2Z1CA

Crystal structure of hypc from thermococcus kodakaraensis kod1
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
71
structure length
71
Chain Sequence
CLAVPGKVIEVNGPVAVVDFGGVKREVRLDLMPDTKPGDWVIVHTGFAIEKLDEKKAMEILEAWAEVEKAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hydrogenase expression/formation protein HypC
publication title Crystal Structures of [NiFe] Hydrogenase Maturation Proteins HypC, HypD, and HypE: Insights into Cyanation Reaction by Thiol Redox Signaling
pubmed doi rcsb
source organism Thermococcus kodakarensis
molecule tags Chaperone, metal binding protein
total genus 17
structure length 71
sequence length 71
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2007-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01455 HupF_HypC HupF/HypC family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.970 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2z1cA00
3VYSA 3VYUA 2OT2A 2Z1CA 3VYTA 3VYRA 3D3RA
chains in the Genus database with same CATH superfamily
5ELEA 1EZ6A 2N88A 1IBLQ 4Z9CB 2QILA 3G71A 4K0KL 3D4DA 5IYDG 3TREA 1I50B 5G3LF 1AZPA 4B3TQ 1R4QB 1IKLA 4KJNA 5IGGA 2MQHA 4F88A 3GP7A 5C44H 3N6RA 4DV1Q 3J81c 4YY3L 4X64Q 4DR3L 2K5VA 1RD9D 1HFNA 4LF4Q 1JJCB 3GTPB 3A8KE 4HCSA 4QUCA 3NTIA 1WCMG 1XMQQ 4NMZA 4APVA 2YU9H 2K5NA 4OO1G 4RFBA 4C1NK 2DNEA 1DXMA 2E2IH 1VQ5A 4U673 4LMQD 4JI3L 3QIAA 2MHVA 3GQBA 1DYQA 3S16B 4CKEA 1ET9A 5CBEE 2YU9B 2EYOA 4C3HB 2Z4HA 2PZTA 3L0OA 2DY8A 2RCFA 4J15A 1EOTA 2L11A 2MPMA 3NQTA 2F0GA 4RHRA 1SE3A 2RA4A 4CDCC 4B3SL 1N33L 1I4XA 3CHBD 3A56A 5JPMC 2CW0D 2F3WA 2R7ZG 4JW0A 4K8IA 2UUBQ 1SFOH 4DPGA 3D4RA 3SK5A 1S5DD 2L12A 5I9OA 4K2LA 2ZXOA 1HR0W 4WJWA 2UXDQ 1ML0D 1SFOB 2Z9HA 2VUMH 1VQHA 4X3UA 1XYIA 1JOOA 1VMPA 5ELNA 1ZYRD 3AB9A 4LFCL 1V1PB 4H02A 3AEVA 5IP7G 1LACA 2K5HA 1GUNA 3H3VH 2UUAQ 1X32A 1N32Q 3HOXG 4A3DB 2NVXB 2H4OA 2UXCL 1SAPA 2NZOA 4RGNA 4FO2A 1BDOA 5GROA 5ELDA 1PH1A 1PZJD 1G2SA 1L1OC 1HNWQ 3S1RB 1LYLA 2EJFC 1PYSB 5BR8L 5LL6X 1FYCA 3U58A 5EKIA 4FF1A 4OX9Q 5CMDA 1WYDA 2EY1A 1EFID 3MXUA 1DONA 1EOVA 3ER0A 1YJ9A 1D1IA 1KDBA 1D5MC 3Q24A 5IODA 1BF4A 1B9NA 1JB3A 3RUZA 4YCVA 1C9OA 4DK6C 1XJVA 3BYYB 3TRZA 4DUYL 4XIGS 4A75A 1X3EA 2B29A 3I8ZA 1EYDA 1GOZA 5EBCA 2XRSD 5IY0A 5EAYA 2KCCA 2CWPA 2O2LD 1SXTA 3H3VC 2KCMA 2L5TA 3A7AB 1C0AA 1I3QB 3C46A 1CQFA 1E22A 1C7YA 2F52A 4ME3A 1V8QA 4X3KA 1BVSA 1X55A 2F0UA 4K0KQ 2H1EA 4A3BH 4NW2A 1CM9A 5IT9E 3R2IA 3OPOA 2KCNA 1OXTA 3G6JB 2FINB 4CJ0B 4BBSG 4IO9A 5DM73 4BY1G 2ZM6L 4ZCKA 4DR3Q 2QGQA 3MA2B 1U4RA 4L5QA 4ME5A 4IUQA 1GHKA 1YNJC 1TQOA 2D0OA 1JWSD 1ENFA 4ILWA 1H9KA 2I5HA 2ID0A 2Z0SA 1O78A 3Q23A 4JK1C 4LJZC 1O80A 4JBMA 4IQZA 2NWGA 2NZHA 3IKJA 4DUZL 5C4XH 3H15A 3FKIG 1LTID 3I3CA 2EYPA 2R7FA 3L3OC 5COYA 1D2BA 3IRBA 1U4MA 3BDCA 4B3SQ 4DR7L 1N33Q 5F2DA 2E2JH 3SK4A 1IYJB 1I4GA 2YYZA 5C4XB 3VR6A 2JA6H 4ZLTF 1EFWA 3OWEB 1TT2A 2IX1A 2B2YC 1IBKL 2B3GA 4RHSA 4K6LA 3EJIA 1LLRD 1P16A 5I4DA 4JI4L 5D3IB 2KEDA 4C3IH 1VQ6A 1JQYD 2B63H 3TBIB 4PZ6A 1H9JA 3H09A 4KN7C 4CJ2C 4V190 1TWAH 1D7QA 4LFCQ 2L15A 4FNFA 1IW7C 2TMPA 4JPBW 4C3IB 4HR7B 3IFDA 2VQFL 2B63B 1WTPA 4WRDA 5DEHA 2EYFA 1X3GA 2UXCQ 4O42A 1GUOA 5CORA 5GAEC 4LF8L 2HQEA 3HOZH 3TEHB 1PFNA 2PPBC 3K7UC 1K8GA 2DN8A 1HPCA 2B2WA 4DV4L 4DNIA 3A0JA 2PCFB 1XNQQ 5M5XB 1EUJA 1Z9FA 1L2FA 5K36G 3S1NH 3S1QH 4NPSA 4QIWE 4RCOA 5FLXE 5JAVA 3J7A5 2BE5D 2JN4A 2F0OA 4CHTB 2A6HC 1SE8A 4HSPA 4WJ3M 4DUYQ 1HZAA 1FD7D 3NENA 3NTHA 3E0EA 5IOCA 2PZWA 2J0TD 2PI2A 3PQIA 4DV6Q 1VQDA 3S1QB 4ZKBB 3CCLA 2KHIA 2B2UA 2XVSA 4A4IA 3J80i 3M85A 4G57A 5C3EG 3S24A 4IN3A 3NWSA 1C4QA 4LF7L 2EXDA 4BXXG 3PUYA 4IPDA 3KLRA 1E7ZA 3KYHC 4ZQ3A 3J80E 3P1HA 1S5BD 2WB1G 4HIDA 5C4JB 1CFMA 1IYUA 2WKDA 4S3SA 3HOVG 3HOYG 1I94L 3M4YA 4BS9A 3HFZB 3S14B 2KA7A 1TWGH 5KGUA 1Q3LA 2Q2HA 1FGUA 1BUVT 2V4DA 3K6OA 2RSNA 1HH2P 4XYOA 1ESFA 2A69C 4C1NI 4TVAB 1J5EL 4OIJA 5ELCA 4PZ8A 1CZGA 1QUQA 1TWGB 5JVH3 1NUCA 2UU9L 3PO2H 2DNCA 3I4MH 3OW2A 5I2XA 1F77A 4X6AH 2JEAI 1TR5A 3A54A 3GTJB 2K6AA 2E2DC 1PYWD 1Y1WB 1VQCA 3KF6B 1OO9B 3MXPA 5LHY1 1CKMA 2AQ1B 3I4MB 4DUZQ 3EQLC 2OCEA 2NN6G 3U50C 2ENBA 2V1CC 1NE3A 1NY4A 2WB1E 1STYA 3UE0A 4DR7Q 4HIOA 1MIUA 2RDHA 1RKNA 1SNQA 1RF2D 1E2ZA 1PRTB 2M9VA 3QJYA 1BQQT 1HQRD 4GKJL 1KAAA 4HMIA 4GNXA 3MXNA 3FDTA 1IBKQ 3HOUG 2VS1A 2QEXA 3OW7A 3T1HL 1KLUD 4JI1L 3DUZA 2RQXA 1K8OA 4B3RL 2JA8G 2F0JA 3X3MA 3DWQA 1KD1C 4G7HC 2VXWA 3JAME 5M3FB 1WI5A 1I6VC 3UI2A 4IOAA 2QF7A 4XDXA 1DM0B 1B8AA 3E0JA 2N3SA 4GOPC 3HGBA 1K8AC 4IFDG 1M1KC 2EYHA 1PH5A 4FF2A 1HJPA 1KNAA 1PZID 2E2HB 2K14A 2OXPA 3UDFA 1Q46A 3GTGH 3SK6A 1SNMA 3URYA 4OGQC 2F0WA 3ONAB 1Z6HA 4BBRH 4I7ZC 1JB7A 4DV4Q 3GTLH 5IYCG 4JI8L 1JT8A 2GA4B 1G8ZD 1A8VA 4IJLA 3PCOB 4PQXA 4BBRB 2R93G 1ILQA 4R9WA 5C3WA 1RTNA 1EWHA 1KDCA 1RODA 3GTLB 4A93B 4GLVB 3CC4A 1DOMA 3BS1A 2WAQG 5IYBH 2KUMA 5C4HA 5JEAG 2F0SA 1QNUA 2PMZE 3WWVA 4A3KG 1HTPA 3D3RA 2NVTB 1SMXA 2NZ1D 1X54A 3CCVA 4RCNA 1PTOH 3I7FA 2LXJA 2HCIA 4DXFA 5K5PA 1HRJA 4LF7Q 2F4IA 2QW7A 1VQ9A 1K3RA 4A3MH 3S17B 4F87A 3H91A 4A3FG 4HJ9A 4YIJA 1EWCA 5FLMG 3I4NG 4DR4L 4BY7B 1P8LA 2WV6D 5LMUL 2F0IA 3KK7A 2R92G 2Z6BA 3BDLA 1SBBB 1I94Q 1RHPA 4B3ML 3C1EA 4KY5A 1PH4A 5IE8A 4DFAA 1EEID 1CZWA 4M1UB 4X65L 1J9OA 4C2MB 1XWEA 1X3FA 2KJXA 2WAQE 4DR5L 1J5EQ 3H0GG 2UU9Q 1CHPD 2JEBI 3BYTB 1UWVA 5DM63 4X3SA 1QVCA 4RG1A 2ES2A 3FMCA 1QB5D 2A5HA 1NSNS 4MNOA 1HTLD 1PTOC 3I4LA 2JA7H 1O7YA 2LY7A 3K57A 2Y0SB 1EIGA 1TWFH 2K7VA 1X9NA 4O1NA 1TIID 5EPJA 3RZOH 4KKTA 4Q5VA 2JA7B 3G6EA 4A3GH 5CC4A 1BBXC 2RVLA 3NEMA 3G48A 3FPUB 4N9TA 1YNNC 4LW1A 4AIMA 3MFYA 3VA5A 4NB3A 3T53B 4K5XA 1KXLA 2LS01 1G51A 1WTQA 3K7AH 4JI1Q 1FVIA 2B2TA 3KLSA 5IYDH 4B3RQ 1GKHA 1B50A 1EU3A 5LMNL 2LMCB 1O7ZA 2DJGC 3ND8A 1SDFA 2RDFA 3E3XA 1XTCD 3MTSA 4IURA 3TDQA 3AFQA 4K5WA 1VQKA 4AH6A 1BNZA 4IUTA 4JI5Q 1H9SB 4GN4B 1E1TA 3K5OA 1YIJA 4C3JB 1LT5D 1WCMH 4JBWA 2PQAB 3RNUA 1CSQA 4OO1H 3EROA 3RLNA 4DV3L 1RTOA 2F0NA 4NP5A 2F0MA 4HSVA 3K8AA 1AP0A 4RA8A 1QE6A 3D6WA 1EWIA 1CK1A 4JI8Q 2NTTA 2MP1A 1CKNB 3B6YA 1X65A 4X66L 4BA2I 2X6LA 2IJ0A 3U9OA 2RHSB 1KLGD 4TKOB 2UXBQ 1WTRA 2K5QA 4KLKA 5D65A 3STBC 1HZ9A 2HIXA 1R9TH 3OIPA 5CV5A 4IFDI 3K0XA 2KENA 2R7ZH 1B70B 2F0KA 1YNXA 1DJRD 1HUNA 2X6GA 3JAML 3QOJA 1K83H 1YJWA 1I4RA 2F0QA 1EY0A 1HFGA 1XPRA 1TKWB 5CYUA 3QWNA 1R9TB 5GAHC 3LGJA 1LTTD 3HOWH 1V43A 5IWAL 2CQAA 4A3EG 3T1YQ 3I72A 4HJAA 1CSPA 2NVYH 3KLSX 1MJCA 1W3SA 4ID6A 5EBDA 3GTOH 4DR4Q 2Q2UA 1TY2A 3HOWB 5IP7H 3ULPA 1GUGA 2KOLA 1T5EA 1TWHH 1WTVA 2O4XA 4GLAC 4B3MQ 2DGYA 3HOXH 4DV2L 4X65Q 1QG7A 2Z4IA 3L2PA 2JA5G 1Z47A 1TWHB 3S1MH 1UEAB 1YHAA 1JC7A 3RLFA 2GVBA 4MN3A 1PV4A 4LFBQ 3PO3H 1QVFA 2J4XA 4Q0FA 3M4OH 3IFTA 2PI2E 2AMCB 1VQ4A 1MJEA 4AYBG 1ASYA 3PO3B 4QB4A 1JICA 4KHZA 1AN8A 1F9RA 3CQZH 3M3YH 1IXRA 3L7ZC 1YITA 2IX3A 4PG3A 5C44B 1Y14B 2K28A 1B2TA 4XT1B 1QOHA 1HZCA 3CQZB 4DF7A 2QCPX 4O0AA 3ICEA 2PNHA 4DNTB 2K4KA 5TSSA 3I91A 2E2IB 1BR9A 2Q8TA 1PH2A 4IPCA 1Q12A 4ABNA 1BOSA 2XIWA 1L1OB 1QVGA 1VQGA 1HQMC 4HJ7A 5LMNQ 2QDBA 3R2TA 5BN3A 5FO8B 2WKCA 1JJGA 1E24A 3F8TA 5BN5A 4AYBE 1NJIC 5BN4A 3J81i 1LTGD 4BBSH 1M4VA 1E3PA 4LFAL 1CI3M 3NBIA 4BY1H 3GTKH 3J81E 3TP7A 1Q1EA 3VR3A 4DV3Q 4BY1B 1JMCA 1HNZL 3S2HH 3OWFA 2VNUD 2VUMB 5EKKA 3GD7A 4N8X1 3GTKB 4DR1Q 4X66Q 3FKIH 1EY5A 4KHPL 2K01A 1BXTA 4UP9A 1CTMA 2HHHL 3DWAA 1KQSA 1Y8PB 4IUNA 3CCUA 1Y1VG 5C0XG 3PIO3 3FKIB 3I55A 5EQ0A 4K14A 1PRTD 1H9RA 5GADC 1WJJA 3W2DA 2A8VA 3A8IE 1PH6A 3PF4A 3E5SA 2KEEA 3P75A 4LF6L 1L0WA 3SGIA 3GDEA 4KTAA 4KMUC 5EPLA 3NHHA 3F2CA 3HKZB 4QIWB 2PW5A 5FK9C 3A5UA 1XPUA 2NBFA 5I2YA 1L0YB 4HN7A 4DV2Q 4A3LG 1S5CD 1EY7A 3KF6A 3A8JE 3QO2A 4LF9L 1G6ZA 1WTWA 1YHQA 1C8CA 1EL0A 2PQEA 3M4PA 1G291 1Q86C 3IAYA 4C3HG 1EY4A 5FKAC 4RGOS 1B53A 1Z7TA 3BDOA 2JP1A 2B2TC 2K5WA 2LSSA 3DLLA 4L63B 2ASBA 1VF7A 5J3BA 4JI6L 5K36H 2JE6I 3KFUA 4A3BB 1LTBD 3I70A 5A2QE 4YY3Q 3D6CA 2B2VA 4FP5D 2EJMA 1FR3A 2QDLA 4KK7A 1HNXL 5L37A 2EXZA 1CKOA 3E9HA 3KBXA 4R4IA 1K0RA 2Z6KC 3MXGA 5AJ3L 3KOJA 5C3EH 1VQJA 4HAEA 1XXGA 4A3JH 2AWOA 2FHTA 4JI3Q 1CT1D 4JBKA 1J8IA 1E2VA 2JJQA 1JOQA 4J8QA 4RKLA 4Y52H 4R4QA 2K50A 4DGZA 4A3DG 1S72A 4A3JB 2DY7A 1SMYD 5DNFA 3M7GA 2FMCA 3HOYH 4WFN3 2KCTA 2ZJRA 1U5KA 4X62L 3EIVA 3J7AV 2C9OA 3NSWA 1K73C 1S5ED 2E2JB 2XSCA 3A5ZB 5JOBA 1K8MA 4G7ZC 1DOLA 1S4ZA 3OMCA 4CDDC 1C48A 1GD7A 2JA6B 1A63A 1DD2A 5E4XA 3PGZA 4P72A 1E0BA 3AFPA 2VZAA 1DOKA 2OTLA 1EY9A 1TS2A 2NYZD 4EQPA 1N36L 3NBHA 1SYBA 1CQVA 1IBML 1TWCH 4FYDA 2A68D 4UAIA 1QJOA 1PH9A 4ZAIA 3T51B 1TWAB 5GAGC 1NCVA 2HQLA 4KHPQ 5BR8Q 1AE2A 1BCPC 2OQ0A 3TSSA 3P7JA 1CUKA 2HHHQ 2OWOA 4L5SA 3HG9A 1EQRA 2AKWB 3FHWA 5A35A 2DUDA 5GQOA 3HOZB 2EYMA 3SR1A 2M2LA 4R4CA 2C35B 1VQEA 1XX8A 2I5LX 3HOUH 1EQTA 2AUJD 3NXWA 1PYBA 1VQOA 2VB2X 3T4AC 4DU9A 4IZ8A 2JA8H 1U0LA 3PIOA 4LF6Q 3RN2A 4A3IH 3RZDH 2EY2A 4MTNA 3S1NB 2K04A 4R4OA 2Q8RE 1TS3A 1ZEQX 1TS5A 4I65A 1Q8IA 4P73A 1KC8C 5G3LD 4L5RC 1V9PA 4A3IB 3AYHB 3RZDB 5NUCA 4JI2L 4PZ7A 1KHIA 2HDLA 5C0XI 4DR2L 2IY5B 2BA1A 2PMZB 1BCPF 2D2CC 1N9WA 1A0IA 3K5NA 4PMWA 4LF9Q 3UDIA 1A3TA 1D1KA 4DKAC 4EX5A 3SE0A 2XWBB 4DAVA 4YHHL 5IYCH 4JCVE 2IT1A 3WOFA 4TRDA 4KD3A 5CBAE 3BZKA 3AQQA 4EGVA 4JI6Q 5C4XG 4QY7A 1VQAA 2R93H 1Q81C 2ZXRA 2ZM6Q 1UE1A 2WP8J 1A15A 1I6HH 3S2DH 1GJXA 1WTHA 1TU2B 5JEAH 2AWNA 4A3KH 1BBUA 1D6EC 1WD0A 1QZHA 2PNRC 3TS0A 3VA7A 3PO2B 4H44C 3JAMc 4C3IG 2K33A 4GOPB 4DR6L 4UP7A 2F4VL 2RDGA 4A76A 2B63G 4A3FH 1H9SA 1PDQA 5JVG3 5KNDA 4HIMA 4HCEA 2PQAA 5C4ZA 2UUCL 1U4PA 2RSOA 4GZYC 5IT9L 4X62Q 3I90A 2CWAA 2CW0C 1X3PA 3PUXA 1CKNA 1QNKA 4JI4Q 4A3CG 1KL9A 4K6DA 2IL8A 1HR0L 1VQMA 5JJZA 3H0GH 5IGEA 3A7LA 1WVLA 1ONLA 3QB3A 4KKUA 3CCRA 1UE7A 2VQFQ 2F0TA 4YWLA 4HJ5A 1HA6A 1N36Q 4DK1A 3BJUA 1SYCA 2EVBA 1ZYRC 2A74C 2IHFA 2D0PA 3H3VI 4LF8Q 1MSGA 1NR2A 3AMUA 4ULLA 5IGDA 1LO5D 1AEXA 4R8NA 5KRUA 3I56A 1SROA 4OONA 4OHJA 1NTGA 3GTGB 3LWUA 2GVAA 2WINB 2JYOA 3S15H 4YWKA 1ET6A 3I4OA 3DEOA 3J81j 4ZUJA 5ELFA 1YZ6A 3H94A 3K58A 2SNMA 1FNWA 3K59A 2CHBD 4L6TB 4GS3A 1VCIA 2B2VC 1CA5A 1XNRL 4IFDJ 5FJ8G 1I4HA 3GTQH 5CV9A 5IP9H 1K9MC 5IGBA 1D5XC 1EIYB 1M8AA 2XWJB 1SEBD 5ELBA 1AW7A 1UAPA 1PH8A 1HHVA 4JI2Q 3QOLA 3CCEA 4DR2Q 1Y1WG 4O2DA 3CF5A 3SK8A 1PMRA 1B7YB 1PTOB 2KQ3A 1OXUA 1STEA 1DCZA 2ZXPA 3PV0A 2EDGA 3DMUA 1A2UA 4DA2A 2D62A 4F8MA 4A3MB 1LABA 3OOCA 1SNDA 3RMHA 3CP0A 1V1QA 5KNBA 1SRUA 2BOSA 2ZJPA 5HGQA 3DHQA 4EVOA 3D8GA 5JEAJ 4IPHA 2VQEL 2ZTCA 4OWXB 4OWWB 1EZ8A 1RL2A 5FLXL 4QF4A 3NUCA 4ZRZA 1JOKA 4H7BA 1EY6A 4DV0L 3O13A 5E7NA 4IUUA 1SNOA 1GO3E 1L1OA 1EQVA 5DAUA 2IWHA 2C5CA 2FMMA 4XYQA 2EQSA 1GUSA 4JI0L 5M3FG 3LX0A 1SN8A 4A3EH 3L9AX 4DR6Q 2NTSA 2F4VQ 1HZBA 4JYAL 2M00A 1N8RC 2K75A 4NXNL 2F0VA 3SHLA 3J80L 2TSSA 2AHOB 3RR5A 1TWFB 4GKJQ 4TSSA 1WFQA 1YNJD 3Q6SA 1V1PA 1B9MA 2HD3A 2ZTDA 5M9OA 1QWYA 1Q82C 3ZYYX 4L5TA 4X64L 1R4PB 5KYIA 4QMGA 2B2WC 3RN5A 3RZOB 1DZ1A 4LF4L 3T1HQ 5J1ZA 4A3GB 4ZUIA 1OXVA 1X6OA 4F7XA 3DM1A 3TN2A 1HR0Q 2I5MX 2Q2IA 4LK1C 4QUFA 3J7YW 4BBRG 1EEFD 1YVCA 4A93G 3K7AB 2ICEC 1NBWA 2R3ZA 2VL6A 3ULLA 1LT6D 5IGCA 1MD2D 4X3TA 2B2UC 1QUQB 2CH4A 2WIIB 1GUTA 1EU4A 5KYLA 2SNSA 1VQIA 2K05A 2YV5A 5M5WH 2K03A 1RCVD 1DGSA 4GLXA 4DAYB 1FNUA 3A74A 1WCMB 3Q8DA 4BY7G 3HP3A 2YTVA 2WACA 3PIP3 1KAWA 1IW7D 1STBA 1UUPA 1YHBA 3W5OA 4WJ4A 2XTIA 2GN5A 4TQUS 3PUWA 3CPWA 4YCWA 1WD1A 3KDFB 1U4LA 5E1FA 2BH2A 1CHQD 1Y8NB 4CJ1B 2BE5C 1II3A 1N32L 4JVZA 5FOBB 2K52A 4FDBA 3MEHA 4H13C 4CBVA 1G2TA 3NELA 4XT3B 2R7ZB 1AZQA 5EGTA 3CPFA 1PFMA 4NXML 2CFMA 1LV9A 3Q0AA 1K83B 2B2YA 3VDYA 2IX0A 5LMUQ 2Y0SG 1SR3A 3PF5A 2A6HD 1YEZA 2FFKB 2NVYB 3K5MA 4ZKCB 5CV8A 5M3MG 2YTXA 5CV7A 5KNCA 1LTSD 3CC2A 1A3VA 1W6KA 2SOBA 2JA7G 3GTOB 3U4ZA 3UE1A 4GNXC 1AH9A 2VQEQ 4DR5Q 2EY6A 3N52A 2FXQA 3HOXB 1VMCA 3EVQA 1FL0A 3KF8B 4P2CB 1SLJA 1Y1VH 1S3OA 3DWPA 4DV0Q 4KN4C 3MEFA 2I0QA 2IHEA 4PMCA 3VYTA 2L55A 3S1MB 1I50H 3EFXD 1IHZA 4MTKA 4PV1C 1B4OA 1K3BC 1KNEA 4JI0Q 2E74C 3M4OB 4JOIA 1RIPA 4UPAA 2VY3A 1SYFA 4JYAQ 3SXHA 4NXNQ 2Y0SE 2CQOA 5HURA 2A69D 4UDUC 3VR5A 4JV5L 2OF1A 3S9WA 3PMFA 3GTPH 4C3JG 4NKLA 4JI7L 3MAQA 3V96A 3M3YB 3VYSA 1LT3D 4OELB 4A3LH 1VQFA 4FF3A 3TP5A 4JG2A 4J1MA 4P71A 3FPPA 2ATWA 2CVRA 3BVGA 3S16H 3R8BA 2MJ8A 2KECA 4C3HH 4POFA 1T5XD 4GKKL 3D31A 1MKHA 3E9IA 4UP8A 2WFWA 4M8AA 2FJ2A 4DXGA 3FEWX 1IYVA 2RKSA 1D5ZC 2O5JC 2PO4A 3NE5B 1H95A 1F9PA 2MFIA 4DV7L 2AQ3B 3CMAA 2HUGA 2E5LL 4LNQA 3V2TA 4BBSB 3I2ZA 1A3UA 2QKIC 2R61A 1EQQA 1Y69U 1FJGL 4RKBA 1HXYD 2MNAA 1RJTA 2ZJQA 3ERQA 1TY0A 1SE4A 3AU7A 2A73B 3CKIB 3GO5A 3M7NA 1X56A 2A6EC 3BVZA 4HJ8A 3HOWG 3CCMA 1XTDA 2VB3X 2R7DA 3CU7A 3U9SA 4CGYB 2MO0A 3MWYW 3S2HB 4EQ5A 2JQOA 1NR4A 2PZUA 2YTYA 2NVXH 4A3DH 1F2MA 3K0YA 2EYLA 1IKMA 3T16A 5EJWA 1BKBA 3S1RH 4LF5L 1PVOA 2RHQB 3KUPA 3DXJC 3FRPB 3PIPA 5DLQE 1N34L 1SJED 2D9UA 2XGTA 4FVMA 1G6PA 1STAA 2HCCA 2CKZB 1PFSA 1JJ2A 5IT9c 2ZTEA 5IWAQ 5KIXA 1Y8OB 4NXMQ 4CKBA 3CRKC 2CCZA 2XNAC 4R1JA 1SYDA 5T1GA 1IL8A 3PO3G 2H5XA 4LUVA 1XNQL 4DAPA 1WTOA 4P74A 2N78A 3GTMH 1IZ6A 5C44G 2E75C 2MGSA 3BZCA 3VYRA 5M5YH 2KHJA 3DEPA 1PH3A 2Q8IB 1SYEA 2HT1A 1EYGA 3G7LA 3K5LA 1TS4A 4UY8C 4EQNA 1B3QA 2XN9C 5C0XJ 3GTMB 1LTRD 4GOPA 2EZVA 5M5YB 1VQLA 4DV6L 2QEJC 1I3QH 2Z8LA 4WORA 2CH4W 4J6HA 3HZXA 4KY7A 4RH6A 1YBYA 1VQPA 1HUMA 1JORA 1UE5A 1EYAA 2EOTA 3KJPA 4AQYL 1SJHD 4JV5Q 2D5DA 1ILPA 3OIQA 1LTLA 4OL7A 1JWMD 2X69A 2E8GA 1MI2A 1VDZA 3OYYA 4XQJA 4JI7Q 4C56C 3SDZA 2ZT9C 2G9DA 4BXXH 1F9SA 5E4WC 3NTKA 2F0HA 1PFBA 1B44D 3CCJA 2VW9A 2VUMG 2E76C 5C3EB 4UHVA 1T9HA 2B39A 1KTKA 1PTOD 1STHA 3NP8A 1ENAA 5IGFA 1XMOL 1Q90A 3HOVH 5J39A 4GKKQ 1BCPB 1QZGA 2RCNA 3PSIA 2WB1B 1UEBA 4LFAQ 3HOVB 3HOYB 4DV7Q 2E5LQ 1YNND 1A2TA 4KJOA 1GUWA 5ELOA 1HA5A 2F0EA 2SEBD 5FLXc 5CR3A 1FJGQ 1RDPD 1ZKOA 1HNZQ 1SYGA 1MBYA 2AUKA 3NK9A 1I5FA 2F1MA 3WDNA 1ZXTA 4ZK9B 2F3IA 3P20A 5C5LA 5LMNW 4K5VA 4OO1I 3J7AF 2L9HA 2NN6H 3HKZG 5D3DA 3CAMA 4RWSC 3KLWA 4FF4A 1ICFB 5I6WA 1TWCB 4OIKA 4IJHA 5FO7B 2Q2TA 2MUYA 5D14A 1JE5A 4LF5Q 4H0LC 3LWEA 1AE3A 3J80c 1MSHA 3D4WA 4YCUA 1KRTA 1N34Q 1S40A 2F0LA 4A3CH 5M5XH 2N55A 1LT4D 1JE4A 1MHWC 5T1IA 4QCLA 1F9QA 2G5DA 4A3BG 3HOUB 2QA4A 4JOIC 1O7IA 3J81L 4EQOA 3STBD 4OXPA 2JA8B 4CDFC 1QCBD 4IFDH 3SEBA 2NVQH 4XXEA 1K0SA 1PH7A 1WOCA 3HKZE 2N49A 5JJKA 3CRLC 3R93A 3F2DA 3EN2A 3WOEA 5J22A 3LNNA 5C6AA 4FXDA 2NVQB 4LUZA 1VQ7A 4KY6A 2LKVA 4A3JG 2PW7A 5C4JH 3RLOA 1W2BA 2EE1A 1JWUD 2JK8A 3BU2A 3S14H 3UDGA 1LTAD 1OTCA 4XQQA 2KHSA 4BWGB 1NAPA 2OQKA 4B08A 1KABA 1HNXQ 3KJOA 2K32A 4AQYQ 5FJ8H 2R93B 3JC66 2JA6G 2F0PA 2OEOA 5AJ3Q 1S5FD 1LUZA 1I6HB 2ALYB 3G4SA 2WAQB 3S2DB 1YI2A 5LL6S 3GTJH 3K81C 1GHJA 3CW2C 4A3KB 4JBJA 1Y1WH 3FP9A 1O7LA 3TZUA 3CD6A 5FLMH 1U9RA 3I4NH 3M9BA 5ISRA 4HEDA 2R92H 1OXXK 1XMOQ 1K28A 1UE6A 2EY5A 3EA6A 1F2ZA 2Z1CA 1F2YA 3OTOL 4A3FB 1FGBD 3I4NB 4DAYA 2R92B 1EIHA 2EJGC 4QJFA 3BZDB 3HOZG 1SE2A 2K5DA 5HGTA 5A2QL 4POGA 2KVMA 1Q1BA 3IL8A 3KDFA 2B8GA 5CV4A 2G9HD 3JAMi 3NPPA 3H0GB 1IBMQ 5M3FH 1PZKD 1G91A 3GV3A 2SDFA 3C1FA 4KKSA 3M4QA 4IALA 4MIUA 1TVXA 4R4TA 2OTJA 4A3IG 3TS2A 3QR8A 3CC7A 2E2HH 1A62A 2JXMB 4XTCS 5EKLA 1LM0A 3V05A 2K1BA 4XQNA 4DNRB 1KRSA 5JPNC 3F2UA 4JI5L 4QL5A 3MFGA 2B8FA 1PRTC 3R3OA 3ND9A 2BDOA 2A6ED 3S15B 3PUZA 4FXKC 5EPKA 2RBMA 3ERSX 4DV5L 1STGA 2F0DA 4A93H 3KF8A 4E6IA 4MZ9A 4L8JA 3W1BA 1BBWA 1XPOA 5JJLA 1QILA 1PXUA 1I4PA 3SVMA 3J7ZC 3BVMA 1I4QA 4YWMA 2NVTH 2UXBL 4QGUA 3FVQA 3QG1A 1M90C 3GTQB 4DAMA 3PO2G 4DN4M 3I4MG 1TXYA 5E3FA 1YJNA 1W6JA 2BA0A 3W1GA 3NBHB 3S17H 4YHHQ 4Y7NH 1VQNA 3OMGA 4BY7H 1ENCA 1NMGA 2LXKA 3T1YL 3HKSA 4BA1I 4ALPA 2EIFA 1B3AA 1PRTF 1J6QA 3F1ZA 3KBGA 1Q7YC 4Y7NB 4KD4A 4GN5A 2F0FA 1D8LA 2BDNA 3TP6A 3C2PA 3I73A 3MVVA 4B9WA 4C2MH 3C3LA 4N9PA 4QQBX 2KBNA 4RMFA 4U68A 1IL2A 2PYKA 4P75A 3MC0B 3PUVA 1WTXA 2L0CA 1OXSC 2DJFC 4K8JA 2LFNA 1IBLL 1KIXA 3GV6A 3MZ5A 4CKCA 4PMBA 4ZYSA 3ITPA 3K80C 2F3VA 2N8NA 3TP8A 1MGSA 1ASZA 4B3TL 4LFBL 3Q22A 2JA9A 1STNA 2P5ZX 3CCSA 2J7ZA 4HIKA 4A3EB 2UUCQ 3NQIA 4IOCA 3T56B 5M3MH 4DV1L 3OTOQ 1GVPA 2HDMA 2RF4A 1SMYC 3W3AA 2MO1A 4K2KA 2JA5H 5KEEA 1XMQL 2NUCA 5M3MB 1AFPA 4LWCA 3OSOA 4KV6A 4LUOA 1EIFA 2OT2A 5I6YA 2L4NA 3E6ZX 2JA5B 2EYJA 4B9XA 3CMEA 3MHBA 5CV6A 2BH8A 3U4VA 1VQ8A 4LAAA 2ICIA 1F2LA 1VS0A 4I7AA 5H1SE 3TZDA 1VF5C 4OEMB 3VR2A 2IW3A 5HY6A 4R8IA 3OHXC 1FNVA 2L1BA 4AYBB 3HS0C 5IYBG 2UUBL 2A68C 4DK0A 3CCQA 5I9PA 5FO9B 2NN6I 4MHEA 4C3JH 5AFWA 1KDAA 2UXDL 1JR0D 1PTOF 5IP9G 2F03A 3X3NA 1JCKB 2A1AA 5M5WB 4KI0A 4A3MG 1B1ZA 1NMFA 2Z6KA 4RAUC 3T13A 1E1OA 4G7OC 2I07B 1A6XA 4KHVA 4IUVA 3TQYA 3VR4A 5JJIA 4GNXB 4NDXA 3MXNB 3H6MA 4IPGA 2UUAL 4JC0A 1PHJA 1XNRQ 3NWTA 1BCPD 4N8FA 1V1OA 4GN3B 4DV5Q 1PLFA 1X3QA 2O5IC 4DR1L 1EYCA 1HCZA 1L0XB 3BG3A 3D0FA 1HNWL 2IPKD 1Q8KA 2R6GA 1SNCA 4RGTA 5C3XA 1H9MA 3F2BA 4RGMA 4OX9L 3TMEA 1EY8A 4V0BA 1SNPA 1GM5A 3UDXA 2JSOA 5C5MA 2AQ2B 1PA6A 1SSOA 4OWTB 1ICWA 1CA6A 5IIFA 2HIVA 1UNSA 4PNYA 4HMJA 4CDEC 1GXDC 2I46A 5CGKA 2BCOA 3A55A 4HTHA 1E2WA 3VYUA 3ULJA 3EBEA 4ODGA 4FXGC 3CXCA 4G4KA 5C0XH 2EPBA 4A3GG 1VQBA 3ZJYC 3DM3A 1BO0A 3RD4A 2A19A 4IUPA 3HEJA 4DK3C 1ESRA 2XRQD 1Y1VB 3HRZC 1NNXA 2NB0A
chains in the Genus database with same CATH topology
5ELEA 1EZ6A 2N88A 4Z9CB 2QILA 3D4DA 1I50B 5G3LF 1AZPA 1R4QB 1IKLA 4KJNA 5IGGA 4F88A 3GP7A 3N6RA 1RD9D 1HFNA 3GTPB 3A8KE 4HCSA 4QUCA 3NTIA 4NMZA 4OO1G 4RFBA 4C1NK 2DNEA 1DXMA 4U673 4LMQD 3QIAA 2MHVA 3GQBA 1DYQA 3S16B 4CKEA 1ET9A 5CBEE 2YU9B 2EYOA 4C3HB 2Z4HA 2PZTA 2DY8A 1EOTA 2L11A 2MPMA 3NQTA 2F0GA 4RHRA 1SE3A 2RA4A 1I4XA 3CHBD 3A56A 5JPMC 2CW0D 2F3WA 4K8IA 3D4RA 3SK5A 1S5DD 2L12A 5I9OA 4K2LA 2ZXOA 4WJWA 1ML0D 1SFOB 4X3UA 1XYIA 1JOOA 1VMPA 1ZYRD 3AB9A 1V1PB 1LACA 1GUNA 1X32A 4A3DB 2NVXB 2H4OA 1SAPA 4RGNA 4FO2A 1BDOA 5ELDA 1PZJD 1G2SA 3S1RB 2EJFC 5LL6X 1FYCA 5EKIA 4FF1A 5CMDA 2EY1A 1EFID 3MXUA 1DONA 1D1IA 1KDBA 1D5MC 3Q24A 5IODA 1BF4A 1B9NA 1JB3A 3RUZA 3BYYB 4XIGS 3I8ZA 1EYDA 1GOZA 5EBCA 2XRSD 2KCCA 2O2LD 1SXTA 3H3VC 2L5TA 3A7AB 1I3QB 3C46A 1CQFA 1V8QA 4X3KA 2F0UA 2H1EA 4NW2A 1CM9A 5IT9E 3R2IA 3OPOA 2KCNA 1OXTA 3G6JB 2FINB 4CJ0B 5DM73 3MA2B 1U4RA 4ME5A 4IUQA 1GHKA 1YNJC 1TQOA 1JWSD 1ENFA 4ILWA 1H9KA 2ID0A 1O78A 3Q23A 4JK1C 4LJZC 1O80A 4IQZA 2NWGA 3IKJA 1LTID 3I3CA 2EYPA 3L3OC 1D2BA 5COYA 1U4MA 3BDCA 5F2DA 3SK4A 1I4GA 2YYZA 5C4XB 3VR6A 4ZLTF 2IX1A 3OWEB 1TT2A 2B2YC 4RHSA 4K6LA 3EJIA 1LLRD 5I4DA 5D3IB 2KEDA 1JQYD 3TBIB 1H9JA 3H09A 4KN7C 4CJ2C 4V190 4FNFA 4C3IB 1IW7C 2TMPA 4HR7B 3IFDA 2B63B 1WTPA 4WRDA 5DEHA 2EYFA 4O42A 1GUOA 5CORA 2HQEA 1PFNA 2PPBC 2DN8A 1HPCA 2B2WA 2PCFB 5M5XB 5K36G 5FLXE 4RCOA 5JAVA 2BE5D 2F0OA 4CHTB 2A6HC 4HSPA 1FD7D 3NTHA 5IOCA 2PZWA 2J0TD 3S1QB 4ZKBB 2B2UA 2XVSA 3M85A 4G57A 4IN3A 3NWSA 1C4QA 3PUYA 3KLRA 4ZQ3A 3J80E 3P1HA 1S5BD 5C4JB 1CFMA 1IYUA 2WKDA 4S3SA 3M4YA 4BS9A 3S14B 2KA7A 5KGUA 1Q3LA 1BUVT 2V4DA 3K6OA 2RSNA 4XYOA 1ESFA 2A69C 4C1NI 4OIJA 5ELCA 1CZGA 1TWGB 5JVH3 1NUCA 2DNCA 5I2XA 1F77A 2JEAI 1TR5A 3A54A 3GTJB 2K6AA 2E2DC 1PYWD 1Y1WB 1OO9B 3MXPA 5LHY1 2AQ1B 3I4MB 3EQLC 2NN6G 2ENBA 1STYA 2RDHA 1RKNA 1SNQA 1RF2D 1E2ZA 1PRTB 2M9VA 3QJYA 1BQQT 1HQRD 1KAAA 4HMIA 3MXNA 3FDTA 3OW7A 1KLUD 3DUZA 2RQXA 1K8OA 2F0JA 3X3MA 3DWQA 4G7HC 2VXWA 3JAME 5M3FB 3UI2A 1I6VC 2QF7A 4XDXA 1DM0B 3E0JA 3HGBA 4IFDG 2EYHA 4FF2A 1KNAA 2E2HB 1PZID 2OXPA 3SK6A 1SNMA 3URYA 4OGQC 2F0WA 3ONAB 1Z6HA 4I7ZC 2GA4B 1G8ZD 4PQXA 4BBRB 1ILQA 4R9WA 5C3WA 1RTNA 1EWHA 1KDCA 1RODA 3GTLB 4A93B 1DOMA 3BS1A 2KUMA 5C4HA 5JEAG 2F0SA 1QNUA 1HTPA 3D3RA 2NVTB 2NZ1D 4RCNA 1PTOH 2HCIA 4DXFA 5K5PA 1HRJA 2F4IA 3S17B 4F87A 3H91A 4YIJA 1EWCA 4BY7B 2WV6D 2F0IA 3KK7A 3BDLA 1SBBB 1RHPA 3C1EA 4KY5A 4DFAA 1EEID 1CZWA 4M1UB 1J9OA 4C2MB 1XWEA 2KJXA 1CHPD 2JEBI 3BYTB 5DM63 4X3SA 3FMCA 1QB5D 2A5HA 1NSNS 1HTLD 1PTOC 3I4LA 1O7YA 2LY7A 3K57A 2Y0SB 1EIGA 2K7VA 4O1NA 1TIID 5EPJA 4KKTA 4Q5VA 2JA7B 5CC4A 1BBXC 2RVLA 3FPUB 4N9TA 1YNNC 3MFYA 3VA5A 3T53B 4K5XA 2LS01 1WTQA 2B2TA 3KLSA 1B50A 1EU3A 2LMCB 1O7ZA 3ND8A 1SDFA 2RDFA 1XTCD 3MTSA 4IURA 3TDQA 4K5WA 1BNZA 4IUTA 1H9SB 3K5OA 4C3JB 1LT5D 4JBWA 4OO1H 3EROA 1RTOA 2F0NA 4NP5A 2F0MA 4HSVA 1AP0A 4RA8A 1QE6A 3D6WA 1CK1A 2NTTA 2MP1A 4BA2I 2X6LA 2IJ0A 3U9OA 1KLGD 4TKOB 1WTRA 2K5QA 5D65A 3OIPA 5CV5A 4IFDI 2F0KA 1DJRD 3HRZC 1HUNA 2X6GA 3JAML 3QOJA 1I4RA 2F0QA 1EY0A 1HFGA 1TKWB 5CYUA 3QWNA 1R9TB 1LTTD 1V43A 2CQAA 3I72A 3KLSX 4ID6A 5EBDA 1TY2A 3HOWB 1GUGA 2KOLA 1T5EA 1WTVA 2O4XA 1QG7A 2Z4IA 1Z47A 1TWHB 1UEAB 1JC7A 3RLFA 4MN3A 2J4XA 4Q0FA 3IFTA 3PO3B 4QB4A 1JICA 4KHZA 1AN8A 1F9RA 3L7ZC 2IX3A 5C44B 2K28A 1B2TA 4XT1B 1QOHA 3CQZB 4DF7A 2QCPX 4DNTB 5TSSA 3I91A 2E2IB 1BR9A 2Q8TA 1Q12A 4ABNA 1BOSA 2XIWA 1HQMC 2QDBA 3R2TA 5BN3A 5FO8B 2WKCA 5BN5A 5BN4A 1LTGD 1M4VA 1CI3M 3NBIA 3J81E 3TP7A 1Q1EA 3VR3A 4BY1B 3OWFA 2VNUD 2VUMB 5EKKA 3GD7A 3GTKB 1EY5A 2K01A 1BXTA 1CTMA 3DWAA 1Y8PB 4IUNA 5C0XG 3PIO3 3FKIB 5EQ0A 4K14A 1PRTD 1H9RA 3W2DA 3A8IE 3E5SA 2KEEA 3P75A 4KTAA 4KMUC 5EPLA 3NHHA 3HKZB 4QIWB 2PW5A 5FK9C 2NBFA 5I2YA 1L0YB 4HN7A 1S5CD 1EY7A 3A8JE 3QO2A 1G6ZA 1WTWA 1C8CA 1EL0A 2PQEA 1G291 3IAYA 4C3HG 1EY4A 5FKAC 4RGOS 1B53A 1Z7TA 3BDOA 2JP1A 2B2TC 2K5WA 4L63B 1VF7A 5K36H 2JE6I 4A3BB 1LTBD 3I70A 5A2QE 3D6CA 2B2VA 4FP5D 2EJMA 1FR3A 4KK7A 2EXZA 3KBXA 3MXGA 4HAEA 1XXGA 2AWOA 2FHTA 1CT1D 1J8IA 1E2VA 1JOQA 4J8QA 4RKLA 4DGZA 4A3JB 2DY7A 1SMYD 5DNFA 3M7GA 2FMCA 4WFN3 3J7AV 2C9OA 3NSWA 1S5ED 2E2JB 2XSCA 5JOBA 1K8MA 4G7ZC 1DOLA 1S4ZA 3OMCA 1C48A 2JA6B 1DD2A 5E4XA 1E0BA 1DOKA 1EY9A 1TS2A 2NYZD 4EQPA 3NBHA 1SYBA 1CQVA 4FYDA 2A68D 4UAIA 1QJOA 4ZAIA 3T51B 1TWAB 1NCVA 1BCPC 3TSSA 3P7JA 3HG9A 5A35A 3HOZB 3SR1A 2EYMA 2M2LA 1XX8A 1EQTA 2AUJD 3NXWA 2VB2X 3T4AC 4DU9A 4IZ8A 2EY2A 3S1NB 2K04A 2Q8RE 1TS3A 1ZEQX 1TS5A 4I65A 1Q8IA 5G3LD 4A3IB 3RZDB 5NUCA 2HDLA 5C0XI 2BA1A 2PMZB 1BCPF 2D2CC 3K5NA 4PMWA 1A3TA 1D1KA 3SE0A 2XWBB 4DAVA 2IT1A 3WOFA 4TRDA 4KD3A 4EGVA 2ZXRA 2WP8J 1A15A 1GJXA 1TU2B 5JEAH 2AWNA 1D6EC 1WD0A 2PNRC 3VA7A 3PO2B 4H44C 4C3IG 2K33A 2RDGA 1H9SA 1PDQA 5JVG3 5KNDA 4HCEA 5C4ZA 1U4PA 2RSOA 4GZYC 5IT9L 3I90A 2CW0C 1X3PA 3PUXA 1QNKA 4K6DA 2IL8A 5JJZA 5IGEA 3A7LA 1WVLA 1ONLA 3QB3A 4KKUA 2F0TA 1HA6A 4DK1A 1SYCA 2EVBA 1ZYRC 2A74C 1MSGA 1NR2A 3AMUA 4ULLA 5IGDA 1LO5D 1AEXA 4R8NA 5KRUA 4OHJA 3GTGB 3LWUA 2WINB 2JYOA 1ET6A 3DEOA 4ZUJA 5ELFA 3H94A 3K58A 2SNMA 1FNWA 3K59A 2CHBD 4L6TB 4IFDJ 1VCIA 2B2VC 1CA5A 1I4HA 5CV9A 5IGBA 1D5XC 1M8AA 2XWJB 1SEBD 5ELBA 1AW7A 1UAPA 1HHVA 3QOLA 3SK8A 1PMRA 1PTOB 2KQ3A 1OXUA 1STEA 1DCZA 2ZXPA 3PV0A 2EDGA 3DMUA 1A2UA 4DA2A 2D62A 4F8MA 4A3MB 1LABA 3OOCA 1SNDA 3RMHA 5KNBA 2BOSA 3DHQA 4EVOA 3D8GA 5JEAJ 1EZ8A 5FLXL 4QF4A 3NUCA 4ZRZA 1JOKA 4H7BA 1EY6A 3O13A 4IUUA 1SNOA 1EQVA 5DAUA 2IWHA 2C5CA 2FMMA 4XYQA 1GUSA 3LX0A 3L9AX 2NTSA 2M00A 2F0VA 3SHLA 3J80L 2TSSA 1TWFB 4TSSA 3Q6SA 1YNJD 1V1PA 1B9MA 5M9OA 1QWYA 3ZYYX 1R4PB 5KYIA 4QMGA 2B2WC 3RZOB 1DZ1A 4A3GB 5J1ZA 4ZUIA 1OXVA 4F7XA 3DM1A 3TN2A 4LK1C 4QUFA 3J7YW 1EEFD 3K7AB 2ICEC 2R3ZA 1LT6D 5IGCA 1MD2D 4X3TA 2B2UC 2WIIB 1GUTA 1EU4A 5KYLA 2SNSA 2K05A 2K03A 1RCVD 1FNUA 1WCMB 3HP3A 2WACA 3PIP3 1IW7D 1STBA 1UUPA 4TQUS 3PUWA 1WD1A 5E1FA 1U4LA 1CHQD 1Y8NB 4CJ1B 2BE5C 1II3A 5FOBB 3MEHA 4H13C 4CBVA 1G2TA 4XT3B 2R7ZB 1AZQA 5EGTA 1PFMA 1LV9A 3Q0AA 1K83B 2B2YA 2IX0A 2A6HD 2FFKB 2NVYB 3K5MA 4ZKCB 5CV8A 5CV7A 5KNCA 1LTSD 1A3VA 1W6KA 2SOBA 3GTOB 2EY6A 3N52A 3HOXB 1VMCA 3EVQA 4P2CB 3DWPA 4KN4C 4PMCA 3VYTA 2L55A 3S1MB 3EFXD 1IHZA 4PV1C 1B4OA 1KNEA 2E74C 3M4OB 1SYFA 3SXHA 5HURA 2A69D 4UDUC 3VR5A 2OF1A 3S9WA 3PMFA 4C3JG 4NKLA 3M3YB 3MAQA 3V96A 3VYSA 1LT3D 4FF3A 3TP5A 4J1MA 3FPPA 2CVRA 3BVGA 3R8BA 2MJ8A 2KECA 1T5XD 3D31A 4M8AA 2FJ2A 4DXGA 3FEWX 1IYVA 2RKSA 1D5ZC 2O5JC 2PO4A 3NE5B 1F9PA 2AQ3B 2HUGA 3V2TA 4BBSB 1A3UA 2QKIC 2R61A 1Y69U 4RKBA 1HXYD 1RJTA 3ERQA 1TY0A 1SE4A 3AU7A 2A73B 3CKIB 3GO5A 3M7NA 2A6EC 3BVZA 2VB3X 3CU7A 3U9SA 4CGYB 3MWYW 3S2HB 2PZUA 1NR4A 1F2MA 3K0YA 2EYLA 1IKMA 3T16A 5EJWA 3KUPA 3DXJC 3FRPB 1SJED 2D9UA 4FVMA 1STAA 2HCCA 5KIXA 1Y8OB 4CKBA 3CRKC 2XNAC 1SYDA 5T1GA 1IL8A 4DAPA 1WTOA 2E75C 2MGSA 3VYRA 3DEPA 2Q8IB 1SYEA 3G7LA 3K5LA 1TS4A 4EQNA 2XN9C 5C0XJ 3GTMB 1LTRD 2EZVA 5M5YB 2QEJC 2Z8LA 4WORA 4J6HA 3HZXA 4KY7A 4RH6A 1HUMA 1JORA 1EYAA 2EOTA 1SJHD 2D5DA 1ILPA 3OIQA 4OL7A 1JWMD 2X69A 1MI2A 1VDZA 4XQJA 4C56C 3SDZA 2ZT9C 2G9DA 1F9SA 5E4WC 3NTKA 2F0HA 1PFBA 1B44D 2E76C 5C3EB 2B39A 1KTKA 1PTOD 1STHA 3NP8A 1ENAA 5IGFA 1Q90A 5J39A 1BCPB 2WB1B 3HOVB 3HOYB 1GUWA 1YNND 1A2TA 4KJOA 1HA5A 2F0EA 2SEBD 5CR3A 1RDPD 1ZKOA 1SYGA 1MBYA 2AUKA 3NK9A 2F1MA 3WDNA 1ZXTA 4ZK9B 3P20A 5C5LA 4K5VA 4OO1I 3J7AF 2L9HA 2NN6H 5D3DA 4RWSC 4FF4A 5I6WA 1TWCB 4OIKA 5FO7B 2MUYA 5D14A 4H0LC 3LWEA 1MSHA 3D4WA 2F0LA 2N55A 1LT4D 1JE4A 5T1IA 4QCLA 1F9QA 3HOUB 3J81L 4EQOA 2JA8B 1QCBD 4IFDH 3SEBA 4XXEA 3CRLC 3R93A 3WOEA 5J22A 3LNNA 5C6AA 4FXDA 2NVQB 4KY6A 2LKVA 2PW7A 2EE1A 1JWUD 1LTAD 4XQQA 2KHSA 4BWGB 1NAPA 4B08A 1KABA 2K32A 2R93B 2F0PA 2OEOA 1S5FD 1I6HB 2WAQB 3S2DB 5LL6S 1GHJA 4A3KB 1O7LA 3TZUA 1U9RA 5ISRA 4HEDA 1OXXK 2EY5A 3EA6A 1F2ZA 2Z1CA 1F2YA 4A3FB 1FGBD 3I4NB 4DAYA 2R92B 1EIHA 2EJGC 3BZDB 1SE2A 2K5DA 5HGTA 5A2QL 2KVMA 1Q1BA 3IL8A 2B8GA 5CV4A 2G9HD 3NPPA 3H0GB 1PZKD 1G91A 3GV3A 2SDFA 3C1FA 4KKSA 4MIUA 4IALA 1TVXA 2JXMB 4XTCS 5EKLA 3V05A 2K1BA 4XQNA 4DNRB 5JPNC 3F2UA 3MFGA 2B8FA 1PRTC 3R3OA 3ND9A 2BDOA 2A6ED 3S15B 3PUZA 4FXKC 5EPKA 2RBMA 1STGA 2F0DA 3KF8A 4E6IA 4L8JA 1QILA 1PXUA 1I4PA 3SVMA 3BVMA 1I4QA 3FVQA 3QG1A 3GTQB 4DN4M 5E3FA 1W6JA 2BA0A 3OMGA 1ENCA 4BA1I 1B3AA 1PRTF 3KBGA 4Y7NB 4KD4A 2F0FA 2BDNA 3TP6A 3C2PA 3I73A 3MVVA 4B9WA 3C3LA 4N9PA 4U68A 2PYKA 3MC0B 3PUVA 1WTXA 2L0CA 1OXSC 4K8JA 2LFNA 3GV6A 3MZ5A 4CKCA 4PMBA 4ZYSA 3ITPA 2F3VA 3TP8A 1MGSA 3Q22A 1STNA 2J7ZA 4A3EB 3NQIA 3T56B 2HDMA 1SMYC 3W3AA 4K2KA 5KEEA 2NUCA 5M3MB 1AFPA 3OSOA 4KV6A 2OT2A 5I6YA 2L4NA 3E6ZX 2JA5B 2EYJA 4B9XA 3MHBA 5CV6A 4LAAA 2ICIA 1F2LA 3TZDA 1VF5C 3VR2A 2IW3A 4R8IA 3OHXC 1FNVA 2L1BA 4AYBB 3HS0C 2A68C 4DK0A 5I9PA 5FO9B 2NN6I 4MHEA 5AFWA 1KDAA 1JR0D 1PTOF 2F03A 3X3NA 1JCKB 5M5WB 4KI0A 1B1ZA 3T13A 4RAUC 4G7OC 2I07B 1A6XA 4KHVA 4IUVA 3VR4A 4NDXA 3H6MA 3NWTA 1BCPD 1V1OA 1PLFA 1X3QA 2O5IC 1EYCA 1HCZA 1L0XB 3BG3A 2IPKD 5C3XA 2R6GA 1SNCA 4RGTA 1H9MA 4RGMA 3TMEA 1EY8A 4V0BA 1SNPA 2JSOA 5C5MA 2AQ2B 1SSOA 1ICWA 1CA6A 5IIFA 1UNSA 4PNYA 4HMJA 1GXDC 2I46A 5CGKA 2BCOA 3A55A 4HTHA 1E2WA 3VYUA 4ODGA 4FXGC 4G4KA 5C0XH 2EPBA 1BO0A 3RD4A 4IUPA 3HEJA 1ESRA 2XRQD 1Y1VB 5CBAE 2NB0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VYS A;  3VYU A;  2OT2 A;  2Z1C A;  3VYT A;  3VYR A;  3D3R A; 
#chains in the Genus database with same CATH topology
 5ELE A;  1EZ6 A;  2N88 A;  1IBL Q;  4Z9C B;  2QIL A;  3G71 A;  4K0K L;  3D4D A;  5IYD G;  3TRE A;  1I50 B;  5G3L F;  1AZP A;  4B3T Q;  1R4Q B;  1IKL A;  4KJN A;  5IGG A;  2MQH A;  4F88 A;  3GP7 A;  5C44 H;  3N6R A;  4DV1 Q;  3J81 c;  4YY3 L;  4X64 Q;  4DR3 L;  2K5V A;  1RD9 D;  1HFN A;  4LF4 Q;  1JJC B;  3GTP B;  3A8K E;  4HCS A;  4QUC A;  3NTI A;  1WCM G;  1XMQ Q;  4NMZ A;  4APV A;  2YU9 H;  2K5N A;  4OO1 G;  4RFB A;  4C1N K;  2DNE A;  1DXM A;  2E2I H;  1VQ5 A;  4U67 3;  4LMQ D;  4JI3 L;  3QIA A;  2MHV A;  3GQB A;  1DYQ A;  3S16 B;  4CKE A;  1ET9 A;  5CBE E;  2YU9 B;  2EYO A;  4C3H B;  2Z4H A;  2PZT A;  3L0O A;  2DY8 A;  2RCF A;  4J15 A;  1EOT A;  2L11 A;  2MPM A;  3NQT A;  2F0G A;  4RHR A;  1SE3 A;  2RA4 A;  4CDC C;  4B3S L;  1N33 L;  1I4X A;  3CHB D;  3A56 A;  5JPM C;  2CW0 D;  2F3W A;  2R7Z G;  4JW0 A;  4K8I A;  2UUB Q;  1SFO H;  4DPG A;  3D4R A;  3SK5 A;  1S5D D;  2L12 A;  5I9O A;  4K2L A;  2ZXO A;  1HR0 W;  4WJW A;  2UXD Q;  1ML0 D;  1SFO B;  2Z9H A;  2VUM H;  1VQH A;  4X3U A;  1XYI A;  1JOO A;  1VMP A;  5ELN A;  1ZYR D;  3AB9 A;  4LFC L;  1V1P B;  4H02 A;  3AEV A;  5IP7 G;  1LAC A;  2K5H A;  1GUN A;  3H3V H;  2UUA Q;  1X32 A;  1N32 Q;  3HOX G;  4A3D B;  2NVX B;  2H4O A;  2UXC L;  1SAP A;  2NZO A;  4RGN A;  4FO2 A;  1BDO A;  5GRO A;  5ELD A;  1PH1 A;  1PZJ D;  1G2S A;  1L1O C;  1HNW Q;  3S1R B;  1LYL A;  2EJF C;  1PYS B;  5BR8 L;  5LL6 X;  1FYC A;  3U58 A;  5EKI A;  4FF1 A;  4OX9 Q;  5CMD A;  1WYD A;  2EY1 A;  1EFI D;  3MXU A;  1DON A;  1EOV A;  3ER0 A;  1YJ9 A;  1D1I A;  1KDB A;  1D5M C;  3Q24 A;  5IOD A;  1BF4 A;  1B9N A;  1JB3 A;  3RUZ A;  4YCV A;  1C9O A;  4DK6 C;  1XJV A;  3BYY B;  3TRZ A;  4DUY L;  4XIG S;  4A75 A;  1X3E A;  2B29 A;  3I8Z A;  1EYD A;  1GOZ A;  5EBC A;  2XRS D;  5IY0 A;  5EAY A;  2KCC A;  2CWP A;  2O2L D;  1SXT A;  3H3V C;  2KCM A;  2L5T A;  3A7A B;  1C0A A;  1I3Q B;  3C46 A;  1CQF A;  1E22 A;  1C7Y A;  2F52 A;  4ME3 A;  1V8Q A;  4X3K A;  1BVS A;  1X55 A;  2F0U A;  4K0K Q;  2H1E A;  4A3B H;  4NW2 A;  1CM9 A;  5IT9 E;  3R2I A;  3OPO A;  2KCN A;  1OXT A;  3G6J B;  2FIN B;  4CJ0 B;  4BBS G;  4IO9 A;  5DM7 3;  4BY1 G;  2ZM6 L;  4ZCK A;  4DR3 Q;  2QGQ A;  3MA2 B;  1U4R A;  4L5Q A;  4ME5 A;  4IUQ A;  1GHK A;  1YNJ C;  1TQO A;  2D0O A;  1JWS D;  1ENF A;  4ILW A;  1H9K A;  2I5H A;  2ID0 A;  2Z0S A;  1O78 A;  3Q23 A;  4JK1 C;  4LJZ C;  1O80 A;  4JBM A;  4IQZ A;  2NWG A;  2NZH A;  3IKJ A;  4DUZ L;  5C4X H;  3H15 A;  3FKI G;  1LTI D;  3I3C A;  2EYP A;  2R7F A;  3L3O C;  5COY A;  1D2B A;  3IRB A;  1U4M A;  3BDC A;  4B3S Q;  4DR7 L;  1N33 Q;  5F2D A;  2E2J H;  3SK4 A;  1IYJ B;  1I4G A;  2YYZ A;  5C4X B;  3VR6 A;  2JA6 H;  4ZLT F;  1EFW A;  3OWE B;  1TT2 A;  2IX1 A;  2B2Y C;  1IBK L;  2B3G A;  4RHS A;  4K6L A;  3EJI A;  1LLR D;  1P16 A;  5I4D A;  4JI4 L;  5D3I B;  2KED A;  4C3I H;  1VQ6 A;  1JQY D;  2B63 H;  3TBI B;  4PZ6 A;  1H9J A;  3H09 A;  4KN7 C;  4CJ2 C;  4V19 0;  1TWA H;  1D7Q A;  4LFC Q;  2L15 A;  4FNF A;  1IW7 C;  2TMP A;  4JPB W;  4C3I B;  4HR7 B;  3IFD A;  2VQF L;  2B63 B;  1WTP A;  4WRD A;  5DEH A;  2EYF A;  1X3G A;  2UXC Q;  4O42 A;  1GUO A;  5COR A;  5GAE C;  4LF8 L;  2HQE A;  3HOZ H;  3TEH B;  1PFN A;  2PPB C;  3K7U C;  1K8G A;  2DN8 A;  1HPC A;  2B2W A;  4DV4 L;  4DNI A;  3A0J A;  2PCF B;  1XNQ Q;  5M5X B;  1EUJ A;  1Z9F A;  1L2F A;  5K36 G;  3S1N H;  3S1Q H;  4NPS A;  4QIW E;  4RCO A;  5FLX E;  5JAV A;  3J7A 5;  2BE5 D;  2JN4 A;  2F0O A;  4CHT B;  2A6H C;  1SE8 A;  4HSP A;  4WJ3 M;  4DUY Q;  1HZA A;  1FD7 D;  3NEN A;  3NTH A;  3E0E A;  5IOC A;  2PZW A;  2J0T D;  2PI2 A;  3PQI A;  4DV6 Q;  1VQD A;  3S1Q B;  4ZKB B;  3CCL A;  2KHI A;  2B2U A;  2XVS A;  4A4I A;  3J80 i;  3M85 A;  4G57 A;  5C3E G;  3S24 A;  4IN3 A;  3NWS A;  1C4Q A;  4LF7 L;  2EXD A;  4BXX G;  3PUY A;  4IPD A;  3KLR A;  1E7Z A;  3KYH C;  4ZQ3 A;  3J80 E;  3P1H A;  1S5B D;  2WB1 G;  4HID A;  5C4J B;  1CFM A;  1IYU A;  2WKD A;  4S3S A;  3HOV G;  3HOY G;  1I94 L;  3M4Y A;  4BS9 A;  3HFZ B;  3S14 B;  2KA7 A;  1TWG H;  5KGU A;  1Q3L A;  2Q2H A;  1FGU A;  1BUV T;  2V4D A;  3K6O A;  2RSN A;  1HH2 P;  4XYO A;  1ESF A;  2A69 C;  4C1N I;  4TVA B;  1J5E L;  4OIJ A;  5ELC A;  4PZ8 A;  1CZG A;  1QUQ A;  1TWG B;  5JVH 3;  1NUC A;  2UU9 L;  3PO2 H;  2DNC A;  3I4M H;  3OW2 A;  5I2X A;  1F77 A;  4X6A H;  2JEA I;  1TR5 A;  3A54 A;  3GTJ B;  2K6A A;  2E2D C;  1PYW D;  1Y1W B;  1VQC A;  3KF6 B;  1OO9 B;  3MXP A;  5LHY 1;  1CKM A;  2AQ1 B;  3I4M B;  4DUZ Q;  3EQL C;  2OCE A;  2NN6 G;  3U50 C;  2ENB A;  2V1C C;  1NE3 A;  1NY4 A;  2WB1 E;  1STY A;  3UE0 A;  4DR7 Q;  4HIO A;  1MIU A;  2RDH A;  1RKN A;  1SNQ A;  1RF2 D;  1E2Z A;  1PRT B;  2M9V A;  3QJY A;  1BQQ T;  1HQR D;  4GKJ L;  1KAA A;  4HMI A;  4GNX A;  3MXN A;  3FDT A;  1IBK Q;  3HOU G;  2VS1 A;  2QEX A;  3OW7 A;  3T1H L;  1KLU D;  4JI1 L;  3DUZ A;  2RQX A;  1K8O A;  4B3R L;  2JA8 G;  2F0J A;  3X3M A;  3DWQ A;  1KD1 C;  4G7H C;  2VXW A;  3JAM E;  5M3F B;  1WI5 A;  1I6V C;  3UI2 A;  4IOA A;  2QF7 A;  4XDX A;  1DM0 B;  1B8A A;  3E0J A;  2N3S A;  4GOP C;  3HGB A;  1K8A C;  4IFD G;  1M1K C;  2EYH A;  1PH5 A;  4FF2 A;  1HJP A;  1KNA A;  1PZI D;  2E2H B;  2K14 A;  2OXP A;  3UDF A;  1Q46 A;  3GTG H;  3SK6 A;  1SNM A;  3URY A;  4OGQ C;  2F0W A;  3ONA B;  1Z6H A;  4BBR H;  4I7Z C;  1JB7 A;  4DV4 Q;  3GTL H;  5IYC G;  4JI8 L;  1JT8 A;  2GA4 B;  1G8Z D;  1A8V A;  4IJL A;  3PCO B;  4PQX A;  4BBR B;  2R93 G;  1ILQ A;  4R9W A;  5C3W A;  1RTN A;  1EWH A;  1KDC A;  1ROD A;  3GTL B;  4A93 B;  4GLV B;  3CC4 A;  1DOM A;  3BS1 A;  2WAQ G;  5IYB H;  2KUM A;  5C4H A;  5JEA G;  2F0S A;  1QNU A;  2PMZ E;  3WWV A;  4A3K G;  1HTP A;  3D3R A;  2NVT B;  1SMX A;  2NZ1 D;  1X54 A;  3CCV A;  4RCN A;  1PTO H;  3I7F A;  2LXJ A;  2HCI A;  4DXF A;  5K5P A;  1HRJ A;  4LF7 Q;  2F4I A;  2QW7 A;  1VQ9 A;  1K3R A;  4A3M H;  3S17 B;  4F87 A;  3H91 A;  4A3F G;  4HJ9 A;  4YIJ A;  1EWC A;  5FLM G;  3I4N G;  4DR4 L;  4BY7 B;  1P8L A;  2WV6 D;  5LMU L;  2F0I A;  3KK7 A;  2R92 G;  2Z6B A;  3BDL A;  1SBB B;  1I94 Q;  1RHP A;  4B3M L;  3C1E A;  4KY5 A;  1PH4 A;  5IE8 A;  4DFA A;  1EEI D;  1CZW A;  4M1U B;  4X65 L;  1J9O A;  4C2M B;  1XWE A;  1X3F A;  2KJX A;  2WAQ E;  4DR5 L;  1J5E Q;  3H0G G;  2UU9 Q;  1CHP D;  2JEB I;  3BYT B;  1UWV A;  5DM6 3;  4X3S A;  1QVC A;  4RG1 A;  2ES2 A;  3FMC A;  1QB5 D;  2A5H A;  1NSN S;  4MNO A;  1HTL D;  1PTO C;  3I4L A;  2JA7 H;  1O7Y A;  2LY7 A;  3K57 A;  2Y0S B;  1EIG A;  1TWF H;  2K7V A;  1X9N A;  4O1N A;  1TII D;  5EPJ A;  3RZO H;  4KKT A;  4Q5V A;  2JA7 B;  3G6E A;  4A3G H;  5CC4 A;  1BBX C;  2RVL A;  3NEM A;  3G48 A;  3FPU B;  4N9T A;  1YNN C;  4LW1 A;  4AIM A;  3MFY A;  3VA5 A;  4NB3 A;  3T53 B;  4K5X A;  1KXL A;  2LS0 1;  1G51 A;  1WTQ A;  3K7A H;  4JI1 Q;  1FVI A;  2B2T A;  3KLS A;  5IYD H;  4B3R Q;  1GKH A;  1B50 A;  1EU3 A;  5LMN L;  2LMC B;  1O7Z A;  2DJG C;  3ND8 A;  1SDF A;  2RDF A;  3E3X A;  1XTC D;  3MTS A;  4IUR A;  3TDQ A;  3AFQ A;  4K5W A;  1VQK A;  4AH6 A;  1BNZ A;  4IUT A;  4JI5 Q;  1H9S B;  4GN4 B;  1E1T A;  3K5O A;  1YIJ A;  4C3J B;  1LT5 D;  1WCM H;  4JBW A;  2PQA B;  3RNU A;  1CSQ A;  4OO1 H;  3ERO A;  3RLN A;  4DV3 L;  1RTO A;  2F0N A;  4NP5 A;  2F0M A;  4HSV A;  3K8A A;  1AP0 A;  4RA8 A;  1QE6 A;  3D6W A;  1EWI A;  1CK1 A;  4JI8 Q;  2NTT A;  2MP1 A;  1CKN B;  3B6Y A;  1X65 A;  4X66 L;  4BA2 I;  2X6L A;  2IJ0 A;  3U9O A;  2RHS B;  1KLG D;  4TKO B;  2UXB Q;  1WTR A;  2K5Q A;  4KLK A;  5D65 A;  3STB C;  1HZ9 A;  2HIX A;  1R9T H;  3OIP A;  5CV5 A;  4IFD I;  3K0X A;  2KEN A;  2R7Z H;  1B70 B;  2F0K A;  1YNX A;  1DJR D;  1HUN A;  2X6G A;  3JAM L;  3QOJ A;  1K83 H;  1YJW A;  1I4R A;  2F0Q A;  1EY0 A;  1HFG A;  1XPR A;  1TKW B;  5CYU A;  3QWN A;  1R9T B;  5GAH C;  3LGJ A;  1LTT D;  3HOW H;  1V43 A;  5IWA L;  2CQA A;  4A3E G;  3T1Y Q;  3I72 A;  4HJA A;  1CSP A;  2NVY H;  3KLS X;  1MJC A;  1W3S A;  4ID6 A;  5EBD A;  3GTO H;  4DR4 Q;  2Q2U A;  1TY2 A;  3HOW B;  5IP7 H;  3ULP A;  1GUG A;  2KOL A;  1T5E A;  1TWH H;  1WTV A;  2O4X A;  4GLA C;  4B3M Q;  2DGY A;  3HOX H;  4DV2 L;  4X65 Q;  1QG7 A;  2Z4I A;  3L2P A;  2JA5 G;  1Z47 A;  1TWH B;  3S1M H;  1UEA B;  1YHA A;  1JC7 A;  3RLF A;  2GVB A;  4MN3 A;  1PV4 A;  4LFB Q;  3PO3 H;  1QVF A;  2J4X A;  4Q0F A;  3M4O H;  3IFT A;  2PI2 E;  2AMC B;  1VQ4 A;  1MJE A;  4AYB G;  1ASY A;  3PO3 B;  4QB4 A;  1JIC A;  4KHZ A;  1AN8 A;  1F9R A;  3CQZ H;  3M3Y H;  1IXR A;  3L7Z C;  1YIT A;  2IX3 A;  4PG3 A;  5C44 B;  1Y14 B;  2K28 A;  1B2T A;  4XT1 B;  1QOH A;  1HZC A;  3CQZ B;  4DF7 A;  2QCP X;  4O0A A;  3ICE A;  2PNH A;  4DNT B;  2K4K A;  5TSS A;  3I91 A;  2E2I B;  1BR9 A;  2Q8T A;  1PH2 A;  4IPC A;  1Q12 A;  4ABN A;  1BOS A;  2XIW A;  1L1O B;  1QVG A;  1VQG A;  1HQM C;  4HJ7 A;  5LMN Q;  2QDB A;  3R2T A;  5BN3 A;  5FO8 B;  2WKC A;  1JJG A;  1E24 A;  3F8T A;  5BN5 A;  4AYB E;  1NJI C;  5BN4 A;  3J81 i;  1LTG D;  4BBS H;  1M4V A;  1E3P A;  4LFA L;  1CI3 M;  3NBI A;  4BY1 H;  3GTK H;  3J81 E;  3TP7 A;  1Q1E A;  3VR3 A;  4DV3 Q;  4BY1 B;  1JMC A;  1HNZ L;  3S2H H;  3OWF A;  2VNU D;  2VUM B;  5EKK A;  3GD7 A;  4N8X 1;  3GTK B;  4DR1 Q;  4X66 Q;  3FKI H;  1EY5 A;  4KHP L;  2K01 A;  1BXT A;  4UP9 A;  1CTM A;  2HHH L;  3DWA A;  1KQS A;  1Y8P B;  4IUN A;  3CCU A;  1Y1V G;  5C0X G;  3PIO 3;  3FKI B;  3I55 A;  5EQ0 A;  4K14 A;  1PRT D;  1H9R A;  5GAD C;  1WJJ A;  3W2D A;  2A8V A;  3A8I E;  1PH6 A;  3PF4 A;  3E5S A;  2KEE A;  3P75 A;  4LF6 L;  1L0W A;  3SGI A;  3GDE A;  4KTA A;  4KMU C;  5EPL A;  3NHH A;  3F2C A;  3HKZ B;  4QIW B;  2PW5 A;  5FK9 C;  3A5U A;  1XPU A;  2NBF A;  5I2Y A;  1L0Y B;  4HN7 A;  4DV2 Q;  4A3L G;  1S5C D;  1EY7 A;  3KF6 A;  3A8J E;  3QO2 A;  4LF9 L;  1G6Z A;  1WTW A;  1YHQ A;  1C8C A;  1EL0 A;  2PQE A;  3M4P A;  1G29 1;  1Q86 C;  3IAY A;  4C3H G;  1EY4 A;  5FKA C;  4RGO S;  1B53 A;  1Z7T A;  3BDO A;  2JP1 A;  2B2T C;  2K5W A;  2LSS A;  3DLL A;  4L63 B;  2ASB A;  1VF7 A;  5J3B A;  4JI6 L;  5K36 H;  2JE6 I;  3KFU A;  4A3B B;  1LTB D;  3I70 A;  5A2Q E;  4YY3 Q;  3D6C A;  2B2V A;  4FP5 D;  2EJM A;  1FR3 A;  2QDL A;  4KK7 A;  1HNX L;  5L37 A;  2EXZ A;  1CKO A;  3E9H A;  3KBX A;  4R4I A;  1K0R A;  2Z6K C;  3MXG A;  5AJ3 L;  3KOJ A;  5C3E H;  1VQJ A;  4HAE A;  1XXG A;  4A3J H;  2AWO A;  2FHT A;  4JI3 Q;  1CT1 D;  4JBK A;  1J8I A;  1E2V A;  2JJQ A;  1JOQ A;  4J8Q A;  4RKL A;  4Y52 H;  4R4Q A;  2K50 A;  4DGZ A;  4A3D G;  1S72 A;  4A3J B;  2DY7 A;  1SMY D;  5DNF A;  3M7G A;  2FMC A;  3HOY H;  4WFN 3;  2KCT A;  2ZJR A;  1U5K A;  4X62 L;  3EIV A;  3J7A V;  2C9O A;  3NSW A;  1K73 C;  1S5E D;  2E2J B;  2XSC A;  3A5Z B;  5JOB A;  1K8M A;  4G7Z C;  1DOL A;  1S4Z A;  3OMC A;  4CDD C;  1C48 A;  1GD7 A;  2JA6 B;  1A63 A;  1DD2 A;  5E4X A;  3PGZ A;  4P72 A;  1E0B A;  3AFP A;  2VZA A;  1DOK A;  2OTL A;  1EY9 A;  1TS2 A;  2NYZ D;  4EQP A;  1N36 L;  3NBH A;  1SYB A;  1CQV A;  1IBM L;  1TWC H;  4FYD A;  2A68 D;  4UAI A;  1QJO A;  1PH9 A;  4ZAI A;  3T51 B;  1TWA B;  5GAG C;  1NCV A;  2HQL A;  4KHP Q;  5BR8 Q;  1AE2 A;  1BCP C;  2OQ0 A;  3TSS A;  3P7J A;  1CUK A;  2HHH Q;  2OWO A;  4L5S A;  3HG9 A;  1EQR A;  2AKW B;  3FHW A;  5A35 A;  2DUD A;  5GQO A;  3HOZ B;  2EYM A;  3SR1 A;  2M2L A;  4R4C A;  2C35 B;  1VQE A;  1XX8 A;  2I5L X;  3HOU H;  1EQT A;  2AUJ D;  3NXW A;  1PYB A;  1VQO A;  2VB2 X;  3T4A C;  4DU9 A;  4IZ8 A;  2JA8 H;  1U0L A;  3PIO A;  4LF6 Q;  3RN2 A;  4A3I H;  3RZD H;  2EY2 A;  4MTN A;  3S1N B;  2K04 A;  4R4O A;  2Q8R E;  1TS3 A;  1ZEQ X;  1TS5 A;  4I65 A;  1Q8I A;  4P73 A;  1KC8 C;  5G3L D;  4L5R C;  1V9P A;  4A3I B;  3AYH B;  3RZD B;  5NUC A;  4JI2 L;  4PZ7 A;  1KHI A;  2HDL A;  5C0X I;  4DR2 L;  2IY5 B;  2BA1 A;  2PMZ B;  1BCP F;  2D2C C;  1N9W A;  1A0I A;  3K5N A;  4PMW A;  4LF9 Q;  3UDI A;  1A3T A;  1D1K A;  4DKA C;  4EX5 A;  3SE0 A;  2XWB B;  4DAV A;  4YHH L;  5IYC H;  4JCV E;  2IT1 A;  3WOF A;  4TRD A;  4KD3 A;  5CBA E;  3BZK A;  3AQQ A;  4EGV A;  4JI6 Q;  5C4X G;  4QY7 A;  1VQA A;  2R93 H;  1Q81 C;  2ZXR A;  2ZM6 Q;  1UE1 A;  2WP8 J;  1A15 A;  1I6H H;  3S2D H;  1GJX A;  1WTH A;  1TU2 B;  5JEA H;  2AWN A;  4A3K H;  1BBU A;  1D6E C;  1WD0 A;  1QZH A;  2PNR C;  3TS0 A;  3VA7 A;  3PO2 B;  4H44 C;  3JAM c;  4C3I G;  2K33 A;  4GOP B;  4DR6 L;  4UP7 A;  2F4V L;  2RDG A;  4A76 A;  2B63 G;  4A3F H;  1H9S A;  1PDQ A;  5JVG 3;  5KND A;  4HIM A;  4HCE A;  2PQA A;  5C4Z A;  2UUC L;  1U4P A;  2RSO A;  4GZY C;  5IT9 L;  4X62 Q;  3I90 A;  2CWA A;  2CW0 C;  1X3P A;  3PUX A;  1CKN A;  1QNK A;  4JI4 Q;  4A3C G;  1KL9 A;  4K6D A;  2IL8 A;  1HR0 L;  1VQM A;  5JJZ A;  3H0G H;  5IGE A;  3A7L A;  1WVL A;  1ONL A;  3QB3 A;  4KKU A;  3CCR A;  1UE7 A;  2VQF Q;  2F0T A;  4YWL A;  4HJ5 A;  1HA6 A;  1N36 Q;  4DK1 A;  3BJU A;  1SYC A;  2EVB A;  1ZYR C;  2A74 C;  2IHF A;  2D0P A;  3H3V I;  4LF8 Q;  1MSG A;  1NR2 A;  3AMU A;  4ULL A;  5IGD A;  1LO5 D;  1AEX A;  4R8N A;  5KRU A;  3I56 A;  1SRO A;  4OON A;  4OHJ A;  1NTG A;  3GTG B;  3LWU A;  2GVA A;  2WIN B;  2JYO A;  3S15 H;  4YWK A;  1ET6 A;  3I4O A;  3DEO A;  3J81 j;  4ZUJ A;  5ELF A;  1YZ6 A;  3H94 A;  3K58 A;  2SNM A;  1FNW A;  3K59 A;  2CHB D;  4L6T B;  4GS3 A;  1VCI A;  2B2V C;  1CA5 A;  1XNR L;  4IFD J;  5FJ8 G;  1I4H A;  3GTQ H;  5CV9 A;  5IP9 H;  1K9M C;  5IGB A;  1D5X C;  1EIY B;  1M8A A;  2XWJ B;  1SEB D;  5ELB A;  1AW7 A;  1UAP A;  1PH8 A;  1HHV A;  4JI2 Q;  3QOL A;  3CCE A;  4DR2 Q;  1Y1W G;  4O2D A;  3CF5 A;  3SK8 A;  1PMR A;  1B7Y B;  1PTO B;  2KQ3 A;  1OXU A;  1STE A;  1DCZ A;  2ZXP A;  3PV0 A;  2EDG A;  3DMU A;  1A2U A;  4DA2 A;  2D62 A;  4F8M A;  4A3M B;  1LAB A;  3OOC A;  1SND A;  3RMH A;  3CP0 A;  1V1Q A;  5KNB A;  1SRU A;  2BOS A;  2ZJP A;  5HGQ A;  3DHQ A;  4EVO A;  3D8G A;  5JEA J;  4IPH A;  2VQE L;  2ZTC A;  4OWX B;  4OWW B;  1EZ8 A;  1RL2 A;  5FLX L;  4QF4 A;  3NUC A;  4ZRZ A;  1JOK A;  4H7B A;  1EY6 A;  4DV0 L;  3O13 A;  5E7N A;  4IUU A;  1SNO A;  1GO3 E;  1L1O A;  1EQV A;  5DAU A;  2IWH A;  2C5C A;  2FMM A;  4XYQ A;  2EQS A;  1GUS A;  4JI0 L;  5M3F G;  3LX0 A;  1SN8 A;  4A3E H;  3L9A X;  4DR6 Q;  2NTS A;  2F4V Q;  1HZB A;  4JYA L;  2M00 A;  1N8R C;  2K75 A;  4NXN L;  2F0V A;  3SHL A;  3J80 L;  2TSS A;  2AHO B;  3RR5 A;  1TWF B;  4GKJ Q;  4TSS A;  1WFQ A;  1YNJ D;  3Q6S A;  1V1P A;  1B9M A;  2HD3 A;  2ZTD A;  5M9O A;  1QWY A;  1Q82 C;  3ZYY X;  4L5T A;  4X64 L;  1R4P B;  5KYI A;  4QMG A;  2B2W C;  3RN5 A;  3RZO B;  1DZ1 A;  4LF4 L;  3T1H Q;  5J1Z A;  4A3G B;  4ZUI A;  1OXV A;  1X6O A;  4F7X A;  3DM1 A;  3TN2 A;  1HR0 Q;  2I5M X;  2Q2I A;  4LK1 C;  4QUF A;  3J7Y W;  4BBR G;  1EEF D;  1YVC A;  4A93 G;  3K7A B;  2ICE C;  1NBW A;  2R3Z A;  2VL6 A;  3ULL A;  1LT6 D;  5IGC A;  1MD2 D;  4X3T A;  2B2U C;  1QUQ B;  2CH4 A;  2WII B;  1GUT A;  1EU4 A;  5KYL A;  2SNS A;  1VQI A;  2K05 A;  2YV5 A;  5M5W H;  2K03 A;  1RCV D;  1DGS A;  4GLX A;  4DAY B;  1FNU A;  3A74 A;  1WCM B;  3Q8D A;  4BY7 G;  3HP3 A;  2YTV A;  2WAC A;  3PIP 3;  1KAW A;  1IW7 D;  1STB A;  1UUP A;  1YHB A;  3W5O A;  4WJ4 A;  2XTI A;  2GN5 A;  4TQU S;  3PUW A;  3CPW A;  4YCW A;  1WD1 A;  3KDF B;  1U4L A;  5E1F A;  2BH2 A;  1CHQ D;  1Y8N B;  4CJ1 B;  2BE5 C;  1II3 A;  1N32 L;  4JVZ A;  5FOB B;  2K52 A;  4FDB A;  3MEH A;  4H13 C;  4CBV A;  1G2T A;  3NEL A;  4XT3 B;  2R7Z B;  1AZQ A;  5EGT A;  3CPF A;  1PFM A;  4NXM L;  2CFM A;  1LV9 A;  3Q0A A;  1K83 B;  2B2Y A;  3VDY A;  2IX0 A;  5LMU Q;  2Y0S G;  1SR3 A;  3PF5 A;  2A6H D;  1YEZ A;  2FFK B;  2NVY B;  3K5M A;  4ZKC B;  5CV8 A;  5M3M G;  2YTX A;  5CV7 A;  5KNC A;  1LTS D;  3CC2 A;  1A3V A;  1W6K A;  2SOB A;  2JA7 G;  3GTO B;  3U4Z A;  3UE1 A;  4GNX C;  1AH9 A;  2VQE Q;  4DR5 Q;  2EY6 A;  3N52 A;  2FXQ A;  3HOX B;  1VMC A;  3EVQ A;  1FL0 A;  3KF8 B;  4P2C B;  1SLJ A;  1Y1V H;  1S3O A;  3DWP A;  4DV0 Q;  4KN4 C;  3MEF A;  2I0Q A;  2IHE A;  4PMC A;  3VYT A;  2L55 A;  3S1M B;  1I50 H;  3EFX D;  1IHZ A;  4MTK A;  4PV1 C;  1B4O A;  1K3B C;  1KNE A;  4JI0 Q;  2E74 C;  3M4O B;  4JOI A;  1RIP A;  4UPA A;  2VY3 A;  1SYF A;  4JYA Q;  3SXH A;  4NXN Q;  2Y0S E;  2CQO A;  5HUR A;  2A69 D;  4UDU C;  3VR5 A;  4JV5 L;  2OF1 A;  3S9W A;  3PMF A;  3GTP H;  4C3J G;  4NKL A;  4JI7 L;  3MAQ A;  3V96 A;  3M3Y B;  3VYS A;  1LT3 D;  4OEL B;  4A3L H;  1VQF A;  4FF3 A;  3TP5 A;  4JG2 A;  4J1M A;  4P71 A;  3FPP A;  2ATW A;  2CVR A;  3BVG A;  3S16 H;  3R8B A;  2MJ8 A;  2KEC A;  4C3H H;  4POF A;  1T5X D;  4GKK L;  3D31 A;  1MKH A;  3E9I A;  4UP8 A;  2WFW A;  4M8A A;  2FJ2 A;  4DXG A;  3FEW X;  1IYV A;  2RKS A;  1D5Z C;  2O5J C;  2PO4 A;  3NE5 B;  1H95 A;  1F9P A;  2MFI A;  4DV7 L;  2AQ3 B;  3CMA A;  2HUG A;  2E5L L;  4LNQ A;  3V2T A;  4BBS B;  3I2Z A;  1A3U A;  2QKI C;  2R61 A;  1EQQ A;  1Y69 U;  1FJG L;  4RKB A;  1HXY D;  2MNA A;  1RJT A;  2ZJQ A;  3ERQ A;  1TY0 A;  1SE4 A;  3AU7 A;  2A73 B;  3CKI B;  3GO5 A;  3M7N A;  1X56 A;  2A6E C;  3BVZ A;  4HJ8 A;  3HOW G;  3CCM A;  1XTD A;  2VB3 X;  2R7D A;  3CU7 A;  3U9S A;  4CGY B;  2MO0 A;  3MWY W;  3S2H B;  4EQ5 A;  2JQO A;  1NR4 A;  2PZU A;  2YTY A;  2NVX H;  4A3D H;  1F2M A;  3K0Y A;  2EYL A;  1IKM A;  3T16 A;  5EJW A;  1BKB A;  3S1R H;  4LF5 L;  1PVO A;  2RHQ B;  3KUP A;  3DXJ C;  3FRP B;  3PIP A;  5DLQ E;  1N34 L;  1SJE D;  2D9U A;  2XGT A;  4FVM A;  1G6P A;  1STA A;  2HCC A;  2CKZ B;  1PFS A;  1JJ2 A;  5IT9 c;  2ZTE A;  5IWA Q;  5KIX A;  1Y8O B;  4NXM Q;  4CKB A;  3CRK C;  2CCZ A;  2XNA C;  4R1J A;  1SYD A;  5T1G A;  1IL8 A;  3PO3 G;  2H5X A;  4LUV A;  1XNQ L;  4DAP A;  1WTO A;  4P74 A;  2N78 A;  3GTM H;  1IZ6 A;  5C44 G;  2E75 C;  2MGS A;  3BZC A;  3VYR A;  5M5Y H;  2KHJ A;  3DEP A;  1PH3 A;  2Q8I B;  1SYE A;  2HT1 A;  1EYG A;  3G7L A;  3K5L A;  1TS4 A;  4UY8 C;  4EQN A;  1B3Q A;  2XN9 C;  5C0X J;  3GTM B;  1LTR D;  4GOP A;  2EZV A;  5M5Y B;  1VQL A;  4DV6 L;  2QEJ C;  1I3Q H;  2Z8L A;  4WOR A;  2CH4 W;  4J6H A;  3HZX A;  4KY7 A;  4RH6 A;  1YBY A;  1VQP A;  1HUM A;  1JOR A;  1UE5 A;  1EYA A;  2EOT A;  3KJP A;  4AQY L;  1SJH D;  4JV5 Q;  2D5D A;  1ILP A;  3OIQ A;  1LTL A;  4OL7 A;  1JWM D;  2X69 A;  2E8G A;  1MI2 A;  1VDZ A;  3OYY A;  4XQJ A;  4JI7 Q;  4C56 C;  3SDZ A;  2ZT9 C;  2G9D A;  4BXX H;  1F9S A;  5E4W C;  3NTK A;  2F0H A;  1PFB A;  1B44 D;  3CCJ A;  2VW9 A;  2VUM G;  2E76 C;  5C3E B;  4UHV A;  1T9H A;  2B39 A;  1KTK A;  1PTO D;  1STH A;  3NP8 A;  1ENA A;  5IGF A;  1XMO L;  1Q90 A;  3HOV H;  5J39 A;  4GKK Q;  1BCP B;  1QZG A;  2RCN A;  3PSI A;  2WB1 B;  1UEB A;  4LFA Q;  3HOV B;  3HOY B;  4DV7 Q;  2E5L Q;  1YNN D;  1A2T A;  4KJO A;  1GUW A;  5ELO A;  1HA5 A;  2F0E A;  2SEB D;  5FLX c;  5CR3 A;  1FJG Q;  1RDP D;  1ZKO A;  1HNZ Q;  1SYG A;  1MBY A;  2AUK A;  3NK9 A;  1I5F A;  2F1M A;  3WDN A;  1ZXT A;  4ZK9 B;  2F3I A;  3P20 A;  5C5L A;  5LMN W;  4K5V A;  4OO1 I;  3J7A F;  2L9H A;  2NN6 H;  3HKZ G;  5D3D A;  3CAM A;  4RWS C;  3KLW A;  4FF4 A;  1ICF B;  5I6W A;  1TWC B;  4OIK A;  4IJH A;  5FO7 B;  2Q2T A;  2MUY A;  5D14 A;  1JE5 A;  4LF5 Q;  4H0L C;  3LWE A;  1AE3 A;  3J80 c;  1MSH A;  3D4W A;  4YCU A;  1KRT A;  1N34 Q;  1S40 A;  2F0L A;  4A3C H;  5M5X H;  2N55 A;  1LT4 D;  1JE4 A;  1MHW C;  5T1I A;  4QCL A;  1F9Q A;  2G5D A;  4A3B G;  3HOU B;  2QA4 A;  4JOI C;  1O7I A;  3J81 L;  4EQO A;  3STB D;  4OXP A;  2JA8 B;  4CDF C;  1QCB D;  4IFD H;  3SEB A;  2NVQ H;  4XXE A;  1K0S A;  1PH7 A;  1WOC A;  3HKZ E;  2N49 A;  5JJK A;  3CRL C;  3R93 A;  3F2D A;  3EN2 A;  3WOE A;  5J22 A;  3LNN A;  5C6A A;  4FXD A;  2NVQ B;  4LUZ A;  1VQ7 A;  4KY6 A;  2LKV A;  4A3J G;  2PW7 A;  5C4J H;  3RLO A;  1W2B A;  2EE1 A;  1JWU D;  2JK8 A;  3BU2 A;  3S14 H;  3UDG A;  1LTA D;  1OTC A;  4XQQ A;  2KHS A;  4BWG B;  1NAP A;  2OQK A;  4B08 A;  1KAB A;  1HNX Q;  3KJO A;  2K32 A;  4AQY Q;  5FJ8 H;  2R93 B;  3JC6 6;  2JA6 G;  2F0P A;  2OEO A;  5AJ3 Q;  1S5F D;  1LUZ A;  1I6H B;  2ALY B;  3G4S A;  2WAQ B;  3S2D B;  1YI2 A;  5LL6 S;  3GTJ H;  3K81 C;  1GHJ A;  3CW2 C;  4A3K B;  4JBJ A;  1Y1W H;  3FP9 A;  1O7L A;  3TZU A;  3CD6 A;  5FLM H;  1U9R A;  3I4N H;  3M9B A;  5ISR A;  4HED A;  2R92 H;  1OXX K;  1XMO Q;  1K28 A;  1UE6 A;  2EY5 A;  3EA6 A;  1F2Z A;  2Z1C A;  1F2Y A;  3OTO L;  4A3F B;  1FGB D;  3I4N B;  4DAY A;  2R92 B;  1EIH A;  2EJG C;  4QJF A;  3BZD B;  3HOZ G;  1SE2 A;  2K5D A;  5HGT A;  5A2Q L;  4POG A;  2KVM A;  1Q1B A;  3IL8 A;  3KDF A;  2B8G A;  5CV4 A;  2G9H D;  3JAM i;  3NPP A;  3H0G B;  1IBM Q;  5M3F H;  1PZK D;  1G91 A;  3GV3 A;  2SDF A;  3C1F A;  4KKS A;  3M4Q A;  4IAL A;  4MIU A;  1TVX A;  4R4T A;  2OTJ A;  4A3I G;  3TS2 A;  3QR8 A;  3CC7 A;  2E2H H;  1A62 A;  2JXM B;  4XTC S;  5EKL A;  1LM0 A;  3V05 A;  2K1B A;  4XQN A;  4DNR B;  1KRS A;  5JPN C;  3F2U A;  4JI5 L;  4QL5 A;  3MFG A;  2B8F A;  1PRT C;  3R3O A;  3ND9 A;  2BDO A;  2A6E D;  3S15 B;  3PUZ A;  4FXK C;  5EPK A;  2RBM A;  3ERS X;  4DV5 L;  1STG A;  2F0D A;  4A93 H;  3KF8 A;  4E6I A;  4MZ9 A;  4L8J A;  3W1B A;  1BBW A;  1XPO A;  5JJL A;  1QIL A;  1PXU A;  1I4P A;  3SVM A;  3J7Z C;  3BVM A;  1I4Q A;  4YWM A;  2NVT H;  2UXB L;  4QGU A;  3FVQ A;  3QG1 A;  1M90 C;  3GTQ B;  4DAM A;  3PO2 G;  4DN4 M;  3I4M G;  1TXY A;  5E3F A;  1YJN A;  1W6J A;  2BA0 A;  3W1G A;  3NBH B;  3S17 H;  4YHH Q;  4Y7N H;  1VQN A;  3OMG A;  4BY7 H;  1ENC A;  1NMG A;  2LXK A;  3T1Y L;  3HKS A;  4BA1 I;  4ALP A;  2EIF A;  1B3A A;  1PRT F;  1J6Q A;  3F1Z A;  3KBG A;  1Q7Y C;  4Y7N B;  4KD4 A;  4GN5 A;  2F0F A;  1D8L A;  2BDN A;  3TP6 A;  3C2P A;  3I73 A;  3MVV A;  4B9W A;  4C2M H;  3C3L A;  4N9P A;  4QQB X;  2KBN A;  4RMF A;  4U68 A;  1IL2 A;  2PYK A;  4P75 A;  3MC0 B;  3PUV A;  1WTX A;  2L0C A;  1OXS C;  2DJF C;  4K8J A;  2LFN A;  1IBL L;  1KIX A;  3GV6 A;  3MZ5 A;  4CKC A;  4PMB A;  4ZYS A;  3ITP A;  3K80 C;  2F3V A;  2N8N A;  3TP8 A;  1MGS A;  1ASZ A;  4B3T L;  4LFB L;  3Q22 A;  2JA9 A;  1STN A;  2P5Z X;  3CCS A;  2J7Z A;  4HIK A;  4A3E B;  2UUC Q;  3NQI A;  4IOC A;  3T56 B;  5M3M H;  4DV1 L;  3OTO Q;  1GVP A;  2HDM A;  2RF4 A;  1SMY C;  3W3A A;  2MO1 A;  4K2K A;  2JA5 H;  5KEE A;  1XMQ L;  2NUC A;  5M3M B;  1AFP A;  4LWC A;  3OSO A;  4KV6 A;  4LUO A;  1EIF A;  2OT2 A;  5I6Y A;  2L4N A;  3E6Z X;  2JA5 B;  2EYJ A;  4B9X A;  3CME A;  3MHB A;  5CV6 A;  2BH8 A;  3U4V A;  1VQ8 A;  4LAA A;  2ICI A;  1F2L A;  1VS0 A;  4I7A A;  5H1S E;  3TZD A;  1VF5 C;  4OEM B;  3VR2 A;  2IW3 A;  5HY6 A;  4R8I A;  3OHX C;  1FNV A;  2L1B A;  4AYB B;  3HS0 C;  5IYB G;  2UUB L;  2A68 C;  4DK0 A;  3CCQ A;  5I9P A;  5FO9 B;  2NN6 I;  4MHE A;  4C3J H;  5AFW A;  1KDA A;  2UXD L;  1JR0 D;  1PTO F;  5IP9 G;  2F03 A;  3X3N A;  1JCK B;  2A1A A;  5M5W B;  4KI0 A;  4A3M G;  1B1Z A;  1NMF A;  2Z6K A;  4RAU C;  3T13 A;  1E1O A;  4G7O C;  2I07 B;  1A6X A;  4KHV A;  4IUV A;  3TQY A;  3VR4 A;  5JJI A;  4GNX B;  4NDX A;  3MXN B;  3H6M A;  4IPG A;  2UUA L;  4JC0 A;  1PHJ A;  1XNR Q;  3NWT A;  1BCP D;  4N8F A;  1V1O A;  4GN3 B;  4DV5 Q;  1PLF A;  1X3Q A;  2O5I C;  4DR1 L;  1EYC A;  1HCZ A;  1L0X B;  3BG3 A;  3D0F A;  1HNW L;  2IPK D;  1Q8K A;  2R6G A;  1SNC A;  4RGT A;  5C3X A;  1H9M A;  3F2B A;  4RGM A;  4OX9 L;  3TME A;  1EY8 A;  4V0B A;  1SNP A;  1GM5 A;  3UDX A;  2JSO A;  5C5M A;  2AQ2 B;  1PA6 A;  1SSO A;  4OWT B;  1ICW A;  1CA6 A;  5IIF A;  2HIV A;  1UNS A;  4PNY A;  4HMJ A;  4CDE C;  1GXD C;  2I46 A;  5CGK A;  2BCO A;  3A55 A;  4HTH A;  1E2W A;  3VYU A;  3ULJ A;  3EBE A;  4ODG A;  4FXG C;  3CXC A;  4G4K A;  5C0X H;  2EPB A;  4A3G G;  1VQB A;  3ZJY C;  3DM3 A;  1BO0 A;  3RD4 A;  2A19 A;  4IUP A;  3HEJ A;  4DK3 C;  1ESR A;  2XRQ D;  1Y1V B;  3HRZ C;  1NNX A;  2NB0 A; 
#chains in the Genus database with same CATH homology
 5ELE A;  1EZ6 A;  2N88 A;  4Z9C B;  2QIL A;  3D4D A;  1I50 B;  5G3L F;  1AZP A;  1R4Q B;  1IKL A;  4KJN A;  5IGG A;  4F88 A;  3GP7 A;  3N6R A;  1RD9 D;  1HFN A;  3GTP B;  3A8K E;  4HCS A;  4QUC A;  3NTI A;  4NMZ A;  4OO1 G;  4RFB A;  4C1N K;  2DNE A;  1DXM A;  4U67 3;  4LMQ D;  3QIA A;  2MHV A;  3GQB A;  1DYQ A;  3S16 B;  4CKE A;  1ET9 A;  5CBE E;  2YU9 B;  2EYO A;  4C3H B;  2Z4H A;  2PZT A;  2DY8 A;  1EOT A;  2L11 A;  2MPM A;  3NQT A;  2F0G A;  4RHR A;  1SE3 A;  2RA4 A;  1I4X A;  3CHB D;  3A56 A;  5JPM C;  2CW0 D;  2F3W A;  4K8I A;  3D4R A;  3SK5 A;  1S5D D;  2L12 A;  5I9O A;  4K2L A;  2ZXO A;  4WJW A;  1ML0 D;  1SFO B;  4X3U A;  1XYI A;  1JOO A;  1VMP A;  1ZYR D;  3AB9 A;  1V1P B;  1LAC A;  1GUN A;  1X32 A;  4A3D B;  2NVX B;  2H4O A;  1SAP A;  4RGN A;  4FO2 A;  1BDO A;  5ELD A;  1PZJ D;  1G2S A;  3S1R B;  2EJF C;  5LL6 X;  1FYC A;  5EKI A;  4FF1 A;  5CMD A;  2EY1 A;  1EFI D;  3MXU A;  1DON A;  1D1I A;  1KDB A;  1D5M C;  3Q24 A;  5IOD A;  1BF4 A;  1B9N A;  1JB3 A;  3RUZ A;  3BYY B;  4XIG S;  3I8Z A;  1EYD A;  1GOZ A;  5EBC A;  2XRS D;  2KCC A;  2O2L D;  1SXT A;  3H3V C;  2L5T A;  3A7A B;  1I3Q B;  3C46 A;  1CQF A;  1V8Q A;  4X3K A;  2F0U A;  2H1E A;  4NW2 A;  1CM9 A;  5IT9 E;  3R2I A;  3OPO A;  2KCN A;  1OXT A;  3G6J B;  2FIN B;  4CJ0 B;  5DM7 3;  3MA2 B;  1U4R A;  4ME5 A;  4IUQ A;  1GHK A;  1YNJ C;  1TQO A;  1JWS D;  1ENF A;  4ILW A;  1H9K A;  2ID0 A;  1O78 A;  3Q23 A;  4JK1 C;  4LJZ C;  1O80 A;  4IQZ A;  2NWG A;  3IKJ A;  1LTI D;  3I3C A;  2EYP A;  3L3O C;  1D2B A;  5COY A;  1U4M A;  3BDC A;  5F2D A;  3SK4 A;  1I4G A;  2YYZ A;  5C4X B;  3VR6 A;  4ZLT F;  2IX1 A;  3OWE B;  1TT2 A;  2B2Y C;  4RHS A;  4K6L A;  3EJI A;  1LLR D;  5I4D A;  5D3I B;  2KED A;  1JQY D;  3TBI B;  1H9J A;  3H09 A;  4KN7 C;  4CJ2 C;  4V19 0;  4FNF A;  4C3I B;  1IW7 C;  2TMP A;  4HR7 B;  3IFD A;  2B63 B;  1WTP A;  4WRD A;  5DEH A;  2EYF A;  4O42 A;  1GUO A;  5COR A;  2HQE A;  1PFN A;  2PPB C;  2DN8 A;  1HPC A;  2B2W A;  2PCF B;  5M5X B;  5K36 G;  5FLX E;  4RCO A;  5JAV A;  2BE5 D;  2F0O A;  4CHT B;  2A6H C;  4HSP A;  1FD7 D;  3NTH A;  5IOC A;  2PZW A;  2J0T D;  3S1Q B;  4ZKB B;  2B2U A;  2XVS A;  3M85 A;  4G57 A;  4IN3 A;  3NWS A;  1C4Q A;  3PUY A;  3KLR A;  4ZQ3 A;  3J80 E;  3P1H A;  1S5B D;  5C4J B;  1CFM A;  1IYU A;  2WKD A;  4S3S A;  3M4Y A;  4BS9 A;  3S14 B;  2KA7 A;  5KGU A;  1Q3L A;  1BUV T;  2V4D A;  3K6O A;  2RSN A;  4XYO A;  1ESF A;  2A69 C;  4C1N I;  4OIJ A;  5ELC A;  1CZG A;  1TWG B;  5JVH 3;  1NUC A;  2DNC A;  5I2X A;  1F77 A;  2JEA I;  1TR5 A;  3A54 A;  3GTJ B;  2K6A A;  2E2D C;  1PYW D;  1Y1W B;  1OO9 B;  3MXP A;  5LHY 1;  2AQ1 B;  3I4M B;  3EQL C;  2NN6 G;  2ENB A;  1STY A;  2RDH A;  1RKN A;  1SNQ A;  1RF2 D;  1E2Z A;  1PRT B;  2M9V A;  3QJY A;  1BQQ T;  1HQR D;  1KAA A;  4HMI A;  3MXN A;  3FDT A;  3OW7 A;  1KLU D;  3DUZ A;  2RQX A;  1K8O A;  2F0J A;  3X3M A;  3DWQ A;  4G7H C;  2VXW A;  3JAM E;  5M3F B;  3UI2 A;  1I6V C;  2QF7 A;  4XDX A;  1DM0 B;  3E0J A;  3HGB A;  4IFD G;  2EYH A;  4FF2 A;  1KNA A;  2E2H B;  1PZI D;  2OXP A;  3SK6 A;  1SNM A;  3URY A;  4OGQ C;  2F0W A;  3ONA B;  1Z6H A;  4I7Z C;  2GA4 B;  1G8Z D;  4PQX A;  4BBR B;  1ILQ A;  4R9W A;  5C3W A;  1RTN A;  1EWH A;  1KDC A;  1ROD A;  3GTL B;  4A93 B;  1DOM A;  3BS1 A;  2KUM A;  5C4H A;  5JEA G;  2F0S A;  1QNU A;  1HTP A;  3D3R A;  2NVT B;  2NZ1 D;  4RCN A;  1PTO H;  2HCI A;  4DXF A;  5K5P A;  1HRJ A;  2F4I A;  3S17 B;  4F87 A;  3H91 A;  4YIJ A;  1EWC A;  4BY7 B;  2WV6 D;  2F0I A;  3KK7 A;  3BDL A;  1SBB B;  1RHP A;  3C1E A;  4KY5 A;  4DFA A;  1EEI D;  1CZW A;  4M1U B;  1J9O A;  4C2M B;  1XWE A;  2KJX A;  1CHP D;  2JEB I;  3BYT B;  5DM6 3;  4X3S A;  3FMC A;  1QB5 D;  2A5H A;  1NSN S;  1HTL D;  1PTO C;  3I4L A;  1O7Y A;  2LY7 A;  3K57 A;  2Y0S B;  1EIG A;  2K7V A;  4O1N A;  1TII D;  5EPJ A;  4KKT A;  4Q5V A;  2JA7 B;  5CC4 A;  1BBX C;  2RVL A;  3FPU B;  4N9T A;  1YNN C;  3MFY A;  3VA5 A;  3T53 B;  4K5X A;  2LS0 1;  1WTQ A;  2B2T A;  3KLS A;  1B50 A;  1EU3 A;  2LMC B;  1O7Z A;  3ND8 A;  1SDF A;  2RDF A;  1XTC D;  3MTS A;  4IUR A;  3TDQ A;  4K5W A;  1BNZ A;  4IUT A;  1H9S B;  3K5O A;  4C3J B;  1LT5 D;  4JBW A;  4OO1 H;  3ERO A;  1RTO A;  2F0N A;  4NP5 A;  2F0M A;  4HSV A;  1AP0 A;  4RA8 A;  1QE6 A;  3D6W A;  1CK1 A;  2NTT A;  2MP1 A;  4BA2 I;  2X6L A;  2IJ0 A;  3U9O A;  1KLG D;  4TKO B;  1WTR A;  2K5Q A;  5D65 A;  3OIP A;  5CV5 A;  4IFD I;  2F0K A;  1DJR D;  3HRZ C;  1HUN A;  2X6G A;  3JAM L;  3QOJ A;  1I4R A;  2F0Q A;  1EY0 A;  1HFG A;  1TKW B;  5CYU A;  3QWN A;  1R9T B;  1LTT D;  1V43 A;  2CQA A;  3I72 A;  3KLS X;  4ID6 A;  5EBD A;  1TY2 A;  3HOW B;  1GUG A;  2KOL A;  1T5E A;  1WTV A;  2O4X A;  1QG7 A;  2Z4I A;  1Z47 A;  1TWH B;  1UEA B;  1JC7 A;  3RLF A;  4MN3 A;  2J4X A;  4Q0F A;  3IFT A;  3PO3 B;  4QB4 A;  1JIC A;  4KHZ A;  1AN8 A;  1F9R A;  3L7Z C;  2IX3 A;  5C44 B;  2K28 A;  1B2T A;  4XT1 B;  1QOH A;  3CQZ B;  4DF7 A;  2QCP X;  4DNT B;  5TSS A;  3I91 A;  2E2I B;  1BR9 A;  2Q8T A;  1Q12 A;  4ABN A;  1BOS A;  2XIW A;  1HQM C;  2QDB A;  3R2T A;  5BN3 A;  5FO8 B;  2WKC A;  5BN5 A;  5BN4 A;  1LTG D;  1M4V A;  1CI3 M;  3NBI A;  3J81 E;  3TP7 A;  1Q1E A;  3VR3 A;  4BY1 B;  3OWF A;  2VNU D;  2VUM B;  5EKK A;  3GD7 A;  3GTK B;  1EY5 A;  2K01 A;  1BXT A;  1CTM A;  3DWA A;  1Y8P B;  4IUN A;  5C0X G;  3PIO 3;  3FKI B;  5EQ0 A;  4K14 A;  1PRT D;  1H9R A;  3W2D A;  3A8I E;  3E5S A;  2KEE A;  3P75 A;  4KTA A;  4KMU C;  5EPL A;  3NHH A;  3HKZ B;  4QIW B;  2PW5 A;  5FK9 C;  2NBF A;  5I2Y A;  1L0Y B;  4HN7 A;  1S5C D;  1EY7 A;  3A8J E;  3QO2 A;  1G6Z A;  1WTW A;  1C8C A;  1EL0 A;  2PQE A;  1G29 1;  3IAY A;  4C3H G;  1EY4 A;  5FKA C;  4RGO S;  1B53 A;  1Z7T A;  3BDO A;  2JP1 A;  2B2T C;  2K5W A;  4L63 B;  1VF7 A;  5K36 H;  2JE6 I;  4A3B B;  1LTB D;  3I70 A;  5A2Q E;  3D6C A;  2B2V A;  4FP5 D;  2EJM A;  1FR3 A;  4KK7 A;  2EXZ A;  3KBX A;  3MXG A;  4HAE A;  1XXG A;  2AWO A;  2FHT A;  1CT1 D;  1J8I A;  1E2V A;  1JOQ A;  4J8Q A;  4RKL A;  4DGZ A;  4A3J B;  2DY7 A;  1SMY D;  5DNF A;  3M7G A;  2FMC A;  4WFN 3;  3J7A V;  2C9O A;  3NSW A;  1S5E D;  2E2J B;  2XSC A;  5JOB A;  1K8M A;  4G7Z C;  1DOL A;  1S4Z A;  3OMC A;  1C48 A;  2JA6 B;  1DD2 A;  5E4X A;  1E0B A;  1DOK A;  1EY9 A;  1TS2 A;  2NYZ D;  4EQP A;  3NBH A;  1SYB A;  1CQV A;  4FYD A;  2A68 D;  4UAI A;  1QJO A;  4ZAI A;  3T51 B;  1TWA B;  1NCV A;  1BCP C;  3TSS A;  3P7J A;  3HG9 A;  5A35 A;  3HOZ B;  3SR1 A;  2EYM A;  2M2L A;  1XX8 A;  1EQT A;  2AUJ D;  3NXW A;  2VB2 X;  3T4A C;  4DU9 A;  4IZ8 A;  2EY2 A;  3S1N B;  2K04 A;  2Q8R E;  1TS3 A;  1ZEQ X;  1TS5 A;  4I65 A;  1Q8I A;  5G3L D;  4A3I B;  3RZD B;  5NUC A;  2HDL A;  5C0X I;  2BA1 A;  2PMZ B;  1BCP F;  2D2C C;  3K5N A;  4PMW A;  1A3T A;  1D1K A;  3SE0 A;  2XWB B;  4DAV A;  2IT1 A;  3WOF A;  4TRD A;  4KD3 A;  4EGV A;  2ZXR A;  2WP8 J;  1A15 A;  1GJX A;  1TU2 B;  5JEA H;  2AWN A;  1D6E C;  1WD0 A;  2PNR C;  3VA7 A;  3PO2 B;  4H44 C;  4C3I G;  2K33 A;  2RDG A;  1H9S A;  1PDQ A;  5JVG 3;  5KND A;  4HCE A;  5C4Z A;  1U4P A;  2RSO A;  4GZY C;  5IT9 L;  3I90 A;  2CW0 C;  1X3P A;  3PUX A;  1QNK A;  4K6D A;  2IL8 A;  5JJZ A;  5IGE A;  3A7L A;  1WVL A;  1ONL A;  3QB3 A;  4KKU A;  2F0T A;  1HA6 A;  4DK1 A;  1SYC A;  2EVB A;  1ZYR C;  2A74 C;  1MSG A;  1NR2 A;  3AMU A;  4ULL A;  5IGD A;  1LO5 D;  1AEX A;  4R8N A;  5KRU A;  4OHJ A;  3GTG B;  3LWU A;  2WIN B;  2JYO A;  1ET6 A;  3DEO A;  4ZUJ A;  5ELF A;  3H94 A;  3K58 A;  2SNM A;  1FNW A;  3K59 A;  2CHB D;  4L6T B;  4IFD J;  1VCI A;  2B2V C;  1CA5 A;  1I4H A;  5CV9 A;  5IGB A;  1D5X C;  1M8A A;  2XWJ B;  1SEB D;  5ELB A;  1AW7 A;  1UAP A;  1HHV A;  3QOL A;  3SK8 A;  1PMR A;  1PTO B;  2KQ3 A;  1OXU A;  1STE A;  1DCZ A;  2ZXP A;  3PV0 A;  2EDG A;  3DMU A;  1A2U A;  4DA2 A;  2D62 A;  4F8M A;  4A3M B;  1LAB A;  3OOC A;  1SND A;  3RMH A;  5KNB A;  2BOS A;  3DHQ A;  4EVO A;  3D8G A;  5JEA J;  1EZ8 A;  5FLX L;  4QF4 A;  3NUC A;  4ZRZ A;  1JOK A;  4H7B A;  1EY6 A;  3O13 A;  4IUU A;  1SNO A;  1EQV A;  5DAU A;  2IWH A;  2C5C A;  2FMM A;  4XYQ A;  1GUS A;  3LX0 A;  3L9A X;  2NTS A;  2M00 A;  2F0V A;  3SHL A;  3J80 L;  2TSS A;  1TWF B;  4TSS A;  3Q6S A;  1YNJ D;  1V1P A;  1B9M A;  5M9O A;  1QWY A;  3ZYY X;  1R4P B;  5KYI A;  4QMG A;  2B2W C;  3RZO B;  1DZ1 A;  4A3G B;  5J1Z A;  4ZUI A;  1OXV A;  4F7X A;  3DM1 A;  3TN2 A;  4LK1 C;  4QUF A;  3J7Y W;  1EEF D;  3K7A B;  2ICE C;  2R3Z A;  1LT6 D;  5IGC A;  1MD2 D;  4X3T A;  2B2U C;  2WII B;  1GUT A;  1EU4 A;  5KYL A;  2SNS A;  2K05 A;  2K03 A;  1RCV D;  1FNU A;  1WCM B;  3HP3 A;  2WAC A;  3PIP 3;  1IW7 D;  1STB A;  1UUP A;  4TQU S;  3PUW A;  1WD1 A;  5E1F A;  1U4L A;  1CHQ D;  1Y8N B;  4CJ1 B;  2BE5 C;  1II3 A;  5FOB B;  3MEH A;  4H13 C;  4CBV A;  1G2T A;  4XT3 B;  2R7Z B;  1AZQ A;  5EGT A;  1PFM A;  1LV9 A;  3Q0A A;  1K83 B;  2B2Y A;  2IX0 A;  2A6H D;  2FFK B;  2NVY B;  3K5M A;  4ZKC B;  5CV8 A;  5CV7 A;  5KNC A;  1LTS D;  1A3V A;  1W6K A;  2SOB A;  3GTO B;  2EY6 A;  3N52 A;  3HOX B;  1VMC A;  3EVQ A;  4P2C B;  3DWP A;  4KN4 C;  4PMC A;  3VYT A;  2L55 A;  3S1M B;  3EFX D;  1IHZ A;  4PV1 C;  1B4O A;  1KNE A;  2E74 C;  3M4O B;  1SYF A;  3SXH A;  5HUR A;  2A69 D;  4UDU C;  3VR5 A;  2OF1 A;  3S9W A;  3PMF A;  4C3J G;  4NKL A;  3M3Y B;  3MAQ A;  3V96 A;  3VYS A;  1LT3 D;  4FF3 A;  3TP5 A;  4J1M A;  3FPP A;  2CVR A;  3BVG A;  3R8B A;  2MJ8 A;  2KEC A;  1T5X D;  3D31 A;  4M8A A;  2FJ2 A;  4DXG A;  3FEW X;  1IYV A;  2RKS A;  1D5Z C;  2O5J C;  2PO4 A;  3NE5 B;  1F9P A;  2AQ3 B;  2HUG A;  3V2T A;  4BBS B;  1A3U A;  2QKI C;  2R61 A;  1Y69 U;  4RKB A;  1HXY D;  1RJT A;  3ERQ A;  1TY0 A;  1SE4 A;  3AU7 A;  2A73 B;  3CKI B;  3GO5 A;  3M7N A;  2A6E C;  3BVZ A;  2VB3 X;  3CU7 A;  3U9S A;  4CGY B;  3MWY W;  3S2H B;  2PZU A;  1NR4 A;  1F2M A;  3K0Y A;  2EYL A;  1IKM A;  3T16 A;  5EJW A;  3KUP A;  3DXJ C;  3FRP B;  1SJE D;  2D9U A;  4FVM A;  1STA A;  2HCC A;  5KIX A;  1Y8O B;  4CKB A;  3CRK C;  2XNA C;  1SYD A;  5T1G A;  1IL8 A;  4DAP A;  1WTO A;  2E75 C;  2MGS A;  3VYR A;  3DEP A;  2Q8I B;  1SYE A;  3G7L A;  3K5L A;  1TS4 A;  4EQN A;  2XN9 C;  5C0X J;  3GTM B;  1LTR D;  2EZV A;  5M5Y B;  2QEJ C;  2Z8L A;  4WOR A;  4J6H A;  3HZX A;  4KY7 A;  4RH6 A;  1HUM A;  1JOR A;  1EYA A;  2EOT A;  1SJH D;  2D5D A;  1ILP A;  3OIQ A;  4OL7 A;  1JWM D;  2X69 A;  1MI2 A;  1VDZ A;  4XQJ A;  4C56 C;  3SDZ A;  2ZT9 C;  2G9D A;  1F9S A;  5E4W C;  3NTK A;  2F0H A;  1PFB A;  1B44 D;  2E76 C;  5C3E B;  2B39 A;  1KTK A;  1PTO D;  1STH A;  3NP8 A;  1ENA A;  5IGF A;  1Q90 A;  5J39 A;  1BCP B;  2WB1 B;  3HOV B;  3HOY B;  1GUW A;  1YNN D;  1A2T A;  4KJO A;  1HA5 A;  2F0E A;  2SEB D;  5CR3 A;  1RDP D;  1ZKO A;  1SYG A;  1MBY A;  2AUK A;  3NK9 A;  2F1M A;  3WDN A;  1ZXT A;  4ZK9 B;  3P20 A;  5C5L A;  4K5V A;  4OO1 I;  3J7A F;  2L9H A;  2NN6 H;  5D3D A;  4RWS C;  4FF4 A;  5I6W A;  1TWC B;  4OIK A;  5FO7 B;  2MUY A;  5D14 A;  4H0L C;  3LWE A;  1MSH A;  3D4W A;  2F0L A;  2N55 A;  1LT4 D;  1JE4 A;  5T1I A;  4QCL A;  1F9Q A;  3HOU B;  3J81 L;  4EQO A;  2JA8 B;  1QCB D;  4IFD H;  3SEB A;  4XXE A;  3CRL C;  3R93 A;  3WOE A;  5J22 A;  3LNN A;  5C6A A;  4FXD A;  2NVQ B;  4KY6 A;  2LKV A;  2PW7 A;  2EE1 A;  1JWU D;  1LTA D;  4XQQ A;  2KHS A;  4BWG B;  1NAP A;  4B08 A;  1KAB A;  2K32 A;  2R93 B;  2F0P A;  2OEO A;  1S5F D;  1I6H B;  2WAQ B;  3S2D B;  5LL6 S;  1GHJ A;  4A3K B;  1O7L A;  3TZU A;  1U9R A;  5ISR A;  4HED A;  1OXX K;  2EY5 A;  3EA6 A;  1F2Z A;  2Z1C A;  1F2Y A;  4A3F B;  1FGB D;  3I4N B;  4DAY A;  2R92 B;  1EIH A;  2EJG C;  3BZD B;  1SE2 A;  2K5D A;  5HGT A;  5A2Q L;  2KVM A;  1Q1B A;  3IL8 A;  2B8G A;  5CV4 A;  2G9H D;  3NPP A;  3H0G B;  1PZK D;  1G91 A;  3GV3 A;  2SDF A;  3C1F A;  4KKS A;  4MIU A;  4IAL A;  1TVX A;  2JXM B;  4XTC S;  5EKL A;  3V05 A;  2K1B A;  4XQN A;  4DNR B;  5JPN C;  3F2U A;  3MFG A;  2B8F A;  1PRT C;  3R3O A;  3ND9 A;  2BDO A;  2A6E D;  3S15 B;  3PUZ A;  4FXK C;  5EPK A;  2RBM A;  1STG A;  2F0D A;  3KF8 A;  4E6I A;  4L8J A;  1QIL A;  1PXU A;  1I4P A;  3SVM A;  3BVM A;  1I4Q A;  3FVQ A;  3QG1 A;  3GTQ B;  4DN4 M;  5E3F A;  1W6J A;  2BA0 A;  3OMG A;  1ENC A;  4BA1 I;  1B3A A;  1PRT F;  3KBG A;  4Y7N B;  4KD4 A;  2F0F A;  2BDN A;  3TP6 A;  3C2P A;  3I73 A;  3MVV A;  4B9W A;  3C3L A;  4N9P A;  4U68 A;  2PYK A;  3MC0 B;  3PUV A;  1WTX A;  2L0C A;  1OXS C;  4K8J A;  2LFN A;  3GV6 A;  3MZ5 A;  4CKC A;  4PMB A;  4ZYS A;  3ITP A;  2F3V A;  3TP8 A;  1MGS A;  3Q22 A;  1STN A;  2J7Z A;  4A3E B;  3NQI A;  3T56 B;  2HDM A;  1SMY C;  3W3A A;  4K2K A;  5KEE A;  2NUC A;  5M3M B;  1AFP A;  3OSO A;  4KV6 A;  2OT2 A;  5I6Y A;  2L4N A;  3E6Z X;  2JA5 B;  2EYJ A;  4B9X A;  3MHB A;  5CV6 A;  4LAA A;  2ICI A;  1F2L A;  3TZD A;  1VF5 C;  3VR2 A;  2IW3 A;  4R8I A;  3OHX C;  1FNV A;  2L1B A;  4AYB B;  3HS0 C;  2A68 C;  4DK0 A;  5I9P A;  5FO9 B;  2NN6 I;  4MHE A;  5AFW A;  1KDA A;  1JR0 D;  1PTO F;  2F03 A;  3X3N A;  1JCK B;  5M5W B;  4KI0 A;  1B1Z A;  3T13 A;  4RAU C;  4G7O C;  2I07 B;  1A6X A;  4KHV A;  4IUV A;  3VR4 A;  4NDX A;  3H6M A;  3NWT A;  1BCP D;  1V1O A;  1PLF A;  1X3Q A;  2O5I C;  1EYC A;  1HCZ A;  1L0X B;  3BG3 A;  2IPK D;  5C3X A;  2R6G A;  1SNC A;  4RGT A;  1H9M A;  4RGM A;  3TME A;  1EY8 A;  4V0B A;  1SNP A;  2JSO A;  5C5M A;  2AQ2 B;  1SSO A;  1ICW A;  1CA6 A;  5IIF A;  1UNS A;  4PNY A;  4HMJ A;  1GXD C;  2I46 A;  5CGK A;  2BCO A;  3A55 A;  4HTH A;  1E2W A;  3VYU A;  4ODG A;  4FXG C;  4G4K A;  5C0X H;  2EPB A;  1BO0 A;  3RD4 A;  4IUP A;  3HEJ A;  1ESR A;  2XRQ D;  1Y1V B;  5CBA E;  2NB0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...