2Z16A

Crystal structure of matrix protein 1 from influenza a virus a/crow/kyoto/t1/2004(h5n1)
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
161
structure length
153
Chain Sequence
SSGMSLLTEVETYVLSIIPSGPLKAEIAQKLEDVFAGKNTDLEALMEWLKTRPILSPLTKGILGFVFTLTVPSRRRFVQNALNDPNNMDRAVKLYKKLKREITFHGAKEVALSYSTGALASCMGLIYNRMGTVTTEVAFGLVCATCEQIADSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Matrix protein 1
publication title Crystal structure of Matrix protein 1 from influenza A virus A/crow/Kyoto/T1/2004(H5N1)
rcsb
source organism Influenza a virus
molecule tags Viral protein
total genus 60
structure length 153
sequence length 161
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00598 Flu_M1 Influenza Matrix protein (M1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.180 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2z16A02
1.20.91.10 Mainly Alpha Up-down Bundle Influenza Virus Matrix Protein; Chain A, domain 1 Influenza Virus Matrix Protein; Chain A, domain 1 2z16A01
3VDXA 4IQ4A 4ITVA 1EA3A 5CQEA 4D9JA 3MD2A 1AA7A 4PUSA 2Z16A
chains in the Genus database with same CATH superfamily
2JRTA 1G59A 4NQWB 4XLAA 4ZYDA 1U78A 5CPRB 1OISA 3HUGB 3H9GA 3SZPA 4AU7A 1RRJA 4G6DA 1WRJA 4RM3A 1G4DA 1WJDA 5K7ZA 1UAAA 3QYEA 5C4XJ 2IGOA 3F6VA 4JBAA 1LFUP 2IGNA 4FISA 1FBSA 2ELJA 1Z0XA 2J5OA 3LAJA 1ZGJA 3VFZA 1B72A 3L2RA 2COMA 3PFYA 4MFDA 1MGTA 1S8NA 1A6QA 4V2FA 4Y3OA 2P5KA 2XSJC 2IP2A 3HIFA 2DTZA 3KPHA 1YFHA 2KDZA 4FHTA 1X3WB 4GO1A 4IRGA 1OJLA 4KUMA 4ANJA 2ZNYA 5EG0A 3I0TA 5LGTA 3G1OA 4I01A 2HEOA 3GTGJ 4XN0A 2IJLA 2FUG2 4LIVA 3DCFA 3M8EA 5EYRA 2VJJA 1HLVA 3E5QA 3LSGA 3OYMA 2OTLI 1XD7A 3L2CA 1GUUA 1WJBA 2X48A 2BV6A 5LLQA 2HZTA 3M1EA 4A3MJ 2XRLA 1B8IA 1VI0A 2Z99A 1WWXA 1A5JA 2Y75A 1MDMA 1XSXA 2M0MA 3HZJA 2PJRA 3PUBA 4HEA2 1OMIA 2D1HA 2M2EA 3HRSA 2Y2ZA 3N97A 3HYIA 2K9MA 1S29A 3QWLA 3F0CA 3LSHA 4HBLA 2EH3A 2K9NA 3Q9VA 2MD0A 4NBQA 3DLLF 1NG6A 4A3IJ 4DYQA 4UB8C 1RR8C 1JXSA 1Q1VA 2AQEA 2CV1A 1ZG1A 3BC8A 3A1YA 1BN5A 1JJ8C 3AL0B 2WAEA 2A69F 1XGSA 1LEBA 3CF2A 3OYGA 1EKEA 2JK3A 1GXQA 3GZ5A 3VEPA 2B0LA 2VPLA 1BL0A 1RC9A 3PM1A 4CZCA 5LRSA 3WTSC 5J8CA 2JVGA 4RAGA 3WTXC 2YX4A 1OR7A 3P9KA 3HGGA 1OPCA 1S6LA 3QU3A 4QPQA 2FF4A 2OCEA 2L0KA 2K86A 1D8KA 2WWYA 5K5OA 5E1WA 2ESNA 4KJZA 3S3OA 1YX5A 3FMQA 2W1OA 4I0AA 2X1EA 3ZPLA 2JSPA 3Q3SA 1BI1A 3H36A 2ADUA 2HDWA 1HW1A 3COAC 3HSEA 2PX9A 3K4LA 4IJAA 4E7ZA 3HOTA 4AD9A 2M7AA 2JJ7A 3S3MA 2L01A 3FHNA 3OYEA 1X1PA 1Z7LA 3I53A 3QYBA 1KYZA 3T5XA 1UJ8A 2ZJRF 2R92J 4EGZA 2RAEA 1PJRA 2NVUB 1X1DA 3RQIA 1ZGWA 4XLEA 4RAFA 2JVHA 1QU3A 1LJ9A 4WF2A 3HOUJ 4HYEA 1QVUA 4A2UA 1ZRDA 1A36A 2FBHA 4DJAA 4C2TA 2MH2A 1U9OA 2OU2A 2IA1A 1D1BA 4HW5A 4A93J 1DQUA 2F5CA 1DDNA 4M3DA 1FBQA 4L0ZB 3P9CA 2VT3A 5TISC 4FASD 1ZAOA 4CYDA 4CGZA 2VOOA 5E3OA 2CV2A 4RAZA 1R36A 5EDNA 4IRIA 1SFUA 4FE4A 1XS9A 1P7JA 2ZMEB 3D5LA 1A35A 2KIUA 1VQ8I 4ESBA 3FISA 5LRRA 2M4GA 5IT3A 2NAZA 2E19A 4NB5A 5EGOA 5DCFA 4BE1A 2CUFA 2QKMB 4CZZA 1I27A 1K6OA 2G0EA 1K83J 3SFZA 5HNHA 3MZHA 1I39A 2DYRH 2BW3B 1YRNA 2QBYA 1MBJA 5IT9K 3S2HJ 1MMAA 1TLHB 2QQBA 3EUHC 1FOXA 2LF8A 4Y7NJ 5HDNA 5J4YA 1MSFC 2PQ8A 2LH9A 2MLKA 2M8EA 5ICFA 5GADJ 3Q0VA 3JSPA 2OBPA 3S1QJ 1W7PA 4E7IA 1BW5A 2E36A 3H3ZA 3CUQC 5H2FC 4B3AA 3W6KB 4L5IA 1TWFJ 3M07A 4MIMA 1FP1D 3DKWA 5IP6A 3IRQA 3AAFA 3O8HA 2R7UA 3IKVA 3IH4A 3I4PA 1FNNA 1W4MA 3V8JA 1T56A 2VLAA 2DFEA 2FD5A 3ML6A 1D1AA 4LGWA 5B5EC 2MC4A 1I3AA 3DEWA 1WVRA 2CQKA 2L2OA 4OIRF 2FOKA 2XAUA 4Z6YA 2P6TA 2DT7B 3QPLA 4P55A 1F4KA 1R6RA 1WGXA 4QTRA 1N25A 4DW6A 2DJNA 1SMTA 1VTNC 1DGRM 2LG4A 4KICA 2DA4A 3MMYB 2WAQN 1HW2A 1IN6A 3KP6A 2L4AA 2OZUA 1ZRFA 2WY7Q 3ZN1A 3ULQB 1ZHFA 5FLVA 1RNLA 2UXNA 3UR3C 4EM2A 4XKVA 1YJ9I 3GF2A 4ENJA 2DN0A 2V4JC 1JKQC 1GV5A 3E6DA 3DU6A 3L9FA 2PN6A 4PGHA 5F08A 1Z21A 4G7ZF 1YG2A 3KP4A 4AVPA 2L54A 3LAPA 2CW7A 2UWMA 2Y0SA 3HRUA 1O4XA 4M6VA 1FZPB 4J00A 1GXPA 1QHGA 5KK1A 3CU7A 4QLCU 4YIRX 4IHXA 3C7JA 1D8JA 1HXDA 4G12A 1XCVA 3CJQB 3N4MA 3K70D 1RUOA 3K4KA 2UUZA 4BHCA 5FD6A 3G4SI 2ZFUA 3G73A 2NVQJ 2K7LA 4FXGB 4DYCA 4P9UA 1MBFA 2RKHA 3WTUC 3V42A 2DDBA 1NK2P 2CQ7A 1OCZH 4A5MA 1TQPA 5F0FA 2Q8KA 3GTJJ 4XORA 4RDUA 5M5YJ 1RI7A 4ENKA 2QSHX 4LG0B 1BI2A 2VKDA 2XGEA 2EIJH 2ELKA 4OINF 1FJLA 4IEJA 3EETA 3Q0WA 3AG2H 3LNQA 1UHMA 1PUEE 2E2IJ 4CYCA 2VBYA 1I1SA 4UVCA 3KLNA 2DA5A 4P96A 3U9GA 3P9IA 3OS0A 4IHSA 1SANA 2JA2A 4IL6C 2ZO4A 3C2GA 1CFAA 5AONA 1K78B 2HKXA 1Y8RB 3L2VA 1XC5A 1G3SA 1O7LA 1X1BA 2MBFA 2P81A 1JKOC 3LFUA 4YIIA 1Z6RA 4CA0A 2KMUA 1A6IA 5IT9Z 1U9NA 1TWHJ 2DA1A 4MNUA 3CMAI 2P7VB 2FRHA 3F8BA 2VQCA 3IL2A 1WH7A 4NQWA 5ICGA 4RGXA 1X3UA 5D5XB 3HUGA 5D4RA 4UNOA 2RVCA 3HG9A 1LB2A 1IRXA 1A31A 1W5SA 1W7PD 5JLWA 3CD6I 5FD5A 3S1NJ 1VQNI 1ODDA 3AFHA 3KEYA 1UG0A 3TBIA 3F21A 1GHCA 4UUVA 4EATA 1QVTA 3LL7A 4PUSA 2XUBA 4ZZLA 2H8WA 4LOCA 1NK3P 2VJIA 1FSEA 2QUFA 3FDYA 4NHJA 4C3JJ 3CCEI 4BNCA 3DPLC 4B4CA 1G3YA 2CRGA 4ON0A 1HQCA 1OCRH 1XMKA 1DU6A 2OA4A 2MGQA 3TDZC 2XF6A 5J4VA 1ZREA 1HW5A 2KFDA 2Z33A 2W24A 4L9TA 1AU7A 2CWEA 1MKMA 2BY0A 1TTYA 3BLYA 2VKHA 5E3MA 2Y9ZA 3FMSA 2K3PA 1WI3A 1Y1VJ 3AG4H 1T2KA 2MABA 3HOXJ 4HQEA 1XX5A 3AG1H 2MFZA 5CVUA 5AIQA 2HPMA 1SAUA 2BYVE 3RYRA 1Z3XA 2EZHA 2KT0A 2DK8A 3E7LA 3GTKJ 5DD8A 3HQAA 4LJZF 2QGUA 3NARA 5E18F 3BCAA 4X0GA 4ABZA 4H0EA 2DDAA 2FXAA 2MH9A 4P5OA 3AL0C 3EYIA 3GLXA 3G71I 2A6TA 5L3BA 5TGTA 3JRIA 4KDPA 2BGCA 2EFPA 4PFPA 1DP3A 4OU0A 4F91B 3B6CA 3OYLA 4II3A 3E6MA 1AOYA 2F5VA 1V3FA 1UFMA 2EA4A 4XNFA 1BW6A 2AQFA 2I5UA 5TRDA 1IDYA 5KHDA 4BBSJ 2ELHA 2ZKZA 3ZQQA 3KYDB 4LB5A 1YQAA 5LHIA 2GA1A 5HOOA 2FNAA 3I59A 4KT5C 1HBXG 1VQ4I 3CCJI 1P7IA 2F5FA 4ESJA 4CCOA 2XGCA 1IN5A 4BXXJ 2R7FA 2Y9YA 4F92B 1K4TA 2JA5J 2BBYA 2KIQA 2FEZA 4YRVA 2QKLB 1D5VA 1Z7UA 2Y0MA 4WB2A 1KQ9A 2IGKA 2O8KA 1JE8A 2Z1DA 3O6BB 2F4MB 2FMYA 3K1PA 4BS9A 4Y33A 2XPWA 3ZR8X 3M3YJ 1IN7A 2E71A 2EB7A 2WBMA 2DK5A 1VQ9I 1Z05A 3CC7I 2XKPA 4PCQA 4JX4A 3OSGA 2OUMA 2HGCA 2DMUA 2K02A 3BPXA 4Q47A 3W2WA 3E3VA 3FBIB 2V1DA 3BP8A 5D4SA 1O3RA 3C3WA 3HSFA 1HSJA 3ZMSA 3GLLA 3G3ZA 4K2EA 1TW3A 4F55A 4Y13A 3KETA 2O9LA 4PJNA 3JRAA 1R4MB 4QPOA 5FROA 1T38A 3FM5A 2E1NA 2HTJA 2NVXJ 3BR2A 2CMPA 5EEGA 4AIJA 3ZMZA 2P6SA 2DMNA 1MZBA 1I5ZA 4RB3C 1TL8A 3S93A 3D1NI 1AKHB 5IYDJ 1DU0A 2ZMEA 4RMNA 3O2PE 5DCMB 3SEQA 3G6EI 1T0FA 4CHUA 1IJWC 4HWJA 2XAGA 3E97A 3MZ8A 1JUPA 3GO5A 2DFFA 2VASA 5K1YA 3I55I 2BW3A 3SQNA 1H8AC 4BY7J 4HQMA 3WGGA 1R00A 1YW8A 2X1DA 2EZKA 1HKTA 2W25A 3OYBA 4OMYA 4BQQA 4RB0A 3V7RA 2P7CB 1P6RA 2M45A 4NDLA 5J47A 2A3SA 4XL9A 3CUQB 5E1ZB 5GTIC 3LSPA 3WG7H 2VQGA 4A3CJ 4H4KC 3QQAA 2DT5A 3V4GA 4DZJA 1SFXA 4LLNA 4XRMA 1WHUA 3RZOJ 1HCRA 4E7LA 4DZPA 5ED4A 1XSDA 3ZMVA 3I3LA 1STZA 3CCSI 2K85A 2R4GA 2ESHA 3A01B 4BKXA 2BY1A 1OCCH 2YSRA 4A3DJ 2PMZA 2PMUA 1VQOI 1RR7A 3CZ6A 1USTA 2X6OA 2HWVA 1T39A 4AIKA 4HSRA 3FKIJ 3ZN0A 1U8RA 2V26A 3FZVA 4AWXB 4C9YA 3EUKL 2LKPA 2R5ZA 4PJ0C 1TQIA 4JX5A 3T8TA 4BQAA 1W5TA 2ZC2A 2V9VA 4JX6A 2EILH 4M71A 4LG3A 1T95A 2ME6A 3U2RA 2QWWA 3K6GA 2LMDA 4EVIA 2AS5F 5B1AH 3LA3A 5J40A 4UVBA 3QOEA 5HS7A 2CU7A 2IXSA 1ZYRF 2HOAA 5HLIA 2V1UA 3GZ6A 2E1CA 3MKYB 1ZARA 3HOVJ 3WTZA 1TWCJ 3L09A 1E2XA 3B02A 3OWTA 2LY9A 3OSFA 2JZYA 1VQ6I 5BPDA 3KP7A 4DNCA 3H5AA 3HBLA 1EH7A 2XB5A 3GTQJ 2R5YB 2HYGD 1IN4A 3REOA 2P4WA 3CO7C 1VQ7I 2UXXA 2W48A 2WADA 5EZGA 1LE8A 2DOAA 2LSOA 4I6OA 2JPCA 2DCEA 4PDKA 3FWEA 3WE3A 3HTSB 3JTGA 3TW6A 3A0BC 5AIPA 3I5UA 5HLGA 1ZH5A 2DQRA 5K7HA 1B1BA 3OYIA 2L5QA 4IF4A 1BR4A 1FPQA 3NWSA 4HX7A 3RTRA 1R71A 1OCTC 3I58A 4HNTA 2L7ZA 1MBKA 1QZYA 1XMXA 3UKGA 4CSWA 2O03A 3JRFA 4UU9C 2ZFWA 2CQNA 2CW0F 1J9IA 3M9AA 4PJMA 4A3LJ 1T6SA 2FBKA 4A3GJ 3G1LA 3OYFA 2FQ4A 2HZDA 4HZFA 5F0CA 4IHTA 3ABUA 2CS3A 4W97A 2VE8A 1U6GA 4A0ZA 2RN7A 2BXZA 3Q9SA 3WGHA 2D1VA 2XVCA 3GFIA 2XASA 1LKXA 1T98A 3LSTA 1FSHA 3DF8A 4L5EA 3FXRA 3K2ZA 2C6YA 1MH3A 3FXMA 1B9NA 3A4CA 3QODA 3JSOA 1OQYA 1P4AA 2W00A 3C1DA 1X3ZB 4IVNA 4N0BA 3M8JA 1ZG5A 3LQQA 3WODF 3RZDJ 2VE9A 1S3JA 2XAHA 5F04A 2YX7A 2VOPA 3OYJA 2R7WA 2Y0SN 5LHHA 4FXKB 2QQ8A 2RREA 2ZJQF 2DBBA 4OIQF 1W36D 2XKOA 2IEKA 1FMWA 2K5CA 3PSFA 4DBQA 5DV5A 1RESA 4Q4ZF 4HV6A 4V2GA 1K4SA 2E7XA 1MIJA 3ZP5A 5F64A 3S16J 1BJAA 4HA8A 4ZYAA 3VWBA 4R1HA 3R4KA 3RKYA 4BU2A 2VT2A 4ZYEA 1UHSA 4P3BA 4HLYA 2ZNZA 3V7SA 1JUMA 4XRFA 2L9NA 5BMZA 4LLLA 3SFIA 2CO5A 3DPTA 3OV8A 1C5AA 2IPQX 5JPNB 3BPVA 2ME0A 2CYYA 1SFKA 2EFWA 3T1BA 2IRFG 3DWLE 1H9GA 5J3LA 1YW7A 3CCLI 2TDXA 4WCGA 1S9HA 3DEUA 2NS8A 1JGGA 3HHHA 3FXKA 3H3UA 2UZKA 1QZEA 1LDKB 3FXQA 4RGUA 3I9V2 2DI3A 5ICEA 2EZIA 3BG9A 2NRAC 3DBHB 4G8XA 4PFOA 5L3DA 2IVMA 2D5VA 1UG2A 2OQGA 3F23A 3VYTB 3B73A 3RCOA 2EBIA 1IV8A 1UB9A 4WXDA 2O7OA 3H1CA 1F36A 5KCMA 1U2WA 4IHWA 4XLNF 4DYRA 4LK1F 3KFWX 5FLXK 2WV1A 1Y39A 3ESWB 3ECOA 2A68F 1VQLI 2R7VA 1R5ID 4HV5A 1FWZA 3L2UA 1D0XA 3NQOA 4E4HA 3K4MA 3GYHX 3M7GA 1YW9A 3KP5A 1KQ0A 1YLFA 3OIQA 5H6QA 3ZQGA 4ZZDA 1ZR2A 2B9SA 2QQAA 1YO5C 1V5EA 4GYGA 1VFCA 4HAMA 4KN4X 2LFBA 1QPIA 1QQIA 1R4NB 2LBFB 3ZMUA 1IAWA 3FK7A 1VZ0A 1IUFA 2LLKA 1TZLA 4A5NA 3BR0A 3OR1C 3L00A 1HOMA 2VODA 2HQNA 4D7NA 3LSKA 2HQAA 4LFUA 1TT5B 3RI4A 2HR3A 2ZXHA 1XSVA 2K40A 1QHHD 1G8XA 3GXOA 1GT0C 2NNYA 5CQEA 4CCMA 1ZLKA 4HF2A 2CJJA 3BTLA 3MKLA 3LA7A 1MJBA 3TQNA 1X4OA 4DOZA 2XDVA 3HDDA 3GUDA 2ZBKA 3CDIA 4JK1X 4C3HJ 4HPQA 2HVQA 2DPDA 4IXAA 2H1LA 2JSCA 2XPVA 2O3FA 3MAJA 4UVAA 1E17A 3DBRB 1KZHA 1BC8C 2LD5A 1CF7B 2HYFA 4V19K 3EYYA 1G3WA 3FX3A 4XKBA 3VSKA 5CQGA 4OAYA 1FC3A 2CFXA 2VB6A 3MKZA 4IHYA 4XRSG 1JTYA 3HXLA 1BI0A 2M1BA 4PJJA 3KEOA 3IH2A 4FX0A 5DCMA 3RPUA 1W1WE 2E5ZA 4RBOA 2PJPA 3S8PA 1O3TA 5J1YA 4P9FA 2MSYA 3IH3A 2Y69H 3EUHA 2XGXA 1WJ5A 3VYSB 2CV0A 1R1UA 3O8GA 3DXJF 3S14J 3BG7A 1OYYA 2FOWA 3R6SA 2O0YA 3CMEI 4TV7A 2EFQA 3BT9A 2XF7A 2WC2A 4ZTFA 1IC8A 2KLOA 4G9YA 1B9MA 3NRVA 4BE2A 2GAUA 1WJFA 2CFOA 2O5RA 5BOXA 2R7QA 2EFNA 3SDBA 2R7TA 1R7JA 2ZJ2A 4BUPA 3ZCOA 1TWAJ 1D3YA 1KU9A 2K9LA 2IS6A 2XSDC 3C18A 4P1WA 3JR9A 1F5TA 2GQQA 2BY2A 1R9TJ 5HS8A 2ECBA 1XMAA 2DOEA 4FT8A 2PBIA 4HX4A 5H20A 1D0ZA 2QEXI 2O6GE 2HXIA 3A02A 4I6ZA 5KAFC 2QLZA 5A2QK 4UUSA 4I76A 3E0JB 4BYYA 1WFXA 4J01A 2W85A 3H9JA 2JRMA 2A05A 5FLXZ 2YPRA 3P5JA 2AO9A 3IP4B 3E6BA 4GFBA 4Q5SF 3S32A 4KA4A 2F5DA 2OF7A 1USSA 1DPRA 2E60A 2OD5A 2RC4A 3LMMA 5HDGA 4KFCA 1UZCA 1E3OC 1P4WA 3CO6C 3GW2A 2K27A 4BHPA 1XCBA 2DFHA 5HS9A 1E0EA 2W82A 2XAJA 3CDHA 1WZ2A 2VJ5A 2B7EA 1NTCA 2L7KA 1XDUA 2CQQA 3CJRB 4MQ9F 2HVSA 1X1CA 1ZK8A 5F0HA 4U7DA 1FOWA 3WU0A 4A3FJ 4GDFA 2XHKA 3OY9A 3QPTA 3DBLB 3T8RA 3VDXA 4MHGA 1PP8F 4WB3A 2KZVA 3BG6A 3D5SC 1YI2I 2JA7J 1R1TA 5DDGA 3CESA 1TQMA 4G7OF 2CUEA 4Y17A 1GVJA 1IUYA 4W1UA 3RKQA 1VQKI 4RGRA 2WV0A 3QP6A 1SVLA 1ERDA 5L3FA 1Y0NA 2LF7A 5F1JA 4DBRA 1IN8A 5LEKA 2E34A 2YU9J 5BNGA 2HDCA 4AYBA 3W6JB 1RETA 4EQQA 5L3EA 2M9HA 2JTVA 4B8XA 4E7KA 5FKMA 1Y6IA 1KGSA 2M4KA 1DUXC 2D2WA 4L9VA 2X6YA 5H6RA 2BZTA 5E3LA 3VODA 3BJOA 3ELKA 2DT6A 3RPUD 2PMZN 4D7MA 1ULYA 3Q0UA 4I99C 1Z91A 2G9WA 4MTDA 5FFXA 4O6JA 5CKTA 2Y48A 1PDNC 2ACJA 3F8NA 4F3QA 4A0XA 1B6AA 5FLMJ 2VC0A 5FKKA 5DUKA 4GCVA 1WI9A 2E7WA 5EJCA 3ROUA 5EEAA 2W84A 3CCVI 5B4PB 2KJCA 3TP3A 4A6EA 2KISA 1SVMA 2VBZA 1RKTA 4FE7A 3WG9A 4ZYHA 1MJ9A 1WPKA 2F48A 4IZZA 3QU6A 3BTCA 4GRIA 2RNGA 1TW2A 5JHUA 2VUMJ 4U0WA 4ZYGA 4MGRA 1WQ2A 3F8MA 1X2MA 2V9KA 2R0QC 3J7ZI 1ZR4A 2STWA 4MQVA 1WKMA 5IPAA 2E1OA 2B39A 3OS1A 3C2BA 4L5JA 2FMLA 4WK8F 4EV0A 1K79A 3HHGA 2GXBA 2KP6A 3DV8A 4IRHA 4PSXA 1SAXA 1TNSA 4HG2A 2G7HA 2GIZA 2EWNA 3GMEA 1JHHA 2NVTJ 3EQLF 2L02A 2ISYA 5A2QZ 3CLOA 1YIOA 2ZB9A 1BA5A 5FKNA 4YEJA 1BM9A 4F93B 5EG0B 3TP0A 1U5TC 1ZN2A 3T0YA 1AWCA 3MEXA 4EJOA 4AM3A 2VBXA 5FFZA 4XLPF 3WU2C 3IKTA 2IA0A 3W2VA 1B4AA 4L9JA 1JKRC 1V5GA 4Q48A 1ZQ3P 2PG4A 5IOZA 3MKWB 3HRTA 3PNTA 4II2A 1JKPC 3PFIA 2A5WA 3GVAA 1XGMA 3IC7A 4G6QA 4BHBA 2PJRB 2DMTA 4XLFA 2X4HA 3ZXSA 1E3HA 1FOYA 2WAFA 4RLQA 3BY6A 3NAUA 3KP3A 2DQLA 4BGDA 2ZJPF 5IOYA 5KNLA 3M8FA 4JYKA 1U0JA 2L4MA 3OIPA 3BR6A 3H0DA 1JI8A 4PSWA 2VN2A 1I6XA 1FYMA 2H27A 2HU9A 3HKZA 3RYPA 2Q1ZB 2CUZA 4U0YA 3FKJA 3F6OA 4HNVA 3IWZA 1HDPA 2R7ZJ 3V7CA 4JP0A 5D5WB 3BZKA 4XOTA 3ZQHA 5HODA 1HC8A 1OKRA 4UXNA 5CLSA 2P5LC 3E1SA 4YELA 2EA2A 3V8KA 3K1NA 3S17J 3I56I 2IBDA 2EINH 2VQLA 3SDGA 1I6HJ 2OV7A 4Y15A 3HQBA 1R5GA 1V4RA 4O3MA 4XOPA 3KIOA 2HDDA 1JGSA 4Y4RA 2PEXA 4XLCA 3DKXA 3SYTA 4C3IJ 2DYSH 3H92A 4F52A 3TKYA 4BAYA 1FT9A 1MBGA 2ICWG 3Q5FA 2KHMA 4N9HA 2XGDA 4HSTA 2X6WA 5M5XJ 1S7AA 3CJTB 3OYKA 3FXJA 4XKWA 4E7JA 1YS7A 3K4CA 3F72A 4A69C 2I10A 3RJPA 4EMSA 1L0OC 3H5RA 3J7AO 5DUIA 3FMRA 5TJJA 1F43A 5E1XA 3ZQFA 1ENHA 1TBXA 1MMSA 4XQFA 2IAIA 1V5FA 3E6CC 3JTHA 3GZNB 3PL8A 2K4JA 4OWRB 4HNUA 4ENNA 3HGYA 3K7AJ 2Y31A 4M3EA 3K1MA 1PVEA 1RKWA 5FKLA 5JI6A 2A5YB 4B48A 4EM0B 4OMZA 4CCLA 1FP2A 4N4NB 4U0VA 1BOBA 3TO9A 3CC2I 1VNDA 1BBYA 3MQ0A 1LVAA 3AG3H 1RUNA 3A0HC 1CF7A 1FTZA 4HX8A 4FTHA 4Y52J 2JN6A 2KDOA 2LOOA 5D5UB 3HOZJ 5FJ8J 1G3TA 2KZGA 5D6FA 1SEUA 3HOSA 3QOPA 2RQQA 3CLQA 1YRNB 2QBYB 1A04A 2X51A 5HVQC 4R79A 5J1RA 2A6HF 3LOCA 2JUCA 5FGMA 3WTYC 2FSWA 4BACA 3OYDA 4D1QA 1VQPI 1YIJI 2DA7A 1TP4A 1LUJB 1ETWA 4D5FA 4M74A 4DQ2A 1BI3A 2P8TA 1GDTA 3KZYA 1FMVA 3OS2A 4A3BJ 2DJIA 3BCBA 3GCMA 3BDDA 4I2OA 1JTXA 3A03A 2CUJA 5HDKA 4BBRJ 3D0SA 1ETKA 1VQ5I 1O7FA 1MBHA 1JT6A 1S7EA 1KU2A 4S0HB 3JREA 2GLOA 4KIGA 2XRNA 4XBFA 1QPMA 2H6CA 3ISPA 3BR5A 5KAIC 4QSHA 3OR2C 4XSXF 5D5VB 2HI3A 5C44J 1W0UA 4N4OB 4L18B 3CJNA 3W3CA 3BG5A 2F6CA 2V6CA 2N8GA 1KYWA 4CO8A 1Y56A 1Y0UA 2CH0A 2HPIA 5F27A 2ZSHB 3HL2A 3PJRA 2HOEA 1VQMI 1EH8A 2XF5A 1CQTA 4CUGA 3PNVA 4BJ5C 2ECCA 1LDJA 3OOPA 1MSEC 2WTEA 3QRFF 2JQ7A 4HDVA 3QP5A 2DXIA 3GX4X 5LEJA 2V9PA 2JMWA 1MMNA 4IO9F 2FNPA 3FXLA 3OL4A 3CCMI 1W0TA 1WJAA 1I3QJ 3GTMJ 3LWFA 2DLLA 1K7AA 5E8GA 2OPTA 2Z5UA 4G6TB 4KN7X 4NNJA 4MLOA 2Z2SB 4C30A 4M3BA 1U8BA 2CSOA 2X85A 2VKVA 4LG0A 1Z3YA 2VPRA 1P92A 2FA5A 2QQ9A 3ZQ7A 4BQNA 3L1PA 4M9SA 2A07F 3TOBA 5F1RA 3M1CA 2NXNB 2DODA 1J7KA 1XDSA 1H9TA 1FIPA 1Z77A 3OOUA 4CYCB 3HB9A 3LSIA 4BQOA 4KIBA 2VKEA 1K78A 1KU7A 2K4BA 1FOKA 4I09A 3K2AA 3FBNB 4UV8A 3DU5A 5JFRA 1YX3A 1BC7C 1ETXA 3PQKA 1IO2A 1ZGAA 2VI6A 4GGGA 5GP9A 3I4MJ 5CJ9A 1IXRC 4JOMA 1PYVA 3CMYA 2ID6A 3JRGA 5CVIA 5ERIA 2H09A 5DM7F 4WXCA 3NEUA 4X1EA 2EV5A 3TMOA 2X9DA 4HDUA 3M4OJ 4XRSA 3S3NA 3CTAA 1X2NA 4U87A 3QAHA 3QPSA 2QSFX 1Z6TA 4PJLA 2BHZA 4CXFA 3F8FA 2LNBA 2VXZA 1Y8QB 2IT0A 3ZGKA 1R1VA 3CCUI 1F9NA 2L9SA 3FF5A 5BPIA 2BVMA 1LFPA 2ETHA 4P3AA 2BY3A 2LREA 3I64A 3ZQLA 3R0AA 2CGPA 3FXUA 1EJ9A 3K4JA 1KU3A 3GFJA 4NUBA 3S1MJ 3ZRGA 3F9KA 3UNGC 2KL4A 5JPMB 3JAMK 4IPAA 5J1UA 4RM2A 1ACIA 1M1EB 4LK0F 4I7HA 1AHDP 4ZDOA 2HS5A 3DP7A 4MO7A 1OCPA 1U5TB 2EZLA 3H9QA 5IP9J 1ETOA 1SC7A 1WCMJ 2F4IA 3CUOA 3V8LA 4AYBN 1OYWA 2E2JJ 3W6VA 2LKSA 3K4BA 2R7XA 5J6XA 4M3FA 3VSLA 3PNYA 4UHTA 1XB4A 1X4PA 5HLTA 2ISZA 2XIGA 2CQXA 4ZC3A 1NHAA 4BY1J 3BOQA 5HLHA 2Q0OA 2BHYA 4D9JA 1T8IA 2V6EA 5D8KB 2E1MB 4LITA 5IP7J 2W7NA 2HOSA 1MMDA 3O3KA 3BG3A 3IHUA 2GA2A 1OR7C 1YE9A 2EFOA 4I98B 4IQJA 2M7BA 1H88C 1IRGA 3FIWA 2LR8A 2Q2EB 2FJ1A 3EUAA 2E2HJ 1TT0A 3BZ6A 1SD7A 3I59B 2EIKH 3JRCA 1HDDC 1I1GA 4RLFA 2FX0A 4CCJA 4L9NA 4A3JJ 1N78A 2HOTA 1CGPA 4CICA 2VXDA 3SJMA 4MEYF 1MNEA 5LGNA 4KMUX 2QA4I 1H0MA 3TGNA 3IWFA 4NC6A 2PI0A 2GM4A 1SD4A 4L0YB 4YG2F 1F1ZA 4M6YA 4G7HF 1QNTA 3ERMA 2A61A 2BVLA 2X1CA 4RB2C 1LVKA 1DGWY 2DO7A 3E5UA 2X0LA 2IS2A 3K70C 3S1RJ 1JUSA 3RPQA 2GOXB 3G2BA 4N9IA 2OZ6A 5LFAA 1J5YA 1Y1WJ 1YYVA 3OMYA 5ILSA 2L9RA 2PFBA 3TW7A 3U21A 1V54H 1KONA 1IZ1A 2EV6A 3P7NA 4D5CA 5EEHA 3A2KA 2V1NA 3WGIA 4EJWA 3OYNA 3GFMA 3BWGA 2XAFA 4KYWA 2PMHA 5DEQA 3MZYA 4O5VA 2P0WA 4C2MJ 5J8FA 1DPUA 1IGNA 3I54A 4EEFG 1D5YA 3BR3A 3QPHA 3BTJA 1AKHA 1ZRCA 5LHGA 3GFLA 2GXGA 2OC6A 5IYBJ 4BDYA 3ZMDA 2DMPA 1IXCA 1SD5A 2KIMA 4WWCA 2LVSA 2M34A 1G6NA 3BJ6A 3ECHA 3F22A 1XPXA 2MC3A 4A3EJ 3GWZA 2GIVA 2KRCA 2WB1A 4HW0A 9ANTA 3JAMZ 4M9XA 3E5XA 3HKZN 4CCKA 2LKXA 2LY2A 3S2DJ 1GVDA 1MNDA 3FXOA 2CG4A 3IUOA 2WA0A 3LSMA 3WTTC 4FX4A 2QSGX 1FLIA 5M5WJ 1YHQI 4UY8I 5L3GA 1FIAA 2WY8Q 3DPUA 4EGYA 1SFOJ 2LY1A 3CUQA 4A6DA 3PIPF 5M3FJ 2DA2A 3DTKA 4MTEA 2BXYA 1IF1A 1ETQA 1RIOH 2M87A 3K10A 3BJAA 2F2EA 4XM3A 3JRDA 2FQ3A 3I71A 4IOCF 4XK4A 1X19A 4I0BA 2LTPA 5FKOA 3TL4X 1P2FA 2HKOA 1YS6A 4LLGF 4DIQA 1S7OA 5E3NA 4P39A 4IHVA 3ABTA 4NC7A 3X2QH 3A01A 5DYMA 1HKQA 1WJCA 2XROA 2DFIA 2HVRA 2M0CA 3R0JA 4M73A 1EV7A 5K5QA 1J75A 2MG4A 2FU4A 5CVJA 1I50J 1TWGJ 3MVPA 4ZDLA 2W4SA 5GPAA 1VF9A 4XKCA 3RSNA 1C0WA 4M9ZA 5F6FA 3F3XA 1ETYA 5M3MJ 2VIXA 2EK5A 4LD5A 2G7UA 4RA2A 4RGSA 3SEZA 3DLAA 4KIFA 1ETVA 2R5ZB 4ASNA 5DM6F 1OLTA 3JW4A 2LP0A 2RV8A 3HJEA 2R7OA 1B59A 2HYJA 2DPUA 2XPUA 3KLOA 2KRFA 2MLGA 3GTPJ 3ZOBA 4S04A 2JUGA 3JRHA 1ZTRA 1WH5A 1H89C 5ILUA 1XGOA 2A6EF 4GYIA 3DTEA 1ZG3A 2F5EA 2ZXIA 1J09A 3DEEA 1LFBA 1JHFA 3U1DA 1PP7U 1QA6A 1MD0A 3HM5A 4G94A 3KX2A 1SD6A 2R5YA 4M6XA 2Y30A 3DKYA 5KVRA 5E17F 1QGPA 1PUFB 4BEHB 3VOEA 1KJSA 2YU3A 1WJEA 1ZELA 3TOAA 5BS6A 5C4JJ 1S5LC 3D5RC 1S72I 4OOIA 1QRYA 3CCYA 3KE2A 4R8HA 1R49A 1LE8B 2MYSA 4CH7A 3K9TA 1Z67A 2GBYA 1N75A 2IW5A 2Z16A 3ASOH 1J0RA 4EJUA 2H1KA 1GLNA 4WXHA 2XAQA 1APLC 1Q1HA 1P4XA 5ICCA 2KRHA 2QZ8A 4A3KJ 4KMFA 4YIFA 3CF5F 1NH3A 2L7FP 1RZ4A 3GEZA 1ZLJA 3IAS2 1IV6A 4JQFA 2GWRA 3GBGA 2R7RA 2ZSIB 4A12A 4AUXA 1QZZA 4XLHA 2E35A 2H94A 2O61A 3CDLA 1ORKA 2I8DA 2M5WA 3CCRI 2QCOA 4YFKF 2V79A 3WE2A 3N05A 4KISA 1YJWI 2DOFA 3FK6A 2HFHA 3RKWA 5K7FA 3S2WA 4DGWB 1TC3C 4HRIA 1ON2A 1ONVA 4FQGA 1OFCX 2DA3A 1O57A 3DFGA 1MH4A 2MW8A 2K9SA 2L7MP 3PQJA 2EJRA 3K4NA 4CDGA 2XV4S 5LD2C 1MBEA 4M3GA 1T08B 1GV2A 4LB6B 3GTOJ 1K61A 1E3PA 4XN3A 2K3FA 4B43A 2VL8A 1O3SA 4XONA 2H6BA 4BJ6C 4RAYA 1NG7A 3MCZA 4QIWN 1B72B 5E8IA 2O8XA 4KNYA 2HQ5A 3EDPA 2OTJI 2HNHA 4IX7A 1UELB 1POGA 3PSIA 1YTYA 1FEXA 3K0LA 2BOLA 1XG1A 1OCOH 5FB2A 3J81K 3ZQCA 2NOJB 4QWQA 2X6XA 5BQTA 1IG7A 2H8RA 3G1MA 3KZZA 4EJVA 1EF4A 3R60A 2NVYJ 3ABMH 4XR6A 3RQ4A 3IV5A 1U5TA 1B8IB 3SXYA 3HOYJ 1IDZA 3LQRA 3RKXA 5GTHC 2BE5F 1BIBA 1MDMB 1JT0A 2OCCH 4RB1A 3MN2A 2QENA 3DQVC 3MWMA 3GTLJ 1UHWA 6PAXA 4AIDA 2YS9A 3BZCA 5D6EA 3KCCA 1BR1A 1TNTA 3H35A 1FBUA 3TO6A 3FHZA 2OJED 2E1MC 3LFKA 1V55H 3BQZA 3NWTA 4IOAF 1MJAA 4PK4A 1DP7P 1HA8A 5JVTA 1R5HA 3JCUC 4ETSA 5K5RA 4ESFA 2L9VA 4E7HA 4HOBA 3LA2A 2AHQA 5CVVA 3DTIA 3MFKA 4XICA 1L3LA 4CCNA 3WTWC 1KA8A 2NYXA 3TEDA 1FX7A 1KQ8A 2NS0A 3KEQA 5GAGJ 3QYFA 3ERED 3CP2A 4BXFA 2R3SA 4S05A 4UB6C 3LSRA 2NS7A 1HKSA 2RDPA 3HC7A 4AIHA 1EA3A 4HF1A 2MD5A 2M30A 2BEOA 2CW8A 2HQRA 1SFEA 2Q2EA 2M8GX 2RQPA 3VYUB 4E70A 2NNNA 3RIRA 3OL3A 3ZMTA 4U88A 1EH6A 4IKFA 5FO5A 3BQYA 4ZJZA 4BH9A 4YFXF 1WSUA 4HF0A 4D0PA 4ZDPA 5LGUA 2MA3A 4E7SA 2V1XA 3BR1A 3CQZJ 2LBFA 3JRBA 5E79C 1ZKGA 5LBQA 2OAZA 1O3QA 2UV1A 5DS9A 3CP8A 3TDUC 2STTA 2AXLA 1W5CC 3U1KA 2DW4A 1X1AA 3VYRB 4BJTA 3IRRA 4ZTJA 2V7FA 2D45A 5GPCA 4OIPF 2JA6J 3KYCB 1AA7A 3OYHA 4Z2YA 1LQ1A 1FTTA 2VBWA 4B09A 3L2QA 2ZCWA 2WAQA 4I02A 3HPHA 2W57A 5JLXA 2DTRA 4AC0A 1FY7A 2EV0A 2JPBA 5GAHJ 1BOAA 4NC8A 5EZHA 1MW7A 4BDZA 2NOGA 2FBIA 2FE3A 1ON1A 3C2HA 1REPC 1BIAA 1IRFA 3AKZA 2QVOA 4OAZA 1MNMC 2RGVA 2ZMEC 1XN7A 2LDUA 5EGOB 4GXOA 1YITI 2QM3A 4MEXF 1D1CA 2EIMH 2VJ4A 3J81Z 1T0FC 1YJNI 3ABLH 1UMQA 2B63J 4UV9A 4XIDA 3J80K 3WHCA 1SVOA 3BTIA 1LEAA 3LSJA 1XGNA 3VB2A 2KJBA 3PUFA 5JVGF 1SMYF 3IAM2 2TRTA 2KIFA 3HEFA 3L7WA 4B1RA 3HTUA 2DMQA 3OYCA 3OYAA 3PO3J 5IYCJ 4U7BA 2L3DA 1J2XA 4ZH4F 4HLXA 1YOVB 5FRNA 3VPRA 1W7PB 4LMYA 5EF6A 1LDDA 3WTVC 4J19A 1XTAA 3KYLA 3R61A 2IA2A 3SZGA 4EM1A 4MFEA 2ZXWH 1G2HA 1P9QC 4YFNF 5B1BH 2VONA 4X6AJ 2R7DA 4PZJA 1X58A 3ASNH 4XSZF 3KP2A 2HTSA 4RS8A 5DTDA 1W36C 2RNJA 2GZWA 4UUTA 2IS4A 4WX9A 4KT6A 3F8CA 2E5NA 2M3AA 3ZQIA 1U3EM 4KITB 1R22A 3FM3A 1LPQA 4M72A 4BL0B 3H5NA 4BE0A 2YR2A 1FYKA 3PIOF 3WHBA 3S15J 2R93J 2QYOA 2IGMA 3HSRA 4ITVA 5FRMA 1Z1DA 3RDIA 1R58A 4B47A 2ID3A 3HRMA 4UUSB 1BR2A 1T33A 4B44A 1QBJA 5IY5H 4FETA 2P5VA 5HNFA 4OIOF 3HPGA 3KLSA 4EJTA 4B3XA 1IW7F 2A73B 1FYLA 3TO7A 1RPWA 2DA6A 3ABKH 2XC7A 2EPFA 2COBA 4PGGA 4C2UA 1ITYA 5ILVA 1D0YA 1IRZA 1MMGA 2QF7A 2JA8J 2DAOA 3OIOA 2WB1N 2PLYA 1N77A 4A0YA 3B6AA 4XMYA 2LC2A 4BXUA 1LNWA 4F7ZA 3KZIC 2K9QA 3CC4I 2YUSA 2EQRA 2JWTA 3MD2A 2DU9A 4BEHA 1PUFA 2HXOA 5L3CA 2VQHA 2LK2A 2GOMA 2KPMA 2IS1A 2JT1A 5C3EJ 1Z9CA 3I4NJ 3CMMA 2KKOA 2TCTA 5CVRA 5B66C 3PO2J 5D8LB 1R23A 1JJ6C 1BJZA 4ENMA 5JHFA 2KQRA 3J7AY 4FCYA 3SZTA 3WU1B 3L2WA 3ONQA 1IXSB 2GXAA 3J7YJ 5E20A 3CCQI 5B3SH 4LIUA 2VC1A 3H0GJ 3SHFA 1HSTA 4E6KG 3EPZA 2AXTC 3H3VK 2XB0X 2LRDA 5DD4A 2F4OB 3W2AA 2LYCA 3HOWJ 2OQRA 2Z3YA 1QO0D 2Z9OA 2R7SA 4IQ4A 5GAEJ 5JR3A 2J5PA 3BROA 1K6YA 4AVZA 1J59A 1UCRA 3J80Z 1HF0A 5CYVA 3K69A 1OYIA 2ZXJA
chains in the Genus database with same CATH topology
2P0WA 1G59A 4NQWB 4XLAA 5CKTA 5FROA 5CPRB 4F3QA 3HUGB 3H9GA 2CMPA 4AU7A 4RM3A 3S93A 2OC6A 4BDYA 4RMNA 1WJDA 4IZZA 4GRIA 1UAAA 2RNGA 3SEQA 3QYEA 2IGOA 2KRCA 2WB1A 2VASA 2IGNA 2BW3A 2V9KA 2ELJA 4CCKA 2LY2A 1MNDA 2X1DA 3L2RA 3IUOA 3OYBA 4BQQA 2WA0A 3LSMA 3PFYA 3OS1A 2WY8Q 3DPUA 4Y3OA 2LY1A 4XL9A 2XSJC 2KP6A 3DTKA 4PSXA 4HG2A 2VQGA 3K10A 4ANJA 4XM3A 4H4KC 1X19A 4YEJA 3TL4X 4F93B 4XN0A 4DIQA 2FUG2 4LIVA 4E7LA 4NC7A 2VJJA 1WJCA 3LSGA 3I3LA 3OYMA 2HVRA 2R4GA 1WJBA 3W2VA 2PMZA 1V5GA 4ZDLA 3CZ6A 2W4SA 3MKWB 2M0MA 3PNTA 4XKCA 2PJRA 3RSNA 3PUBA 4HEA2 4II2A 4HSRA 2A5WA 2V26A 2VIXA 2PJRB 4C9YA 3EUKL 4XLFA 2K9MA 3ZXSA 3LSHA 3SEZA 3DLAA 2WAFA 2MD0A 4RLQA 1NG6A 4BGDA 1OLTA 4LG3A 1T95A 5KNLA 2R7OA 2AQEA 1U0JA 2CV1A 3BC8A 3A1YA 3OIPA 3AL0B 3K6GA 3H0DA 2WAEA 4PSWA 1JI8A 3CF2A 3OYGA 2JUGA 2VPLA 3QOEA 2IXSA 4CZCA 2HU9A 3HKZA 2JVGA 2Q1ZB 3DTEA 2CUZA 3MKYB 3FKJA 2ZXIA 1J09A 3DEEA 4QPQA 4XOTA 3OWTA 3KX2A 3E1SA 4YELA 3DKYA 4KJZA 3H5AA 4BEHB 3S3OA 1YX5A 2W1OA 1WJEA 2X1EA 2VQLA 2JSPA 1ZELA 2WADA 2OV7A 2HDWA 2DOAA 3D5RC 2DCEA 4XOPA 3K4LA 4E7ZA 3HOTA 2MYSA 4CH7A 2M7AA 4Y4RA 1N75A 2Z16A 3S3MA 4XLCA 3FHNA 1GLNA 3DKXA 3SYTA 3OYEA 1Z7LA 4F52A 3QYBA 2KRHA 2KHMA 4HSTA 2X6WA 3OYIA 1PJRA 2L5QA 1BR4A 1X1DA 3NWSA 4XKWA 3RTRA 4XLEA 3IAS2 3OYKA 2JVHA 4JQFA 4HNTA 4E7JA 3GBGA 3K4CA 2R7RA 2ZSIB 1QU3A 3H5RA 4CSWA 4XLHA 4PJMA 4DJAA 4C2TA 4XQFA 2I8DA 1V5FA 3OYFA 1D1BA 2HZDA 1DQUA 3N05A 4KISA 3PL8A 4OWRB 2CS3A 4HNUA 4DGWB 4HRIA 4FASD 2CV2A 4B48A 4CCLA 4N4NB 1BOBA 3D5LA 1LKXA 2M4GA 3K4NA 2KDOA 4BE1A 2LOOA 2QKMB 3A4CA 3QODA 5LD2C 5HNHA 2W00A 2BW3B 4XN3A 3HOSA 3M8JA 4B43A 2RQQA 2VL8A 4XONA 4BJ6C 1MMAA 1NG7A 3EUHC 2X51A 5HVQC 4R79A 3OYJA 2R7WA 2RREA 1W36D 4BACA 3OYDA 4D1QA 2LH9A 2HNHA 4IX7A 1FMWA 1UELB 2K5CA 3PSFA 4DBQA 3PSIA 2BOLA 4E7IA 2NOJB 2X6XA 1FMVA 4ZYAA 3OS2A 3VWBA 2DJIA 2R7UA 3BCBA 4BU2A 2VLAA 2CUJA 1D1AA 2MC4A 4XR6A 3RQ4A 2L2OA 2XAUA 2L9NA 3DPTA 3DQVC 3OR2C 2DT7B 1R6RA 1SFKA 4N4OB 1DGRM 2LG4A 3DWLE 3MMYB 1BR1A 3H35A 3W3CA 2E1MC 2F6CA 1S9HA 2WY7Q 3NWTA 4PK4A 1HA8A 1Y56A 2CH0A 2HPIA 2ZSHB 1LDKB 3HL2A 3UR3C 3I9V2 4E7HA 3PJRA 4XKVA 2XF5A 3DTIA 4PFOA 2V4JC 4CCNA 4CUGA 3PNVA 4BJ5C 3VYTB 3DU6A 3RCOA 1Z21A 3QYFA 3CP2A 2CW7A 2UWMA 4BXFA 2Y0SA 2DXIA 3HC7A 5KCMA 1QHGA 4J00A 1EA3A 1MMNA 2CW8A 3OL4A 2R7VA 1WJAA 3CJQB 3K70D 3VYUB 3K4KA 2UUZA 1D0XA 3L2UA 2ZFUA 4FXGB 3OL3A 4E4HA 4G6TB 3K4MA 4NNJA 4MLOA 2Z2SB 4C30A 3V42A 4IKFA 2X85A 4ZJZA 1Z3YA 4XORA 3OIQA 4ZDPA 4BQNA 2VKDA 4E7SA 2LBFA 1V5EA 2UV1A 3M1CA 2LBFB 3CP8A 1VZ0A 1TZLA 3OR1C 1X1AA 3OOUA 3VYRB 4BJTA 4ZTJA 2V7FA 3LSIA 4BQOA 3OS0A 3LSKA 2HQAA 2JA2A 1AA7A 3OYHA 3C2GA 2ZXHA 3FBNB 1QHHD 1G8XA 3L2QA 3L2VA 3DU5A 1X1BA 2WAQA 5CQEA 4CCMA 1YX3A 3HPHA 3LFUA 4CA0A 1X4OA 4DOZA 2XDVA 2KMUA 4BDZA 4HPQA 2HVQA 4NC8A 1MW7A 4JOMA 3C2HA 2VQCA 1PYVA 3AKZA 4OAZA 3HG9A 1IRXA 4XKBA 3TMOA 3VSKA 5CQGA 3S3NA 4OAYA 1D1CA 2VJ4A 2VB6A 3AFHA 1T0FC 4U87A 3MKZA 3KEYA 1UG0A 3TBIA 3HXLA 4PJJA 4PJLA 4EATA 2E5ZA 3LL7A 4PUSA 2VXZA 2VJIA 3S8PA 3IAM2 3ZGKA 2CV0A 3VYSB 3FDYA 1WJ5A 3OYCA 3OYAA 3DPLC 2L9SA 3BG7A 4U7BA 2BVMA 1LFPA 5FRNA 2LREA 4ZTFA 2XF7A 2KLOA 2XF6A 3K4JA 4NUBA 3KYLA 3ZRGA 3SZGA 4BE2A 1P9QC 3F9KA 3UNGC 1WJFA 2CFOA 2O5RA 2KL4A 5JPMB 3BLYA 2VKHA 2R7QA 3SDBA 2K3PA 2R7TA 4RM2A 2MABA 4BUPA 4ZDOA 3ZCOA 1W36C 2K9LA 2IS6A 2MFZA 4P1WA 3H9QA 2IS4A 4KT6A 2HPMA 1SAUA 2E5NA 2M3AA 2F4IA 1Z3XA 4KITB 4BL0B 3H5NA 1D0ZA 4BE0A 3K4BA 2R7XA 2IGMA 4ITVA 3VSLA 5FRMA 3BCAA 4B47A 4X0GA 3PNYA 3E0JB 1X4PA 5HLTA 1WFXA 4J01A 4ZC3A 4P5OA 1BR2A 3H9JA 3AL0C 4B44A 4D9JA 2A6TA 5TGTA 3IP4B 2V6EA 2E1MB 4LITA 4PFPA 4FETA 3S32A 1DP3A 4F91B 5HNFA 3OYLA 3HPGA 4II3A 2W7NA 1MMDA 4B3XA 2F5VA 2E60A 3LMMA 1OR7C 1YE9A 4XNFA 2XC7A 4IQJA 2AQFA 2M7BA 1E0EA 5KHDA 4C2UA 2W82A 3ZQQA 1D0YA 2VJ5A 1MMGA 2Q2EB 3EUAA 2L7KA 5HOOA 3CJRB 2HVSA 1TT0A 1X1CA 4CCOA 1N77A 3OY9A 4XMYA 2LC2A 4RLFA 3VDXA 4F92B 4CCJA 2KZVA 3BG6A 3D5SC 1N78A 3CESA 4YRVA 2QKLB 3MD2A 4BEHA 2VXDA 2VQHA 2IGKA 1MNEA 2GOMA 2KPMA 2IS1A 2Z1DA 3CMMA 1ERDA 4BS9A 4Y33A 3ZR8X 4DBRA 2WBMA 2KQRA 2BVLA 5JHFA 2X1CA 3J7AY 3L2WA 1LVKA 1DGWY 3ONQA 2IS2A 4AYBA 3K70C 2GOXB 2OUMA 3G2BA 4LIUA 5LFAA 3W2WA 4E6KG 4E7KA 3FBIB 3EPZA 1Y6IA 2LRDA 2M4KA 3W2AA 2LYCA 3OMYA 2X6YA 3U21A 2DT6A 3RPUD 1KONA 4IQ4A 4F55A 2R7SA 1K6YA 4AVZA 3A2KA 2V1NA 3OYNA 4PJNA 4QPOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VDX A;  4IQ4 A;  4ITV A;  1EA3 A;  5CQE A;  4D9J A;  3MD2 A;  1AA7 A;  4PUS A;  2Z16 A; 
#chains in the Genus database with same CATH topology
 2JRT A;  1G59 A;  4NQW B;  4XLA A;  4ZYD A;  1U78 A;  5CPR B;  1OIS A;  3HUG B;  3H9G A;  3SZP A;  4AU7 A;  1RRJ A;  4G6D A;  1WRJ A;  4RM3 A;  1G4D A;  1WJD A;  5K7Z A;  1UAA A;  3QYE A;  5C4X J;  2IGO A;  3F6V A;  4JBA A;  1LFU P;  2IGN A;  4FIS A;  1FBS A;  2ELJ A;  1Z0X A;  2J5O A;  3LAJ A;  1ZGJ A;  3VFZ A;  1B72 A;  3L2R A;  2COM A;  3PFY A;  4MFD A;  1MGT A;  1S8N A;  1A6Q A;  4V2F A;  4Y3O A;  2P5K A;  2XSJ C;  2IP2 A;  3HIF A;  2DTZ A;  3KPH A;  1YFH A;  2KDZ A;  4FHT A;  1X3W B;  4GO1 A;  4IRG A;  1OJL A;  4KUM A;  4ANJ A;  2ZNY A;  5EG0 A;  3I0T A;  5LGT A;  3G1O A;  4I01 A;  2HEO A;  3GTG J;  4XN0 A;  2IJL A;  2FUG 2;  4LIV A;  3DCF A;  3M8E A;  5EYR A;  2VJJ A;  1HLV A;  3E5Q A;  3LSG A;  3OYM A;  2OTL I;  1XD7 A;  3L2C A;  1GUU A;  1WJB A;  2X48 A;  2BV6 A;  5LLQ A;  2HZT A;  3M1E A;  4A3M J;  2XRL A;  1B8I A;  1VI0 A;  2Z99 A;  1WWX A;  1A5J A;  2Y75 A;  1MDM A;  1XSX A;  2M0M A;  3HZJ A;  2PJR A;  3PUB A;  4HEA 2;  1OMI A;  2D1H A;  2M2E A;  3HRS A;  2Y2Z A;  3N97 A;  3HYI A;  2K9M A;  1S29 A;  3QWL A;  3F0C A;  3LSH A;  4HBL A;  2EH3 A;  2K9N A;  3Q9V A;  2MD0 A;  4NBQ A;  3DLL F;  1NG6 A;  4A3I J;  4DYQ A;  4UB8 C;  1RR8 C;  1JXS A;  1Q1V A;  2AQE A;  2CV1 A;  1ZG1 A;  3BC8 A;  3A1Y A;  1BN5 A;  1JJ8 C;  3AL0 B;  2WAE A;  2A69 F;  1XGS A;  1LEB A;  3CF2 A;  3OYG A;  1EKE A;  2JK3 A;  1GXQ A;  3GZ5 A;  3VEP A;  2B0L A;  2VPL A;  1BL0 A;  1RC9 A;  3PM1 A;  4CZC A;  5LRS A;  3WTS C;  5J8C A;  2JVG A;  4RAG A;  3WTX C;  2YX4 A;  1OR7 A;  3P9K A;  3HGG A;  1OPC A;  1S6L A;  3QU3 A;  4QPQ A;  2FF4 A;  2OCE A;  2L0K A;  2K86 A;  1D8K A;  2WWY A;  5K5O A;  5E1W A;  2ESN A;  4KJZ A;  3S3O A;  1YX5 A;  3FMQ A;  2W1O A;  4I0A A;  2X1E A;  3ZPL A;  2JSP A;  3Q3S A;  1BI1 A;  3H36 A;  2ADU A;  2HDW A;  1HW1 A;  3COA C;  3HSE A;  2PX9 A;  3K4L A;  4IJA A;  4E7Z A;  3HOT A;  4AD9 A;  2M7A A;  2JJ7 A;  3S3M A;  2L01 A;  3FHN A;  3OYE A;  1X1P A;  1Z7L A;  3I53 A;  3QYB A;  1KYZ A;  3T5X A;  1UJ8 A;  2ZJR F;  2R92 J;  4EGZ A;  2RAE A;  1PJR A;  2NVU B;  1X1D A;  3RQI A;  1ZGW A;  4XLE A;  4RAF A;  2JVH A;  1QU3 A;  1LJ9 A;  4WF2 A;  3HOU J;  4HYE A;  1QVU A;  4A2U A;  1ZRD A;  1A36 A;  2FBH A;  4DJA A;  4C2T A;  2MH2 A;  1U9O A;  2OU2 A;  2IA1 A;  1D1B A;  4HW5 A;  4A93 J;  1DQU A;  2F5C A;  1DDN A;  4M3D A;  1FBQ A;  4L0Z B;  3P9C A;  2VT3 A;  5TIS C;  4FAS D;  1ZAO A;  4CYD A;  4CGZ A;  2VOO A;  5E3O A;  2CV2 A;  4RAZ A;  1R36 A;  5EDN A;  4IRI A;  1SFU A;  4FE4 A;  1XS9 A;  1P7J A;  2ZME B;  3D5L A;  1A35 A;  2KIU A;  1VQ8 I;  4ESB A;  3FIS A;  5LRR A;  2M4G A;  5IT3 A;  2NAZ A;  2E19 A;  4NB5 A;  5EGO A;  5DCF A;  4BE1 A;  2CUF A;  2QKM B;  4CZZ A;  1I27 A;  1K6O A;  2G0E A;  1K83 J;  3SFZ A;  5HNH A;  3MZH A;  1I39 A;  2DYR H;  2BW3 B;  1YRN A;  2QBY A;  1MBJ A;  5IT9 K;  3S2H J;  1MMA A;  1TLH B;  2QQB A;  3EUH C;  1FOX A;  2LF8 A;  4Y7N J;  5HDN A;  5J4Y A;  1MSF C;  2PQ8 A;  2LH9 A;  2MLK A;  2M8E A;  5ICF A;  5GAD J;  3Q0V A;  3JSP A;  2OBP A;  3S1Q J;  1W7P A;  4E7I A;  1BW5 A;  2E36 A;  3H3Z A;  3CUQ C;  5H2F C;  4B3A A;  3W6K B;  4L5I A;  1TWF J;  3M07 A;  4MIM A;  1FP1 D;  3DKW A;  5IP6 A;  3IRQ A;  3AAF A;  3O8H A;  2R7U A;  3IKV A;  3IH4 A;  3I4P A;  1FNN A;  1W4M A;  3V8J A;  1T56 A;  2VLA A;  2DFE A;  2FD5 A;  3ML6 A;  1D1A A;  4LGW A;  5B5E C;  2MC4 A;  1I3A A;  3DEW A;  1WVR A;  2CQK A;  2L2O A;  4OIR F;  2FOK A;  2XAU A;  4Z6Y A;  2P6T A;  2DT7 B;  3QPL A;  4P55 A;  1F4K A;  1R6R A;  1WGX A;  4QTR A;  1N25 A;  4DW6 A;  2DJN A;  1SMT A;  1VTN C;  1DGR M;  2LG4 A;  4KIC A;  2DA4 A;  3MMY B;  2WAQ N;  1HW2 A;  1IN6 A;  3KP6 A;  2L4A A;  2OZU A;  1ZRF A;  2WY7 Q;  3ZN1 A;  3ULQ B;  1ZHF A;  5FLV A;  1RNL A;  2UXN A;  3UR3 C;  4EM2 A;  4XKV A;  1YJ9 I;  3GF2 A;  4ENJ A;  2DN0 A;  2V4J C;  1JKQ C;  1GV5 A;  3E6D A;  3DU6 A;  3L9F A;  2PN6 A;  4PGH A;  5F08 A;  1Z21 A;  4G7Z F;  1YG2 A;  3KP4 A;  4AVP A;  2L54 A;  3LAP A;  2CW7 A;  2UWM A;  2Y0S A;  3HRU A;  1O4X A;  4M6V A;  1FZP B;  4J00 A;  1GXP A;  1QHG A;  5KK1 A;  3CU7 A;  4QLC U;  4YIR X;  4IHX A;  3C7J A;  1D8J A;  1HXD A;  4G12 A;  1XCV A;  3CJQ B;  3N4M A;  3K70 D;  1RUO A;  3K4K A;  2UUZ A;  4BHC A;  5FD6 A;  3G4S I;  2ZFU A;  3G73 A;  2NVQ J;  2K7L A;  4FXG B;  4DYC A;  4P9U A;  1MBF A;  2RKH A;  3WTU C;  3V42 A;  2DDB A;  1NK2 P;  2CQ7 A;  1OCZ H;  4A5M A;  1TQP A;  5F0F A;  2Q8K A;  3GTJ J;  4XOR A;  4RDU A;  5M5Y J;  1RI7 A;  4ENK A;  2QSH X;  4LG0 B;  1BI2 A;  2VKD A;  2XGE A;  2EIJ H;  2ELK A;  4OIN F;  1FJL A;  4IEJ A;  3EET A;  3Q0W A;  3AG2 H;  3LNQ A;  1UHM A;  1PUE E;  2E2I J;  4CYC A;  2VBY A;  1I1S A;  4UVC A;  3KLN A;  2DA5 A;  4P96 A;  3U9G A;  3P9I A;  3OS0 A;  4IHS A;  1SAN A;  2JA2 A;  4IL6 C;  2ZO4 A;  3C2G A;  1CFA A;  5AON A;  1K78 B;  2HKX A;  1Y8R B;  3L2V A;  1XC5 A;  1G3S A;  1O7L A;  1X1B A;  2MBF A;  2P81 A;  1JKO C;  3LFU A;  4YII A;  1Z6R A;  4CA0 A;  2KMU A;  1A6I A;  5IT9 Z;  1U9N A;  1TWH J;  2DA1 A;  4MNU A;  3CMA I;  2P7V B;  2FRH A;  3F8B A;  2VQC A;  3IL2 A;  1WH7 A;  4NQW A;  5ICG A;  4RGX A;  1X3U A;  5D5X B;  3HUG A;  5D4R A;  4UNO A;  2RVC A;  3HG9 A;  1LB2 A;  1IRX A;  1A31 A;  1W5S A;  1W7P D;  5JLW A;  3CD6 I;  5FD5 A;  3S1N J;  1VQN I;  1ODD A;  3AFH A;  3KEY A;  1UG0 A;  3TBI A;  3F21 A;  1GHC A;  4UUV A;  4EAT A;  1QVT A;  3LL7 A;  4PUS A;  2XUB A;  4ZZL A;  2H8W A;  4LOC A;  1NK3 P;  2VJI A;  1FSE A;  2QUF A;  3FDY A;  4NHJ A;  4C3J J;  3CCE I;  4BNC A;  3DPL C;  4B4C A;  1G3Y A;  2CRG A;  4ON0 A;  1HQC A;  1OCR H;  1XMK A;  1DU6 A;  2OA4 A;  2MGQ A;  3TDZ C;  2XF6 A;  5J4V A;  1ZRE A;  1HW5 A;  2KFD A;  2Z33 A;  2W24 A;  4L9T A;  1AU7 A;  2CWE A;  1MKM A;  2BY0 A;  1TTY A;  3BLY A;  2VKH A;  5E3M A;  2Y9Z A;  3FMS A;  2K3P A;  1WI3 A;  1Y1V J;  3AG4 H;  1T2K A;  2MAB A;  3HOX J;  4HQE A;  1XX5 A;  3AG1 H;  2MFZ A;  5CVU A;  5AIQ A;  2HPM A;  1SAU A;  2BYV E;  3RYR A;  1Z3X A;  2EZH A;  2KT0 A;  2DK8 A;  3E7L A;  3GTK J;  5DD8 A;  3HQA A;  4LJZ F;  2QGU A;  3NAR A;  5E18 F;  3BCA A;  4X0G A;  4ABZ A;  4H0E A;  2DDA A;  2FXA A;  2MH9 A;  4P5O A;  3AL0 C;  3EYI A;  3GLX A;  3G71 I;  2A6T A;  5L3B A;  5TGT A;  3JRI A;  4KDP A;  2BGC A;  2EFP A;  4PFP A;  1DP3 A;  4OU0 A;  4F91 B;  3B6C A;  3OYL A;  4II3 A;  3E6M A;  1AOY A;  2F5V A;  1V3F A;  1UFM A;  2EA4 A;  4XNF A;  1BW6 A;  2AQF A;  2I5U A;  5TRD A;  1IDY A;  5KHD A;  4BBS J;  2ELH A;  2ZKZ A;  3ZQQ A;  3KYD B;  4LB5 A;  1YQA A;  5LHI A;  2GA1 A;  5HOO A;  2FNA A;  3I59 A;  4KT5 C;  1HBX G;  1VQ4 I;  3CCJ I;  1P7I A;  2F5F A;  4ESJ A;  4CCO A;  2XGC A;  1IN5 A;  4BXX J;  2R7F A;  2Y9Y A;  4F92 B;  1K4T A;  2JA5 J;  2BBY A;  2KIQ A;  2FEZ A;  4YRV A;  2QKL B;  1D5V A;  1Z7U A;  2Y0M A;  4WB2 A;  1KQ9 A;  2IGK A;  2O8K A;  1JE8 A;  2Z1D A;  3O6B B;  2F4M B;  2FMY A;  3K1P A;  4BS9 A;  4Y33 A;  2XPW A;  3ZR8 X;  3M3Y J;  1IN7 A;  2E71 A;  2EB7 A;  2WBM A;  2DK5 A;  1VQ9 I;  1Z05 A;  3CC7 I;  2XKP A;  4PCQ A;  4JX4 A;  3OSG A;  2OUM A;  2HGC A;  2DMU A;  2K02 A;  3BPX A;  4Q47 A;  3W2W A;  3E3V A;  3FBI B;  2V1D A;  3BP8 A;  5D4S A;  1O3R A;  3C3W A;  3HSF A;  1HSJ A;  3ZMS A;  3GLL A;  3G3Z A;  4K2E A;  1TW3 A;  4F55 A;  4Y13 A;  3KET A;  2O9L A;  4PJN A;  3JRA A;  1R4M B;  4QPO A;  5FRO A;  1T38 A;  3FM5 A;  2E1N A;  2HTJ A;  2NVX J;  3BR2 A;  2CMP A;  5EEG A;  4AIJ A;  3ZMZ A;  2P6S A;  2DMN A;  1MZB A;  1I5Z A;  4RB3 C;  1TL8 A;  3S93 A;  3D1N I;  1AKH B;  5IYD J;  1DU0 A;  2ZME A;  4RMN A;  3O2P E;  5DCM B;  3SEQ A;  3G6E I;  1T0F A;  4CHU A;  1IJW C;  4HWJ A;  2XAG A;  3E97 A;  3MZ8 A;  1JUP A;  3GO5 A;  2DFF A;  2VAS A;  5K1Y A;  3I55 I;  2BW3 A;  3SQN A;  1H8A C;  4BY7 J;  4HQM A;  3WGG A;  1R00 A;  1YW8 A;  2X1D A;  2EZK A;  1HKT A;  2W25 A;  3OYB A;  4OMY A;  4BQQ A;  4RB0 A;  3V7R A;  2P7C B;  1P6R A;  2M45 A;  4NDL A;  5J47 A;  2A3S A;  4XL9 A;  3CUQ B;  5E1Z B;  5GTI C;  3LSP A;  3WG7 H;  2VQG A;  4A3C J;  4H4K C;  3QQA A;  2DT5 A;  3V4G A;  4DZJ A;  1SFX A;  4LLN A;  4XRM A;  1WHU A;  3RZO J;  1HCR A;  4E7L A;  4DZP A;  5ED4 A;  1XSD A;  3ZMV A;  3I3L A;  1STZ A;  3CCS I;  2K85 A;  2R4G A;  2ESH A;  3A01 B;  4BKX A;  2BY1 A;  1OCC H;  2YSR A;  4A3D J;  2PMZ A;  2PMU A;  1VQO I;  1RR7 A;  3CZ6 A;  1UST A;  2X6O A;  2HWV A;  1T39 A;  4AIK A;  4HSR A;  3FKI J;  3ZN0 A;  1U8R A;  2V26 A;  3FZV A;  4AWX B;  4C9Y A;  3EUK L;  2LKP A;  2R5Z A;  4PJ0 C;  1TQI A;  4JX5 A;  3T8T A;  4BQA A;  1W5T A;  2ZC2 A;  2V9V A;  4JX6 A;  2EIL H;  4M71 A;  4LG3 A;  1T95 A;  2ME6 A;  3U2R A;  2QWW A;  3K6G A;  2LMD A;  4EVI A;  2AS5 F;  5B1A H;  3LA3 A;  5J40 A;  4UVB A;  3QOE A;  5HS7 A;  2CU7 A;  2IXS A;  1ZYR F;  2HOA A;  5HLI A;  2V1U A;  3GZ6 A;  2E1C A;  3MKY B;  1ZAR A;  3HOV J;  3WTZ A;  1TWC J;  3L09 A;  1E2X A;  3B02 A;  3OWT A;  2LY9 A;  3OSF A;  2JZY A;  1VQ6 I;  5BPD A;  3KP7 A;  4DNC A;  3H5A A;  3HBL A;  1EH7 A;  2XB5 A;  3GTQ J;  2R5Y B;  2HYG D;  1IN4 A;  3REO A;  2P4W A;  3CO7 C;  1VQ7 I;  2UXX A;  2W48 A;  2WAD A;  5EZG A;  1LE8 A;  2DOA A;  2LSO A;  4I6O A;  2JPC A;  2DCE A;  4PDK A;  3FWE A;  3WE3 A;  3HTS B;  3JTG A;  3TW6 A;  3A0B C;  5AIP A;  3I5U A;  5HLG A;  1ZH5 A;  2DQR A;  5K7H A;  1B1B A;  3OYI A;  2L5Q A;  4IF4 A;  1BR4 A;  1FPQ A;  3NWS A;  4HX7 A;  3RTR A;  1R71 A;  1OCT C;  3I58 A;  4HNT A;  2L7Z A;  1MBK A;  1QZY A;  1XMX A;  3UKG A;  4CSW A;  2O03 A;  3JRF A;  4UU9 C;  2ZFW A;  2CQN A;  2CW0 F;  1J9I A;  3M9A A;  4PJM A;  4A3L J;  1T6S A;  2FBK A;  4A3G J;  3G1L A;  3OYF A;  2FQ4 A;  2HZD A;  4HZF A;  5F0C A;  4IHT A;  3ABU A;  2CS3 A;  4W97 A;  2VE8 A;  1U6G A;  4A0Z A;  2RN7 A;  2BXZ A;  3Q9S A;  3WGH A;  2D1V A;  2XVC A;  3GFI A;  2XAS A;  1LKX A;  1T98 A;  3LST A;  1FSH A;  3DF8 A;  4L5E A;  3FXR A;  3K2Z A;  2C6Y A;  1MH3 A;  3FXM A;  1B9N A;  3A4C A;  3QOD A;  3JSO A;  1OQY A;  1P4A A;  2W00 A;  3C1D A;  1X3Z B;  4IVN A;  4N0B A;  3M8J A;  1ZG5 A;  3LQQ A;  3WOD F;  3RZD J;  2VE9 A;  1S3J A;  2XAH A;  5F04 A;  2YX7 A;  2VOP A;  3OYJ A;  2R7W A;  2Y0S N;  5LHH A;  4FXK B;  2QQ8 A;  2RRE A;  2ZJQ F;  2DBB A;  4OIQ F;  1W36 D;  2XKO A;  2IEK A;  1FMW A;  2K5C A;  3PSF A;  4DBQ A;  5DV5 A;  1RES A;  4Q4Z F;  4HV6 A;  4V2G A;  1K4S A;  2E7X A;  1MIJ A;  3ZP5 A;  5F64 A;  3S16 J;  1BJA A;  4HA8 A;  4ZYA A;  3VWB A;  4R1H A;  3R4K A;  3RKY A;  4BU2 A;  2VT2 A;  4ZYE A;  1UHS A;  4P3B A;  4HLY A;  2ZNZ A;  3V7S A;  1JUM A;  4XRF A;  2L9N A;  5BMZ A;  4LLL A;  3SFI A;  2CO5 A;  3DPT A;  3OV8 A;  1C5A A;  2IPQ X;  5JPN B;  3BPV A;  2ME0 A;  2CYY A;  1SFK A;  2EFW A;  3T1B A;  2IRF G;  3DWL E;  1H9G A;  5J3L A;  1YW7 A;  3CCL I;  2TDX A;  4WCG A;  1S9H A;  3DEU A;  2NS8 A;  1JGG A;  3HHH A;  3FXK A;  3H3U A;  2UZK A;  1QZE A;  1LDK B;  3FXQ A;  4RGU A;  3I9V 2;  2DI3 A;  5ICE A;  2EZI A;  3BG9 A;  2NRA C;  3DBH B;  4G8X A;  4PFO A;  5L3D A;  2IVM A;  2D5V A;  1UG2 A;  2OQG A;  3F23 A;  3VYT B;  3B73 A;  3RCO A;  2EBI A;  1IV8 A;  1UB9 A;  4WXD A;  2O7O A;  3H1C A;  1F36 A;  5KCM A;  1U2W A;  4IHW A;  4XLN F;  4DYR A;  4LK1 F;  3KFW X;  5FLX K;  2WV1 A;  1Y39 A;  3ESW B;  3ECO A;  2A68 F;  1VQL I;  2R7V A;  1R5I D;  4HV5 A;  1FWZ A;  3L2U A;  1D0X A;  3NQO A;  4E4H A;  3K4M A;  3GYH X;  3M7G A;  1YW9 A;  3KP5 A;  1KQ0 A;  1YLF A;  3OIQ A;  5H6Q A;  3ZQG A;  4ZZD A;  1ZR2 A;  2B9S A;  2QQA A;  1YO5 C;  1V5E A;  4GYG A;  1VFC A;  4HAM A;  4KN4 X;  2LFB A;  1QPI A;  1QQI A;  1R4N B;  2LBF B;  3ZMU A;  1IAW A;  3FK7 A;  1VZ0 A;  1IUF A;  2LLK A;  1TZL A;  4A5N A;  3BR0 A;  3OR1 C;  3L00 A;  1HOM A;  2VOD A;  2HQN A;  4D7N A;  3LSK A;  2HQA A;  4LFU A;  1TT5 B;  3RI4 A;  2HR3 A;  2ZXH A;  1XSV A;  2K40 A;  1QHH D;  1G8X A;  3GXO A;  1GT0 C;  2NNY A;  5CQE A;  4CCM A;  1ZLK A;  4HF2 A;  2CJJ A;  3BTL A;  3MKL A;  3LA7 A;  1MJB A;  3TQN A;  1X4O A;  4DOZ A;  2XDV A;  3HDD A;  3GUD A;  2ZBK A;  3CDI A;  4JK1 X;  4C3H J;  4HPQ A;  2HVQ A;  2DPD A;  4IXA A;  2H1L A;  2JSC A;  2XPV A;  2O3F A;  3MAJ A;  4UVA A;  1E17 A;  3DBR B;  1KZH A;  1BC8 C;  2LD5 A;  1CF7 B;  2HYF A;  4V19 K;  3EYY A;  1G3W A;  3FX3 A;  4XKB A;  3VSK A;  5CQG A;  4OAY A;  1FC3 A;  2CFX A;  2VB6 A;  3MKZ A;  4IHY A;  4XRS G;  1JTY A;  3HXL A;  1BI0 A;  2M1B A;  4PJJ A;  3KEO A;  3IH2 A;  4FX0 A;  5DCM A;  3RPU A;  1W1W E;  2E5Z A;  4RBO A;  2PJP A;  3S8P A;  1O3T A;  5J1Y A;  4P9F A;  2MSY A;  3IH3 A;  2Y69 H;  3EUH A;  2XGX A;  1WJ5 A;  3VYS B;  2CV0 A;  1R1U A;  3O8G A;  3DXJ F;  3S14 J;  3BG7 A;  1OYY A;  2FOW A;  3R6S A;  2O0Y A;  3CME I;  4TV7 A;  2EFQ A;  3BT9 A;  2XF7 A;  2WC2 A;  4ZTF A;  1IC8 A;  2KLO A;  4G9Y A;  1B9M A;  3NRV A;  4BE2 A;  2GAU A;  1WJF A;  2CFO A;  2O5R A;  5BOX A;  2R7Q A;  2EFN A;  3SDB A;  2R7T A;  1R7J A;  2ZJ2 A;  4BUP A;  3ZCO A;  1TWA J;  1D3Y A;  1KU9 A;  2K9L A;  2IS6 A;  2XSD C;  3C18 A;  4P1W A;  3JR9 A;  1F5T A;  2GQQ A;  2BY2 A;  1R9T J;  5HS8 A;  2ECB A;  1XMA A;  2DOE A;  4FT8 A;  2PBI A;  4HX4 A;  5H20 A;  1D0Z A;  2QEX I;  2O6G E;  2HXI A;  3A02 A;  4I6Z A;  5KAF C;  2QLZ A;  5A2Q K;  4UUS A;  4I76 A;  3E0J B;  4BYY A;  1WFX A;  4J01 A;  2W85 A;  3H9J A;  2JRM A;  2A05 A;  5FLX Z;  2YPR A;  3P5J A;  2AO9 A;  3IP4 B;  3E6B A;  4GFB A;  4Q5S F;  3S32 A;  4KA4 A;  2F5D A;  2OF7 A;  1USS A;  1DPR A;  2E60 A;  2OD5 A;  2RC4 A;  3LMM A;  5HDG A;  4KFC A;  1UZC A;  1E3O C;  1P4W A;  3CO6 C;  3GW2 A;  2K27 A;  4BHP A;  1XCB A;  2DFH A;  5HS9 A;  1E0E A;  2W82 A;  2XAJ A;  3CDH A;  1WZ2 A;  2VJ5 A;  2B7E A;  1NTC A;  2L7K A;  1XDU A;  2CQQ A;  3CJR B;  4MQ9 F;  2HVS A;  1X1C A;  1ZK8 A;  5F0H A;  4U7D A;  1FOW A;  3WU0 A;  4A3F J;  4GDF A;  2XHK A;  3OY9 A;  3QPT A;  3DBL B;  3T8R A;  3VDX A;  4MHG A;  1PP8 F;  4WB3 A;  2KZV A;  3BG6 A;  3D5S C;  1YI2 I;  2JA7 J;  1R1T A;  5DDG A;  3CES A;  1TQM A;  4G7O F;  2CUE A;  4Y17 A;  1GVJ A;  1IUY A;  4W1U A;  3RKQ A;  1VQK I;  4RGR A;  2WV0 A;  3QP6 A;  1SVL A;  1ERD A;  5L3F A;  1Y0N A;  2LF7 A;  5F1J A;  4DBR A;  1IN8 A;  5LEK A;  2E34 A;  2YU9 J;  5BNG A;  2HDC A;  4AYB A;  3W6J B;  1RET A;  4EQQ A;  5L3E A;  2M9H A;  2JTV A;  4B8X A;  4E7K A;  5FKM A;  1Y6I A;  1KGS A;  2M4K A;  1DUX C;  2D2W A;  4L9V A;  2X6Y A;  5H6R A;  2BZT A;  5E3L A;  3VOD A;  3BJO A;  3ELK A;  2DT6 A;  3RPU D;  2PMZ N;  4D7M A;  1ULY A;  3Q0U A;  4I99 C;  1Z91 A;  2G9W A;  4MTD A;  5FFX A;  4O6J A;  5CKT A;  2Y48 A;  1PDN C;  2ACJ A;  3F8N A;  4F3Q A;  4A0X A;  1B6A A;  5FLM J;  2VC0 A;  5FKK A;  5DUK A;  4GCV A;  1WI9 A;  2E7W A;  5EJC A;  3ROU A;  5EEA A;  2W84 A;  3CCV I;  5B4P B;  2KJC A;  3TP3 A;  4A6E A;  2KIS A;  1SVM A;  2VBZ A;  1RKT A;  4FE7 A;  3WG9 A;  4ZYH A;  1MJ9 A;  1WPK A;  2F48 A;  4IZZ A;  3QU6 A;  3BTC A;  4GRI A;  2RNG A;  1TW2 A;  5JHU A;  2VUM J;  4U0W A;  4ZYG A;  4MGR A;  1WQ2 A;  3F8M A;  1X2M A;  2V9K A;  2R0Q C;  3J7Z I;  1ZR4 A;  2STW A;  4MQV A;  1WKM A;  5IPA A;  2E1O A;  2B39 A;  3OS1 A;  3C2B A;  4L5J A;  2FML A;  4WK8 F;  4EV0 A;  1K79 A;  3HHG A;  2GXB A;  2KP6 A;  3DV8 A;  4IRH A;  4PSX A;  1SAX A;  1TNS A;  4HG2 A;  2G7H A;  2GIZ A;  2EWN A;  3GME A;  1JHH A;  2NVT J;  3EQL F;  2L02 A;  2ISY A;  5A2Q Z;  3CLO A;  1YIO A;  2ZB9 A;  1BA5 A;  5FKN A;  4YEJ A;  1BM9 A;  4F93 B;  5EG0 B;  3TP0 A;  1U5T C;  1ZN2 A;  3T0Y A;  1AWC A;  3MEX A;  4EJO A;  4AM3 A;  2VBX A;  5FFZ A;  4XLP F;  3WU2 C;  3IKT A;  2IA0 A;  3W2V A;  1B4A A;  4L9J A;  1JKR C;  1V5G A;  4Q48 A;  1ZQ3 P;  2PG4 A;  5IOZ A;  3MKW B;  3HRT A;  3PNT A;  4II2 A;  1JKP C;  3PFI A;  2A5W A;  3GVA A;  1XGM A;  3IC7 A;  4G6Q A;  4BHB A;  2PJR B;  2DMT A;  4XLF A;  2X4H A;  3ZXS A;  1E3H A;  1FOY A;  2WAF A;  4RLQ A;  3BY6 A;  3NAU A;  3KP3 A;  2DQL A;  4BGD A;  2ZJP F;  5IOY A;  5KNL A;  3M8F A;  4JYK A;  1U0J A;  2L4M A;  3OIP A;  3BR6 A;  3H0D A;  1JI8 A;  4PSW A;  2VN2 A;  1I6X A;  1FYM A;  2H27 A;  2HU9 A;  3HKZ A;  3RYP A;  2Q1Z B;  2CUZ A;  4U0Y A;  3FKJ A;  3F6O A;  4HNV A;  3IWZ A;  1HDP A;  2R7Z J;  3V7C A;  4JP0 A;  5D5W B;  3BZK A;  4XOT A;  3ZQH A;  5HOD A;  1HC8 A;  1OKR A;  4UXN A;  5CLS A;  2P5L C;  3E1S A;  4YEL A;  2EA2 A;  3V8K A;  3K1N A;  3S17 J;  3I56 I;  2IBD A;  2EIN H;  2VQL A;  3SDG A;  1I6H J;  2OV7 A;  4Y15 A;  3HQB A;  1R5G A;  1V4R A;  4O3M A;  4XOP A;  3KIO A;  2HDD A;  1JGS A;  4Y4R A;  2PEX A;  4XLC A;  3DKX A;  3SYT A;  4C3I J;  2DYS H;  3H92 A;  4F52 A;  3TKY A;  4BAY A;  1FT9 A;  1MBG A;  2ICW G;  3Q5F A;  2KHM A;  4N9H A;  2XGD A;  4HST A;  2X6W A;  5M5X J;  1S7A A;  3CJT B;  3OYK A;  3FXJ A;  4XKW A;  4E7J A;  1YS7 A;  3K4C A;  3F72 A;  4A69 C;  2I10 A;  3RJP A;  4EMS A;  1L0O C;  3H5R A;  3J7A O;  5DUI A;  3FMR A;  5TJJ A;  1F43 A;  5E1X A;  3ZQF A;  1ENH A;  1TBX A;  1MMS A;  4XQF A;  2IAI A;  1V5F A;  3E6C C;  3JTH A;  3GZN B;  3PL8 A;  2K4J A;  4OWR B;  4HNU A;  4ENN A;  3HGY A;  3K7A J;  2Y31 A;  4M3E A;  3K1M A;  1PVE A;  1RKW A;  5FKL A;  5JI6 A;  2A5Y B;  4B48 A;  4EM0 B;  4OMZ A;  4CCL A;  1FP2 A;  4N4N B;  4U0V A;  1BOB A;  3TO9 A;  3CC2 I;  1VND A;  1BBY A;  3MQ0 A;  1LVA A;  3AG3 H;  1RUN A;  3A0H C;  1CF7 A;  1FTZ A;  4HX8 A;  4FTH A;  4Y52 J;  2JN6 A;  2KDO A;  2LOO A;  5D5U B;  3HOZ J;  5FJ8 J;  1G3T A;  2KZG A;  5D6F A;  1SEU A;  3HOS A;  3QOP A;  2RQQ A;  3CLQ A;  1YRN B;  2QBY B;  1A04 A;  2X51 A;  5HVQ C;  4R79 A;  5J1R A;  2A6H F;  3LOC A;  2JUC A;  5FGM A;  3WTY C;  2FSW A;  4BAC A;  3OYD A;  4D1Q A;  1VQP I;  1YIJ I;  2DA7 A;  1TP4 A;  1LUJ B;  1ETW A;  4D5F A;  4M74 A;  4DQ2 A;  1BI3 A;  2P8T A;  1GDT A;  3KZY A;  1FMV A;  3OS2 A;  4A3B J;  2DJI A;  3BCB A;  3GCM A;  3BDD A;  4I2O A;  1JTX A;  3A03 A;  2CUJ A;  5HDK A;  4BBR J;  3D0S A;  1ETK A;  1VQ5 I;  1O7F A;  1MBH A;  1JT6 A;  1S7E A;  1KU2 A;  4S0H B;  3JRE A;  2GLO A;  4KIG A;  2XRN A;  4XBF A;  1QPM A;  2H6C A;  3ISP A;  3BR5 A;  5KAI C;  4QSH A;  3OR2 C;  4XSX F;  5D5V B;  2HI3 A;  5C44 J;  1W0U A;  4N4O B;  4L18 B;  3CJN A;  3W3C A;  3BG5 A;  2F6C A;  2V6C A;  2N8G A;  1KYW A;  4CO8 A;  1Y56 A;  1Y0U A;  2CH0 A;  2HPI A;  5F27 A;  2ZSH B;  3HL2 A;  3PJR A;  2HOE A;  1VQM I;  1EH8 A;  2XF5 A;  1CQT A;  4CUG A;  3PNV A;  4BJ5 C;  2ECC A;  1LDJ A;  3OOP A;  1MSE C;  2WTE A;  3QRF F;  2JQ7 A;  4HDV A;  3QP5 A;  2DXI A;  3GX4 X;  5LEJ A;  2V9P A;  2JMW A;  1MMN A;  4IO9 F;  2FNP A;  3FXL A;  3OL4 A;  3CCM I;  1W0T A;  1WJA A;  1I3Q J;  3GTM J;  3LWF A;  2DLL A;  1K7A A;  5E8G A;  2OPT A;  2Z5U A;  4G6T B;  4KN7 X;  4NNJ A;  4MLO A;  2Z2S B;  4C30 A;  4M3B A;  1U8B A;  2CSO A;  2X85 A;  2VKV A;  4LG0 A;  1Z3Y A;  2VPR A;  1P92 A;  2FA5 A;  2QQ9 A;  3ZQ7 A;  4BQN A;  3L1P A;  4M9S A;  2A07 F;  3TOB A;  5F1R A;  3M1C A;  2NXN B;  2DOD A;  1J7K A;  1XDS A;  1H9T A;  1FIP A;  1Z77 A;  3OOU A;  4CYC B;  3HB9 A;  3LSI A;  4BQO A;  4KIB A;  2VKE A;  1K78 A;  1KU7 A;  2K4B A;  1FOK A;  4I09 A;  3K2A A;  3FBN B;  4UV8 A;  3DU5 A;  5JFR A;  1YX3 A;  1BC7 C;  1ETX A;  3PQK A;  1IO2 A;  1ZGA A;  2VI6 A;  4GGG A;  5GP9 A;  3I4M J;  5CJ9 A;  1IXR C;  4JOM A;  1PYV A;  3CMY A;  2ID6 A;  3JRG A;  5CVI A;  5ERI A;  2H09 A;  5DM7 F;  4WXC A;  3NEU A;  4X1E A;  2EV5 A;  3TMO A;  2X9D A;  4HDU A;  3M4O J;  4XRS A;  3S3N A;  3CTA A;  1X2N A;  4U87 A;  3QAH A;  3QPS A;  2QSF X;  1Z6T A;  4PJL A;  2BHZ A;  4CXF A;  3F8F A;  2LNB A;  2VXZ A;  1Y8Q B;  2IT0 A;  3ZGK A;  1R1V A;  3CCU I;  1F9N A;  2L9S A;  3FF5 A;  5BPI A;  2BVM A;  1LFP A;  2ETH A;  4P3A A;  2BY3 A;  2LRE A;  3I64 A;  3ZQL A;  3R0A A;  2CGP A;  3FXU A;  1EJ9 A;  3K4J A;  1KU3 A;  3GFJ A;  4NUB A;  3S1M J;  3ZRG A;  3F9K A;  3UNG C;  2KL4 A;  5JPM B;  3JAM K;  4IPA A;  5J1U A;  4RM2 A;  1ACI A;  1M1E B;  4LK0 F;  4I7H A;  1AHD P;  4ZDO A;  2HS5 A;  3DP7 A;  4MO7 A;  1OCP A;  1U5T B;  2EZL A;  3H9Q A;  5IP9 J;  1ETO A;  1SC7 A;  1WCM J;  2F4I A;  3CUO A;  3V8L A;  4AYB N;  1OYW A;  2E2J J;  3W6V A;  2LKS A;  3K4B A;  2R7X A;  5J6X A;  4M3F A;  3VSL A;  3PNY A;  4UHT A;  1XB4 A;  1X4P A;  5HLT A;  2ISZ A;  2XIG A;  2CQX A;  4ZC3 A;  1NHA A;  4BY1 J;  3BOQ A;  5HLH A;  2Q0O A;  2BHY A;  4D9J A;  1T8I A;  2V6E A;  5D8K B;  2E1M B;  4LIT A;  5IP7 J;  2W7N A;  2HOS A;  1MMD A;  3O3K A;  3BG3 A;  3IHU A;  2GA2 A;  1OR7 C;  1YE9 A;  2EFO A;  4I98 B;  4IQJ A;  2M7B A;  1H88 C;  1IRG A;  3FIW A;  2LR8 A;  2Q2E B;  2FJ1 A;  3EUA A;  2E2H J;  1TT0 A;  3BZ6 A;  1SD7 A;  3I59 B;  2EIK H;  3JRC A;  1HDD C;  1I1G A;  4RLF A;  2FX0 A;  4CCJ A;  4L9N A;  4A3J J;  1N78 A;  2HOT A;  1CGP A;  4CIC A;  2VXD A;  3SJM A;  4MEY F;  1MNE A;  5LGN A;  4KMU X;  2QA4 I;  1H0M A;  3TGN A;  3IWF A;  4NC6 A;  2PI0 A;  2GM4 A;  1SD4 A;  4L0Y B;  4YG2 F;  1F1Z A;  4M6Y A;  4G7H F;  1QNT A;  3ERM A;  2A61 A;  2BVL A;  2X1C A;  4RB2 C;  1LVK A;  1DGW Y;  2DO7 A;  3E5U A;  2X0L A;  2IS2 A;  3K70 C;  3S1R J;  1JUS A;  3RPQ A;  2GOX B;  3G2B A;  4N9I A;  2OZ6 A;  5LFA A;  1J5Y A;  1Y1W J;  1YYV A;  3OMY A;  5ILS A;  2L9R A;  2PFB A;  3TW7 A;  3U21 A;  1V54 H;  1KON A;  1IZ1 A;  2EV6 A;  3P7N A;  4D5C A;  5EEH A;  3A2K A;  2V1N A;  3WGI A;  4EJW A;  3OYN A;  3GFM A;  3BWG A;  2XAF A;  4KYW A;  2PMH A;  5DEQ A;  3MZY A;  4O5V A;  2P0W A;  4C2M J;  5J8F A;  1DPU A;  1IGN A;  3I54 A;  4EEF G;  1D5Y A;  3BR3 A;  3QPH A;  3BTJ A;  1AKH A;  1ZRC A;  5LHG A;  3GFL A;  2GXG A;  2OC6 A;  5IYB J;  4BDY A;  3ZMD A;  2DMP A;  1IXC A;  1SD5 A;  2KIM A;  4WWC A;  2LVS A;  2M34 A;  1G6N A;  3BJ6 A;  3ECH A;  3F22 A;  1XPX A;  2MC3 A;  4A3E J;  3GWZ A;  2GIV A;  2KRC A;  2WB1 A;  4HW0 A;  9ANT A;  3JAM Z;  4M9X A;  3E5X A;  3HKZ N;  4CCK A;  2LKX A;  2LY2 A;  3S2D J;  1GVD A;  1MND A;  3FXO A;  2CG4 A;  3IUO A;  2WA0 A;  3LSM A;  3WTT C;  4FX4 A;  2QSG X;  1FLI A;  5M5W J;  1YHQ I;  4UY8 I;  5L3G A;  1FIA A;  2WY8 Q;  3DPU A;  4EGY A;  1SFO J;  2LY1 A;  3CUQ A;  4A6D A;  3PIP F;  5M3F J;  2DA2 A;  3DTK A;  4MTE A;  2BXY A;  1IF1 A;  1ETQ A;  1RIO H;  2M87 A;  3K10 A;  3BJA A;  2F2E A;  4XM3 A;  3JRD A;  2FQ3 A;  3I71 A;  4IOC F;  4XK4 A;  1X19 A;  4I0B A;  2LTP A;  5FKO A;  3TL4 X;  1P2F A;  2HKO A;  1YS6 A;  4LLG F;  4DIQ A;  1S7O A;  5E3N A;  4P39 A;  4IHV A;  3ABT A;  4NC7 A;  3X2Q H;  3A01 A;  5DYM A;  1HKQ A;  1WJC A;  2XRO A;  2DFI A;  2HVR A;  2M0C A;  3R0J A;  4M73 A;  1EV7 A;  5K5Q A;  1J75 A;  2MG4 A;  2FU4 A;  5CVJ A;  1I50 J;  1TWG J;  3MVP A;  4ZDL A;  2W4S A;  5GPA A;  1VF9 A;  4XKC A;  3RSN A;  1C0W A;  4M9Z A;  5F6F A;  3F3X A;  1ETY A;  5M3M J;  2VIX A;  2EK5 A;  4LD5 A;  2G7U A;  4RA2 A;  4RGS A;  3SEZ A;  3DLA A;  4KIF A;  1ETV A;  2R5Z B;  4ASN A;  5DM6 F;  1OLT A;  3JW4 A;  2LP0 A;  2RV8 A;  3HJE A;  2R7O A;  1B59 A;  2HYJ A;  2DPU A;  2XPU A;  3KLO A;  2KRF A;  2MLG A;  3GTP J;  3ZOB A;  4S04 A;  2JUG A;  3JRH A;  1ZTR A;  1WH5 A;  1H89 C;  5ILU A;  1XGO A;  2A6E F;  4GYI A;  3DTE A;  1ZG3 A;  2F5E A;  2ZXI A;  1J09 A;  3DEE A;  1LFB A;  1JHF A;  3U1D A;  1PP7 U;  1QA6 A;  1MD0 A;  3HM5 A;  4G94 A;  3KX2 A;  1SD6 A;  2R5Y A;  4M6X A;  2Y30 A;  3DKY A;  5KVR A;  5E17 F;  1QGP A;  1PUF B;  4BEH B;  3VOE A;  1KJS A;  2YU3 A;  1WJE A;  1ZEL A;  3TOA A;  5BS6 A;  5C4J J;  1S5L C;  3D5R C;  1S72 I;  4OOI A;  1QRY A;  3CCY A;  3KE2 A;  4R8H A;  1R49 A;  1LE8 B;  2MYS A;  4CH7 A;  3K9T A;  1Z67 A;  2GBY A;  1N75 A;  2IW5 A;  2Z16 A;  3ASO H;  1J0R A;  4EJU A;  2H1K A;  1GLN A;  4WXH A;  2XAQ A;  1APL C;  1Q1H A;  1P4X A;  5ICC A;  2KRH A;  2QZ8 A;  4A3K J;  4KMF A;  4YIF A;  3CF5 F;  1NH3 A;  2L7F P;  1RZ4 A;  3GEZ A;  1ZLJ A;  3IAS 2;  1IV6 A;  4JQF A;  2GWR A;  3GBG A;  2R7R A;  2ZSI B;  4A12 A;  4AUX A;  1QZZ A;  4XLH A;  2E35 A;  2H94 A;  2O61 A;  3CDL A;  1ORK A;  2I8D A;  2M5W A;  3CCR I;  2QCO A;  4YFK F;  2V79 A;  3WE2 A;  3N05 A;  4KIS A;  1YJW I;  2DOF A;  3FK6 A;  2HFH A;  3RKW A;  5K7F A;  3S2W A;  4DGW B;  1TC3 C;  4HRI A;  1ON2 A;  1ONV A;  4FQG A;  1OFC X;  2DA3 A;  1O57 A;  3DFG A;  1MH4 A;  2MW8 A;  2K9S A;  2L7M P;  3PQJ A;  2EJR A;  3K4N A;  4CDG A;  2XV4 S;  5LD2 C;  1MBE A;  4M3G A;  1T08 B;  1GV2 A;  4LB6 B;  3GTO J;  1K61 A;  1E3P A;  4XN3 A;  2K3F A;  4B43 A;  2VL8 A;  1O3S A;  4XON A;  2H6B A;  4BJ6 C;  4RAY A;  1NG7 A;  3MCZ A;  4QIW N;  1B72 B;  5E8I A;  2O8X A;  4KNY A;  2HQ5 A;  3EDP A;  2OTJ I;  2HNH A;  4IX7 A;  1UEL B;  1POG A;  3PSI A;  1YTY A;  1FEX A;  3K0L A;  2BOL A;  1XG1 A;  1OCO H;  5FB2 A;  3J81 K;  3ZQC A;  2NOJ B;  4QWQ A;  2X6X A;  5BQT A;  1IG7 A;  2H8R A;  3G1M A;  3KZZ A;  4EJV A;  1EF4 A;  3R60 A;  2NVY J;  3ABM H;  4XR6 A;  3RQ4 A;  3IV5 A;  1U5T A;  1B8I B;  3SXY A;  3HOY J;  1IDZ A;  3LQR A;  3RKX A;  5GTH C;  2BE5 F;  1BIB A;  1MDM B;  1JT0 A;  2OCC H;  4RB1 A;  3MN2 A;  2QEN A;  3DQV C;  3MWM A;  3GTL J;  1UHW A;  6PAX A;  4AID A;  2YS9 A;  3BZC A;  5D6E A;  3KCC A;  1BR1 A;  1TNT A;  3H35 A;  1FBU A;  3TO6 A;  3FHZ A;  2OJE D;  2E1M C;  3LFK A;  1V55 H;  3BQZ A;  3NWT A;  4IOA F;  1MJA A;  4PK4 A;  1DP7 P;  1HA8 A;  5JVT A;  1R5H A;  3JCU C;  4ETS A;  5K5R A;  4ESF A;  2L9V A;  4E7H A;  4HOB A;  3LA2 A;  2AHQ A;  5CVV A;  3DTI A;  3MFK A;  4XIC A;  1L3L A;  4CCN A;  3WTW C;  1KA8 A;  2NYX A;  3TED A;  1FX7 A;  1KQ8 A;  2NS0 A;  3KEQ A;  5GAG J;  3QYF A;  3ERE D;  3CP2 A;  4BXF A;  2R3S A;  4S05 A;  4UB6 C;  3LSR A;  2NS7 A;  1HKS A;  2RDP A;  3HC7 A;  4AIH A;  1EA3 A;  4HF1 A;  2MD5 A;  2M30 A;  2BEO A;  2CW8 A;  2HQR A;  1SFE A;  2Q2E A;  2M8G X;  2RQP A;  3VYU B;  4E70 A;  2NNN A;  3RIR A;  3OL3 A;  3ZMT A;  4U88 A;  1EH6 A;  4IKF A;  5FO5 A;  3BQY A;  4ZJZ A;  4BH9 A;  4YFX F;  1WSU A;  4HF0 A;  4D0P A;  4ZDP A;  5LGU A;  2MA3 A;  4E7S A;  2V1X A;  3BR1 A;  3CQZ J;  2LBF A;  3JRB A;  5E79 C;  1ZKG A;  5LBQ A;  2OAZ A;  1O3Q A;  2UV1 A;  5DS9 A;  3CP8 A;  3TDU C;  2STT A;  2AXL A;  1W5C C;  3U1K A;  2DW4 A;  1X1A A;  3VYR B;  4BJT A;  3IRR A;  4ZTJ A;  2V7F A;  2D45 A;  5GPC A;  4OIP F;  2JA6 J;  3KYC B;  1AA7 A;  3OYH A;  4Z2Y A;  1LQ1 A;  1FTT A;  2VBW A;  4B09 A;  3L2Q A;  2ZCW A;  2WAQ A;  4I02 A;  3HPH A;  2W57 A;  5JLX A;  2DTR A;  4AC0 A;  1FY7 A;  2EV0 A;  2JPB A;  5GAH J;  1BOA A;  4NC8 A;  5EZH A;  1MW7 A;  4BDZ A;  2NOG A;  2FBI A;  2FE3 A;  1ON1 A;  3C2H A;  1REP C;  1BIA A;  1IRF A;  3AKZ A;  2QVO A;  4OAZ A;  1MNM C;  2RGV A;  2ZME C;  1XN7 A;  2LDU A;  5EGO B;  4GXO A;  1YIT I;  2QM3 A;  4MEX F;  1D1C A;  2EIM H;  2VJ4 A;  3J81 Z;  1T0F C;  1YJN I;  3ABL H;  1UMQ A;  2B63 J;  4UV9 A;  4XID A;  3J80 K;  3WHC A;  1SVO A;  3BTI A;  1LEA A;  3LSJ A;  1XGN A;  3VB2 A;  2KJB A;  3PUF A;  5JVG F;  1SMY F;  3IAM 2;  2TRT A;  2KIF A;  3HEF A;  3L7W A;  4B1R A;  3HTU A;  2DMQ A;  3OYC A;  3OYA A;  3PO3 J;  5IYC J;  4U7B A;  2L3D A;  1J2X A;  4ZH4 F;  4HLX A;  1YOV B;  5FRN A;  3VPR A;  1W7P B;  4LMY A;  5EF6 A;  1LDD A;  3WTV C;  4J19 A;  1XTA A;  3KYL A;  3R61 A;  2IA2 A;  3SZG A;  4EM1 A;  4MFE A;  2ZXW H;  1G2H A;  1P9Q C;  4YFN F;  5B1B H;  2VON A;  4X6A J;  2R7D A;  4PZJ A;  1X58 A;  3ASN H;  4XSZ F;  3KP2 A;  2HTS A;  4RS8 A;  5DTD A;  1W36 C;  2RNJ A;  2GZW A;  4UUT A;  2IS4 A;  4WX9 A;  4KT6 A;  3F8C A;  2E5N A;  2M3A A;  3ZQI A;  1U3E M;  4KIT B;  1R22 A;  3FM3 A;  1LPQ A;  4M72 A;  4BL0 B;  3H5N A;  4BE0 A;  2YR2 A;  1FYK A;  3PIO F;  3WHB A;  3S15 J;  2R93 J;  2QYO A;  2IGM A;  3HSR A;  4ITV A;  5FRM A;  1Z1D A;  3RDI A;  1R58 A;  4B47 A;  2ID3 A;  3HRM A;  4UUS B;  1BR2 A;  1T33 A;  4B44 A;  1QBJ A;  5IY5 H;  4FET A;  2P5V A;  5HNF A;  4OIO F;  3HPG A;  3KLS A;  4EJT A;  4B3X A;  1IW7 F;  2A73 B;  1FYL A;  3TO7 A;  1RPW A;  2DA6 A;  3ABK H;  2XC7 A;  2EPF A;  2COB A;  4PGG A;  4C2U A;  1ITY A;  5ILV A;  1D0Y A;  1IRZ A;  1MMG A;  2QF7 A;  2JA8 J;  2DAO A;  3OIO A;  2WB1 N;  2PLY A;  1N77 A;  4A0Y A;  3B6A A;  4XMY A;  2LC2 A;  4BXU A;  1LNW A;  4F7Z A;  3KZI C;  2K9Q A;  3CC4 I;  2YUS A;  2EQR A;  2JWT A;  3MD2 A;  2DU9 A;  4BEH A;  1PUF A;  2HXO A;  5L3C A;  2VQH A;  2LK2 A;  2GOM A;  2KPM A;  2IS1 A;  2JT1 A;  5C3E J;  1Z9C A;  3I4N J;  3CMM A;  2KKO A;  2TCT A;  5CVR A;  5B66 C;  3PO2 J;  5D8L B;  1R23 A;  1JJ6 C;  1BJZ A;  4ENM A;  5JHF A;  2KQR A;  3J7A Y;  4FCY A;  3SZT A;  3WU1 B;  3L2W A;  3ONQ A;  1IXS B;  2GXA A;  3J7Y J;  5E20 A;  3CCQ I;  5B3S H;  4LIU A;  2VC1 A;  3H0G J;  3SHF A;  1HST A;  4E6K G;  3EPZ A;  2AXT C;  3H3V K;  2XB0 X;  2LRD A;  5DD4 A;  2F4O B;  3W2A A;  2LYC A;  3HOW J;  2OQR A;  2Z3Y A;  1QO0 D;  2Z9O A;  2R7S A;  4IQ4 A;  5GAE J;  5JR3 A;  2J5P A;  3BRO A;  1K6Y A;  4AVZ A;  1J59 A;  1UCR A;  3J80 Z;  1HF0 A;  5CYV A;  3K69 A;  1OYI A;  2ZXJ A; 
#chains in the Genus database with same CATH homology
 2P0W A;  1G59 A;  4NQW B;  4XLA A;  5CKT A;  5FRO A;  5CPR B;  4F3Q A;  3HUG B;  3H9G A;  2CMP A;  4AU7 A;  4RM3 A;  3S93 A;  2OC6 A;  4BDY A;  4RMN A;  1WJD A;  4IZZ A;  4GRI A;  1UAA A;  2RNG A;  3SEQ A;  3QYE A;  2IGO A;  2KRC A;  2WB1 A;  2VAS A;  2IGN A;  2BW3 A;  2V9K A;  2ELJ A;  4CCK A;  2LY2 A;  1MND A;  2X1D A;  3L2R A;  3IUO A;  3OYB A;  4BQQ A;  2WA0 A;  3LSM A;  3PFY A;  3OS1 A;  2WY8 Q;  3DPU A;  4Y3O A;  2LY1 A;  4XL9 A;  2XSJ C;  2KP6 A;  3DTK A;  4PSX A;  4HG2 A;  2VQG A;  3K10 A;  4ANJ A;  4XM3 A;  4H4K C;  1X19 A;  4YEJ A;  3TL4 X;  4F93 B;  4XN0 A;  4DIQ A;  2FUG 2;  4LIV A;  4E7L A;  4NC7 A;  2VJJ A;  1WJC A;  3LSG A;  3I3L A;  3OYM A;  2HVR A;  2R4G A;  1WJB A;  3W2V A;  2PMZ A;  1V5G A;  4ZDL A;  3CZ6 A;  2W4S A;  3MKW B;  2M0M A;  3PNT A;  4XKC A;  2PJR A;  3RSN A;  3PUB A;  4HEA 2;  4II2 A;  4HSR A;  2A5W A;  2V26 A;  2VIX A;  2PJR B;  4C9Y A;  3EUK L;  4XLF A;  2K9M A;  3ZXS A;  3LSH A;  3SEZ A;  3DLA A;  2WAF A;  2MD0 A;  4RLQ A;  1NG6 A;  4BGD A;  1OLT A;  4LG3 A;  1T95 A;  5KNL A;  2R7O A;  2AQE A;  1U0J A;  2CV1 A;  3BC8 A;  3A1Y A;  3OIP A;  3AL0 B;  3K6G A;  3H0D A;  2WAE A;  4PSW A;  1JI8 A;  3CF2 A;  3OYG A;  2JUG A;  2VPL A;  3QOE A;  2IXS A;  4CZC A;  2HU9 A;  3HKZ A;  2JVG A;  2Q1Z B;  3DTE A;  2CUZ A;  3MKY B;  3FKJ A;  2ZXI A;  1J09 A;  3DEE A;  4QPQ A;  4XOT A;  3OWT A;  3KX2 A;  3E1S A;  4YEL A;  3DKY A;  4KJZ A;  3H5A A;  4BEH B;  3S3O A;  1YX5 A;  2W1O A;  1WJE A;  2X1E A;  2VQL A;  2JSP A;  1ZEL A;  2WAD A;  2OV7 A;  2HDW A;  2DOA A;  3D5R C;  2DCE A;  4XOP A;  3K4L A;  4E7Z A;  3HOT A;  2MYS A;  4CH7 A;  2M7A A;  4Y4R A;  1N75 A;  2Z16 A;  3S3M A;  4XLC A;  3FHN A;  1GLN A;  3DKX A;  3SYT A;  3OYE A;  1Z7L A;  4F52 A;  3QYB A;  2KRH A;  2KHM A;  4HST A;  2X6W A;  3OYI A;  1PJR A;  2L5Q A;  1BR4 A;  1X1D A;  3NWS A;  4XKW A;  3RTR A;  4XLE A;  3IAS 2;  3OYK A;  2JVH A;  4JQF A;  4HNT A;  4E7J A;  3GBG A;  3K4C A;  2R7R A;  2ZSI B;  1QU3 A;  3H5R A;  4CSW A;  4XLH A;  4PJM A;  4DJA A;  4C2T A;  4XQF A;  2I8D A;  1V5F A;  3OYF A;  1D1B A;  2HZD A;  1DQU A;  3N05 A;  4KIS A;  3PL8 A;  4OWR B;  2CS3 A;  4HNU A;  4DGW B;  4HRI A;  4FAS D;  2CV2 A;  4B48 A;  4CCL A;  4N4N B;  1BOB A;  3D5L A;  1LKX A;  2M4G A;  3K4N A;  2KDO A;  4BE1 A;  2LOO A;  2QKM B;  3A4C A;  3QOD A;  5LD2 C;  5HNH A;  2W00 A;  2BW3 B;  4XN3 A;  3HOS A;  3M8J A;  4B43 A;  2RQQ A;  2VL8 A;  4XON A;  4BJ6 C;  1MMA A;  1NG7 A;  3EUH C;  2X51 A;  5HVQ C;  4R79 A;  3OYJ A;  2R7W A;  2RRE A;  1W36 D;  4BAC A;  3OYD A;  4D1Q A;  2LH9 A;  2HNH A;  4IX7 A;  1FMW A;  1UEL B;  2K5C A;  3PSF A;  4DBQ A;  3PSI A;  2BOL A;  4E7I A;  2NOJ B;  2X6X A;  1FMV A;  4ZYA A;  3OS2 A;  3VWB A;  2DJI A;  2R7U A;  3BCB A;  4BU2 A;  2VLA A;  2CUJ A;  1D1A A;  2MC4 A;  4XR6 A;  3RQ4 A;  2L2O A;  2XAU A;  2L9N A;  3DPT A;  3DQV C;  3OR2 C;  2DT7 B;  1R6R A;  1SFK A;  4N4O B;  1DGR M;  2LG4 A;  3DWL E;  3MMY B;  1BR1 A;  3H35 A;  3W3C A;  2E1M C;  2F6C A;  1S9H A;  2WY7 Q;  3NWT A;  4PK4 A;  1HA8 A;  1Y56 A;  2CH0 A;  2HPI A;  2ZSH B;  1LDK B;  3HL2 A;  3UR3 C;  3I9V 2;  4E7H A;  3PJR A;  4XKV A;  2XF5 A;  3DTI A;  4PFO A;  2V4J C;  4CCN A;  4CUG A;  3PNV A;  4BJ5 C;  3VYT B;  3DU6 A;  3RCO A;  1Z21 A;  3QYF A;  3CP2 A;  2CW7 A;  2UWM A;  4BXF A;  2Y0S A;  2DXI A;  3HC7 A;  5KCM A;  1QHG A;  4J00 A;  1EA3 A;  1MMN A;  2CW8 A;  3OL4 A;  2R7V A;  1WJA A;  3CJQ B;  3K70 D;  3VYU B;  3K4K A;  2UUZ A;  1D0X A;  3L2U A;  2ZFU A;  4FXG B;  3OL3 A;  4E4H A;  4G6T B;  3K4M A;  4NNJ A;  4MLO A;  2Z2S B;  4C30 A;  3V42 A;  4IKF A;  2X85 A;  4ZJZ A;  1Z3Y A;  4XOR A;  3OIQ A;  4ZDP A;  4BQN A;  2VKD A;  4E7S A;  2LBF A;  1V5E A;  2UV1 A;  3M1C A;  2LBF B;  3CP8 A;  1VZ0 A;  1TZL A;  3OR1 C;  1X1A A;  3OOU A;  3VYR B;  4BJT A;  4ZTJ A;  2V7F A;  3LSI A;  4BQO A;  3OS0 A;  3LSK A;  2HQA A;  2JA2 A;  1AA7 A;  3OYH A;  3C2G A;  2ZXH A;  3FBN B;  1QHH D;  1G8X A;  3L2Q A;  3L2V A;  3DU5 A;  1X1B A;  2WAQ A;  5CQE A;  4CCM A;  1YX3 A;  3HPH A;  3LFU A;  4CA0 A;  1X4O A;  4DOZ A;  2XDV A;  2KMU A;  4BDZ A;  4HPQ A;  2HVQ A;  4NC8 A;  1MW7 A;  4JOM A;  3C2H A;  2VQC A;  1PYV A;  3AKZ A;  4OAZ A;  3HG9 A;  1IRX A;  4XKB A;  3TMO A;  3VSK A;  5CQG A;  3S3N A;  4OAY A;  1D1C A;  2VJ4 A;  2VB6 A;  3AFH A;  1T0F C;  4U87 A;  3MKZ A;  3KEY A;  1UG0 A;  3TBI A;  3HXL A;  4PJJ A;  4PJL A;  4EAT A;  2E5Z A;  3LL7 A;  4PUS A;  2VXZ A;  2VJI A;  3S8P A;  3IAM 2;  3ZGK A;  2CV0 A;  3VYS B;  3FDY A;  1WJ5 A;  3OYC A;  3OYA A;  3DPL C;  2L9S A;  3BG7 A;  4U7B A;  2BVM A;  1LFP A;  5FRN A;  2LRE A;  4ZTF A;  2XF7 A;  2KLO A;  2XF6 A;  3K4J A;  4NUB A;  3KYL A;  3ZRG A;  3SZG A;  4BE2 A;  1P9Q C;  3F9K A;  3UNG C;  1WJF A;  2CFO A;  2O5R A;  2KL4 A;  5JPM B;  3BLY A;  2VKH A;  2R7Q A;  3SDB A;  2K3P A;  2R7T A;  4RM2 A;  2MAB A;  4BUP A;  4ZDO A;  3ZCO A;  1W36 C;  2K9L A;  2IS6 A;  2MFZ A;  4P1W A;  3H9Q A;  2IS4 A;  4KT6 A;  2HPM A;  1SAU A;  2E5N A;  2M3A A;  2F4I A;  1Z3X A;  4KIT B;  4BL0 B;  3H5N A;  1D0Z A;  4BE0 A;  3K4B A;  2R7X A;  2IGM A;  4ITV A;  3VSL A;  5FRM A;  3BCA A;  4B47 A;  4X0G A;  3PNY A;  3E0J B;  1X4P A;  5HLT A;  1WFX A;  4J01 A;  4ZC3 A;  4P5O A;  1BR2 A;  3H9J A;  3AL0 C;  4B44 A;  4D9J A;  2A6T A;  5TGT A;  3IP4 B;  2V6E A;  2E1M B;  4LIT A;  4PFP A;  4FET A;  3S32 A;  1DP3 A;  4F91 B;  5HNF A;  3OYL A;  3HPG A;  4II3 A;  2W7N A;  1MMD A;  4B3X A;  2F5V A;  2E60 A;  3LMM A;  1OR7 C;  1YE9 A;  4XNF A;  2XC7 A;  4IQJ A;  2AQF A;  2M7B A;  1E0E A;  5KHD A;  4C2U A;  2W82 A;  3ZQQ A;  1D0Y A;  2VJ5 A;  1MMG A;  2Q2E B;  3EUA A;  2L7K A;  5HOO A;  3CJR B;  2HVS A;  1TT0 A;  1X1C A;  4CCO A;  1N77 A;  3OY9 A;  4XMY A;  2LC2 A;  4RLF A;  3VDX A;  4F92 B;  4CCJ A;  2KZV A;  3BG6 A;  3D5S C;  1N78 A;  3CES A;  4YRV A;  2QKL B;  3MD2 A;  4BEH A;  2VXD A;  2VQH A;  2IGK A;  1MNE A;  2GOM A;  2KPM A;  2IS1 A;  2Z1D A;  3CMM A;  1ERD A;  4BS9 A;  4Y33 A;  3ZR8 X;  4DBR A;  2WBM A;  2KQR A;  2BVL A;  5JHF A;  2X1C A;  3J7A Y;  3L2W A;  1LVK A;  1DGW Y;  3ONQ A;  2IS2 A;  4AYB A;  3K70 C;  2GOX B;  2OUM A;  3G2B A;  4LIU A;  5LFA A;  3W2W A;  4E6K G;  4E7K A;  3FBI B;  3EPZ A;  1Y6I A;  2LRD A;  2M4K A;  3W2A A;  2LYC A;  3OMY A;  2X6Y A;  3U21 A;  2DT6 A;  3RPU D;  1KON A;  4IQ4 A;  4F55 A;  2R7S A;  1K6Y A;  4AVZ A;  3A2K A;  2V1N A;  3OYN A;  4PJN A;  4QPO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...