI A;  1D0Z A;  2A6E F;  3KL4 A;  1NG1 A;  4C3B A;  3B0V C;  2NUP B;  4HE8 D;  4I1M A;  3V7O A;  3T4R A;  1TWG A;  4C7O B;  4PJL A;  1ZHY A;  3WG7 C;  4YWQ A;  1JPJ A;  3T6J A;  4Q4Z F;  1OKK D;  4G7H F;  2QTV A;  5BUO A;  4JVS A;  3FAJ A;  3JYH A;  4DBR A;  3EHN A;  3ZG1 A;  3N24 A;  3L0I A;  2G3K A;  4J32 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...