2Z16A

Crystal structure of matrix protein 1 from influenza a virus a/crow/kyoto/t1/2004(h5n1)
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
161
structure length
153
Chain Sequence
SSGMSLLTEVETYVLSIIPSGPLKAEIAQKLEDVFAGKNTDLEALMEWLKTRPILSPLTKGILGFVFTLTVPSRRRFVQNALNDPNNMDRAVKLYKKLKREITFHGAKEVALSYSTGALASCMGLIYNRMGTVTTEVAFGLVCATCEQIADSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Matrix protein 1
publication title Crystal structure of Matrix protein 1 from influenza A virus A/crow/Kyoto/T1/2004(H5N1)
rcsb
source organism Influenza a virus
molecule tags Viral protein
total genus 60
structure length 153
sequence length 161
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00598 Flu_M1 Influenza Matrix protein (M1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.180 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2z16A02
1.20.91.10 Mainly Alpha Up-down Bundle Influenza Virus Matrix Protein; Chain A, domain 1 Influenza Virus Matrix Protein; Chain A, domain 1 2z16A01
1EA3A 2Z16A 1AA7A 4IQ4A 3MD2A 4PUSA 3VDXA 5CQEA 4D9JA 4ITVA
chains in the Genus database with same CATH superfamily
2EBIA 1R1TA 2YX4A 3JRHA 4KDPA 3DPTA 2L5QA 3SQNA 2KHMA 2DFFA 1MMDA 3LOCA 2KZGA 1X19A 2LD5A 1M1EB 4HNUA 2E7WA 1UHMA 1G3WA 5H6QA 1VZ0A 2R7SA 4OWRB 2E1NA 1VFCA 1Y1WJ 3CF2A 3KE2A 2DXIA 3L2QA 3ASNH 3FXOA 3S1QJ 1R5GA 2CSOA 5EEAA 4LLNA 1OISA 2JSPA 1BOBA 3KP5A 1YYVA 2XPUA 1FNNA 2K40A 3S1NJ 2K9LA 2W48A 4D7NA 1YLFA 2DA7A 2DMQA 1WJ5A 4EEFG 4XICA 1BL0A 4AM3A 1FSEA 3HRUA 2HTJA 1Q1VA 1FT9A 3BQZA 4HYEA 2EV5A 2FBIA 3LSIA 1SVOA 2KKOA 4M74A 5DCMA 1B9MA 4KN4X 4PSXA 2H27A 1Z0XA 5C4XJ 2Y30A 3LSJA 2DOAA 3REOA 2M0CA 1BOAA 1TLHB 2HOTA 2Z5UA 5DCMB 1ZGJA 1X2MA 4YIIA 3FKIJ 2RNJA 1MBKA 2GLOA 5DTDA 1XDUA 1P2FA 1FMVA 1K7AA 1U5TC 5CVIA 3BG7A 2DYRH 3C2HA 4RGUA 1WQ2A 2O61A 3DBRB 4UUTA 3H3ZA 1K6YA 3C2GA 3IWFA 1X3UA 3OYKA 2GZWA 3OS2A 4BQNA 3K70C 3RKQA 1X1BA 1Y6IA 2PJPA 4M72A 3JRFA 5B1AH 1UMQA 2FA5A 4AD9A 5FFXA 2KJBA 3HGYA 4HX8A 1YE9A 2MFZA 3RSNA 1FEXA 3CCLI 2K9MA 1O3TA 3OYMA 5DYMA 1ZH5A 2ZC2A 2E1MB 1W7PD 1X4OA 1KU9A 1MW7A 1J7KA 5IOZA 3K6GA 3IRRA 4UUVA 3CO7C 1W7PA 3DP7A 3ZN0A 3ML6A 4PSWA 1IUFA 3ZQQA 4CDGA 1W7PB 2L9NA 1UG0A 2JVGA 4E7SA 1JT0A 2NVXJ 1VQ7I 1FP1D 4DZJA 2DMPA 3PM1A 3I5UA 3CMYA 3A0BC 3BR2A 4BHBA 2V9KA 2MC3A 2EV6A 2IA2A 2X9DA 3TKYA 1YX3A 2HPIA 3HRTA 3RPUD 3TP3A 4B3XA 3AL0C 1QVUA 2RGVA 2ECCA 2JWTA 3GW2A 3ZQHA 5EG0B 2VI6A 1JE8A 1D3YA 3WG9A 1O4XA 2M7BA 4GDFA 3D5LA 4BDZA 5IP9J 1X1DA 4IHVA 4FT8A 3GTOJ 1TWCJ 4HSRA 3DU6A 2X1CA 4B3AA 3HOSA 3HRMA 3DPUA 3CMMA 1Y1VJ 3RYRA 4A2UA 3OYLA 3DPLC 3KIOA 3QP5A 1NK3P 3H0GJ 4A3EJ 3K1PA 3K2ZA 3K4LA 1HDPA 5TGTA 3FHNA 3K69A 1HF0A 2OZUA 1F36A 2VN2A 2HQ5A 1MMGA 3PNTA 1MJAA 1U3EM 3B02A 5J8CA 4LFUA 3HOWJ 3KETA 4LOCA 2W24A 3VWBA 3W3CA 4WX9A 2A6TA 1D0XA 4M6YA 3QYBA 4CZZA 2WWYA 3W6VA 1B1BA 2JN6A 4B1RA 1ZTRA 1Z21A 3F0CA 1H9GA 1TQIA 4OINF 3H9QA 3M9AA 2HGCA 3IH2A 2GOMA 5KAIC 5CQEA 5EJCA 1LJ9A 2EFNA 4Y3OA 3SZGA 1ZR4A 4I6ZA 1IRFA 1MBEA 1SMYF 1UHWA 1KQ0A 2K02A 1BA5A 4BU2A 3TEDA 1I1GA 1XDSA 4U0VA 3SEQA 2YSRA 4IF4A 2HDCA 2V1XA 5FKNA 3I64A 4WWCA 2D45A 5LRSA 4RMNA 1MDMB 2QWWA 2ZCWA 1FOXA 2QQ9A 4DZPA 2RVCA 4OMZA 3S2HJ 1IDYA 2XRNA 5F0CA 2FBKA 4HDVA 2QZ8A 4TV7A 4IZZA 1MMAA 1ZLJA 2FX0A 3R61A 5L3EA 2F4MB 5CLSA 2IS2A 3MKLA 3VYUB 2HTSA 4AIKA 2BY0A 2AQEA 4XL9A 3DU5A 3K2AA 4DYRA 4J01A 2J5OA 3K4CA 5F04A 2ISZA 1S7AA 2D5VA 2JA7J 2HQRA 4MGRA 3ZCOA 1LFUP 4A0YA 2IT0A 1LFBA 2I5UA 3HM5A 4WXCA 3QYEA 4B8XA 3K7AJ 2YPRA 3OY9A 4C3HJ 1VQLI 4RAZA 2E60A 3S15J 2ID6A 3OL3A 4Y15A 1TBXA 4BHCA 5LEJA 4G6DA 2ZKZA 3GEZA 4QTRA 2HYJA 3HEFA 1O3SA 4KIBA 4ZJZA 1FLIA 3FHZA 1T6SA 2R7RA 1J9IA 1ETOA 2OU2A 1S7OA 1RETA 3I53A 1KU7A 4RGXA 1Y0UA 2M8GX 1XGOA 4OAYA 4AUXA 4YG2F 1P92A 3J7AY 1D0YA 3B73A 3R4KA 1D1BA 4IHWA 3ECOA 5KNLA 4XLCA 3HC7A 2DQLA 2G7HA 4BXXJ 1A31A 3OYBA 4ZYGA 3VB2A 1JHFA 3BR5A 2HVSA 2XIGA 3HOXJ 1ZKGA 5H2FC 1W0TA 4KYWA 2XAUA 3OS0A 2QM3A 4B09A 2R7FA 4FQGA 3K70D 5E79C 2VKEA 4B47A 3QPHA 2CH0A 1J0RA 3MQ0A 3TDUC 3WTVC 2A07F 1AKHB 1PDNC 3RQ4A 3LMMA 3R60A 4RA2A 2CQ7A 1YJWI 4A3IJ 3SJMA 4E7LA 4RB0A 3BQYA 3I71A 3A03A 1SVMA 3F8BA 4HW5A 4FHTA 2EFOA 3JAMZ 4JBAA 2WADA 1VI0A 3MWMA 1NG6A 4KT6A 4XLAA 3SZPA 3L7WA 4BQAA 3GTLJ 3HQBA 2XF5A 4OOIA 1ETWA 2BEOA 2V1UA 3J81K 3GFIA 1JGGA 2HWVA 5E3OA 3FXRA 4L0YB 5JHUA 3KP3A 1JKPC 5TRDA 3HSFA 2DA2A 1D8JA 2DFIA 4BE2A 1MBJA 2K4JA 4NC6A 3FMSA 2EWNA 1F1ZA 1WJAA 3SEZA 1WRJA 2XAHA 5ILUA 2Q2EA 2ICWG 2R0QC 5F27A 2E1CA 3JCUC 2PI0A 2LSOA 4A69C 1I6XA 4PZJA 1J59A 2ZMEB 1MNMC 1MH3A 2R92J 1FP2A 2LREA 4U7DA 2P81A 2W25A 2B7EA 4AIHA 2BY1A 3H1CA 2VB6A 1VQPI 3LA7A 2DJNA 3AL0B 4J19A 3PSIA 4LLLA 4RBOA 3F9KA 3RKXA 3DF8A 3A2KA 3DEUA 4KFCA 2LKPA 3CCJI 2KRCA 2XAFA 4RLQA 1RKTA 1MBFA 4N0BA 1HKSA 1LDJA 1PUEE 5DUKA 2RKHA 3GZNB 4UNOA 2K9QA 1I6HJ 2BY2A 1WJDA 2DTRA 2EZLA 2E35A 3W6KB 3HIFA 2Z33A 4ETSA 4C2UA 1D8KA 1O3QA 1S29A 3HHGA 3KFWX 2CWEA 1IF1A 2IJLA 3V8KA 2LR8A 3HB9A 2YR2A 4QPQA 9ANTA 1MIJA 1T33A 3PIOF 2IS4A 4IKFA 3ONQA 2DMUA 1E3PA 3QPSA 2LLKA 3JRDA 3M8FA 5CQGA 2OCCH 1LEAA 4P9UA 1QVTA 3WODF 4CA0A 1X1CA 2P5KA 2AXTC 4IPAA 3FMRA 2OV7A 2VJ4A 3WE2A 5GTHC 5ICEA 3CDLA 1GUUA 5DCFA 1R49A 1IXRC 1X1PA 5FRMA 2YUSA 5FKKA 4S04A 1DQUA 1U9NA 4BY1J 1SFXA 4UUSA 3FMQA 2VXZA 2JTVA 1UHSA 4BEHA 3WTYC 4BDYA 1DPUA 3HOZJ 2Z3YA 3ZQLA 2YU9J 3KP6A 4IRHA 4UUSB 3HOTA 3HTUA 2CG4A 4BBRJ 1GVJA 4LLGF 1CFAA 1VTNC 2R5YA 1RR7A 2Y0MA 2ETHA 1MMSA 4OIRF 1OJLA 2W00A 1RESA 2X6YA 1ZARA 2A5YB 4LJZF 3WTWC 2R5YB 5E1ZB 2VT3A 3WU1B 5KAFC 1OMIA 5M5YJ 3L2RA 2R7QA 2JZYA 1PJRA 1OYIA 4D7MA 3VSKA 5E20A 4C3IJ 1PUFA 5GTIC 4M9SA 4CCMA 1HBXG 1HKQA 5IT3A 2X6OA 1FBUA 3COAC 2VL8A 1D1AA 1RUNA 3R0AA 5BMZA 5J1YA 4QPOA 2JQ7A 2HU9A 2M4GA 3IAS2 4PCQA 1YOVB 2IGOA 2BZTA 3QPTA 5D8KB 2HQAA 3OWTA 2N8GA 1ZG3A 3IH4A 3LNQA 3S14J 4MTEA 3JRCA 3N4MA 4XOTA 1FTZA 3N97A 4V19K 2LKSA 2DOFA 1GT0C 1BIAA 3BR6A 1HCRA 2QQ8A 2XRLA 2VIXA 4RAYA 2YU3A 2WV1A 5K5OA 2QSGX 2JT1A 3FX3A 5J8FA 4ZDLA 2OPTA 3GO5A 1TT5B 4XNFA 2WAEA 1Z91A 3H92A 3ZN1A 4F3QA 3PFYA 2PN6A 1UFMA 4Q48A 4NQWA 1X3ZB 3HPHA 3S3MA 1ACIA 3BG9A 5AIQA 5DUIA 1EA3A 4G12A 4M3DA 4PFPA 2LFBA 2PMHA 2CUJA 3RJPA 4DYQA 2E1MC 3HZJA 3WE3A 4NQWB 5HLTA 1RZ4A 1SC7A 2JPBA 3GX4X 1P9QC 1Y8RB 2Z99A 5F1RA 2M30A 4PJJA 5CVUA 1H89C 2FOWA 5CPRB 1OYYA 3GTKJ 1B6AA 2MABA 1K83J 4IOCF 2V6EA 4HQMA 3OS1A 4FTHA 4I2OA 3F6VA 1TWFJ 1A5JA 5GPAA 1IXCA 3HJEA 3LSMA 3SFZA 2HNHA 4R1HA 1R6RA 2DW4A 4MO7A 4ZH4F 4L0ZB 1MD0A 3FXJA 4I02A 4XLFA 1FYKA 3LWFA 4P5OA 5F08A 1XCBA 3PO3J 2L9SA 4WF2A 2BGCA 3LFUA 4IQ4A 3NWTA 4QIWN 1KGSA 3CCRI 4CCOA 3AG4H 4YFKF 3KX2A 3PIPF 5FRNA 2F5DA 4G9YA 2QSHX 3MMYB 3CCYA 2G7UA 2M7AA 3G73A 4E7ZA 3VODA 1CGPA 1VF9A 1R7JA 4FETA 4EJOA 4HA8A 1MMNA 1XS9A 1FIAA 1Z67A 3F22A 2O6GE 1IG7A 3HOVJ 1WWXA 2K3FA 2TCTA 1JTXA 3NQOA 1V55H 3WGIA 1RPWA 2BHYA 4I09A 3AAFA 1LE8A 3MKWB 1JJ6C 5BPDA 4DW6A 4HX7A 2YX7A 2Z1DA 4L9VA 3A4CA 3KLSA 3GFMA 4A3MJ 1OKRA 1OCTC 4IXAA 3WTZA 3FXKA 4KT5C 2IP2A 2JA8J 2Y2ZA 3TOAA 3VPRA 3DKXA 2EILH 1VNDA 4UVBA 1VQMI 1R22A 1GV2A 1MNEA 3E6BA 4AU7A 1DP3A 3I59A 4I98B 2G9WA 3HRSA 3M07A 4UB8C 3HGGA 3DTIA 3K4JA 2GXAA 1Y0NA 1IZ1A 1JKRC 2WA0A 2HOAA 2L7KA 3OR1C 3M8EA 3PFIA 3Q5FA 4JK1X 1R1VA 2DO7A 1LVAA 1HSJA 4XM3A 2NVYJ 3MFKA 2ZXJA 1TNTA 3TGNA 1NTCA 2L4MA 1BC8C 3ELKA 3OYEA 3KYCB 2FNPA 4CCLA 5LEKA 4W97A 2EFPA 2X4HA 5F0HA 3K4MA 3L09A 1W5SA 3F23A 5J6XA 3PSFA 2PMZN 2PLYA 5KHDA 2A3SA 4L5IA 1YTYA 2P8TA 1XMAA 3J81Z 2DAOA 3I56I 1WI3A 1JKOC 4LIUA 3GZ6A 4DQ2A 2KIUA 3OYIA 4HRIA 2EH3A 5F6FA 3FF5A 2DK8A 3QP6A 3JAMK 1G6NA 3S2WA 2UUZA 5J1UA 1TZLA 1WI9A 5EDNA 2QKLB 3DFGA 2LBFA 2F5FA 4K2EA 1XB4A 1D5VA 5HLGA 2H09A 1JKQC 1R1UA 4HX4A 1HLVA 2XC7A 4CGZA 2LNBA 4JQFA 5E18F 1XGSA 2PJRA 3TP0A 3Q9SA 3X2QH 1MSEC 1AA7A 2F4OB 2EINH 2H8WA 4MNUA 3L2CA 2ZNZA 1YS6A 1EKEA 1YRNA 3AG1H 1SD4A 4KUMA 5FKLA 5CVJA 1PP7U 3CCEI 1GLNA 4M9XA 2PJRB 2JUCA 4V2FA 1PYVA 3V42A 1XMXA 3I3LA 2F5EA 1YRNB 5FKOA 4U7BA 1AOYA 4YELA 2OBPA 2CV0A 1S3JA 3EPZA 4G6TB 2BHZA 2EIMH 5TISC 2BYVE 5C4JJ 4IHXA 4G6QA 3LSPA 3KP4A 2FD5A 4G94A 1JUMA 3A02A 5FD6A 2E36A 1R5ID 4HZFA 1K78A 2PMZA 5ED4A 2F2EA 2LY2A 4Y13A 3D5RC 3V7RA 2Y48A 1X3WB 4L9JA 4N9IA 4XKVA 1BW5A 3TW6A 3E7LA 1P6RA 3ERMA 3GFLA 2NNNA 3FDYA 4I76A 3L2WA 5A2QZ 3VFZA 2CU7A 1BC7C 1YIOA 3M1EA 3Q9VA 3ZMVA 4F91B 2E5NA 3ROUA 2Z16A 2W82A 4MFDA 2L7FP 2HKXA 5DD4A 3A0HC 2UXNA 1V3FA 4HF1A 2VJIA 3G3ZA 1NH3A 4XN3A 3MKYB 4YFNF 1YFHA 3C18A 4RGSA 4GFBA 3H5RA 2VPLA 1LQ1A 4G7OF 1IN7A 3IL2A 3LSGA 4RM3A 2JA5J 2ELKA 2DFEA 3K4KA 1VQ6I 3AKZA 3V4GA 2DA3A 1BW6A 1IV6A 3U2RA 2IAIA 2Y75A 1NK2P 2XHKA 4UVAA 4ABZA 4N9HA 5J4YA 2K3PA 5K5QA 1QQIA 2KMUA 3PL8A 2LY9A 2PEXA 3OOUA 4YFXF 2DFHA 2NOJB 5E3MA 1G59A 5DEQA 1A36A 4IOAF 1FMWA 2EQRA 1IC8A 3VDXA 1JUSA 1SD6A 4RB3C 1JGSA 1TNSA 3BJ6A 3M8JA 3P7NA 1IN8A 3IV5A 5LHHA 2ZMEC 3EUAA 3QAHA 4G8XA 1LUJB 3OYHA 2QYOA 3QRFF 5K7FA 2H6BA 3T1BA 2MD0A 3O6BB 5C3EJ 3GBGA 2R4GA 4ZYEA 2ZO4A 3G4SI 2KPMA 1Z3XA 4QLCU 1T08B 2HKOA 1VQ9I 3G2BA 2DTZA 4HWJA 4KIFA 3BWGA 3EQLF 4FX4A 5DV5A 4A5MA 2ZSHB 2EA2A 5FO5A 1BI0A 4YRVA 3DQVC 1Q1HA 3P9CA 1IN4A 4NBQA 1K79A 3CCUI 1QU3A 1LPQA 3NRVA 5HNFA 1DGRM 2GA2A 3F3XA 4PGGA 4EJWA 3UKGA 4HNVA 2OF7A 3LA3A 5JPMB 1ON1A 1ZYRF 1P7JA 3CC7I 4NB5A 2A68F 2VE8A 4E70A 1IUYA 1TQPA 3MVPA 1RR8C 4PDKA 2DA4A 3OIQA 1QZZA 2P7VB 3BJOA 3DBLB 2AQFA 1XSDA 3CZ6A 1RNLA 3JRGA 3ZMSA 2PX9A 1FJLA 2NS0A 2CGPA 2CUZA 2X85A 3IKTA 2ZNYA 2W7NA 2JMWA 3LQQA 4CCKA 1W36C 5K5RA 3S32A 4DJAA 1KQ8A 3PUBA 1HC8A 4X1EA 5IP7J 2LRDA 3MN2A 3FISA 3CDHA 4UHTA 5KCMA 4A6DA 4BUPA 1UJ8A 4XQFA 2B9SA 2LKXA 2X1EA 4KISA 1OYWA 2RV8A 1ZHFA 3CJTB 2K86A 3EDPA 2L2OA 3HXLA 1LDKB 5J1RA 2M4KA 3TO9A 3DWLE 3ZR8X 3AG2H 2KP6A 3L2UA 1Z6TA 2A6EF 4F52A 3U1DA 4LD5A 1IGNA 4XLEA 3RTRA 4EVIA 1ZRCA 2XASA 5ICFA 1VQ8I 4I0AA 2E34A 2TDXA 3WHCA 2OTJI 2ME0A 2XPVA 1KU3A 2HZTA 3KLOA 1GV5A 2L3DA 1AHDP 4JX6A 2O7OA 2QA4I 4OIPF 1ZGAA 2ZXIA 1WKMA 1I5ZA 3HOUJ 1S5LC 2HYGD 3HYIA 1ZRFA 2EIJH 1V54H 3LSHA 5BQTA 2P6TA 2ZJPF 2O9LA 4A5NA 3N05A 4XR6A 1XN7A 2L9VA 3DBHB 4BYYA 4EM1A 2BVLA 5JPNB 1JUPA 2STTA 1TP4A 1O7LA 4IX7A 2VOOA 2XAGA 1JXSA 3UR3C 2ISYA 4UV8A 2FMLA 3JW4A 3D5SC 4LIVA 1O3RA 2DBBA 3BLYA 2ACJA 1FBQA 2OC6A 2O5RA 1E0EA 3Q0UA 4MQVA 2HOEA 2WC2A 4LK0F 3K1NA 3KCCA 2FF4A 1V5FA 3K0LA 3CQZJ 3CU7A 1QZYA 3ZGKA 1A04A 5M3FJ 1QHGA 5FB2A 4U0WA 3V8LA 2FSWA 3E5XA 3OYCA 3TQNA 1WJBA 1PP8F 2FRHA 1T0FA 1OLTA 2EIKH 3JRAA 2QGUA 1V5EA 4IQJA 3G1OA 2E1OA 1SAXA 1RC9A 1OR7A 2G0EA 4UY8I 5D5WB 2PMUA 4XRSG 1GXQA 1P4AA 2M5WA 3KYLA 1OCCH 3A01A 2XB5A 2D2WA 4RB2C 3W2AA 2E2JJ 5GPCA 3BZ6A 3ZXSA 3HSEA 2QENA 3A01B 3C1DA 1H88C 3ABLH 4LK1F 3TW7A 1HW5A 1TC3C 1Z6RA 4GYGA 3JR9A 1OCPA 2QBYA 4QWQA 4HV6A 3F8FA 2BXYA 3PUFA 5LGNA 2E7XA 2EB7A 3O8GA 4MQ9F 3GTMJ 4HNTA 1ZAOA 1EJ9A 5JLXA 4BGDA 1ZK8A 2QBYB 3VYRB 5HOOA 4NC7A 3S8PA 2ZJ2A 4RLFA 4XKCA 2XDVA 1FSHA 1KQ9A 3KEOA 2DPDA 2KDZA 3NARA 3GWZA 4MEYF 3F8NA 4UVCA 5FGMA 5FKMA 2M9HA 4ZYHA 1PVEA 2Q2EB 3VYTB 4C2MJ 3SXYA 2E2HJ 4IVNA 1AWCA 2L7MP 3CUQA 3K10A 1D1CA 3BCBA 2BVMA 1SAUA 3BR3A 3L2VA 4X0GA 2PG4A 3CJRB 3H35A 2XV4S 1Z7LA 1KONA 4OU0A 1WCMJ 3CUQB 4BJ6C 3E6MA 3Q0WA 4XSXF 2EJRA 3ASOH 3RKYA 2GXGA 1LFPA 1P4WA 4BBSJ 2IS1A 2A05A 1VQNI 2ME6A 4H0EA 4HLYA 4M3FA 5J40A 3K9TA 4Y52J 1T38A 3PQJA 3QOPA 2ZFUA 2HI3A 2DN0A 3DTEA 1I27A 4HF0A 1L0OC 4Y33A 3ZQFA 3PNYA 4J00A 3FM3A 5ERIA 5A2QK 3GZ5A 2W57A 5D6EA 3S16J 1F4KA 1ZRDA 2LH9A 1SD7A 1W4MA 4E7JA 1YHQI 5EEGA 2O8KA 2IVMA 4FX0A 5CVRA 2MH9A 4L5JA 1P4XA 3QODA 3WU0A 3I58A 1W36D 2RQPA 4DOZA 3MKZA 1I50J 1ZG5A 3J80K 2KQRA 4EQQA 2CUFA 5LRRA 4E7HA 4PJLA 2VKHA 5GAHJ 4XK4A 2NRAC 1QRYA 5L3CA 3I0TA 5LD2C 3OYNA 1J09A 1RI7A 2R7DA 2BW3A 1TWAJ 2NAZA 1LVKA 3J7AO 5K7HA 3H5NA 2M45A 2V26A 3BR1A 3WG7H 5LHGA 5D5UB 3CCMI 3BROA 3GLXA 1OCOH 4AIDA 5EZGA 2WAFA 2BW3B 1YITI 3IHUA 1I39A 3BZCA 1RUOA 2XGDA 5HDNA 4CH7A 3GLLA 4CCJA 1UG2A 2TRTA 2X48A 3S3NA 1VQKI 1E17A 4EM2A 2AHQA 2NYXA 2HR3A 3OIOA 2M0MA 3OMYA 1SMTA 4BEHB 2DOEA 1XSXA 3CCVI 4F93B 3EUHA 4R79A 5F64A 1WJCA 2O03A 5E8IA 4P3BA 1J2XA 2CS3A 4HPQA 4RS8A 2UV1A 1TL8A 3KLNA 3I4MJ 1R00A 4LMYA 2FEZA 3CUOA 3DEWA 2DI3A 3LAPA 1ZREA 3ZRGA 1W5TA 1PUFB 1UB9A 3FXLA 1DU0A 1ENHA 3DTKA 3UNGC 1MKMA 1MH4A 2IBDA 3KZIC 4WCGA 2OAZA 3WTUC 1C5AA 1U6GA 2KZVA 1T98A 3RIRA 4A93J 2WB1N 1N78A 1HW1A 4BL0B 1HXDA 2GQQA 2FOKA 3DLLF 2X0LA 4MEXF 2MLKA 2VQCA 4C9YA 3W6JB 4G7ZF 1UZCA 1XSVA 3OYDA 1WZ2A 4GGGA 1IW7F 2DA1A 5CKTA 1YJ9I 2KRHA 2JVHA 2BE5F 2XB0X 2FBHA 2V9PA 3SZTA 2YS9A 5JLWA 4XLNF 3GF2A 2W4SA 1R4MB 4GXOA 4ESFA 3VYSB 3R0JA 2BBYA 2XSDC 2FQ3A 3CCQI 2GOXB 4I99C 2KL4A 2QKMB 2M2EA 3HUGA 3LL7A 1K61A 4ASNA 1R71A 2PBIA 5D4RA 1G4DA 2VT2A 3OOPA 5E1XA 2NVQJ 5IYDJ 3BC8A 3HUGB 1HSTA 2IW5A 1CQTA 1JJ8C 3T5XA 3H3UA 3T0YA 2ZJQF 3S2DJ 3BOQA 3OSGA 3CESA 4ENMA 2LF8A 1XX5A 4EMSA 1U8BA 4XONA 2I8DA 2WB1A 3H9JA 1NG7A 1WJEA 3HDDA 3CP2A 5E1WA 4LG3A 4I7HA 4E4HA 2NOGA 5ICCA 1UELB 4BQQA 1HDDC 5JVTA 2F5VA 2LYCA 2ADUA 4HBLA 2IA1A 3FK6A 3MAJA 2NNYA 1XGNA 3MCZA 5L3DA 4KICA 4S05A 3F21A 6PAXA 1BJAA 1MJ9A 1BR2A 1Z3YA 2DU9A 3TDZC 5FLMJ 1YX5A 1FYLA 1DPRA 1ORKA 1POGA 2DJIA 2F4IA 1D0ZA 4O6JA 5E3NA 3S1RJ 2L02A 3RI4A 3D0SA 1DUXC 3BR0A 5J3LA 3BCAA 5DD8A 4EJUA 3B6CA 5D5XB 1HOMA 3BZKA 3BG5A 1Z05A 3U21A 3K4NA 4HSTA 5JVGF 1YW8A 2XGXA 1N77A 5BS6A 3FXMA 3M4OJ 3KYDB 4LITA 1R4NB 4MIMA 3GVAA 3IKVA 2Q8KA 3TO7A 1KYWA 2KJCA 1LE8B 2XUBA 4EV0A 1APLC 2O8XA 2W1OA 3V7CA 2HFHA 5IP6A 2Q1ZB 2CFXA 4HAMA 2V79A 5FD5A 5H6RA 5EGOA 3GMEA 5E17F 2OJED 3ERED 4A3LJ 4OIOF 2VJ5A 1N75A 2MYSA 5LLQA 1XPXA 2VBYA 5DDGA 4NDLA 4Y7NJ 3OYGA 5K1YA 2BXZA 3I59B 1MGTA 5EGOB 2IGNA 4ZDPA 4EGYA 1H0MA 1C0WA 4I01A 3WGHA 1IO2A 3QU3A 3CMEI 4PJMA 4MTDA 2P5LC 3ZQIA 4IL6C 3V7SA 4DNCA 1U0JA 4C3JJ 4A6EA 2DMTA 3JRBA 4ZZLA 5EF6A 1QA6A 3ZPLA 3JRIA 1L3LA 3LQRA 4L18B 4WB3A 3TOBA 5B66C 1VQ5I 2GAUA 4M3BA 2H1LA 3LSTA 3G71I 2R93J 3HG9A 3ABUA 1OPCA 1B9NA 5M3MJ 2CV2A 1NHAA 2R7ZJ 2DDAA 2CJJA 3IAM2 2A6HF 2BOLA 3ZMDA 2H94A 5HODA 3JTGA 3AG3H 1YS7A 4FXGB 1Z77A 4WXHA 3TO6A 4D5CA 5FJ8J 4U88A 2NVTJ 2ID3A 4P9FA 1J75A 2LBFB 2D1VA 1RKWA 3JTHA 3MZ8A 2ZXWH 1ONVA 5CYVA 1O7FA 2M34A 4AWXB 2CRGA 3HPGA 1EV7A 4L9TA 4GRIA 2E2IJ 4DBQA 4L9NA 3ZQGA 3GTPJ 2IPQX 4RGRA 1YW7A 3FZVA 4YIFA 1UAAA 4BHPA 2RN7A 2WY8Q 2RQQA 4YEJA 3GFJA 2VC1A 2ZSIB 2EZKA 3SFIA 1U8RA 4PJNA 2COMA 1T39A 2WBMA 3LSKA 3PJRA 3S17J 3H36A 5HS7A 3G1MA 2XAQA 1REPC 1IXSB 1FWZA 2DCEA 5BNGA 4E7IA 2LDUA 4RAFA 1SEUA 5LFAA 1ON2A 2O0YA 1K78B 4F55A 1RRJA 2LP0A 3CTAA 2A73B 1P7IA 2Z9OA 4DBRA 3FXUA 1D5YA 1HA8A 3KEQA 5AONA 5HLHA 1YJNI 4IHSA 3SYTA 2GWRA 2RAEA 1SVLA 1EH6A 5GADJ 3I55I 2DPUA 2RC4A 5HDKA 5D5VB 1T0FC 4NUBA 2DODA 5HLIA 3CP8A 1S9HA 3J80Z 3GCMA 3FWEA 2EPFA 5L3GA 4HDUA 5IOYA 3VEPA 2A61A 1OR7C 3FKJA 4XRMA 1VQ4I 3ISPA 4LGWA 3CJQB 1X1AA 3E0JB 2OUMA 2Y69H 3L00A 4ENJA 5B4PB 1BJZA 1R23A 3MZHA 4KN7X 2X1DA 3E3VA 4RM2A 5ILVA 1X4PA 1YQAA 4U87A 1LB2A 4HW0A 3KZZA 4M6XA 2EZHA 4DYCA 2K4BA 2V9VA 1BBYA 1H8AC 3IH3A 2B0LA 2JRTA 4H4KC 4Z2YA 2ELJA 4A3JJ 4ZZDA 3H9GA 3ESWB 4Z6YA 2Y9ZA 2HXOA 4V2GA 2IEKA 3MEXA 4II2A 1XMKA 4Y17A 2I10A 4BKXA 5J4VA 5BPIA 1SD5A 2D1HA 4EJTA 2FNAA 1G3SA 1XCVA 3C7JA 2MD5A 3KP2A 5KK1A 2VLAA 2MA3A 5FLXK 4I6OA 3I9V2 1ETYA 2Z2SB 3S3OA 1S72I 2FU4A 5HS8A 3ABKH 1R9TJ 3BTIA 3W2WA 4DIQA 4CSWA 3T8RA 4OIQF 3ECHA 4ZDOA 1XD7A 2UXXA 3CUQC 4AVZA 5LHIA 4EGZA 4CYCA 2L54A 4BXUA 2HVRA 2HDDA 4KIGA 3P9KA 2K5CA 1RIOH 1J5YA 1O57A 4CYCB 1ZELA 2BV6A 2EK5A 2RDPA 1K6OA 1WH5A 1G3YA 2CUEA 2R7XA 2VUMJ 5EG0A 1MNDA 3BTJA 3RKWA 3RZDJ 2A69F 1BR4A 2ZB9A 5IPAA 5H20A 2V4JC 2ELHA 2R5ZA 3FK7A 3U9GA 4A3FJ 3RPUA 4ZYAA 1QBJA 4F92B 1G3TA 4BH9A 4N4NB 2QF7A 4HQEA 2BY3A 2CQNA 2QQAA 3JREA 4PFOA 2AXLA 3LAJA 1EH8A 1ERDA 2WV0A 5D6FA 2WAQN 3NWSA 2R5ZB 4ESJA 4BJTA 4O3MA 4FE7A 2FQ4A 4XMYA 3I4PA 3CMAI 1WSUA 5FLVA 3BT9A 4P3AA 2QEXI 1QHHD 4CZCA 2FMYA 2P5VA 1FOWA 4GCVA 2JRMA 2NS8A 2ZBKA 2CQXA 2ZXHA 3HQAA 4EM0B 4NHJA 3H0DA 1B59A 4A0XA 4IO9F 4B4CA 1YIJI 2O3FA 2UZKA 1I1SA 4KA4A 2QSFX 4PUSA 4ANJA 2ZJRF 3QU6A 2UWMA 4B43A 1ETXA 4AVPA 5JHFA 2LTPA 1KZHA 2HS5A 2VE9A 1DGWY 1GHCA 1TT0A 2VKVA 2LMDA 3KZYA 5DS9A 2M87A 1U2WA 3HTSB 3DXJF 4A3CJ 2LOOA 2ECBA 1ETVA 3HHHA 1TWHJ 3LFKA 2L0KA 5F0FA 5GP9A 3BJAA 1QPMA 2R7VA 4A12A 4HEA2 1MDMA 1ODDA 1QPIA 2L9RA 2XPWA 4FE4A 3J7YJ 3A1YA 1SFUA 1IRGA 2WAQA 2VPRA 4ZTJA 1XGMA 2Q0OA 3EUHC 4PK4A 3E6DA 4IHYA 4XOPA 1K4TA 2R7TA 3BPXA 5HS9A 2XGCA 4ZTFA 4M9ZA 4MHGA 1HQCA 4UV9A 3P9IA 1TTYA 3GTJJ 2HXIA 5M5WJ 1S8NA 3QQAA 2DT6A 1UCRA 2JSCA 2COBA 2NVUB 5L3FA 2NS7A 2QLZA 1LKXA 4PGHA 4KJZA 2HVQA 4B48A 3G6EI 1STZA 2CO5A 1WH7A 1TW2A 3KEYA 3C2BA 4ZC3A 4FCYA 2R7UA 2DK5A 2JUGA 2V1DA 5GAEJ 1ZGWA 2K9NA 2X51A 3VOEA 4IRIA 2EFQA 5K7ZA 3WTSC 2HDWA 1OCRH 1T8IA 2GXBA 3E1SA 4KMUX 1IN5A 4CXFA 3HL2A 2F6CA 3K4BA 1GDTA 1EF4A 3EYIA 2NXNB 4XN0A 1G2HA 4NC8A 4BY7J 2RREA 3WGGA 4M71A 3L9FA 3OL4A 4BXFA 3OSFA 1GVDA 3ZMUA 3WTXC 3IWZA 1BR1A 2MH2A 3M3YJ 4OMYA 4XRSA 3CF5F 2KFDA 2GA1A 4MFEA 1BM9A 2K7LA 5TJJA 3RQIA 2AS5F 4CYDA 3S1MJ 4P1WA 5IT9K 4WXDA 1TWGJ 4HG2A 3CC4I 2Y9YA 3E5QA 2IS6A 4Q47A 3ZQCA 2Y0SN 1ULYA 4XKWA 5ILSA 1WHUA 1IRXA 1T56A 1U5TA 3ZMTA 1AKHA 3TBIA 1OCZH 2E71A 3TL4X 1HKTA 1BI1A 2VBXA 4HF2A 4XORA 1SANA 3OYJA 2QCOA 1U5TB 2XF7A 2X6WA 1VQOI 2HOSA 1WPKA 3WHBA 1ITYA 4M3GA 4ITVA 1FYMA 4BJ5C 3B6AA 1X2NA 3EUKL 3H3VK 1X58A 4KNYA 4KMFA 1V5GA 5HVQC 3ABMH 3L1PA 2VJJA 1Y56A 2XKOA 4F7ZA 1N25A 1A6QA 2KIMA 3F8MA 4P39A 5JFRA 4M6VA 1MJBA 3C3WA 1SFKA 3FIWA 4CUGA 1YG2A 1IAWA 5AIPA 1SFOJ 1IDZA 2HZDA 1MBHA 4D1QA 5D8LB 1LEBA 3MZYA 2JPCA 1ZR2A 4B44A 4HLXA 2X6XA 3SHFA 2MG4A 1I3QJ 5DM7F 2IXSA 5HNHA 4N4OB 3E6CC 2OQRA 2FXAA 2ZMEA 3EETA 2FE3A 4ENKA 2Y0SA 2OQGA 1XC5A 3CJNA 1MSFC 4BQOA 2IGMA 4D0PA 2CW8A 1FPQA 4P55A 3ZMZA 3M1CA 2VBWA 2W84A 2IA0A 1W1WE 2HEOA 3GTQJ 4XKBA 1KA8A 3IRQA 3MD2A 2QVOA 1FTTA 5ICGA 2VQHA 4EJVA 1K4SA 5IYCJ 1BIBA 2CQKA 3FBNB 4XRFA 1USSA 4AC0A 1G8XA 2C6YA 2VBZA 2OTLI 2XF6A 2JA6J 2R7OA 2AO9A 1F5TA 2W85A 3CD6I 4JYKA 3HOYJ 3QWLA 2MBFA 3U1KA 1MBGA 4X6AJ 2CMPA 1FOKA 2LF7A 1XTAA 4PJ0C 3F6OA 4IJAA 2CQQA 4ZYDA 2V1NA 2KDOA 5FFZA 5CVVA 2B39A 4A3BJ 2DT7B 2CFOA 3H5AA 4L5EA 2E5ZA 4NNJA 4LB6B 2PFBA 2VQLA 4C30A 3W2VA 4DGWB 5LGUA 3J7ZI 4LG0A 3BG6A 2LG4A 2KT0A 4Y4RA 1A35A 2A5WA 3P5JA 1R58A 2DYSH 4LG0B 3CLOA 2LC2A 3JSOA 2H8RA 1OFCX 4JX5A 4FASD 1YO5C 5GAGJ 1QO0D 2STWA 1V4RA 2PQ8A 4HOBA 4BE1A 3GYHX 4BE0A 1ETKA 5FLXZ 1FX7A 3E5UA 3DCFA 4D9JA 2H1KA 4P96A 1Z7UA 3G1LA 5KVRA 1XG1A 5IY5H 2JA2A 3RYPA 5EZHA 1TQMA 2HPMA 1R36A 4JP0A 2FJ1A 1ZG1A 2K27A 1Z9CA 2GIVA 1YW9A 3E97A 2ESNA 3IP4B 2MSYA 2V6CA 4ESBA 1FZPB 1LDDA 1QZEA 1IJWC 2DA5A 4UB6C 2EA4A 1YI2I 5CJ9A 3Q0VA 1FIPA 5L3BA 5C44J 3WU2C 2VC0A 4CCNA 4XIDA 4A3DJ 1KYZA 2KIFA 3PO2J 2J5PA 1KJSA 4ON0A 4OAZA 4BS9A 2P0WA 3KPHA 3OYAA 4ENNA 2VODA 3QOEA 3S93A 1S6LA 3LA2A 1OQYA 4E7KA 3O8HA 3CC2I 5DM6F 1AU7A 3BTLA 3I4NJ 2GM4A 5FROA 5D4SA 4U0YA 1E3HA 2ESHA 2DLLA 3EYYA 2RNGA 3M7GA 5JR3A 4CICA 2M1BA 5EEHA 1WFXA 1GXPA 4HV5A 5F1JA 1FY7A 3ZP5A 2ZFWA 2R3SA 4EATA 1BN5A 3IUOA 2R7WA 3TMOA 2WY7Q 3OIPA 3QYFA 2GBYA 5E8GA 3ZQ7A 2MC4A 3LSRA 1ZLKA 2JJ7A 2DDBA 4AYBN 2MLGA 4MLOA 4XBFA 1Z1DA 2VASA 4WK8F 4Q4ZF 2H6CA 2XVCA 3BPVA 1T95A 2F48A 4C2TA 4UU9C 3FXQA 3GUDA 1B72A 1T2KA 4Q5SF 2LK2A 4BACA 1QGPA 1S7EA 3OR2C 4IHTA 2IRFG 3GTGJ 1LNWA 1ETQA 3PNVA 3FBIB 1SFEA 3ZOBA 2P4WA 3GXOA 4JOMA 1B72B 1FC3A 1B8IA 4YIRX 1USTA 2E19A 3NEUA 4O5VA 1CF7A 1JHHA 3VSLA 4JX4A 4XSZF 1F43A 1H9TA 3PQKA 1U78A 1FOYA 1ZN2A 1B8IB 2HQNA 5B3SH 3BTCA 3HSRA 5M5XJ 4G7HF 1CF7B 5LGTA 3RZOJ 2CW0F 3JSPA 3WTTC 3HKZN 3DV8A 4R8HA 4E6KG 2FUG2 5B5EC 2MW8A 3F8CA 2L4AA 5B1BH 4A3GJ 2XROA 3KP7A 4D5FA 2CYYA 2DMNA 3CO6C 1Y39A 4IEJA 3NAUA 4LB5A 1I3AA 3OV8A 3BY6A 2MGQA 3ULQB 4AYBA 2OD5A 4II3A 3DLAA 4RB1A 4I0BA 3SDGA 1U9OA 3BG3A 3O3KA 5J47A 2L7ZA 3CCSI 2KLOA 2QQBA 4BNCA 3ABTA 1KU2A 2OCEA 2XGEA 1DDNA 3SDBA 2KIQA 2DT5A 2HYFA 1TW3A 4CO8A 2F5CA 5E3LA 2K9SA 1MZBA 3K1MA 4M73A 3RPQA 3FM5A 3IC7A 1HW2A 2Y31A 4XLHA 3RCOA 2DA6A 2KISA 3BP8A 2XAJA 3CLQA 3I54A 3QPLA 1WGXA 5IYBJ 4A3KJ 4BAYA 3DEEA 5JI6A 1IN6A 4S0HB 4FXKB 2EZIA 3Q3SA 1QNTA 2OZ6A 2JK3A 1WVRA 2CV1A 4CHUA 3HKZA 4AIJA 5IT9Z 1BI2A 4UXNA 2VONA 5BOXA 3DKYA 2EV0A 2KRFA 3CDIA 2P6SA 3R6SA 3T8TA 1JI8A 2GIZA 2P7CB 3HBLA 3RDIA 3OYFA 3AFHA 4KITB 3BDDA 2XSJC 3D1NI 2IGKA 1IV8A 1FBSA 1JTYA 1R5HA 2VKDA 3V8JA 1A6IA 2LY1A 5EYRA 4RDUA 1IRZA 2XKPA 1W5CC 2M8EA 2K85A 1E3OC 4QSHA 1BI3A 2L01A 1E2XA 1DP7P 2VOPA 4W1UA 4A0ZA 5LBQA 2M3AA 4GYIA 2OA4A 3O2PE 4XLPF 1DU6A 3DKWA 2CW7A 1WJFA 5HDGA 2VQGA 1W0UA 1F9NA 4M3EA 1Y8QB 1EH7A 2EFWA 3F72A 2WTEA 2B63J 2DQRA 4WB2A 1B4AA 4IRGA 2V7FA 2VXDA 4RAGA 1JT6A 2LVSA 4FISA 4GO1A 1ZQ3P 2QUFA
chains in the Genus database with same CATH topology
2ZXHA 3DPTA 3H0DA 2L5QA 2KHMA 1MMDA 1X19A 4HNUA 4ZDLA 2Q2EB 2R7SA 3VYTB 1VZ0A 4OWRB 4PUSA 4XNFA 4ANJA 3CF2A 2WAEA 3K10A 2UWMA 1D1CA 3BCBA 2BVMA 4B43A 4F3QA 1SAUA 3PFYA 5JHFA 3L2QA 2DXIA 3L2VA 4X0GA 3H35A 3CJRB 1DGWY 1TT0A 2JSPA 3HPHA 3S3MA 1Z7LA 1KONA 1BOBA 4BJ6C 1EA3A 4PFPA 2LOOA 2CUJA 2K9LA 2E1MC 1LFPA 4NQWB 5HLTA 2IS1A 1WJ5A 1P9QC 4PJJA 5CPRB 2MABA 2R7VA 2V6EA 4HEA2 2ZFUA 3OS1A 3A1YA 3LSMA 3DTEA 3LSIA 2HNHA 2WAQA 1R6RA 4Y33A 4ZTJA 4PK4A 3EUHC 3PNYA 4J00A 4PSXA 4XLFA 4P5OA 4XOPA 2R7TA 2DOAA 2LH9A 4E7JA 2L9SA 3LFUA 4IQ4A 4ZTFA 3NWTA 4CCOA 3KX2A 3QODA 1W36D 5FRNA 1FMVA 3MMYB 4DOZA 3MKZA 3BG7A 2DT6A 3C2HA 2KQRA 2M7AA 4E7ZA 2VPLA 4E7HA 4PJLA 2VKHA 4FETA 1LKXA 1MMNA 4KJZA 1K6YA 2HVQA 3C2GA 4B48A 3OYKA 5LD2C 3OS2A 3OYNA 4BQNA 1J09A 3K70C 3KEYA 1X1BA 4ZC3A 2R7UA 2BW3A 1Y6IA 2JUGA 1LVKA 3H5NA 2V26A 2X51A 2HDWA 3MKWB 1YE9A 2WAFA 2BW3B 2MFZA 3E1SA 2Z1DA 3HL2A 3RSNA 3A4CA 2F6CA 3K4BA 2K9MA 4CH7A 4XN0A 4NC8A 4CCJA 2RREA 3OYMA 3S3NA 2E1MB 3OL4A 4BXFA 1X4OA 3DKXA 1MW7A 2M0MA 3OMYA 3K6GA 1BR1A 1MNEA 4BEHB 4AU7A 1DP3A 4F93B 4PSWA 4R79A 3ZQQA 1WJCA 2L9NA 1UG0A 3DTIA 3K4JA 2JVGA 2WA0A 2L7KA 3OR1C 4P1WA 2CS3A 4HPQA 4HG2A 2UV1A 4E7SA 4XM3A 2IS6A 4XKWA 3OYEA 1IRXA 4CCLA 2V9KA 3TBIA 3TL4X 1YX3A 2HPIA 3K4MA 3RPUD 3ZRGA 4B3XA 3AL0C 4XORA 3PSFA 3OYJA 3DTKA 3UNGC 2XF7A 2X6WA 5KHDA 2KZVA 4ITVA 4BJ5C 3EUKL 2M7BA 4LIUA 3D5LA 4BDZA 1N78A 3OYIA 4HRIA 1X1DA 1V5GA 5HVQC 4BL0B 2VJJA 1Y56A 4HSRA 3DU6A 2UUZA 2X1CA 1TZLA 2VQCA 3HOSA 4C9YA 3DPUA 3CMMA 3OYLA 2QKLB 3DPLC 3OYDA 2LBFA 4CUGA 1SFKA 3K4LA 2XC7A 2HZDA 4JQFA 3FHNA 5TGTA 2PJRA 5CKTA 4D1QA 1AA7A 2KRHA 1MMGA 2JVHA 3PNTA 4B44A 2X6XA 2W4SA 3VWBA 3W3CA 2IXSA 3VYSB 4N4OB 5HNHA 1GLNA 2A6TA 1D0XA 2PJRB 4XL9A 3QYBA 3V42A 1PYVA 2GOXB 3I3LA 2KL4A 2QKMB 4U7BA 4YELA 3LL7A 1Z21A 2CV0A 2Y0SA 3EPZA 4G6TB 4BQOA 2IGMA 2CW8A 3H9QA 3BC8A 3HUGB 3M1CA 2GOMA 5CQEA 4XKBA 4Y3OA 3SZGA 2PMZA 3MD2A 2LY2A 2VQHA 4BU2A 3D5RC 3CESA 3SEQA 4XONA 2I8DA 2WB1A 3FBNB 4XKVA 3H9JA 1NG7A 1G8XA 4RMNA 1WJEA 2XF6A 3FDYA 3L2WA 3CP2A 4LG3A 2R7OA 4E4HA 1UELB 4BQQA 4F91B 2E5NA 2Z16A 2W82A 2F5VA 2LYCA 4IZZA 2CMPA 1MMAA 2VJIA 2IS2A 4XN3A 1BR2A 1Z3YA 3VYUB 3MKYB 2V1NA 2KDOA 2AQEA 1YX5A 2DJIA 3H5RA 2DT7B 2F4IA 1D0ZA 3DU5A 2CFOA 3H5AA 4NNJA 2E5ZA 4J01A 4C30A 2VQLA 3W2VA 4DGWB 3K4CA 3BG6A 2LG4A 3LSGA 4RM3A 4Y4RA 3K4KA 3ZCOA 3BCAA 3AKZA 2A5WA 3QYEA 3U21A 3K4NA 4HSTA 1N77A 3OY9A 2LC2A 4LITA 2E60A 4FASD 3OL3A 4BE1A 2K3PA 4BE0A 2KMUA 3PL8A 2W1OA 3OOUA 2Q1ZB 4D9JA 2NOJB 4ZJZA 1G59A 2R7RA 1FMWA 1N75A 2VJ5A 2MYSA 3VDXA 2JA2A 3M8JA 4OAYA 2HPMA 3OYGA 3EUAA 3J7AY 1D0YA 1D1BA 3IP4B 2IGNA 4ZDPA 4XLCA 3HC7A 5KNLA 3OYHA 3OYBA 2MD0A 2HVSA 2XAUA 3GBGA 3OS0A 4PJMA 4CCNA 2R4GA 2KPMA 1Z3XA 4OAZA 4BS9A 3K70D 1U0JA 4B47A 3G2BA 2P0WA 3OYAA 2CH0A 3QOEA 3S93A 4E7KA 3RQ4A 5FROA 3LMMA 2ZSHB 4YRVA 3DQVC 4E7LA 2RNGA 3HG9A 1WFXA 1QU3A 2CV2A 2WADA 5HNFA 1DGRM 1NG6A 4KT6A 4XLAA 2XF5A 3IAM2 2BOLA 4FXGB 5JPMB 4EATA 3IUOA 2LBFB 2R7WA 3TMOA 2WY7Q 3OIPA 3QYFA 3OIQA 4BE2A 2MC4A 3HPGA 2AQFA 4GRIA 4MLOA 3CZ6A 2VASA 4DBQA 1WJAA 3SEZA 2CUZA 2X85A 1UAAA 1T95A 2WY8Q 4C2TA 2RQQA 2W7NA 4YEJA 2ZSIB 1W36C 4CCKA 4BACA 4PJNA 3S32A 2LREA 2WBMA 3LSKA 3OR2C 4DJAA 3PJRA 3PUBA 3PNVA 3FBIB 2DCEA 2LRDA 4JOMA 4E7IA 5KCMA 4BUPA 4XQFA 2VB6A 2X1EA 4KISA 5LFAA 3AL0B 2L2OA 3HXLA 1LDKB 3PSIA 4F55A 2M4KA 3F9KA 3VSLA 4DBRA 3DWLE 3A2KA 3ZR8X 1HA8A 2KP6A 3L2UA 4F52A 3SYTA 2KRCA 4RLQA 4XLEA 3RTRA 4E6KG 2FUG2 1T0FC 4NUBA 1WJDA 3CP8A 1S9HA 4C2UA 2ZXIA 1OR7C 3FKJA 4AYBA 3CJQB 4II3A 3DLAA 1X1AA 3E0JB 2OUMA 3LSHA 3N05A 4QPQA 4XR6A 2X1DA 4RM2A 2IS4A 1X4PA 2BVLA 2KLOA 4U87A 3ONQA 4IKFA 4IX7A 3UR3C 5CQGA 3SDBA 3D5SC 4LIVA 3BLYA 4CA0A 1X1CA 2OC6A 2O5RA 2OV7A 2VJ4A 4XLHA 4H4KC 3RCOA 1E0EA 2ELJA 3H9GA 5FRMA 1V5FA 4II2A 3DEEA 3ZGKA 1DQUA 1QHGA 2VXZA 2CV1A 2VLAA 4BEHA 3I9V2 3HKZA 4BDYA 2Z2SB 3OYCA 3S3OA 1WJBA 3DKYA 1OLTA 4DIQA 3W2WA 3HOTA 1V5EA 4CSWA 4IQJA 4ZDOA 1JI8A 4AVZA 2W00A 2X6YA 2HVRA 3OYFA 3AFHA 4KITB 2XSJC 2IGKA 3KYLA 3L2RA 2K5CA 2R7QA 2VKDA 1PJRA 1ZELA 2LY1A 3VSKA 3W2AA 4CCMA 2R7XA 3ZXSA 1MNDA 1BR4A 2VL8A 1D1AA 2V4JC 4QPOA 2HU9A 2M4GA 3IAS2 2M3AA 2IGOA 4ZYAA 4F92B 4N4NB 2CW7A 1WJFA 2VQGA 2HQAA 3OWTA 4PFOA 4HNTA 1ERDA 3NWSA 4BJTA 4BGDA 4XMYA 4XOTA 3VYRB 5HOOA 4NC7A 2V7FA 2VXDA 3S8PA 1QHHD 4RLFA 4CZCA 4XKCA 2VIXA 2XDVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EA3 A;  2Z16 A;  1AA7 A;  4IQ4 A;  3MD2 A;  4PUS A;  3VDX A;  5CQE A;  4D9J A;  4ITV A; 
#chains in the Genus database with same CATH topology
 2EBI A;  1R1T A;  2YX4 A;  3JRH A;  4KDP A;  3DPT A;  2L5Q A;  3SQN A;  2KHM A;  2DFF A;  1MMD A;  3LOC A;  2KZG A;  1X19 A;  2LD5 A;  1M1E B;  4HNU A;  2E7W A;  1UHM A;  1G3W A;  5H6Q A;  1VZ0 A;  2R7S A;  4OWR B;  2E1N A;  1VFC A;  1Y1W J;  3CF2 A;  3KE2 A;  2DXI A;  3L2Q A;  3ASN H;  3FXO A;  3S1Q J;  1R5G A;  2CSO A;  5EEA A;  4LLN A;  1OIS A;  2JSP A;  1BOB A;  3KP5 A;  1YYV A;  2XPU A;  1FNN A;  2K40 A;  3S1N J;  2K9L A;  2W48 A;  4D7N A;  1YLF A;  2DA7 A;  2DMQ A;  1WJ5 A;  4EEF G;  4XIC A;  1BL0 A;  4AM3 A;  1FSE A;  3HRU A;  2HTJ A;  1Q1V A;  1FT9 A;  3BQZ A;  4HYE A;  2EV5 A;  2FBI A;  3LSI A;  1SVO A;  2KKO A;  4M74 A;  5DCM A;  1B9M A;  4KN4 X;  4PSX A;  2H27 A;  1Z0X A;  5C4X J;  2Y30 A;  3LSJ A;  2DOA A;  3REO A;  2M0C A;  1BOA A;  1TLH B;  2HOT A;  2Z5U A;  5DCM B;  1ZGJ A;  1X2M A;  4YII A;  3FKI J;  2RNJ A;  1MBK A;  2GLO A;  5DTD A;  1XDU A;  1P2F A;  1FMV A;  1K7A A;  1U5T C;  5CVI A;  3BG7 A;  2DYR H;  3C2H A;  4RGU A;  1WQ2 A;  2O61 A;  3DBR B;  4UUT A;  3H3Z A;  1K6Y A;  3C2G A;  3IWF A;  1X3U A;  3OYK A;  2GZW A;  3OS2 A;  4BQN A;  3K70 C;  3RKQ A;  1X1B A;  1Y6I A;  2PJP A;  4M72 A;  3JRF A;  5B1A H;  1UMQ A;  2FA5 A;  4AD9 A;  5FFX A;  2KJB A;  3HGY A;  4HX8 A;  1YE9 A;  2MFZ A;  3RSN A;  1FEX A;  3CCL I;  2K9M A;  1O3T A;  3OYM A;  5DYM A;  1ZH5 A;  2ZC2 A;  2E1M B;  1W7P D;  1X4O A;  1KU9 A;  1MW7 A;  1J7K A;  5IOZ A;  3K6G A;  3IRR A;  4UUV A;  3CO7 C;  1W7P A;  3DP7 A;  3ZN0 A;  3ML6 A;  4PSW A;  1IUF A;  3ZQQ A;  4CDG A;  1W7P B;  2L9N A;  1UG0 A;  2JVG A;  4E7S A;  1JT0 A;  2NVX J;  1VQ7 I;  1FP1 D;  4DZJ A;  2DMP A;  3PM1 A;  3I5U A;  3CMY A;  3A0B C;  3BR2 A;  4BHB A;  2V9K A;  2MC3 A;  2EV6 A;  2IA2 A;  2X9D A;  3TKY A;  1YX3 A;  2HPI A;  3HRT A;  3RPU D;  3TP3 A;  4B3X A;  3AL0 C;  1QVU A;  2RGV A;  2ECC A;  2JWT A;  3GW2 A;  3ZQH A;  5EG0 B;  2VI6 A;  1JE8 A;  1D3Y A;  3WG9 A;  1O4X A;  2M7B A;  4GDF A;  3D5L A;  4BDZ A;  5IP9 J;  1X1D A;  4IHV A;  4FT8 A;  3GTO J;  1TWC J;  4HSR A;  3DU6 A;  2X1C A;  4B3A A;  3HOS A;  3HRM A;  3DPU A;  3CMM A;  1Y1V J;  3RYR A;  4A2U A;  3OYL A;  3DPL C;  3KIO A;  3QP5 A;  1NK3 P;  3H0G J;  4A3E J;  3K1P A;  3K2Z A;  3K4L A;  1HDP A;  5TGT A;  3FHN A;  3K69 A;  1HF0 A;  2OZU A;  1F36 A;  2VN2 A;  2HQ5 A;  1MMG A;  3PNT A;  1MJA A;  1U3E M;  3B02 A;  5J8C A;  4LFU A;  3HOW J;  3KET A;  4LOC A;  2W24 A;  3VWB A;  3W3C A;  4WX9 A;  2A6T A;  1D0X A;  4M6Y A;  3QYB A;  4CZZ A;  2WWY A;  3W6V A;  1B1B A;  2JN6 A;  4B1R A;  1ZTR A;  1Z21 A;  3F0C A;  1H9G A;  1TQI A;  4OIN F;  3H9Q A;  3M9A A;  2HGC A;  3IH2 A;  2GOM A;  5KAI C;  5CQE A;  5EJC A;  1LJ9 A;  2EFN A;  4Y3O A;  3SZG A;  1ZR4 A;  4I6Z A;  1IRF A;  1MBE A;  1SMY F;  1UHW A;  1KQ0 A;  2K02 A;  1BA5 A;  4BU2 A;  3TED A;  1I1G A;  1XDS A;  4U0V A;  3SEQ A;  2YSR A;  4IF4 A;  2HDC A;  2V1X A;  5FKN A;  3I64 A;  4WWC A;  2D45 A;  5LRS A;  4RMN A;  1MDM B;  2QWW A;  2ZCW A;  1FOX A;  2QQ9 A;  4DZP A;  2RVC A;  4OMZ A;  3S2H J;  1IDY A;  2XRN A;  5F0C A;  2FBK A;  4HDV A;  2QZ8 A;  4TV7 A;  4IZZ A;  1MMA A;  1ZLJ A;  2FX0 A;  3R61 A;  5L3E A;  2F4M B;  5CLS A;  2IS2 A;  3MKL A;  3VYU B;  2HTS A;  4AIK A;  2BY0 A;  2AQE A;  4XL9 A;  3DU5 A;  3K2A A;  4DYR A;  4J01 A;  2J5O A;  3K4C A;  5F04 A;  2ISZ A;  1S7A A;  2D5V A;  2JA7 J;  2HQR A;  4MGR A;  3ZCO A;  1LFU P;  4A0Y A;  2IT0 A;  1LFB A;  2I5U A;  3HM5 A;  4WXC A;  3QYE A;  4B8X A;  3K7A J;  2YPR A;  3OY9 A;  4C3H J;  1VQL I;  4RAZ A;  2E60 A;  3S15 J;  2ID6 A;  3OL3 A;  4Y15 A;  1TBX A;  4BHC A;  5LEJ A;  4G6D A;  2ZKZ A;  3GEZ A;  4QTR A;  2HYJ A;  3HEF A;  1O3S A;  4KIB A;  4ZJZ A;  1FLI A;  3FHZ A;  1T6S A;  2R7R A;  1J9I A;  1ETO A;  2OU2 A;  1S7O A;  1RET A;  3I53 A;  1KU7 A;  4RGX A;  1Y0U A;  2M8G X;  1XGO A;  4OAY A;  4AUX A;  4YG2 F;  1P92 A;  3J7A Y;  1D0Y A;  3B73 A;  3R4K A;  1D1B A;  4IHW A;  3ECO A;  5KNL A;  4XLC A;  3HC7 A;  2DQL A;  2G7H A;  4BXX J;  1A31 A;  3OYB A;  4ZYG A;  3VB2 A;  1JHF A;  3BR5 A;  2HVS A;  2XIG A;  3HOX J;  1ZKG A;  5H2F C;  1W0T A;  4KYW A;  2XAU A;  3OS0 A;  2QM3 A;  4B09 A;  2R7F A;  4FQG A;  3K70 D;  5E79 C;  2VKE A;  4B47 A;  3QPH A;  2CH0 A;  1J0R A;  3MQ0 A;  3TDU C;  3WTV C;  2A07 F;  1AKH B;  1PDN C;  3RQ4 A;  3LMM A;  3R60 A;  4RA2 A;  2CQ7 A;  1YJW I;  4A3I J;  3SJM A;  4E7L A;  4RB0 A;  3BQY A;  3I71 A;  3A03 A;  1SVM A;  3F8B A;  4HW5 A;  4FHT A;  2EFO A;  3JAM Z;  4JBA A;  2WAD A;  1VI0 A;  3MWM A;  1NG6 A;  4KT6 A;  4XLA A;  3SZP A;  3L7W A;  4BQA A;  3GTL J;  3HQB A;  2XF5 A;  4OOI A;  1ETW A;  2BEO A;  2V1U A;  3J81 K;  3GFI A;  1JGG A;  2HWV A;  5E3O A;  3FXR A;  4L0Y B;  5JHU A;  3KP3 A;  1JKP C;  5TRD A;  3HSF A;  2DA2 A;  1D8J A;  2DFI A;  4BE2 A;  1MBJ A;  2K4J A;  4NC6 A;  3FMS A;  2EWN A;  1F1Z A;  1WJA A;  3SEZ A;  1WRJ A;  2XAH A;  5ILU A;  2Q2E A;  2ICW G;  2R0Q C;  5F27 A;  2E1C A;  3JCU C;  2PI0 A;  2LSO A;  4A69 C;  1I6X A;  4PZJ A;  1J59 A;  2ZME B;  1MNM C;  1MH3 A;  2R92 J;  1FP2 A;  2LRE A;  4U7D A;  2P81 A;  2W25 A;  2B7E A;  4AIH A;  2BY1 A;  3H1C A;  2VB6 A;  1VQP I;  3LA7 A;  2DJN A;  3AL0 B;  4J19 A;  3PSI A;  4LLL A;  4RBO A;  3F9K A;  3RKX A;  3DF8 A;  3A2K A;  3DEU A;  4KFC A;  2LKP A;  3CCJ I;  2KRC A;  2XAF A;  4RLQ A;  1RKT A;  1MBF A;  4N0B A;  1HKS A;  1LDJ A;  1PUE E;  5DUK A;  2RKH A;  3GZN B;  4UNO A;  2K9Q A;  1I6H J;  2BY2 A;  1WJD A;  2DTR A;  2EZL A;  2E35 A;  3W6K B;  3HIF A;  2Z33 A;  4ETS A;  4C2U A;  1D8K A;  1O3Q A;  1S29 A;  3HHG A;  3KFW X;  2CWE A;  1IF1 A;  2IJL A;  3V8K A;  2LR8 A;  3HB9 A;  2YR2 A;  4QPQ A;  9ANT A;  1MIJ A;  1T33 A;  3PIO F;  2IS4 A;  4IKF A;  3ONQ A;  2DMU A;  1E3P A;  3QPS A;  2LLK A;  3JRD A;  3M8F A;  5CQG A;  2OCC H;  1LEA A;  4P9U A;  1QVT A;  3WOD F;  4CA0 A;  1X1C A;  2P5K A;  2AXT C;  4IPA A;  3FMR A;  2OV7 A;  2VJ4 A;  3WE2 A;  5GTH C;  5ICE A;  3CDL A;  1GUU A;  5DCF A;  1R49 A;  1IXR C;  1X1P A;  5FRM A;  2YUS A;  5FKK A;  4S04 A;  1DQU A;  1U9N A;  4BY1 J;  1SFX A;  4UUS A;  3FMQ A;  2VXZ A;  2JTV A;  1UHS A;  4BEH A;  3WTY C;  4BDY A;  1DPU A;  3HOZ J;  2Z3Y A;  3ZQL A;  2YU9 J;  3KP6 A;  4IRH A;  4UUS B;  3HOT A;  3HTU A;  2CG4 A;  4BBR J;  1GVJ A;  4LLG F;  1CFA A;  1VTN C;  2R5Y A;  1RR7 A;  2Y0M A;  2ETH A;  1MMS A;  4OIR F;  1OJL A;  2W00 A;  1RES A;  2X6Y A;  1ZAR A;  2A5Y B;  4LJZ F;  3WTW C;  2R5Y B;  5E1Z B;  2VT3 A;  3WU1 B;  5KAF C;  1OMI A;  5M5Y J;  3L2R A;  2R7Q A;  2JZY A;  1PJR A;  1OYI A;  4D7M A;  3VSK A;  5E20 A;  4C3I J;  1PUF A;  5GTI C;  4M9S A;  4CCM A;  1HBX G;  1HKQ A;  5IT3 A;  2X6O A;  1FBU A;  3COA C;  2VL8 A;  1D1A A;  1RUN A;  3R0A A;  5BMZ A;  5J1Y A;  4QPO A;  2JQ7 A;  2HU9 A;  2M4G A;  3IAS 2;  4PCQ A;  1YOV B;  2IGO A;  2BZT A;  3QPT A;  5D8K B;  2HQA A;  3OWT A;  2N8G A;  1ZG3 A;  3IH4 A;  3LNQ A;  3S14 J;  4MTE A;  3JRC A;  3N4M A;  4XOT A;  1FTZ A;  3N97 A;  4V19 K;  2LKS A;  2DOF A;  1GT0 C;  1BIA A;  3BR6 A;  1HCR A;  2QQ8 A;  2XRL A;  2VIX A;  4RAY A;  2YU3 A;  2WV1 A;  5K5O A;  2QSG X;  2JT1 A;  3FX3 A;  5J8F A;  4ZDL A;  2OPT A;  3GO5 A;  1TT5 B;  4XNF A;  2WAE A;  1Z91 A;  3H92 A;  3ZN1 A;  4F3Q A;  3PFY A;  2PN6 A;  1UFM A;  4Q48 A;  4NQW A;  1X3Z B;  3HPH A;  3S3M A;  1ACI A;  3BG9 A;  5AIQ A;  5DUI A;  1EA3 A;  4G12 A;  4M3D A;  4PFP A;  2LFB A;  2PMH A;  2CUJ A;  3RJP A;  4DYQ A;  2E1M C;  3HZJ A;  3WE3 A;  4NQW B;  5HLT A;  1RZ4 A;  1SC7 A;  2JPB A;  3GX4 X;  1P9Q C;  1Y8R B;  2Z99 A;  5F1R A;  2M30 A;  4PJJ A;  5CVU A;  1H89 C;  2FOW A;  5CPR B;  1OYY A;  3GTK J;  1B6A A;  2MAB A;  1K83 J;  4IOC F;  2V6E A;  4HQM A;  3OS1 A;  4FTH A;  4I2O A;  3F6V A;  1TWF J;  1A5J A;  5GPA A;  1IXC A;  3HJE A;  3LSM A;  3SFZ A;  2HNH A;  4R1H A;  1R6R A;  2DW4 A;  4MO7 A;  4ZH4 F;  4L0Z B;  1MD0 A;  3FXJ A;  4I02 A;  4XLF A;  1FYK A;  3LWF A;  4P5O A;  5F08 A;  1XCB A;  3PO3 J;  2L9S A;  4WF2 A;  2BGC A;  3LFU A;  4IQ4 A;  3NWT A;  4QIW N;  1KGS A;  3CCR I;  4CCO A;  3AG4 H;  4YFK F;  3KX2 A;  3PIP F;  5FRN A;  2F5D A;  4G9Y A;  2QSH X;  3MMY B;  3CCY A;  2G7U A;  2M7A A;  3G73 A;  4E7Z A;  3VOD A;  1CGP A;  1VF9 A;  1R7J A;  4FET A;  4EJO A;  4HA8 A;  1MMN A;  1XS9 A;  1FIA A;  1Z67 A;  3F22 A;  2O6G E;  1IG7 A;  3HOV J;  1WWX A;  2K3F A;  2TCT A;  1JTX A;  3NQO A;  1V55 H;  3WGI A;  1RPW A;  2BHY A;  4I09 A;  3AAF A;  1LE8 A;  3MKW B;  1JJ6 C;  5BPD A;  4DW6 A;  4HX7 A;  2YX7 A;  2Z1D A;  4L9V A;  3A4C A;  3KLS A;  3GFM A;  4A3M J;  1OKR A;  1OCT C;  4IXA A;  3WTZ A;  3FXK A;  4KT5 C;  2IP2 A;  2JA8 J;  2Y2Z A;  3TOA A;  3VPR A;  3DKX A;  2EIL H;  1VND A;  4UVB A;  1VQM I;  1R22 A;  1GV2 A;  1MNE A;  3E6B A;  4AU7 A;  1DP3 A;  3I59 A;  4I98 B;  2G9W A;  3HRS A;  3M07 A;  4UB8 C;  3HGG A;  3DTI A;  3K4J A;  2GXA A;  1Y0N A;  1IZ1 A;  1JKR C;  2WA0 A;  2HOA A;  2L7K A;  3OR1 C;  3M8E A;  3PFI A;  3Q5F A;  4JK1 X;  1R1V A;  2DO7 A;  1LVA A;  1HSJ A;  4XM3 A;  2NVY J;  3MFK A;  2ZXJ A;  1TNT A;  3TGN A;  1NTC A;  2L4M A;  1BC8 C;  3ELK A;  3OYE A;  3KYC B;  2FNP A;  4CCL A;  5LEK A;  4W97 A;  2EFP A;  2X4H A;  5F0H A;  3K4M A;  3L09 A;  1W5S A;  3F23 A;  5J6X A;  3PSF A;  2PMZ N;  2PLY A;  5KHD A;  2A3S A;  4L5I A;  1YTY A;  2P8T A;  1XMA A;  3J81 Z;  2DAO A;  3I56 I;  1WI3 A;  1JKO C;  4LIU A;  3GZ6 A;  4DQ2 A;  2KIU A;  3OYI A;  4HRI A;  2EH3 A;  5F6F A;  3FF5 A;  2DK8 A;  3QP6 A;  3JAM K;  1G6N A;  3S2W A;  2UUZ A;  5J1U A;  1TZL A;  1WI9 A;  5EDN A;  2QKL B;  3DFG A;  2LBF A;  2F5F A;  4K2E A;  1XB4 A;  1D5V A;  5HLG A;  2H09 A;  1JKQ C;  1R1U A;  4HX4 A;  1HLV A;  2XC7 A;  4CGZ A;  2LNB A;  4JQF A;  5E18 F;  1XGS A;  2PJR A;  3TP0 A;  3Q9S A;  3X2Q H;  1MSE C;  1AA7 A;  2F4O B;  2EIN H;  2H8W A;  4MNU A;  3L2C A;  2ZNZ A;  1YS6 A;  1EKE A;  1YRN A;  3AG1 H;  1SD4 A;  4KUM A;  5FKL A;  5CVJ A;  1PP7 U;  3CCE I;  1GLN A;  4M9X A;  2PJR B;  2JUC A;  4V2F A;  1PYV A;  3V42 A;  1XMX A;  3I3L A;  2F5E A;  1YRN B;  5FKO A;  4U7B A;  1AOY A;  4YEL A;  2OBP A;  2CV0 A;  1S3J A;  3EPZ A;  4G6T B;  2BHZ A;  2EIM H;  5TIS C;  2BYV E;  5C4J J;  4IHX A;  4G6Q A;  3LSP A;  3KP4 A;  2FD5 A;  4G94 A;  1JUM A;  3A02 A;  5FD6 A;  2E36 A;  1R5I D;  4HZF A;  1K78 A;  2PMZ A;  5ED4 A;  2F2E A;  2LY2 A;  4Y13 A;  3D5R C;  3V7R A;  2Y48 A;  1X3W B;  4L9J A;  4N9I A;  4XKV A;  1BW5 A;  3TW6 A;  3E7L A;  1P6R A;  3ERM A;  3GFL A;  2NNN A;  3FDY A;  4I76 A;  3L2W A;  5A2Q Z;  3VFZ A;  2CU7 A;  1BC7 C;  1YIO A;  3M1E A;  3Q9V A;  3ZMV A;  4F91 B;  2E5N A;  3ROU A;  2Z16 A;  2W82 A;  4MFD A;  2L7F P;  2HKX A;  5DD4 A;  3A0H C;  2UXN A;  1V3F A;  4HF1 A;  2VJI A;  3G3Z A;  1NH3 A;  4XN3 A;  3MKY B;  4YFN F;  1YFH A;  3C18 A;  4RGS A;  4GFB A;  3H5R A;  2VPL A;  1LQ1 A;  4G7O F;  1IN7 A;  3IL2 A;  3LSG A;  4RM3 A;  2JA5 J;  2ELK A;  2DFE A;  3K4K A;  1VQ6 I;  3AKZ A;  3V4G A;  2DA3 A;  1BW6 A;  1IV6 A;  3U2R A;  2IAI A;  2Y75 A;  1NK2 P;  2XHK A;  4UVA A;  4ABZ A;  4N9H A;  5J4Y A;  2K3P A;  5K5Q A;  1QQI A;  2KMU A;  3PL8 A;  2LY9 A;  2PEX A;  3OOU A;  4YFX F;  2DFH A;  2NOJ B;  5E3M A;  1G59 A;  5DEQ A;  1A36 A;  4IOA F;  1FMW A;  2EQR A;  1IC8 A;  3VDX A;  1JUS A;  1SD6 A;  4RB3 C;  1JGS A;  1TNS A;  3BJ6 A;  3M8J A;  3P7N A;  1IN8 A;  3IV5 A;  5LHH A;  2ZME C;  3EUA A;  3QAH A;  4G8X A;  1LUJ B;  3OYH A;  2QYO A;  3QRF F;  5K7F A;  2H6B A;  3T1B A;  2MD0 A;  3O6B B;  5C3E J;  3GBG A;  2R4G A;  4ZYE A;  2ZO4 A;  3G4S I;  2KPM A;  1Z3X A;  4QLC U;  1T08 B;  2HKO A;  1VQ9 I;  3G2B A;  2DTZ A;  4HWJ A;  4KIF A;  3BWG A;  3EQL F;  4FX4 A;  5DV5 A;  4A5M A;  2ZSH B;  2EA2 A;  5FO5 A;  1BI0 A;  4YRV A;  3DQV C;  1Q1H A;  3P9C A;  1IN4 A;  4NBQ A;  1K79 A;  3CCU I;  1QU3 A;  1LPQ A;  3NRV A;  5HNF A;  1DGR M;  2GA2 A;  3F3X A;  4PGG A;  4EJW A;  3UKG A;  4HNV A;  2OF7 A;  3LA3 A;  5JPM B;  1ON1 A;  1ZYR F;  1P7J A;  3CC7 I;  4NB5 A;  2A68 F;  2VE8 A;  4E70 A;  1IUY A;  1TQP A;  3MVP A;  1RR8 C;  4PDK A;  2DA4 A;  3OIQ A;  1QZZ A;  2P7V B;  3BJO A;  3DBL B;  2AQF A;  1XSD A;  3CZ6 A;  1RNL A;  3JRG A;  3ZMS A;  2PX9 A;  1FJL A;  2NS0 A;  2CGP A;  2CUZ A;  2X85 A;  3IKT A;  2ZNY A;  2W7N A;  2JMW A;  3LQQ A;  4CCK A;  1W36 C;  5K5R A;  3S32 A;  4DJA A;  1KQ8 A;  3PUB A;  1HC8 A;  4X1E A;  5IP7 J;  2LRD A;  3MN2 A;  3FIS A;  3CDH A;  4UHT A;  5KCM A;  4A6D A;  4BUP A;  1UJ8 A;  4XQF A;  2B9S A;  2LKX A;  2X1E A;  4KIS A;  1OYW A;  2RV8 A;  1ZHF A;  3CJT B;  2K86 A;  3EDP A;  2L2O A;  3HXL A;  1LDK B;  5J1R A;  2M4K A;  3TO9 A;  3DWL E;  3ZR8 X;  3AG2 H;  2KP6 A;  3L2U A;  1Z6T A;  2A6E F;  4F52 A;  3U1D A;  4LD5 A;  1IGN A;  4XLE A;  3RTR A;  4EVI A;  1ZRC A;  2XAS A;  5ICF A;  1VQ8 I;  4I0A A;  2E34 A;  2TDX A;  3WHC A;  2OTJ I;  2ME0 A;  2XPV A;  1KU3 A;  2HZT A;  3KLO A;  1GV5 A;  2L3D A;  1AHD P;  4JX6 A;  2O7O A;  2QA4 I;  4OIP F;  1ZGA A;  2ZXI A;  1WKM A;  1I5Z A;  3HOU J;  1S5L C;  2HYG D;  3HYI A;  1ZRF A;  2EIJ H;  1V54 H;  3LSH A;  5BQT A;  2P6T A;  2ZJP F;  2O9L A;  4A5N A;  3N05 A;  4XR6 A;  1XN7 A;  2L9V A;  3DBH B;  4BYY A;  4EM1 A;  2BVL A;  5JPN B;  1JUP A;  2STT A;  1TP4 A;  1O7L A;  4IX7 A;  2VOO A;  2XAG A;  1JXS A;  3UR3 C;  2ISY A;  4UV8 A;  2FML A;  3JW4 A;  3D5S C;  4LIV A;  1O3R A;  2DBB A;  3BLY A;  2ACJ A;  1FBQ A;  2OC6 A;  2O5R A;  1E0E A;  3Q0U A;  4MQV A;  2HOE A;  2WC2 A;  4LK0 F;  3K1N A;  3KCC A;  2FF4 A;  1V5F A;  3K0L A;  3CQZ J;  3CU7 A;  1QZY A;  3ZGK A;  1A04 A;  5M3F J;  1QHG A;  5FB2 A;  4U0W A;  3V8L A;  2FSW A;  3E5X A;  3OYC A;  3TQN A;  1WJB A;  1PP8 F;  2FRH A;  1T0F A;  1OLT A;  2EIK H;  3JRA A;  2QGU A;  1V5E A;  4IQJ A;  3G1O A;  2E1O A;  1SAX A;  1RC9 A;  1OR7 A;  2G0E A;  4UY8 I;  5D5W B;  2PMU A;  4XRS G;  1GXQ A;  1P4A A;  2M5W A;  3KYL A;  1OCC H;  3A01 A;  2XB5 A;  2D2W A;  4RB2 C;  3W2A A;  2E2J J;  5GPC A;  3BZ6 A;  3ZXS A;  3HSE A;  2QEN A;  3A01 B;  3C1D A;  1H88 C;  3ABL H;  4LK1 F;  3TW7 A;  1HW5 A;  1TC3 C;  1Z6R A;  4GYG A;  3JR9 A;  1OCP A;  2QBY A;  4QWQ A;  4HV6 A;  3F8F A;  2BXY A;  3PUF A;  5LGN A;  2E7X A;  2EB7 A;  3O8G A;  4MQ9 F;  3GTM J;  4HNT A;  1ZAO A;  1EJ9 A;  5JLX A;  4BGD A;  1ZK8 A;  2QBY B;  3VYR B;  5HOO A;  4NC7 A;  3S8P A;  2ZJ2 A;  4RLF A;  4XKC A;  2XDV A;  1FSH A;  1KQ9 A;  3KEO A;  2DPD A;  2KDZ A;  3NAR A;  3GWZ A;  4MEY F;  3F8N A;  4UVC A;  5FGM A;  5FKM A;  2M9H A;  4ZYH A;  1PVE A;  2Q2E B;  3VYT B;  4C2M J;  3SXY A;  2E2H J;  4IVN A;  1AWC A;  2L7M P;  3CUQ A;  3K10 A;  1D1C A;  3BCB A;  2BVM A;  1SAU A;  3BR3 A;  3L2V A;  4X0G A;  2PG4 A;  3CJR B;  3H35 A;  2XV4 S;  1Z7L A;  1KON A;  4OU0 A;  1WCM J;  3CUQ B;  4BJ6 C;  3E6M A;  3Q0W A;  4XSX F;  2EJR A;  3ASO H;  3RKY A;  2GXG A;  1LFP A;  1P4W A;  4BBS J;  2IS1 A;  2A05 A;  1VQN I;  2ME6 A;  4H0E A;  4HLY A;  4M3F A;  5J40 A;  3K9T A;  4Y52 J;  1T38 A;  3PQJ A;  3QOP A;  2ZFU A;  2HI3 A;  2DN0 A;  3DTE A;  1I27 A;  4HF0 A;  1L0O C;  4Y33 A;  3ZQF A;  3PNY A;  4J00 A;  3FM3 A;  5ERI A;  5A2Q K;  3GZ5 A;  2W57 A;  5D6E A;  3S16 J;  1F4K A;  1ZRD A;  2LH9 A;  1SD7 A;  1W4M A;  4E7J A;  1YHQ I;  5EEG A;  2O8K A;  2IVM A;  4FX0 A;  5CVR A;  2MH9 A;  4L5J A;  1P4X A;  3QOD A;  3WU0 A;  3I58 A;  1W36 D;  2RQP A;  4DOZ A;  3MKZ A;  1I50 J;  1ZG5 A;  3J80 K;  2KQR A;  4EQQ A;  2CUF A;  5LRR A;  4E7H A;  4PJL A;  2VKH A;  5GAH J;  4XK4 A;  2NRA C;  1QRY A;  5L3C A;  3I0T A;  5LD2 C;  3OYN A;  1J09 A;  1RI7 A;  2R7D A;  2BW3 A;  1TWA J;  2NAZ A;  1LVK A;  3J7A O;  5K7H A;  3H5N A;  2M45 A;  2V26 A;  3BR1 A;  3WG7 H;  5LHG A;  5D5U B;  3CCM I;  3BRO A;  3GLX A;  1OCO H;  4AID A;  5EZG A;  2WAF A;  2BW3 B;  1YIT I;  3IHU A;  1I39 A;  3BZC A;  1RUO A;  2XGD A;  5HDN A;  4CH7 A;  3GLL A;  4CCJ A;  1UG2 A;  2TRT A;  2X48 A;  3S3N A;  1VQK I;  1E17 A;  4EM2 A;  2AHQ A;  2NYX A;  2HR3 A;  3OIO A;  2M0M A;  3OMY A;  1SMT A;  4BEH B;  2DOE A;  1XSX A;  3CCV I;  4F93 B;  3EUH A;  4R79 A;  5F64 A;  1WJC A;  2O03 A;  5E8I A;  4P3B A;  1J2X A;  2CS3 A;  4HPQ A;  4RS8 A;  2UV1 A;  1TL8 A;  3KLN A;  3I4M J;  1R00 A;  4LMY A;  2FEZ A;  3CUO A;  3DEW A;  2DI3 A;  3LAP A;  1ZRE A;  3ZRG A;  1W5T A;  1PUF B;  1UB9 A;  3FXL A;  1DU0 A;  1ENH A;  3DTK A;  3UNG C;  1MKM A;  1MH4 A;  2IBD A;  3KZI C;  4WCG A;  2OAZ A;  3WTU C;  1C5A A;  1U6G A;  2KZV A;  1T98 A;  3RIR A;  4A93 J;  2WB1 N;  1N78 A;  1HW1 A;  4BL0 B;  1HXD A;  2GQQ A;  2FOK A;  3DLL F;  2X0L A;  4MEX F;  2MLK A;  2VQC A;  4C9Y A;  3W6J B;  4G7Z F;  1UZC A;  1XSV A;  3OYD A;  1WZ2 A;  4GGG A;  1IW7 F;  2DA1 A;  5CKT A;  1YJ9 I;  2KRH A;  2JVH A;  2BE5 F;  2XB0 X;  2FBH A;  2V9P A;  3SZT A;  2YS9 A;  5JLW A;  4XLN F;  3GF2 A;  2W4S A;  1R4M B;  4GXO A;  4ESF A;  3VYS B;  3R0J A;  2BBY A;  2XSD C;  2FQ3 A;  3CCQ I;  2GOX B;  4I99 C;  2KL4 A;  2QKM B;  2M2E A;  3HUG A;  3LL7 A;  1K61 A;  4ASN A;  1R71 A;  2PBI A;  5D4R A;  1G4D A;  2VT2 A;  3OOP A;  5E1X A;  2NVQ J;  5IYD J;  3BC8 A;  3HUG B;  1HST A;  2IW5 A;  1CQT A;  1JJ8 C;  3T5X A;  3H3U A;  3T0Y A;  2ZJQ F;  3S2D J;  3BOQ A;  3OSG A;  3CES A;  4ENM A;  2LF8 A;  1XX5 A;  4EMS A;  1U8B A;  4XON A;  2I8D A;  2WB1 A;  3H9J A;  1NG7 A;  1WJE A;  3HDD A;  3CP2 A;  5E1W A;  4LG3 A;  4I7H A;  4E4H A;  2NOG A;  5ICC A;  1UEL B;  4BQQ A;  1HDD C;  5JVT A;  2F5V A;  2LYC A;  2ADU A;  4HBL A;  2IA1 A;  3FK6 A;  3MAJ A;  2NNY A;  1XGN A;  3MCZ A;  5L3D A;  4KIC A;  4S05 A;  3F21 A;  6PAX A;  1BJA A;  1MJ9 A;  1BR2 A;  1Z3Y A;  2DU9 A;  3TDZ C;  5FLM J;  1YX5 A;  1FYL A;  1DPR A;  1ORK A;  1POG A;  2DJI A;  2F4I A;  1D0Z A;  4O6J A;  5E3N A;  3S1R J;  2L02 A;  3RI4 A;  3D0S A;  1DUX C;  3BR0 A;  5J3L A;  3BCA A;  5DD8 A;  4EJU A;  3B6C A;  5D5X B;  1HOM A;  3BZK A;  3BG5 A;  1Z05 A;  3U21 A;  3K4N A;  4HST A;  5JVG F;  1YW8 A;  2XGX A;  1N77 A;  5BS6 A;  3FXM A;  3M4O J;  3KYD B;  4LIT A;  1R4N B;  4MIM A;  3GVA A;  3IKV A;  2Q8K A;  3TO7 A;  1KYW A;  2KJC A;  1LE8 B;  2XUB A;  4EV0 A;  1APL C;  2O8X A;  2W1O A;  3V7C A;  2HFH A;  5IP6 A;  2Q1Z B;  2CFX A;  4HAM A;  2V79 A;  5FD5 A;  5H6R A;  5EGO A;  3GME A;  5E17 F;  2OJE D;  3ERE D;  4A3L J;  4OIO F;  2VJ5 A;  1N75 A;  2MYS A;  5LLQ A;  1XPX A;  2VBY A;  5DDG A;  4NDL A;  4Y7N J;  3OYG A;  5K1Y A;  2BXZ A;  3I59 B;  1MGT A;  5EGO B;  2IGN A;  4ZDP A;  4EGY A;  1H0M A;  1C0W A;  4I01 A;  3WGH A;  1IO2 A;  3QU3 A;  3CME I;  4PJM A;  4MTD A;  2P5L C;  3ZQI A;  4IL6 C;  3V7S A;  4DNC A;  1U0J A;  4C3J J;  4A6E A;  2DMT A;  3JRB A;  4ZZL A;  5EF6 A;  1QA6 A;  3ZPL A;  3JRI A;  1L3L A;  3LQR A;  4L18 B;  4WB3 A;  3TOB A;  5B66 C;  1VQ5 I;  2GAU A;  4M3B A;  2H1L A;  3LST A;  3G71 I;  2R93 J;  3HG9 A;  3ABU A;  1OPC A;  1B9N A;  5M3M J;  2CV2 A;  1NHA A;  2R7Z J;  2DDA A;  2CJJ A;  3IAM 2;  2A6H F;  2BOL A;  3ZMD A;  2H94 A;  5HOD A;  3JTG A;  3AG3 H;  1YS7 A;  4FXG B;  1Z77 A;  4WXH A;  3TO6 A;  4D5C A;  5FJ8 J;  4U88 A;  2NVT J;  2ID3 A;  4P9F A;  1J75 A;  2LBF B;  2D1V A;  1RKW A;  3JTH A;  3MZ8 A;  2ZXW H;  1ONV A;  5CYV A;  1O7F A;  2M34 A;  4AWX B;  2CRG A;  3HPG A;  1EV7 A;  4L9T A;  4GRI A;  2E2I J;  4DBQ A;  4L9N A;  3ZQG A;  3GTP J;  2IPQ X;  4RGR A;  1YW7 A;  3FZV A;  4YIF A;  1UAA A;  4BHP A;  2RN7 A;  2WY8 Q;  2RQQ A;  4YEJ A;  3GFJ A;  2VC1 A;  2ZSI B;  2EZK A;  3SFI A;  1U8R A;  4PJN A;  2COM A;  1T39 A;  2WBM A;  3LSK A;  3PJR A;  3S17 J;  3H36 A;  5HS7 A;  3G1M A;  2XAQ A;  1REP C;  1IXS B;  1FWZ A;  2DCE A;  5BNG A;  4E7I A;  2LDU A;  4RAF A;  1SEU A;  5LFA A;  1ON2 A;  2O0Y A;  1K78 B;  4F55 A;  1RRJ A;  2LP0 A;  3CTA A;  2A73 B;  1P7I A;  2Z9O A;  4DBR A;  3FXU A;  1D5Y A;  1HA8 A;  3KEQ A;  5AON A;  5HLH A;  1YJN I;  4IHS A;  3SYT A;  2GWR A;  2RAE A;  1SVL A;  1EH6 A;  5GAD J;  3I55 I;  2DPU A;  2RC4 A;  5HDK A;  5D5V B;  1T0F C;  4NUB A;  2DOD A;  5HLI A;  3CP8 A;  1S9H A;  3J80 Z;  3GCM A;  3FWE A;  2EPF A;  5L3G A;  4HDU A;  5IOY A;  3VEP A;  2A61 A;  1OR7 C;  3FKJ A;  4XRM A;  1VQ4 I;  3ISP A;  4LGW A;  3CJQ B;  1X1A A;  3E0J B;  2OUM A;  2Y69 H;  3L00 A;  4ENJ A;  5B4P B;  1BJZ A;  1R23 A;  3MZH A;  4KN7 X;  2X1D A;  3E3V A;  4RM2 A;  5ILV A;  1X4P A;  1YQA A;  4U87 A;  1LB2 A;  4HW0 A;  3KZZ A;  4M6X A;  2EZH A;  4DYC A;  2K4B A;  2V9V A;  1BBY A;  1H8A C;  3IH3 A;  2B0L A;  2JRT A;  4H4K C;  4Z2Y A;  2ELJ A;  4A3J J;  4ZZD A;  3H9G A;  3ESW B;  4Z6Y A;  2Y9Z A;  2HXO A;  4V2G A;  2IEK A;  3MEX A;  4II2 A;  1XMK A;  4Y17 A;  2I10 A;  4BKX A;  5J4V A;  5BPI A;  1SD5 A;  2D1H A;  4EJT A;  2FNA A;  1G3S A;  1XCV A;  3C7J A;  2MD5 A;  3KP2 A;  5KK1 A;  2VLA A;  2MA3 A;  5FLX K;  4I6O A;  3I9V 2;  1ETY A;  2Z2S B;  3S3O A;  1S72 I;  2FU4 A;  5HS8 A;  3ABK H;  1R9T J;  3BTI A;  3W2W A;  4DIQ A;  4CSW A;  3T8R A;  4OIQ F;  3ECH A;  4ZDO A;  1XD7 A;  2UXX A;  3CUQ C;  4AVZ A;  5LHI A;  4EGZ A;  4CYC A;  2L54 A;  4BXU A;  2HVR A;  2HDD A;  4KIG A;  3P9K A;  2K5C A;  1RIO H;  1J5Y A;  1O57 A;  4CYC B;  1ZEL A;  2BV6 A;  2EK5 A;  2RDP A;  1K6O A;  1WH5 A;  1G3Y A;  2CUE A;  2R7X A;  2VUM J;  5EG0 A;  1MND A;  3BTJ A;  3RKW A;  3RZD J;  2A69 F;  1BR4 A;  2ZB9 A;  5IPA A;  5H20 A;  2V4J C;  2ELH A;  2R5Z A;  3FK7 A;  3U9G A;  4A3F J;  3RPU A;  4ZYA A;  1QBJ A;  4F92 B;  1G3T A;  4BH9 A;  4N4N B;  2QF7 A;  4HQE A;  2BY3 A;  2CQN A;  2QQA A;  3JRE A;  4PFO A;  2AXL A;  3LAJ A;  1EH8 A;  1ERD A;  2WV0 A;  5D6F A;  2WAQ N;  3NWS A;  2R5Z B;  4ESJ A;  4BJT A;  4O3M A;  4FE7 A;  2FQ4 A;  4XMY A;  3I4P A;  3CMA I;  1WSU A;  5FLV A;  3BT9 A;  4P3A A;  2QEX I;  1QHH D;  4CZC A;  2FMY A;  2P5V A;  1FOW A;  4GCV A;  2JRM A;  2NS8 A;  2ZBK A;  2CQX A;  2ZXH A;  3HQA A;  4EM0 B;  4NHJ A;  3H0D A;  1B59 A;  4A0X A;  4IO9 F;  4B4C A;  1YIJ I;  2O3F A;  2UZK A;  1I1S A;  4KA4 A;  2QSF X;  4PUS A;  4ANJ A;  2ZJR F;  3QU6 A;  2UWM A;  4B43 A;  1ETX A;  4AVP A;  5JHF A;  2LTP A;  1KZH A;  2HS5 A;  2VE9 A;  1DGW Y;  1GHC A;  1TT0 A;  2VKV A;  2LMD A;  3KZY A;  5DS9 A;  2M87 A;  1U2W A;  3HTS B;  3DXJ F;  4A3C J;  2LOO A;  2ECB A;  1ETV A;  3HHH A;  1TWH J;  3LFK A;  2L0K A;  5F0F A;  5GP9 A;  3BJA A;  1QPM A;  2R7V A;  4A12 A;  4HEA 2;  1MDM A;  1ODD A;  1QPI A;  2L9R A;  2XPW A;  4FE4 A;  3J7Y J;  3A1Y A;  1SFU A;  1IRG A;  2WAQ A;  2VPR A;  4ZTJ A;  1XGM A;  2Q0O A;  3EUH C;  4PK4 A;  3E6D A;  4IHY A;  4XOP A;  1K4T A;  2R7T A;  3BPX A;  5HS9 A;  2XGC A;  4ZTF A;  4M9Z A;  4MHG A;  1HQC A;  4UV9 A;  3P9I A;  1TTY A;  3GTJ J;  2HXI A;  5M5W J;  1S8N A;  3QQA A;  2DT6 A;  1UCR A;  2JSC A;  2COB A;  2NVU B;  5L3F A;  2NS7 A;  2QLZ A;  1LKX A;  4PGH A;  4KJZ A;  2HVQ A;  4B48 A;  3G6E I;  1STZ A;  2CO5 A;  1WH7 A;  1TW2 A;  3KEY A;  3C2B A;  4ZC3 A;  4FCY A;  2R7U A;  2DK5 A;  2JUG A;  2V1D A;  5GAE J;  1ZGW A;  2K9N A;  2X51 A;  3VOE A;  4IRI A;  2EFQ A;  5K7Z A;  3WTS C;  2HDW A;  1OCR H;  1T8I A;  2GXB A;  3E1S A;  4KMU X;  1IN5 A;  4CXF A;  3HL2 A;  2F6C A;  3K4B A;  1GDT A;  1EF4 A;  3EYI A;  2NXN B;  4XN0 A;  1G2H A;  4NC8 A;  4BY7 J;  2RRE A;  3WGG A;  4M71 A;  3L9F A;  3OL4 A;  4BXF A;  3OSF A;  1GVD A;  3ZMU A;  3WTX C;  3IWZ A;  1BR1 A;  2MH2 A;  3M3Y J;  4OMY A;  4XRS A;  3CF5 F;  2KFD A;  2GA1 A;  4MFE A;  1BM9 A;  2K7L A;  5TJJ A;  3RQI A;  2AS5 F;  4CYD A;  3S1M J;  4P1W A;  5IT9 K;  4WXD A;  1TWG J;  4HG2 A;  3CC4 I;  2Y9Y A;  3E5Q A;  2IS6 A;  4Q47 A;  3ZQC A;  2Y0S N;  1ULY A;  4XKW A;  5ILS A;  1WHU A;  1IRX A;  1T56 A;  1U5T A;  3ZMT A;  1AKH A;  3TBI A;  1OCZ H;  2E71 A;  3TL4 X;  1HKT A;  1BI1 A;  2VBX A;  4HF2 A;  4XOR A;  1SAN A;  3OYJ A;  2QCO A;  1U5T B;  2XF7 A;  2X6W A;  1VQO I;  2HOS A;  1WPK A;  3WHB A;  1ITY A;  4M3G A;  4ITV A;  1FYM A;  4BJ5 C;  3B6A A;  1X2N A;  3EUK L;  3H3V K;  1X58 A;  4KNY A;  4KMF A;  1V5G A;  5HVQ C;  3ABM H;  3L1P A;  2VJJ A;  1Y56 A;  2XKO A;  4F7Z A;  1N25 A;  1A6Q A;  2KIM A;  3F8M A;  4P39 A;  5JFR A;  4M6V A;  1MJB A;  3C3W A;  1SFK A;  3FIW A;  4CUG A;  1YG2 A;  1IAW A;  5AIP A;  1SFO J;  1IDZ A;  2HZD A;  1MBH A;  4D1Q A;  5D8L B;  1LEB A;  3MZY A;  2JPC A;  1ZR2 A;  4B44 A;  4HLX A;  2X6X A;  3SHF A;  2MG4 A;  1I3Q J;  5DM7 F;  2IXS A;  5HNH A;  4N4O B;  3E6C C;  2OQR A;  2FXA A;  2ZME A;  3EET A;  2FE3 A;  4ENK A;  2Y0S A;  2OQG A;  1XC5 A;  3CJN A;  1MSF C;  4BQO A;  2IGM A;  4D0P A;  2CW8 A;  1FPQ A;  4P55 A;  3ZMZ A;  3M1C A;  2VBW A;  2W84 A;  2IA0 A;  1W1W E;  2HEO A;  3GTQ J;  4XKB A;  1KA8 A;  3IRQ A;  3MD2 A;  2QVO A;  1FTT A;  5ICG A;  2VQH A;  4EJV A;  1K4S A;  5IYC J;  1BIB A;  2CQK A;  3FBN B;  4XRF A;  1USS A;  4AC0 A;  1G8X A;  2C6Y A;  2VBZ A;  2OTL I;  2XF6 A;  2JA6 J;  2R7O A;  2AO9 A;  1F5T A;  2W85 A;  3CD6 I;  4JYK A;  3HOY J;  3QWL A;  2MBF A;  3U1K A;  1MBG A;  4X6A J;  2CMP A;  1FOK A;  2LF7 A;  1XTA A;  4PJ0 C;  3F6O A;  4IJA A;  2CQQ A;  4ZYD A;  2V1N A;  2KDO A;  5FFZ A;  5CVV A;  2B39 A;  4A3B J;  2DT7 B;  2CFO A;  3H5A A;  4L5E A;  2E5Z A;  4NNJ A;  4LB6 B;  2PFB A;  2VQL A;  4C30 A;  3W2V A;  4DGW B;  5LGU A;  3J7Z I;  4LG0 A;  3BG6 A;  2LG4 A;  2KT0 A;  4Y4R A;  1A35 A;  2A5W A;  3P5J A;  1R58 A;  2DYS H;  4LG0 B;  3CLO A;  2LC2 A;  3JSO A;  2H8R A;  1OFC X;  4JX5 A;  4FAS D;  1YO5 C;  5GAG J;  1QO0 D;  2STW A;  1V4R A;  2PQ8 A;  4HOB A;  4BE1 A;  3GYH X;  4BE0 A;  1ETK A;  5FLX Z;  1FX7 A;  3E5U A;  3DCF A;  4D9J A;  2H1K A;  4P96 A;  1Z7U A;  3G1L A;  5KVR A;  1XG1 A;  5IY5 H;  2JA2 A;  3RYP A;  5EZH A;  1TQM A;  2HPM A;  1R36 A;  4JP0 A;  2FJ1 A;  1ZG1 A;  2K27 A;  1Z9C A;  2GIV A;  1YW9 A;  3E97 A;  2ESN A;  3IP4 B;  2MSY A;  2V6C A;  4ESB A;  1FZP B;  1LDD A;  1QZE A;  1IJW C;  2DA5 A;  4UB6 C;  2EA4 A;  1YI2 I;  5CJ9 A;  3Q0V A;  1FIP A;  5L3B A;  5C44 J;  3WU2 C;  2VC0 A;  4CCN A;  4XID A;  4A3D J;  1KYZ A;  2KIF A;  3PO2 J;  2J5P A;  1KJS A;  4ON0 A;  4OAZ A;  4BS9 A;  2P0W A;  3KPH A;  3OYA A;  4ENN A;  2VOD A;  3QOE A;  3S93 A;  1S6L A;  3LA2 A;  1OQY A;  4E7K A;  3O8H A;  3CC2 I;  5DM6 F;  1AU7 A;  3BTL A;  3I4N J;  2GM4 A;  5FRO A;  5D4S A;  4U0Y A;  1E3H A;  2ESH A;  2DLL A;  3EYY A;  2RNG A;  3M7G A;  5JR3 A;  4CIC A;  2M1B A;  5EEH A;  1WFX A;  1GXP A;  4HV5 A;  5F1J A;  1FY7 A;  3ZP5 A;  2ZFW A;  2R3S A;  4EAT A;  1BN5 A;  3IUO A;  2R7W A;  3TMO A;  2WY7 Q;  3OIP A;  3QYF A;  2GBY A;  5E8G A;  3ZQ7 A;  2MC4 A;  3LSR A;  1ZLK A;  2JJ7 A;  2DDB A;  4AYB N;  2MLG A;  4MLO A;  4XBF A;  1Z1D A;  2VAS A;  4WK8 F;  4Q4Z F;  2H6C A;  2XVC A;  3BPV A;  1T95 A;  2F48 A;  4C2T A;  4UU9 C;  3FXQ A;  3GUD A;  1B72 A;  1T2K A;  4Q5S F;  2LK2 A;  4BAC A;  1QGP A;  1S7E A;  3OR2 C;  4IHT A;  2IRF G;  3GTG J;  1LNW A;  1ETQ A;  3PNV A;  3FBI B;  1SFE A;  3ZOB A;  2P4W A;  3GXO A;  4JOM A;  1B72 B;  1FC3 A;  1B8I A;  4YIR X;  1UST A;  2E19 A;  3NEU A;  4O5V A;  1CF7 A;  1JHH A;  3VSL A;  4JX4 A;  4XSZ F;  1F43 A;  1H9T A;  3PQK A;  1U78 A;  1FOY A;  1ZN2 A;  1B8I B;  2HQN A;  5B3S H;  3BTC A;  3HSR A;  5M5X J;  4G7H F;  1CF7 B;  5LGT A;  3RZO J;  2CW0 F;  3JSP A;  3WTT C;  3HKZ N;  3DV8 A;  4R8H A;  4E6K G;  2FUG 2;  5B5E C;  2MW8 A;  3F8C A;  2L4A A;  5B1B H;  4A3G J;  2XRO A;  3KP7 A;  4D5F A;  2CYY A;  2DMN A;  3CO6 C;  1Y39 A;  4IEJ A;  3NAU A;  4LB5 A;  1I3A A;  3OV8 A;  3BY6 A;  2MGQ A;  3ULQ B;  4AYB A;  2OD5 A;  4II3 A;  3DLA A;  4RB1 A;  4I0B A;  3SDG A;  1U9O A;  3BG3 A;  3O3K A;  5J47 A;  2L7Z A;  3CCS I;  2KLO A;  2QQB A;  4BNC A;  3ABT A;  1KU2 A;  2OCE A;  2XGE A;  1DDN A;  3SDB A;  2KIQ A;  2DT5 A;  2HYF A;  1TW3 A;  4CO8 A;  2F5C A;  5E3L A;  2K9S A;  1MZB A;  3K1M A;  4M73 A;  3RPQ A;  3FM5 A;  3IC7 A;  1HW2 A;  2Y31 A;  4XLH A;  3RCO A;  2DA6 A;  2KIS A;  3BP8 A;  2XAJ A;  3CLQ A;  3I54 A;  3QPL A;  1WGX A;  5IYB J;  4A3K J;  4BAY A;  3DEE A;  5JI6 A;  1IN6 A;  4S0H B;  4FXK B;  2EZI A;  3Q3S A;  1QNT A;  2OZ6 A;  2JK3 A;  1WVR A;  2CV1 A;  4CHU A;  3HKZ A;  4AIJ A;  5IT9 Z;  1BI2 A;  4UXN A;  2VON A;  5BOX A;  3DKY A;  2EV0 A;  2KRF A;  3CDI A;  2P6S A;  3R6S A;  3T8T A;  1JI8 A;  2GIZ A;  2P7C B;  3HBL A;  3RDI A;  3OYF A;  3AFH A;  4KIT B;  3BDD A;  2XSJ C;  3D1N I;  2IGK A;  1IV8 A;  1FBS A;  1JTY A;  1R5H A;  2VKD A;  3V8J A;  1A6I A;  2LY1 A;  5EYR A;  4RDU A;  1IRZ A;  2XKP A;  1W5C C;  2M8E A;  2K85 A;  1E3O C;  4QSH A;  1BI3 A;  2L01 A;  1E2X A;  1DP7 P;  2VOP A;  4W1U A;  4A0Z A;  5LBQ A;  2M3A A;  4GYI A;  2OA4 A;  3O2P E;  4XLP F;  1DU6 A;  3DKW A;  2CW7 A;  1WJF A;  5HDG A;  2VQG A;  1W0U A;  1F9N A;  4M3E A;  1Y8Q B;  1EH7 A;  2EFW A;  3F72 A;  2WTE A;  2B63 J;  2DQR A;  4WB2 A;  1B4A A;  4IRG A;  2V7F A;  2VXD A;  4RAG A;  1JT6 A;  2LVS A;  4FIS A;  4GO1 A;  1ZQ3 P;  2QUF A; 
#chains in the Genus database with same CATH homology
 2ZXH A;  3DPT A;  3H0D A;  2L5Q A;  2KHM A;  1MMD A;  1X19 A;  4HNU A;  4ZDL A;  2Q2E B;  2R7S A;  3VYT B;  1VZ0 A;  4OWR B;  4PUS A;  4XNF A;  4ANJ A;  3CF2 A;  2WAE A;  3K10 A;  2UWM A;  1D1C A;  3BCB A;  2BVM A;  4B43 A;  4F3Q A;  1SAU A;  3PFY A;  5JHF A;  3L2Q A;  2DXI A;  3L2V A;  4X0G A;  3H35 A;  3CJR B;  1DGW Y;  1TT0 A;  2JSP A;  3HPH A;  3S3M A;  1Z7L A;  1KON A;  1BOB A;  4BJ6 C;  1EA3 A;  4PFP A;  2LOO A;  2CUJ A;  2K9L A;  2E1M C;  1LFP A;  4NQW B;  5HLT A;  2IS1 A;  1WJ5 A;  1P9Q C;  4PJJ A;  5CPR B;  2MAB A;  2R7V A;  2V6E A;  4HEA 2;  2ZFU A;  3OS1 A;  3A1Y A;  3LSM A;  3DTE A;  3LSI A;  2HNH A;  2WAQ A;  1R6R A;  4Y33 A;  4ZTJ A;  4PK4 A;  3EUH C;  3PNY A;  4J00 A;  4PSX A;  4XLF A;  4P5O A;  4XOP A;  2R7T A;  2DOA A;  2LH9 A;  4E7J A;  2L9S A;  3LFU A;  4IQ4 A;  4ZTF A;  3NWT A;  4CCO A;  3KX2 A;  3QOD A;  1W36 D;  5FRN A;  1FMV A;  3MMY B;  4DOZ A;  3MKZ A;  3BG7 A;  2DT6 A;  3C2H A;  2KQR A;  2M7A A;  4E7Z A;  2VPL A;  4E7H A;  4PJL A;  2VKH A;  4FET A;  1LKX A;  1MMN A;  4KJZ A;  1K6Y A;  2HVQ A;  3C2G A;  4B48 A;  3OYK A;  5LD2 C;  3OS2 A;  3OYN A;  4BQN A;  1J09 A;  3K70 C;  3KEY A;  1X1B A;  4ZC3 A;  2R7U A;  2BW3 A;  1Y6I A;  2JUG A;  1LVK A;  3H5N A;  2V26 A;  2X51 A;  2HDW A;  3MKW B;  1YE9 A;  2WAF A;  2BW3 B;  2MFZ A;  3E1S A;  2Z1D A;  3HL2 A;  3RSN A;  3A4C A;  2F6C A;  3K4B A;  2K9M A;  4CH7 A;  4XN0 A;  4NC8 A;  4CCJ A;  2RRE A;  3OYM A;  3S3N A;  2E1M B;  3OL4 A;  4BXF A;  1X4O A;  3DKX A;  1MW7 A;  2M0M A;  3OMY A;  3K6G A;  1BR1 A;  1MNE A;  4BEH B;  4AU7 A;  1DP3 A;  4F93 B;  4PSW A;  4R79 A;  3ZQQ A;  1WJC A;  2L9N A;  1UG0 A;  3DTI A;  3K4J A;  2JVG A;  2WA0 A;  2L7K A;  3OR1 C;  4P1W A;  2CS3 A;  4HPQ A;  4HG2 A;  2UV1 A;  4E7S A;  4XM3 A;  2IS6 A;  4XKW A;  3OYE A;  1IRX A;  4CCL A;  2V9K A;  3TBI A;  3TL4 X;  1YX3 A;  2HPI A;  3K4M A;  3RPU D;  3ZRG A;  4B3X A;  3AL0 C;  4XOR A;  3PSF A;  3OYJ A;  3DTK A;  3UNG C;  2XF7 A;  2X6W A;  5KHD A;  2KZV A;  4ITV A;  4BJ5 C;  3EUK L;  2M7B A;  4LIU A;  3D5L A;  4BDZ A;  1N78 A;  3OYI A;  4HRI A;  1X1D A;  1V5G A;  5HVQ C;  4BL0 B;  2VJJ A;  1Y56 A;  4HSR A;  3DU6 A;  2UUZ A;  2X1C A;  1TZL A;  2VQC A;  3HOS A;  4C9Y A;  3DPU A;  3CMM A;  3OYL A;  2QKL B;  3DPL C;  3OYD A;  2LBF A;  4CUG A;  1SFK A;  3K4L A;  2XC7 A;  2HZD A;  4JQF A;  3FHN A;  5TGT A;  2PJR A;  5CKT A;  4D1Q A;  1AA7 A;  2KRH A;  1MMG A;  2JVH A;  3PNT A;  4B44 A;  2X6X A;  2W4S A;  3VWB A;  3W3C A;  2IXS A;  3VYS B;  4N4O B;  5HNH A;  1GLN A;  2A6T A;  1D0X A;  2PJR B;  4XL9 A;  3QYB A;  3V42 A;  1PYV A;  2GOX B;  3I3L A;  2KL4 A;  2QKM B;  4U7B A;  4YEL A;  3LL7 A;  1Z21 A;  2CV0 A;  2Y0S A;  3EPZ A;  4G6T B;  4BQO A;  2IGM A;  2CW8 A;  3H9Q A;  3BC8 A;  3HUG B;  3M1C A;  2GOM A;  5CQE A;  4XKB A;  4Y3O A;  3SZG A;  2PMZ A;  3MD2 A;  2LY2 A;  2VQH A;  4BU2 A;  3D5R C;  3CES A;  3SEQ A;  4XON A;  2I8D A;  2WB1 A;  3FBN B;  4XKV A;  3H9J A;  1NG7 A;  1G8X A;  4RMN A;  1WJE A;  2XF6 A;  3FDY A;  3L2W A;  3CP2 A;  4LG3 A;  2R7O A;  4E4H A;  1UEL B;  4BQQ A;  4F91 B;  2E5N A;  2Z16 A;  2W82 A;  2F5V A;  2LYC A;  4IZZ A;  2CMP A;  1MMA A;  2VJI A;  2IS2 A;  4XN3 A;  1BR2 A;  1Z3Y A;  3VYU B;  3MKY B;  2V1N A;  2KDO A;  2AQE A;  1YX5 A;  2DJI A;  3H5R A;  2DT7 B;  2F4I A;  1D0Z A;  3DU5 A;  2CFO A;  3H5A A;  4NNJ A;  2E5Z A;  4J01 A;  4C30 A;  2VQL A;  3W2V A;  4DGW B;  3K4C A;  3BG6 A;  2LG4 A;  3LSG A;  4RM3 A;  4Y4R A;  3K4K A;  3ZCO A;  3BCA A;  3AKZ A;  2A5W A;  3QYE A;  3U21 A;  3K4N A;  4HST A;  1N77 A;  3OY9 A;  2LC2 A;  4LIT A;  2E60 A;  4FAS D;  3OL3 A;  4BE1 A;  2K3P A;  4BE0 A;  2KMU A;  3PL8 A;  2W1O A;  3OOU A;  2Q1Z B;  4D9J A;  2NOJ B;  4ZJZ A;  1G59 A;  2R7R A;  1FMW A;  1N75 A;  2VJ5 A;  2MYS A;  3VDX A;  2JA2 A;  3M8J A;  4OAY A;  2HPM A;  3OYG A;  3EUA A;  3J7A Y;  1D0Y A;  1D1B A;  3IP4 B;  2IGN A;  4ZDP A;  4XLC A;  3HC7 A;  5KNL A;  3OYH A;  3OYB A;  2MD0 A;  2HVS A;  2XAU A;  3GBG A;  3OS0 A;  4PJM A;  4CCN A;  2R4G A;  2KPM A;  1Z3X A;  4OAZ A;  4BS9 A;  3K70 D;  1U0J A;  4B47 A;  3G2B A;  2P0W A;  3OYA A;  2CH0 A;  3QOE A;  3S93 A;  4E7K A;  3RQ4 A;  5FRO A;  3LMM A;  2ZSH B;  4YRV A;  3DQV C;  4E7L A;  2RNG A;  3HG9 A;  1WFX A;  1QU3 A;  2CV2 A;  2WAD A;  5HNF A;  1DGR M;  1NG6 A;  4KT6 A;  4XLA A;  2XF5 A;  3IAM 2;  2BOL A;  4FXG B;  5JPM B;  4EAT A;  3IUO A;  2LBF B;  2R7W A;  3TMO A;  2WY7 Q;  3OIP A;  3QYF A;  3OIQ A;  4BE2 A;  2MC4 A;  3HPG A;  2AQF A;  4GRI A;  4MLO A;  3CZ6 A;  2VAS A;  4DBQ A;  1WJA A;  3SEZ A;  2CUZ A;  2X85 A;  1UAA A;  1T95 A;  2WY8 Q;  4C2T A;  2RQQ A;  2W7N A;  4YEJ A;  2ZSI B;  1W36 C;  4CCK A;  4BAC A;  4PJN A;  3S32 A;  2LRE A;  2WBM A;  3LSK A;  3OR2 C;  4DJA A;  3PJR A;  3PUB A;  3PNV A;  3FBI B;  2DCE A;  2LRD A;  4JOM A;  4E7I A;  5KCM A;  4BUP A;  4XQF A;  2VB6 A;  2X1E A;  4KIS A;  5LFA A;  3AL0 B;  2L2O A;  3HXL A;  1LDK B;  3PSI A;  4F55 A;  2M4K A;  3F9K A;  3VSL A;  4DBR A;  3DWL E;  3A2K A;  3ZR8 X;  1HA8 A;  2KP6 A;  3L2U A;  4F52 A;  3SYT A;  2KRC A;  4RLQ A;  4XLE A;  3RTR A;  4E6K G;  2FUG 2;  1T0F C;  4NUB A;  1WJD A;  3CP8 A;  1S9H A;  4C2U A;  2ZXI A;  1OR7 C;  3FKJ A;  4AYB A;  3CJQ B;  4II3 A;  3DLA A;  1X1A A;  3E0J B;  2OUM A;  3LSH A;  3N05 A;  4QPQ A;  4XR6 A;  2X1D A;  4RM2 A;  2IS4 A;  1X4P A;  2BVL A;  2KLO A;  4U87 A;  3ONQ A;  4IKF A;  4IX7 A;  3UR3 C;  5CQG A;  3SDB A;  3D5S C;  4LIV A;  3BLY A;  4CA0 A;  1X1C A;  2OC6 A;  2O5R A;  2OV7 A;  2VJ4 A;  4XLH A;  4H4K C;  3RCO A;  1E0E A;  2ELJ A;  3H9G A;  5FRM A;  1V5F A;  4II2 A;  3DEE A;  3ZGK A;  1DQU A;  1QHG A;  2VXZ A;  2CV1 A;  2VLA A;  4BEH A;  3I9V 2;  3HKZ A;  4BDY A;  2Z2S B;  3OYC A;  3S3O A;  1WJB A;  3DKY A;  1OLT A;  4DIQ A;  3W2W A;  3HOT A;  1V5E A;  4CSW A;  4IQJ A;  4ZDO A;  1JI8 A;  4AVZ A;  2W00 A;  2X6Y A;  2HVR A;  3OYF A;  3AFH A;  4KIT B;  2XSJ C;  2IGK A;  3KYL A;  3L2R A;  2K5C A;  2R7Q A;  2VKD A;  1PJR A;  1ZEL A;  2LY1 A;  3VSK A;  3W2A A;  4CCM A;  2R7X A;  3ZXS A;  1MND A;  1BR4 A;  2VL8 A;  1D1A A;  2V4J C;  4QPO A;  2HU9 A;  2M4G A;  3IAS 2;  2M3A A;  2IGO A;  4ZYA A;  4F92 B;  4N4N B;  2CW7 A;  1WJF A;  2VQG A;  2HQA A;  3OWT A;  4PFO A;  4HNT A;  1ERD A;  3NWS A;  4BJT A;  4BGD A;  4XMY A;  4XOT A;  3VYR B;  5HOO A;  4NC7 A;  2V7F A;  2VXD A;  3S8P A;  1QHH D;  4RLF A;  4CZC A;  4XKC A;  2VIX A;  2XDV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...