2Z1CA

Crystal structure of hypc from thermococcus kodakaraensis kod1
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
71
structure length
71
Chain Sequence
CLAVPGKVIEVNGPVAVVDFGGVKREVRLDLMPDTKPGDWVIVHTGFAIEKLDEKKAMEILEAWAEVEKAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of [NiFe] Hydrogenase Maturation Proteins HypC, HypD, and HypE: Insights into Cyanation Reaction by Thiol Redox Signaling
pubmed doi rcsb
source organism Thermococcus kodakarensis
molecule tags Chaperone, metal binding protein
molecule keywords Hydrogenase expression/formation protein HypC
total genus 17
structure length 71
sequence length 71
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2007-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01455 HupF_HypC HupF/HypC family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.970 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2z1cA00
3D3RA 3VYRA 2Z1CA 3VYUA 2OT2A 3VYSA 3VYTA
chains in the Genus database with same CATH superfamily
4OXPA 1WTHA 4DUZL 4POGA 3ND8A 4DV0Q 4GKJL 2R93B 1KC8C 1P16A 1RODA 2PMZB 1KNAA 1UE6A 2EZVA 4ZRZA 3GTLH 4U673 5CV6A 1O80A 3BVZA 1X3FA 3OHXC 1SYFA 1SROA 3J80i 2N8NA 3S17B 3H91A 3D4DA 4XQQA 2K52A 1TY0A 1VQHA 4JBMA 2BE5D 4HJ8A 1TU2B 4MIUA 2CH4W 4NDXA 3CAMA 5BN5A 3SK6A 2ENBA 3U50C 2D5DA 1K83H 1SAPA 3ONAB 4B3MQ 1K8GA 2X69A 1IW7D 1I3QH 2LXJA 3IKJA 5KEEA 1FL0A 3PUYA 3T13A 3GTKB 3R93A 4CKBA 3RZDB 3K8AA 4P71A 1ENFA 1CTMA 2CWPA 4A3IH 1AN8A 1EWCA 5JOBA 5BN4A 3M4OH 2IY5B 4DU9A 5C4ZA 4X64L 1DYQA 3R2IA 2A69D 3SK5A 3HKZE 3B6YA 2JA6G 4HJ5A 4JI4L 3PO2B 4L63B 3X3MA 4JI6Q 2OQKA 4E6IA 2IL8A 4HSPA 3EROA 4C1NI 2PPBC 4HJAA 1YNNC 2D0PA 2EE1A 4PG3A 3HOYH 1G2SA 1GUWA 3A8IE 3NTKA 2CFMA 3HG9A 3HKZB 4K8JA 1FGUA 2OF1A 2CH4A 3KJOA 1XPRA 3RZDH 1NSNS 4DAMA 1TY2A 4A3EB 1S5BD 5LMUQ 4DNIA 2JA8G 1IBLL 2L12A 3J80c 3VR3A 3UI2A 4B3SQ 3MXPA 2L5TA 1FVIA 1TR5A 3FKIB 1VF7A 1F9SA 3SVMA 4B3SL 1H9SA 1TIID 4QMGA 4TSSA 2R7FA 3U9SA 4AQYL 1HA6A 1V1PA 4DV3L 3F2BA 4JI5L 4F8MA 4MHEA 2FMCA 1R4QB 4RKBA 2X6LA 1HRJA 1YBYA 4JCVE 3IFTA 1EQVA 3M3YH 3L0OA 2SNMA 1GUNA 2JYOA 1FJGL 2E75C 1QILA 3I3CA 4K0KQ 1TWFH 4CKEA 1HZ9A 2SDFA 4OHJA 4LF9Q 2PMZE 4R1JA 3BG3A 5IGCA 4TKOB 1X3GA 2VY3A 4JV5L 1HA5A 1WTVA 1VQAA 1TVXA 1JORA 3M4QA 4RKLA 4UHVA 1HQMC 3AYHB 2PQAB 3SGIA 1IYJB 1QCBD 4XTCS 4WJ3M 1BXTA 1Q81C 4FF2A 5D65A 3S1QH 4YY3Q 1VQ4A 1N32Q 1L2FA 4OX9L 2ZTEA 4XT3B 1UUPA 3U9OA 2BCOA 4R4IA 1I6HH 4A3EH 4LAAA 4FO2A 2KOLA 4B3ML 1CSPA 1EYDA 3SR1A 5IGGA 1SFOH 2O2LD 3VR2A 1JWMD 2VZAA 3NTIA 5DM63 1N33L 4EX5A 4RWSC 1A6XA 2FINB 1A3UA 3WOFA 3G7LA 1JE5A 2EJGC 2KCMA 4JI1L 1YNXA 3ICEA 1VDZA 4IUTA 5KRUA 3KF6A 2F3VA 4JBKA 2F0KA 4K5XA 3S9WA 3OTOL 1SNOA 1EEID 4ID6A 5CMDA 5IGDA 2ES2A 3I2ZA 4CJ2C 1HCZA 1C48A 4EQNA 2N78A 1K3BC 1EFWA 4ZKBB 2WAQG 1LO5D 4CDEC 5JPNC 3OTOQ 1X3PA 2ASBA 4BY7B 1SBBB 2NBFA 1QNKA 2K28A 4A3FG 2L1BA 1GO3E 1MHWC 4QUCA 1SR3A 2N88A 4FVMA 4IOAA 5CGKA 3DLLA 3FKIG 5IYDH 3V2TA 2LS01 1KRTA 4NPSA 3E9IA 3NP8A 2XWBB 4A3MH 2E74C 3BZDB 3A7AB 4IOCA 1PZKD 5E4WC 3HOUB 1EY7A 1CM9A 3G6JB 4KHZA 2ZXPA 1JOQA 3ITPA 1WTOA 3U4ZA 1XJVA 5M3MH 2E76C 2Y0SG 1HPCA 3TBIB 4BXXG 4JVZA 4H13C 3I4MG 3H09A 3O13A 2EYMA 2HCCA 2WB1E 2ZJRA 3W2DA 2IX1A 4OONA 3BVGA 4DV4L 2OWOA 3CCUA 1T9HA 1IL2A 4G7OC 4LF5Q 2PQEA 1KDCA 1CK1A 2E2HB 4UPAA 5LMNL 5CV4A 1EYCA 1MIUA 1I5FA 4DXFA 4DV2Q 1A3VA 2BE5C 1FJGQ 2MPMA 2A6HC 3K6OA 1QZGA 1WTWA 1G91A 3X3NA 4I7ZC 3RLFA 4C3HG 5EPKA 4R9WA 4JYAQ 2RHQB 4R4CA 5M3MB 3C46A 2K75A 4BA2I 5EJWA 3KF8A 4JC0A 5CYUA 2HHHQ 2UXDQ 1KDAA 5ELEA 1EZ8A 5KGUA 3AB9A 4K6DA 3DWAA 2F0JA 1W6KA 2RDHA 3FVQA 3K7AH 3J7AF 1WCMH 3CMEA 4HAEA 4C3JH 2J4XA 3QB3A 4DAPA 3FRPB 3KBGA 1EY8A 3HS0C 2JA5G 2VQEQ 3H6MA 1NCVA 4IUVA 3OYYA 1PH9A 4ZQ3A 3W1GA 3OMCA 1G8ZD 3TS0A 1D5MC 1UEBA 3T1YQ 3K58A 3E3XA 1TWCB 2Z0SA 3IAYA 1A2TA 5EPJA 4OX9Q 2L55A 2R93G 2QGQA 4HTHA 1Y69U 3KFUA 1VQEA 1VQ7A 2ZJQA 1K8AC 4N8X1 1NMGA 4A93G 1SE4A 3M4PA 1E0BA 3KK7A 3HOVG 3W3AA 1WJJA 2BDOA 4IPGA 1EIFA 2UUCQ 1XNQQ 3HOVB 1WCMB 1Z9FA 3JAMi 3I56A 4KKTA 5IOCA 4ME3A 5GAHC 1VQMA 4A3BB 3NEMA 4C2MB 1IYVA 2ICIA 1XX8A 3DMUA 1PTOC 3FP9A 4YHHQ 1VQ5A 4KHPL 3VA7A 1BNZA 4A3GH 4GKKL 1F9QA 4JI0Q 1ESFA 1PZID 5J3BA 1FD7D 5ELBA 3EIVA 3DWPA 2K5QA 1X6OA 1FYCA 5EAYA 4A3MB 5C0XI 1A3TA 2QDBA 4BBRH 1NUCA 2F4VQ 3GTMB 5K36G 4GNXB 1KAAA 3H0GG 3OW2A 4NXML 4XQJA 1AZQA 4GLXA 2VB3X 1VQOA 3STBD 3E9HA 2EY2A 3Q22A 3Q6SA 2O5JC 3JAME 1KHIA 5DNFA 3K59A 3CCEA 1O7LA 3J80L 1VF5C 5H1SE 4QQBX 3CKIB 5C6AA 1SJED 1PH7A 2IWHA 3EJIA 4PMWA 1CZWA 1XNRL 2EQSA 1HTPA 1PTOF 4F88A 5LMUL 2F0IA 5LL6S 1QVGA 1EY4A 2HDLA 4YIJA 5FLMH 1XMQL 3ULJA 5JEAG 3H3VI 2CVRA 3PIPA 3FDTA 4DV6Q 1MKHA 4X66L 3KLRA 1ILPA 3MXNA 1V1QA 4K14A 2KEEA 1WTPA 1JT8A 4HN7A 1B8AA 3H3VH 2I46A 4IFDH 2HIVA 3JAML 2UXCL 5JJIA 3MA2B 3I4MH 3GV6A 1CI3M 2EJFC 3FKIH 4B3TQ 2CKZB 4KD3A 5C3EB 1ZKOA 3BDOA 1LTBD 5DLQE 1DOKA 1HR0L 2R7ZH 1ILQA 4F7XA 4ZYSA 4BY7G 1I6HB 2C5CA 3MXNB 4DV5L 1VCIA 4DNTB 3IFDA 5I6WA 3K7AB 1JOKA 4K6LA 4RH6A 3S2HB 1BKBA 4EVOA 1H95A 1CZGA 2F3WA 3NK9A 3I8ZA 4CKCA 2KQ3A 3ND9A 3SEBA 1JWSD 1HZBA 3WOEA 4DR5Q 1EOTA 4OO1I 4GN3B 3TP7A 1OO9B 2IHFA 1Q3LA 5COYA 3L3OC 3VR6A 5CC4A 2DY8A 3C1EA 3DEPA 4K8IA 1I94Q 1LT4D 5FOBB 1E2WA 4DR3L 2R7ZB 1SMXA 2Z4HA 2KHIA 1BBXC 2F0UA 3VYSA 2NVQH 1G6PA 3GTGB 3QIAA 1OTCA 3D4WA 5EGTA 1YJNA 2R92B 4B3RQ 1L0WA 2PZTA 2D0OA 1N34Q 3J7AV 2K14A 1OXUA 5AJ3L 3I73A 2XTIA 1Q1EA 3PUZA 3PO3H 5AFWA 2PZUA 4X3SA 1A62A 2JA7B 1H9MA 4BBSG 2B2WC 3T1HL 3D31A 4RFBA 3NQIA 3S1NB 2KA7A 2L0CA 4DXGA 2JE6I 3S2DH 1Q46A 4A3KH 3T51B 3A8JE 2GVBA 3H94A 4A3CG 1PFMA 4JI7L 3CU7A 3G71A 1PH5A 3HOZH 5M3FH 2PNHA 4CGYB 3CP0A 1B4OA 1OXXK 4CJ1B 2YV5A 2ATWA 5KYIA 3I4NH 5EKKA 3H3VC 4JI8Q 2F0MA 2QA4A 4BY7H 3J7A5 2IW3A 1YIJA 1PRTC 1HFNA 1V1PB 1N9WA 3HOWH 2AUJD 2XN9C 4A3IB 1PRTD 1O7YA 3QO2A 1PHJA 1K9MC 1PZJD 4DUYQ 5M5XH 3J81E 3SK8A 3Q23A 1QE6A 1YI2A 3K5MA 2ZTCA 1EOVA 4RGOS 3HOUH 3DM1A 2UUBQ 5EBCA 1SDFA 3NBHA 4I7AA 5CV9A 3GTGH 3NTHA 3S17H 5C4HA 2Q8IB 2VUMB 3P7JA 5JPMC 1QJOA 1UE1A 1M90C 3EBEA 3MZ5A 1J5EQ 1F9RA 2R92H 3DUZA 1MSGA 1CHQD 1NY4A 4A3DG 1EWIA 1WD0A 3I7FA 1B3AA 1X9NA 1DJRD 1EIHA 4FNFA 2JA6B 3NBHB 2IHEA 5T1GA 3R8BA 1PYWD 1SJHD 4O2DA 1PTOB 3GTKH 4DR1L 4LFBQ 4FXKC 4KV6A 2MQHA 3LNNA 4NKLA 4JOIA 5EQ0A 3S1MB 2OEOA 4JI7Q 3D8GA 3HOZB 4QL5A 4NMZA 1R9TH 2M2LA 1QOHA 3PO2G 1BF4A 4BY1B 1UNSA 3KDFB 3TQYA 4DR7L 1HZCA 2B2WA 2LFNA 1C7YA 5JAVA 4QJFA 3RNUA 1CT1D 3OPOA 5DAUA 5FLXL 2ALYB 1A0IA 1MSHA 1U4LA 1E2ZA 2PCFB 1JMCA 4LUZA 4CDDC 1BCPF 1IZ6A 2RA4A 5C4JB 4R8NA 2OTLA 4NW2A 4ZUJA 1HR0W 5IODA 1N34L 1XMQQ 4XYOA 5CV5A 3CCVA 4ABNA 1CFMA 1UE5A 3C1FA 1SYDA 4DV7L 3I91A 4X65L 4RHSA 1BCPB 1ET6A 1NR4A 1C0AA 4I65A 2EYPA 1PH2A 1VQ9A 1IHZA 2EY5A 2EXZA 2K5NA 4K2LA 4JBJA 1I4HA 3HKZG 3RUZA 4BS9A 5CBAE 4A93B 1RF2D 2E2IH 4F87A 3K7UC 5IT9L 3OSOA 5FK9C 2L11A 4IJHA 2EIFA 1EZ6A 2ZXRA 4FXDA 2NWGA 2Z4IA 1N8RC 1D5ZC 3CCLA 5C3EG 2RBMA 2AMCB 3A74A 5I6YA 3ZJYC 1PTOH 4A3DH 1KABA 1BR9A 1TS4A 1WTXA 2O5IC 2HQEA 1JC7A 2F0QA 3OMGA 4Q5VA 5GAEC 1AFPA 3U4VA 2F52A 4AH6A 1LV9A 3PCOB 2B63G 4LK1C 3TSSA 5IT9E 4QIWB 2AWOA 4LFCL 2UUCL 1KD1C 3I4NG 4KKSA 1WI5A 1X55A 1M4VA 3F2UA 5F2DA 1K8MA 2Q8TA 1EEFD 2QDLA 5KIXA 2UXCQ 3CMAA 1FGBD 1D5XC 1DZ1A 4H7BA 1B44D 1Y1VG 2WB1G 2MO1A 4XYQA 3H15A 2E2JB 2FJ2A 3J7YW 2CCZA 2KENA 1STNA 5C4JH 2WV6D 2RCFA 3PMFA 2B3GA 3TMEA 3KBXA 3RN2A 1STBA 4V190 3RN5A 2NB0A 3TDQA 4BY1G 2AQ2B 1XNRQ 5IY0A 2C35B 1S5DD 2KBNA 4IPHA 3CCSA 1X3QA 4HCSA 3Q0AA 2D62A 2KEDA 2VQFQ 1STGA 1ZXTA 3J81c 2K1BA 2NVTH 5A2QE 5M5WB 4HR7B 1PH6A 4HMJA 1R9TB 1XXGA 3UDFA 1SN8A 4IUPA 2YU9H 2HHHL 2M9VA 4KHVA 2K32A 5IP7H 2K33A 1HNWQ 4L8JA 1U4PA 1PYSB 4LF7Q 1B7YB 4DK6C 4X65Q 4K5WA 4JK1C 4DV1Q 2BH2A 4LJZC 1Y14B 3BYYB 1DOMA 2I0QA 4KHPQ 4IURA 3MEFA 1SFOB 1ZYRD 2K01A 3K0XA 1E24A 2IX3A 4KY5A 1Q1BA 1M8AA 1VQIA 2DGYA 4ODGA 1LTGD 2IJ0A 3A5UA 1PLFA 4IPDA 3GP7A 5C3XA 3GTLB 3E6ZX 1XNQL 1QVCA 1T5XD 1MD2D 4JI8L 2YU9B 4J6HA 2PO4A 1FNVA 3CCJA 3V96A 2ZJPA 3GTPB 3N52A 5IGFA 2JSOA 3JC66 2R6GA 1HZAA 3QWNA 2B63H 4DR4L 1K8OA 1B9NA 4KK7A 1D8LA 1TQOA 1Y8NB 3CPWA 2MFIA 1KQSA 1YHAA 4FF4A 1HHVA 3PQIA 5CBEE 4GLVB 4ZK9B 1GUSA 4DR1Q 1Y1VH 2ICEC 4G4KA 4L5TA 3T1HQ 3D6CA 1B53A 3A54A 1L1OC 4PZ6A 1P8LA 5JJZA 2EXDA 1VQPA 3OIQA 3MTSA 3PO3B 3UE0A 1J8IA 3ER0A 5IYCH 3M4OB 4N9TA 1ASYA 1PH1A 3AQQA 1QNUA 3OOCA 5M5WH 4A75A 4A76A 3F8TA 1DCZA 3CC7A 1BQQT 1NMFA 2NN6G 4QGUA 1IKLA 1I4RA 2BH8A 1V1OA 2B2YC 3K80C 1S5CD 4KY6A 4APVA 2M00A 5EPLA 1KXLA 1LTTD 5C4XH 3GV3A 1SLJA 1GUGA 1RCVD 5CV8A 3EN2A 3L9AX 4CDCC 5C3EH 1N36Q 4RAUC 4DK0A 2R7DA 2L9HA 5C44H 5IP7G 5LHY1 5C3WA 3A5ZB 5HGTA 2AKWB 2RSOA 1JJ2A 3HOXH 1LLRD 4LF5L 1DD2A 1GUOA 4DR5L 2SNSA 2BA1A 2UXBQ 4GLAC 5IE8A 1TWAH 4DV4Q 2HT1A 1Q12A 5IP9G 2F0HA 4CBVA 1VQ8A 4A3KG 1F9PA 1IL8A 1N32L 1QB5D 4BXXH 2F0FA 3V05A 3J81j 5KNCA 1AZPA 2VUMG 1TXYA 1FR3A 2ZT9C 4OGQC 1T5EA 5IYDG 2NZHA 3CC2A 1D7QA 1HFGA 1PFBA 2JQOA 1EY0A 2Q8RE 5G3LF 4ZUIA 5IYBH 1PH3A 3MHBA 4JBWA 1SE2A 4GN4B 3PIOA 4OL7A 2Q2HA 1XYIA 2E8GA 3T16A 3P1HA 3AU7A 2HCIA 3NELA 1JQYD 3EFXD 1SMYC 4DK1A 1AE3A 2RSNA 3EVQA 4A3EG 3HOWG 4HIOA 4P72A 2I07B 4K0KL 3K5LA 1TWFB 4C3HH 3DEOA 3MC0B 2PW5A 5C0XH 4X66Q 5E7NA 4DV6L 3PUXA 2F4IA 4HIMA 4LF6L 4LWCA 1BDOA 2VB2X 3DHQA 4DV3Q 4WRDA 3SE0A 4DK3C 2XGTA 4AQYQ 1XMOL 4M1UB 5EKIA 4JW0A 5EBDA 4DR3Q 2WAQE 4WJ4A 2QW7A 4S3SA 3GTJH 1LABA 2LY7A 4UP7A 5HY6A 2Y0SE 4HIKA 3SK4A 1EQQA 1WFQA 4JI1Q 3LWEA 3T56B 4B9XA 4X62L 2WP8J 4C3JG 2ZTDA 4JI2L 1I50B 3M7GA 4C3IH 2RKSA 1C9OA 4OIKA 2JA5H 2OXPA 1EY9A 4OIJA 2CW0D 4JI0L 4LNQA 2K50A 4GKKQ 3MXUA 2YYZA 3H0GB 4YY3L 3LGJA 4YHHL 3PGZA 1KTKA 1Q8IA 4QY7A 2SOBA 5J22A 3D3RA 3CCQA 5ELFA 4U68A 4YCVA 3GTOB 5JJLA 2EYOA 1HUNA 3UE1A 3TEHB 4FXGC 1O78A 2H5XA 1GUTA 1HJPA 4X3KA 4X64Q 1KRSA 4P74A 4GNXC 5JEAJ 4JV5Q 1STYA 3HKSA 1AEXA 2E2IB 1B1ZA 3BU2A 4RGNA 1SYGA 3SDZA 3FPPA 3E0EA 1VQCA 2K5HA 4ZLTF 2JA7H 3LWUA 2DUDA 2Q2UA 1L0XB 1GD7A 2EPBA 4DGZA 1JB3A 3M3YB 1MBYA 5A35A 1TWAB 4JI2Q 1XTDA 2FMMA 2NVTB 2VQEL 3A56A 1BO0A 4LUVA 4DR2L 1SE8A 4B08A 3I55A 4X3UA 4KLKA 1YNND 2L15A 2P5ZX 4DFAA 2F0VA 2F0SA 4A3LH 1KNEA 4OWWB 3N6RA 5C5MA 5GROA 2B8FA 1D1KA 2KUMA 5ELNA 1LTSD 3OIPA 3HOXG 2H4OA 4L5SA 3M9BA 2Z1CA 2NN6H 1J9OA 4MTNA 3K57A 1L0YB 1VQGA 4LF8L 5CORA 2ID0A 3PUVA 4P73A 1GKHA 2E5LL 2N49A 2AUKA 1AP0A 4HIDA 4R8IA 1E7ZA 5I2XA 5A2QL 1E2VA 4C3HB 2JEBI 2R93H 2ZXOA 1VQJA 3VR5A 3MAQA 4JI6L 2A74C 1EYGA 4UY8C 1WVLA 1H9JA 1HH2P 3HOVH 1STHA 1TS2A 2XSCA 2B2TA 2XIWA 4FF3A 1ML0D 3I4NB 1NAPA 2RVLA 4DA2A 4ULLA 1PH4A 2G5DA 1WOCA 1GXDC 3CQZB 4IZ8A 2B2VA 1KL9A 3CXCA 4MN3A 4CDFC 2K4KA 3BZCA 5LL6X 3TRZA 4PV1C 3Q24A 1ONLA 3T1YL 3KJPA 4XDXA 3GTQH 5K5PA 1YEZA 2K5VA 3LX0A 2EY1A 1PRTB 2UXBL 3E5SA 1GOZA 1ICWA 1B50A 1B70B 1VMPA 4KKUA 2ZM6L 2NZOA 5DEHA 5C5LA 4BBRG 4A3BG 4YWMA 4L5RC 1MI2A 1YNJD 2NYZD 2QILA 1PTOD 3S2DB 2V4DA 3GD7A 2IX0A 1Y1WH 2KJXA 1IXRA 2HUGA 4PZ7A 4OWTB 3HFZB 4N8FA 5E3FA 2HIXA 5C0XG 1XMOQ 2CQAA 3EQLC 1LUZA 2UXDL 1RKNA 2XWJB 2LKVA 1LTLA 1SYCA 2DN8A 1G51A 1SNQA 1VS0A 4QUFA 4JPBW 2K05A 3FMCA 3MVVA 3CCMA 4DUZQ 2JJQA 4LF6Q 3GTQB 1ICFB 1VQFA 2X6GA 2WFWA 2CQOA 2H1EA 3CCRA 4NXNL 4DV2L 2BDNA 4RMFA 4QB4A 2ZM6Q 2WIIB 4ILWA 1CQFA 1TWHH 1TS3A 3QR8A 4WJWA 4L6TB 1YITA 3KOJA 2AHOB 2BOSA 4RCNA 3A8KE 4IFDI 2JA5B 1HXYD 1D6EC 3J81L 1Y8PB 5IGBA 3C3LA 3Q8DA 3CRLC 5ISRA 2NVXB 3I4LA 3K5OA 3KUPA 1PA6A 1HQRD 4C3IG 1STAA 3VR4A 1SSOA 1VQBA 3BDLA 1IBKQ 1U4RA 1F77A 4A3CH 3NXWA 1XTCD 4UAIA 1KLGD 3CD6A 4HJ7A 3S16H 3CHBD 1GVPA 1PYBA 2F0NA 2GN5A 3MEHA 2VW9A 4DNRB 2A68C 2JP1A 4XT1B 4PQXA 1JCKB 3PIO3 4YWLA 3S2HH 1TKWB 1EIYB 4X3TA 5IYCG 1F2MA 1GM5A 5FO8B 3BDCA 2NVXH 2KECA 3M4YA 1VQ6A 2Z6KA 5T1IA 3BJUA 4BWGB 5BN3A 2E5LQ 5C0XJ 3U58A 2JA8H 1DXMA 4DV1L 3UDGA 3QJYA 5FLXc 1AW7A 3SXHA 3I4MB 2VS1A 1HNWL 2JA7G 5FJ8G 4MNOA 1Z47A 3J80E 4IALA 4X6AH 2RF4A 2I5MX 3I70A 4JI5Q 1F2LA 1SXTA 2DNCA 1W6JA 1ESRA 4RGMA 1W2BA 1TT2A 1PFSA 2K6AA 5FLXE 2NVYB 4DPGA 3HOUG 3RR5A 1A8VA 2EYHA 2EYLA 2R92G 1KIXA 3CC4A 1PH8A 4KMUC 1H9SB 1Y8OB 2K03A 1TWHB 1IBLQ 1N33Q 2OCEA 1QWYA 2A1AA 2LXKA 5IWAQ 4R4TA 3TREA 4GZYC 2WKDA 4A3FB 5I9OA 2KCNA 1EIGA 5GADC 2NUCA 3S16B 4DR4Q 3HOYG 5ELDA 3P20A 2CHBD 4YCUA 3S15H 1AE2A 5EKLA 1LTID 1YNJC 4LW1A 4JI4Q 3GDEA 2HQLA 2I5LX 3G4SA 1H9RA 3E0JA 3HRZC 4FYDA 2MUYA 1TS5A 3DM3A 3DWQA 2F0EA 3FEWX 4IN3A 3CF5A 3DXJC 4TVAB 1BCPC 5HURA 4LFAL 1HUMA 1PMRA 4QCLA 3BS1A 2FFKB 4LF9L 3AFPA 1SRUA 4LF4Q 1K83B 4WORA 4IJLA 2SEBD 3S24A 5J1ZA 4OEMB 1BBUA 5M5YH 2XRSD 2NZ1D 2PI2E 3JAMc 1JJGA 4X62Q 3STBC 2R3ZA 4V0BA 1ASZA 3BYTB 2A69C 4Y7NH 1FNUA 2XRQD 2YTYA 2RDGA 5FJ8H 5I9PA 5ELCA 1JWUD 1R4PB 3SHLA 2WACA 4A3BH 2G9HD 1K0RA 2J7ZA 3VYUA 2A6HD 1E3PA 1HTLD 4DV7Q 4O1NA 4DR2Q 1EU4A 2B2UA 5J39A 1CKOA 4JG2A 4RHRA 4KN4C 2EYJA 4C56C 1F2YA 4JOIC 2B2UC 4DV0L 2CWAA 2VXWA 5M5XB 4G7ZC 2NTTA 1X3EA 3HOWB 3QOLA 3TP5A 1UE7A 1GJXA 3PF5A 3KDFA 2TSSA 1ZEQX 1VQDA 3S15B 2UU9Q 4DKAC 1E1TA 1LYLA 1Q8KA 3GTOH 1BCPD 2N55A 2B8GA 3S14H 2PNRC 3ERQA 1J6QA 4GOPC 3PIP3 5DM73 3F2DA 3ULPA 3NUCA 2B63B 3NENA 1S72A 3WDNA 1JB7A 1S5FD 1KLUD 1XWEA 3I90A 3K0YA 3RLNA 3T53B 5CV7A 3NWSA 3AMUA 2WKCA 4G7HC 1ZYRC 1EU3A 5ELOA 1TWGH 3D6WA 1B2TA 3PUWA 4IFDJ 2J0TD 1YHQA 4MTKA 3ZYYX 4HJ9A 1EY5A 5M5YB 3GTMH 1TWCH 1PDQA 1O7ZA 1G6ZA 4O42A 1EY6A 1AH9A 4BBRB 5KNDA 4Y7NB 1I4PA 1II3A 1U0LA 1IYUA 4HCEA 1YVCA 1ET9A 4A3FH 4PNYA 3TZDA 2D9UA 3F2CA 2AWNA 4BY1H 1IBML 5FKAC 3PSIA 3VYRA 1OXTA 3OW7A 5D3IB 2RQXA 2DJFC 4HMIA 1MGSA 4NB3A 4A4IA 2UUBL 1BVSA 2EYFA 3AFQA 4A3MG 1JICA 1MJCA 1Y1VB 2WB1B 4GKJQ 1NBWA 1RL2A 1CA5A 2NVYH 1QG7A 2BA0A 2RHSB 3KF8B 2A19A 1Z6HA 2G9DA 1CKNB 4KJOA 4UDUC 5GAGC 3TS2A 1L1OA 4TRDA 5JVH3 5M3MG 1Y1WB 3FHWA 1HNZL 3M7NA 2A5HA 4Q0FA 1EWHA 3A0JA 4HEDA 4O0AA 5BR8Q 4DR7Q 1KDBA 2K5DA 1EQRA 1CQVA 4A93H 2NVQB 3K81C 2AQ3B 2F0LA 2B2TC 4IUQA 5C4XB 5D14A 4AYBE 4EQ5A 1CKNA 2A8VA 3ERSX 1Q90A 3MFGA 3UDXA 2A73B 4RGTA 4P75A 3HOXB 4R4QA 1HNZQ 2KVMA 3CQZH 4A3JG 5KYLA 3S1QB 3L2PA 5C44B 1SMYD 1VQNA 1JE4A 3W1BA 4FDBA 1A63A 1S5ED 2D2CC 4A3GG 1EFID 4A3DB 3G48A 5LMNW 2UUAL 2Z9HA 4M8AA 2FXQA 4B3RL 1N36L 2EJMA 3BVMA 1SNMA 4J8QA 1RTOA 3R2TA 4ZKCB 4IO9A 2QCPX 4LF7L 5C44G 1I4GA 1S40A 1F2ZA 3CRKC 1WYDA 1SNPA 4A3JB 5M9OA 3C2PA 1I94L 5I4DA 1SNDA 2KCTA 3KLSX 4FP5D 3VYTA 2MGSA 1RTNA 2PW7A 3FPUB 3TP6A 3KLSA 4DUYL 1WD1A 2V1CC 2EY6A 1SYEA 4GNXA 4JI3Q 1JR0D 1I3QB 4DR6Q 2VQFL 3D0FA 5C4XG 2OTJA 2VL6A 5JEAH 1GHKA 1CUKA 2EVBA 2IT1A 1L1OB 2C9OA 2RDFA 5E1FA 3I4OA 1HR0Q 3A7LA 2HD3A 2Y0SB 3TZUA 2JN4A 2VUMH 3GO5A 1C8CA 2FHTA 2KHSA 2MP1A 1BUVT 3M85A 4C3JB 3S14B 4LMQD 5IYBG 2PZWA 1O7IA 3NPPA 4TQUS 3VA5A 5I2YA 3GTJB 1K28A 3NE5B 4ME5A 3TN2A 4GOPA 1ENCA 1IW7C 1NNXA 1I4XA 4RCOA 1G2TA 2DY7A 1I6VC 1QUQB 1PXUA 1YZ6A 2B2YA 1UEAB 1I4QA 1K3RA 2Q2TA 3QOJA 1IKMA 1D1IA 2NTSA 3HEJA 2PQAA 2A68D 1VQLA 4LUOA 2F0OA 1SE3A 3NQTA 1PFNA 3NBIA 2B39A 1U5KA 5K36H 1JOOA 2PYKA 3H0GH 2F1MA 1IBMQ 2Q2IA 1OXSC 3RZOB 1BOSA 4GOPB 5M3FB 5FLMG 1WTQA 1CA6A 4J15A 3IL8A 3A55A 4AYBG 2DNEA 1QVFA 3GQBA 1YJWA 3HOYB 1Q86C 2IPKD 5CR3A 1NTGA 3URYA 1M1KC 2WAQB 4H0LC 3KF6B 2GVAA 4C2MH 1K73C 3MWYW 4K2KA 3VDYA 2TMPA 5G3LD 1S4ZA 5HGQA 4KJNA 5IP9H 4LFAQ 1YJ9A 3W5OA 3R3OA 3OWFA 4G57A 1SNCA 3RZOH 4BBSB 1HNXQ 2JA8B 2R61A 4B3TL 2DJGC 2AQ1B 1VQKA 3GTPH 1U9RA 1SYBA 4XIGS 4DAVA 2QEJC 4OO1H 4ALPA 4R4OA 4LFCQ 4A3JH 5FO9B 4IFDG 3HOZG 4UP8A 3BZKA 1HNXL 2UU9L 4C1NK 3J81i 1B9MA 5IIFA 4POFA 4PZ8A 3NSWA 4GS3A 3RMHA 5IT9c 1WTRA 5E4XA 1V9PA 1X56A 1RJTA 4XXEA 3S1RB 4LFBL 4IQZA 2R7ZG 2MO0A 4Z9CB 5NUCA 1DGSA 2MNAA 3NHHA 4IPCA 1V43A 4B9WA 1XPUA 2CW0C 2KCCA 1E22A 1K0SA 2GA4B 4MZ9A 3NWTA 4JI3L 1Q82C 3L7ZC 4DR6L 1NR2A 2QEXA 1LACA 1V8QA 2QKIC 1FNWA 4YWKA 4NXMQ 3P75A 4HSVA 4A3LG 1G291 2F4VL 2N3SA 5FO7B 1OXVA 1LT6D 1RIPA 1PRTF 1QZHA 4BA1I 3QG1A 4RA8A 1Q7YC 1I50H 2JK8A 4C3IB 1W3SA 4RG1A 2E2HH 4UP9A 2OT2A 2F0WA 1CKMA 1CSQA 2NN6I 4A3IG 2A6ED 2L4NA 1QUQA 4LF4L 1X32A 2UUAQ 3PO3G 2F3IA 3I72A 1Z7TA 1RHPA 4KTAA 1X65A 4ZAIA 2JA6H 4BBSH 1C4QA 1LT5D 1H9KA 3J7ZC 2F0DA 4EQOA 2JXMB 2OQ0A 2Z6BA 3HP3A 4K5VA 4A3KB 2F03A 2Z6KC 1EUJA 1ENAA 4CJ0B 4QIWE 3HGBA 2XNAC 1UWVA 1XPOA 3PV0A 1LM0A 5JVG3 1NE3A 4AYBB 3S1MH 1E1OA 1LTAD 3EA6A 2PI2A 1DONA 1X54A 5M3FG 1UAPA 3WWVA 1MJEA 4FF1A 2JEAI 1VMCA 3CW2C 2MHVA 1U4MA 4OO1G 2YTXA 4KN7C 3UDIA 4J1MA 5IWAL 2K5WA 4AIMA 1RD9D 3MXGA 2E2JH 2MJ8A 3S1RH 4NP5A 3D4RA 1KAWA 3MFYA 2XVSA 1PV4A 2O4XA 4YCWA 4ZCKA 4NXNQ 3CPFA 1TWGB 2B29A 4DF7A 1J5EL 3OWEB 4WFN3 3F1ZA 2HDMA 4IUNA 2F0GA 3RLOA 1DOLA 1SEBD 4EGVA 2LMCB 2I5HA 1Y1WG 3PF4A 1GHJA 3RD4A 4JYAL 1A15A 2LSSA 2K04A 4XQNA 1A2UA 4PMBA 1B3QA 3TP8A 5D3DA 1DM0B 5JJKA 1BBWA 4KY7A 2KHJA 4GN5A 3IRBA 1EYAA 2E2DC 2RCNA 1RDPD 1D2BA 4P2CB 5GQOA 4DAYA 4H02A 1LT3D 5LMNQ 1WCMG 2EOTA 4OELB 2F0PA 1EL0A 4QF4A 2K7VA 1YHBA 3AEVA 1LTRD 4H44C 1STEA 1JJCB 1EQTA 3K5NA 2QF7A 2JA9A 5IGEA 4Y52H 2Z8LA 4DV5Q 4OWXB 2B2VC 3ULLA 2VNUD 2EDGA 4DAYB 1IBKL 3KYHC 3S1NH 1PVOA 4KD4A 5KNBA 3KLWA 4KI0A 4L5QA 4CHTB 5BR8L 4PMCA 5TSSA 3PO2H 4IUUA 5L37A 2WINB 2YTVA 4EQPA 4DN4M 3HZXA 4N9PA 1S3OA 3G6EA 2A6EC 3T4AC 4A3GB 2F0TA 5AJ3Q 1NJIC 4LF8Q 1CHPD
chains in the Genus database with same CATH topology
3ND8A 2R93B 1RODA 2PMZB 1KNAA 2EZVA 4ZRZA 4U673 5CV6A 1O80A 3BVZA 3OHXC 1SYFA 3S17B 3H91A 3D4DA 4XQQA 1TY0A 2BE5D 1TU2B 4MIUA 4NDXA 5BN5A 3SK6A 2ENBA 2D5DA 1SAPA 3ONAB 2X69A 1IW7D 3IKJA 5KEEA 3PUYA 3T13A 3GTKB 3R93A 4CKBA 3RZDB 1ENFA 1CTMA 1AN8A 1EWCA 5JOBA 5BN4A 4DU9A 5C4ZA 1DYQA 3R2IA 2A69D 3SK5A 3PO2B 4L63B 3X3MA 4E6IA 2IL8A 4HSPA 3EROA 4C1NI 2PPBC 1YNNC 2EE1A 1G2SA 1GUWA 3A8IE 3NTKA 3HG9A 3HKZB 4K8JA 2OF1A 1NSNS 1TY2A 4A3EB 1S5BD 2L12A 3VR3A 3UI2A 3MXPA 2L5TA 1TR5A 3FKIB 1VF7A 1F9SA 3SVMA 1H9SA 1TIID 4QMGA 4TSSA 3U9SA 1HA6A 1V1PA 4F8MA 4MHEA 2FMCA 1R4QB 4RKBA 2X6LA 1HRJA 3IFTA 1EQVA 2SNMA 1GUNA 2JYOA 2E75C 1QILA 3I3CA 4CKEA 2SDFA 4OHJA 3BG3A 5IGCA 4TKOB 1HA5A 1WTVA 1TVXA 1JORA 4RKLA 1HQMC 1QCBD 4XTCS 1BXTA 4FF2A 5D65A 4XT3B 1UUPA 3U9OA 2BCOA 4LAAA 4FO2A 2KOLA 1EYDA 3SR1A 5IGGA 2O2LD 3VR2A 1JWMD 5DM63 3NTIA 4RWSC 1A6XA 2FINB 1A3UA 3WOFA 3G7LA 2EJGC 1VDZA 4IUTA 5KRUA 2F3VA 2F0KA 4K5XA 3S9WA 1SNOA 1EEID 4ID6A 5CMDA 5IGDA 4CJ2C 1HCZA 1C48A 4EQNA 4ZKBB 1LO5D 5JPNC 1X3PA 4BY7B 1SBBB 2NBFA 1QNKA 2K28A 2L1BA 4QUCA 2N88A 4FVMA 5CGKA 3V2TA 2LS01 3NP8A 2XWBB 2E74C 3BZDB 3A7AB 1PZKD 5E4WC 3HOUB 1EY7A 1CM9A 3G6JB 4KHZA 2ZXPA 1JOQA 3ITPA 1WTOA 2E76C 1HPCA 3TBIB 4H13C 3H09A 3O13A 2EYMA 2HCCA 3W2DA 2IX1A 3BVGA 4G7OC 2PQEA 1KDCA 1CK1A 2E2HB 5CV4A 1EYCA 4DXFA 1A3VA 2BE5C 2MPMA 2A6HC 3K6OA 1WTWA 1G91A 3X3NA 4I7ZC 3RLFA 4C3HG 5EPKA 4R9WA 5M3MB 3C46A 4BA2I 5EJWA 3KF8A 5CYUA 1KDAA 5ELEA 1EZ8A 5KGUA 3AB9A 4K6DA 2F0JA 3DWAA 1W6KA 2RDHA 3FVQA 3J7AF 4HAEA 2J4XA 3QB3A 4DAPA 3FRPB 3KBGA 1EY8A 3HS0C 3H6MA 1NCVA 4IUVA 4ZQ3A 3OMCA 1G8ZD 1D5MC 3K58A 1TWCB 3IAYA 1A2TA 5EPJA 2L55A 1Y69U 4HTHA 1SE4A 1E0BA 3KK7A 3W3AA 2BDOA 3HOVB 1WCMB 4KKTA 5IOCA 4A3BB 4C2MB 1IYVA 2ICIA 1XX8A 3DMUA 1PTOC 3VA7A 1BNZA 1F9QA 1ESFA 1PZID 1FD7D 5ELBA 3DWPA 2K5QA 1FYCA 4A3MB 5C0XI 1A3TA 2QDBA 1NUCA 3GTMB 5K36G 1KAAA 4XQJA 1AZQA 2VB3X 2EY2A 3Q22A 3Q6SA 2O5JC 3JAME 5DNFA 3K59A 1O7LA 3J80L 1VF5C 3CKIB 5C6AA 1SJED 2IWHA 3EJIA 4PMWA 1CZWA 1HTPA 1PTOF 4F88A 2F0IA 5LL6S 1EY4A 2HDLA 4YIJA 5JEAG 2CVRA 3FDTA 3KLRA 1ILPA 3MXNA 4K14A 2KEEA 1WTPA 4HN7A 2I46A 4IFDH 3JAML 3MA2B 3GV6A 1CI3M 2EJFC 4KD3A 5C3EB 1ZKOA 3BDOA 1LTBD 1DOKA 1ILQA 4F7XA 4ZYSA 1I6HB 2C5CA 1VCIA 4DNTB 3IFDA 5I6WA 3K7AB 1JOKA 4K6LA 4RH6A 3S2HB 4EVOA 1CZGA 2F3WA 3NK9A 3I8ZA 4CKCA 2KQ3A 3ND9A 3SEBA 1JWSD 3WOEA 1EOTA 4OO1I 3TP7A 1OO9B 1Q3LA 5COYA 3L3OC 3VR6A 5CC4A 2DY8A 3C1EA 3DEPA 4K8IA 1LT4D 5FOBB 1E2WA 2R7ZB 2Z4HA 1BBXC 2F0UA 3VYSA 3GTGB 3QIAA 3D4WA 5EGTA 2R92B 2PZTA 3J7AV 1OXUA 3I73A 1Q1EA 3PUZA 5AFWA 2PZUA 4X3SA 2JA7B 1H9MA 2B2WC 3D31A 4RFBA 3NQIA 3S1NB 2KA7A 2L0CA 4DXGA 2JE6I 3T51B 3A8JE 3H94A 1PFMA 3CU7A 4CGYB 1B4OA 1OXXK 4CJ1B 5KYIA 5EKKA 3H3VC 2F0MA 2IW3A 1PRTC 1HFNA 1V1PB 2AUJD 2XN9C 4A3IB 1PRTD 1O7YA 3QO2A 1PZJD 3J81E 3SK8A 3Q23A 1QE6A 3K5MA 4RGOS 3DM1A 5EBCA 1SDFA 3NBHA 5CV9A 3NTHA 5C4HA 2Q8IB 2VUMB 3P7JA 5JPMC 1QJOA 3MZ5A 1F9RA 3DUZA 1MSGA 1CHQD 1WD0A 1B3AA 1DJRD 1EIHA 4FNFA 2JA6B 5T1GA 3R8BA 1PYWD 1SJHD 1PTOB 4FXKC 4KV6A 3LNNA 4NKLA 5EQ0A 3S1MB 2OEOA 3D8GA 3HOZB 4NMZA 2M2LA 1QOHA 1BF4A 4BY1B 1UNSA 2B2WA 2LFNA 5JAVA 1CT1D 3OPOA 5DAUA 5FLXL 1MSHA 1U4LA 1E2ZA 2PCFB 1BCPF 2RA4A 5C4JB 4R8NA 4NW2A 4ZUJA 5IODA 4XYOA 5CV5A 4ABNA 1CFMA 3C1FA 1SYDA 3I91A 4RHSA 1BCPB 1ET6A 1NR4A 4I65A 2EYPA 1IHZA 2EY5A 2EXZA 4K2LA 1I4HA 3RUZA 4BS9A 5CBAE 4A93B 1RF2D 4F87A 5IT9L 3OSOA 5FK9C 2L11A 1EZ6A 2ZXRA 4FXDA 2NWGA 2Z4IA 1D5ZC 2RBMA 5I6YA 1PTOH 1KABA 1BR9A 1TS4A 1WTXA 2O5IC 2HQEA 1JC7A 2F0QA 3OMGA 4Q5VA 1AFPA 1LV9A 4LK1C 3TSSA 5IT9E 4QIWB 2AWOA 4KKSA 1M4VA 3F2UA 5F2DA 1K8MA 2Q8TA 1EEFD 5KIXA 1FGBD 1D5XC 1DZ1A 4H7BA 1B44D 4XYQA 2E2JB 2FJ2A 3J7YW 1STNA 2WV6D 3PMFA 3TMEA 3KBXA 1STBA 4V190 2NB0A 3TDQA 2AQ2B 1S5DD 1X3QA 4HCSA 3Q0AA 2D62A 2KEDA 1STGA 1ZXTA 2K1BA 5A2QE 5M5WB 4HR7B 4HMJA 1R9TB 1XXGA 4IUPA 2M9VA 4KHVA 2K32A 2K33A 1U4PA 4L8JA 4K5WA 4JK1C 4LJZC 3BYYB 1DOMA 4IURA 1SFOB 1ZYRD 2K01A 2IX3A 4KY5A 1Q1BA 1M8AA 4ODGA 1LTGD 2IJ0A 1PLFA 3GP7A 5C3XA 3GTLB 3E6ZX 1T5XD 1MD2D 2YU9B 4J6HA 2PO4A 1FNVA 3V96A 3GTPB 3N52A 5IGFA 2JSOA 2R6GA 3QWNA 1K8OA 1B9NA 4KK7A 1TQOA 1Y8NB 1HHVA 4FF4A 5CBEE 4ZK9B 1GUSA 2ICEC 4G4KA 3D6CA 1B53A 3A54A 5JJZA 3OIQA 3MTSA 3PO3B 1J8IA 3M4OB 4N9TA 1QNUA 3OOCA 1DCZA 1BQQT 2NN6G 1IKLA 1I4RA 1V1OA 2B2YC 1S5CD 4KY6A 2M00A 5EPLA 1LTTD 3GV3A 1GUGA 1RCVD 5CV8A 3L9AX 4RAUC 4DK0A 2L9HA 5LHY1 5C3WA 5HGTA 2RSOA 1LLRD 1DD2A 1GUOA 2SNSA 2BA1A 1Q12A 2F0HA 4CBVA 1F9PA 1IL8A 1QB5D 2F0FA 3V05A 5KNCA 1AZPA 1FR3A 2ZT9C 4OGQC 1T5EA 1HFGA 1PFBA 1EY0A 2Q8RE 5G3LF 4ZUIA 3MHBA 4JBWA 1SE2A 4OL7A 1XYIA 3T16A 3P1HA 3AU7A 2HCIA 1JQYD 3EFXD 1SMYC 4DK1A 3EVQA 2RSNA 2I07B 3K5LA 1TWFB 3DEOA 3MC0B 2PW5A 5C0XH 3PUXA 2F4IA 1BDOA 2VB2X 3DHQA 4WRDA 3SE0A 4M1UB 5EKIA 5EBDA 4S3SA 1LABA 2LY7A 3SK4A 3LWEA 3T56B 4B9XA 2WP8J 4C3JG 1I50B 3M7GA 2RKSA 4OIKA 2OXPA 1EY9A 4OIJA 2CW0D 3MXUA 2YYZA 3H0GB 1KTKA 1Q8IA 2SOBA 5J22A 3D3RA 5ELFA 4U68A 3GTOB 1HUNA 2EYOA 4FXGC 1O78A 1GUTA 4X3KA 5JEAJ 1STYA 1AEXA 2E2IB 1B1ZA 4RGNA 1SYGA 3SDZA 3FPPA 4ZLTF 3LWUA 1L0XB 2EPBA 4DGZA 1JB3A 3M3YB 1MBYA 5A35A 1TWAB 2FMMA 2NVTB 3A56A 1BO0A 4B08A 4X3UA 1YNND 4DFAA 2F0VA 2F0SA 1KNEA 3N6RA 5C5MA 2B8FA 1D1KA 2KUMA 1LTSD 3OIPA 2H4OA 2Z1CA 2NN6H 1J9OA 3K57A 1L0YB 5CORA 2ID0A 3PUVA 2AUKA 1AP0A 4R8IA 5I2XA 5A2QL 1E2VA 4C3HB 2JEBI 2ZXOA 3VR5A 3MAQA 2A74C 1WVLA 1H9JA 1STHA 1TS2A 2XSCA 2B2TA 2XIWA 4FF3A 1ML0D 3I4NB 1NAPA 2RVLA 4DA2A 4ULLA 1GXDC 3CQZB 4IZ8A 2B2VA 4MN3A 5LL6X 4PV1C 3Q24A 1ONLA 4XDXA 5K5PA 3LX0A 2EY1A 1PRTB 3E5SA 1GOZA 1ICWA 1B50A 1VMPA 4KKUA 5DEHA 5C5LA 1MI2A 1YNJD 2NYZD 2QILA 1PTOD 3S2DB 2V4DA 3GD7A 2IX0A 2KJXA 2HUGA 5E3FA 5C0XG 2CQAA 3EQLC 1RKNA 2XWJB 2LKVA 1SYCA 2DN8A 1SNQA 4QUFA 2K05A 3FMCA 3MVVA 3GTQB 2X6GA 2H1EA 2BDNA 4QB4A 2WIIB 4ILWA 1CQFA 4WJWA 1TS3A 4L6TB 2BOSA 4RCNA 3A8KE 4IFDI 2JA5B 1HXYD 1D6EC 3J81L 1Y8PB 5IGBA 3C3LA 2NVXB 3CRLC 5ISRA 3I4LA 3K5OA 3KUPA 1HQRD 4C3IG 1STAA 3VR4A 1SSOA 3BDLA 1U4RA 1F77A 3NXWA 1XTCD 4UAIA 1KLGD 3CHBD 2F0NA 3MEHA 4DNRB 2A68C 2JP1A 4XT1B 4PQXA 1JCKB 3PIO3 1TKWB 4X3TA 1F2MA 5FO8B 3BDCA 2KECA 3M4YA 5T1IA 4BWGB 5BN3A 5C0XJ 1DXMA 3QJYA 1AW7A 3SXHA 3I4MB 3J80E 1Z47A 4IALA 3I70A 1F2LA 1SXTA 2DNCA 1W6JA 1ESRA 4RGMA 1TT2A 2K6AA 5FLXE 2NVYB 2EYHA 2EYLA 4KMUC 1H9SB 1Y8OB 2K03A 1TWHB 1QWYA 4GZYC 2WKDA 4A3FB 5I9OA 2KCNA 1EIGA 2NUCA 3S16B 5ELDA 3P20A 2CHBD 5EKLA 1LTID 1YNJC 1H9RA 3E0JA 3HRZC 4FYDA 2MUYA 1TS5A 3DWQA 2F0EA 3FEWX 4IN3A 3DXJC 5HURA 1BCPC 1HUMA 1PMRA 4QCLA 3BS1A 2FFKB 1K83B 4WORA 2SEBD 5J1ZA 2XRSD 2NZ1D 2R3ZA 4V0BA 3BYTB 2A69C 1FNUA 2XRQD 2RDGA 5I9PA 5ELCA 1JWUD 1R4PB 3SHLA 2WACA 2G9HD 2J7ZA 3VYUA 2A6HD 1HTLD 4O1NA 1EU4A 5J39A 2B2UA 4RHRA 4KN4C 2EYJA 4C56C 1F2YA 2B2UC 2VXWA 5M5XB 4G7ZC 2NTTA 3HOWB 3QOLA 3TP5A 1GJXA 2TSSA 1ZEQX 3S15B 1BCPD 2N55A 2B8GA 2PNRC 3ERQA 3PIP3 5DM73 3NUCA 2B63B 3WDNA 1S5FD 1KLUD 1XWEA 3I90A 3K0YA 3T53B 5CV7A 3NWSA 3AMUA 2WKCA 4G7HC 1ZYRC 1EU3A 3D6WA 1B2TA 3PUWA 4IFDJ 2J0TD 3ZYYX 1EY5A 5M5YB 1PDQA 1O7ZA 1G6ZA 4O42A 1EY6A 4BBRB 5KNDA 4Y7NB 1I4PA 1II3A 1IYUA 4HCEA 1ET9A 4PNYA 3TZDA 2D9UA 2AWNA 5FKAC 3VYRA 1OXTA 3OW7A 5D3IB 2RQXA 4HMIA 1MGSA 2EYFA 1JICA 1Y1VB 2WB1B 1CA5A 1QG7A 2BA0A 1Z6HA 2G9DA 4KJOA 4UDUC 4TRDA 5JVH3 1Y1WB 3M7NA 2A5HA 4Q0FA 1EWHA 4HEDA 1KDBA 2K5DA 1CQVA 2NVQB 2AQ3B 2F0LA 2B2TC 4IUQA 5C4XB 5D14A 1Q90A 3MFGA 2A73B 4RGTA 3HOXB 2KVMA 5KYLA 3S1QB 5C44B 1SMYD 1JE4A 1S5ED 2D2CC 1EFID 4A3DB 4M8AA 2EJMA 3BVMA 1SNMA 4J8QA 1RTOA 3R2TA 4ZKCB 2QCPX 1I4GA 1F2ZA 3CRKC 1SNPA 4A3JB 5M9OA 3C2PA 5I4DA 1SNDA 4FP5D 3KLSX 3VYTA 2MGSA 1RTNA 2PW7A 3FPUB 3TP6A 3KLSA 1WD1A 2EY6A 1SYEA 1JR0D 1I3QB 5JEAH 1GHKA 2EVBA 2IT1A 2C9OA 2RDFA 5E1FA 3A7LA 2Y0SB 3TZUA 3GO5A 1C8CA 2FHTA 2KHSA 2MP1A 1BUVT 3M85A 4C3JB 3S14B 4LMQD 2PZWA 3NPPA 4TQUS 3VA5A 5I2YA 3GTJB 3NE5B 4ME5A 3TN2A 1ENCA 1IW7C 1I4XA 4RCOA 1G2TA 2DY7A 1I6VC 1PXUA 2B2YA 1UEAB 1I4QA 3QOJA 1IKMA 1D1IA 2NTSA 3HEJA 2A68D 2F0OA 1SE3A 3NQTA 1PFNA 3NBIA 2B39A 5K36H 1JOOA 2PYKA 2F1MA 1OXSC 3RZOB 1BOSA 1CA6A 1WTQA 5M3FB 3IL8A 3A55A 2DNEA 3GQBA 3HOYB 2IPKD 5CR3A 3URYA 2WAQB 4H0LC 3MWYW 4K2KA 2TMPA 5G3LD 1S4ZA 4KJNA 3R3OA 3OWFA 4G57A 1SNCA 4BBSB 2JA8B 2R61A 2AQ1B 1U9RA 1SYBA 4XIGS 4DAVA 2QEJC 4OO1H 4IFDG 5FO9B 4C1NK 1B9MA 5IIFA 3NSWA 3RMHA 1WTRA 5E4XA 1RJTA 4XXEA 3S1RB 4IQZA 4Z9CB 5NUCA 3NHHA 1V43A 4B9WA 2CW0C 2KCCA 2GA4B 3NWTA 3L7ZC 1NR2A 1LACA 1V8QA 2QKIC 1FNWA 3P75A 4HSVA 1G291 5FO7B 1OXVA 1LT6D 1PRTF 4BA1I 3QG1A 4RA8A 4C3IB 2OT2A 2F0WA 2NN6I 2A6ED 2L4NA 1X32A 3I72A 1Z7TA 1RHPA 4KTAA 4ZAIA 1C4QA 1LT5D 1H9KA 2F0DA 4EQOA 2JXMB 3HP3A 4K5VA 2F03A 4A3KB 1ENAA 4CJ0B 3HGBA 2XNAC 3PV0A 5JVG3 4AYBB 1LTAD 3EA6A 1DONA 1UAPA 2JEAI 4FF1A 1VMCA 2MHVA 1U4MA 4OO1G 4KN7C 4J1MA 2K5WA 1RD9D 3MXGA 2MJ8A 4NP5A 3D4RA 3MFYA 2XVSA 2O4XA 1TWGB 4DF7A 3OWEB 4WFN3 4IUNA 2HDMA 2F0GA 1DOLA 1SEBD 4EGVA 2LMCB 1GHJA 3RD4A 1A15A 2K04A 4XQNA 1A2UA 4PMBA 3TP8A 5D3DA 1DM0B 4KY7A 1D2BA 1EYAA 2E2DC 1RDPD 4P2CB 4DAYA 1LT3D 2EOTA 2F0PA 1EL0A 4QF4A 2K7VA 1LTRD 4H44C 1STEA 1EQTA 3K5NA 2QF7A 5IGEA 2Z8LA 2B2VC 2VNUD 2EDGA 4KD4A 5KNBA 4KI0A 4CHTB 4PMCA 5TSSA 4IUUA 2WINB 4EQPA 4DN4M 3HZXA 4N9PA 2A6EC 3T4AC 4A3GB 2F0TA 1CHPD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D3R A;  3VYR A;  2Z1C A;  3VYU A;  2OT2 A;  3VYS A;  3VYT A; 
#chains in the Genus database with same CATH topology
 4OXP A;  1WTH A;  4DUZ L;  4POG A;  3ND8 A;  4DV0 Q;  4GKJ L;  2R93 B;  1KC8 C;  1P16 A;  1ROD A;  2PMZ B;  1KNA A;  1UE6 A;  2EZV A;  4ZRZ A;  3GTL H;  4U67 3;  5CV6 A;  1O80 A;  3BVZ A;  1X3F A;  3OHX C;  1SYF A;  1SRO A;  3J80 i;  2N8N A;  3S17 B;  3H91 A;  3D4D A;  4XQQ A;  2K52 A;  1TY0 A;  1VQH A;  4JBM A;  2BE5 D;  4HJ8 A;  1TU2 B;  4MIU A;  2CH4 W;  4NDX A;  3CAM A;  5BN5 A;  3SK6 A;  2ENB A;  3U50 C;  2D5D A;  1K83 H;  1SAP A;  3ONA B;  4B3M Q;  1K8G A;  2X69 A;  1IW7 D;  1I3Q H;  2LXJ A;  3IKJ A;  5KEE A;  1FL0 A;  3PUY A;  3T13 A;  3GTK B;  3R93 A;  4CKB A;  3RZD B;  3K8A A;  4P71 A;  1ENF A;  1CTM A;  2CWP A;  4A3I H;  1AN8 A;  1EWC A;  5JOB A;  5BN4 A;  3M4O H;  2IY5 B;  4DU9 A;  5C4Z A;  4X64 L;  1DYQ A;  3R2I A;  2A69 D;  3SK5 A;  3HKZ E;  3B6Y A;  2JA6 G;  4HJ5 A;  4JI4 L;  3PO2 B;  4L63 B;  3X3M A;  4JI6 Q;  2OQK A;  4E6I A;  2IL8 A;  4HSP A;  3ERO A;  4C1N I;  2PPB C;  4HJA A;  1YNN C;  2D0P A;  2EE1 A;  4PG3 A;  3HOY H;  1G2S A;  1GUW A;  3A8I E;  3NTK A;  2CFM A;  3HG9 A;  3HKZ B;  4K8J A;  1FGU A;  2OF1 A;  2CH4 A;  3KJO A;  1XPR A;  3RZD H;  1NSN S;  4DAM A;  1TY2 A;  4A3E B;  1S5B D;  5LMU Q;  4DNI A;  2JA8 G;  1IBL L;  2L12 A;  3J80 c;  3VR3 A;  3UI2 A;  4B3S Q;  3MXP A;  2L5T A;  1FVI A;  1TR5 A;  3FKI B;  1VF7 A;  1F9S A;  3SVM A;  4B3S L;  1H9S A;  1TII D;  4QMG A;  4TSS A;  2R7F A;  3U9S A;  4AQY L;  1HA6 A;  1V1P A;  4DV3 L;  3F2B A;  4JI5 L;  4F8M A;  4MHE A;  2FMC A;  1R4Q B;  4RKB A;  2X6L A;  1HRJ A;  1YBY A;  4JCV E;  3IFT A;  1EQV A;  3M3Y H;  3L0O A;  2SNM A;  1GUN A;  2JYO A;  1FJG L;  2E75 C;  1QIL A;  3I3C A;  4K0K Q;  1TWF H;  4CKE A;  1HZ9 A;  2SDF A;  4OHJ A;  4LF9 Q;  2PMZ E;  4R1J A;  3BG3 A;  5IGC A;  4TKO B;  1X3G A;  2VY3 A;  4JV5 L;  1HA5 A;  1WTV A;  1VQA A;  1TVX A;  1JOR A;  3M4Q A;  4RKL A;  4UHV A;  1HQM C;  3AYH B;  2PQA B;  3SGI A;  1IYJ B;  1QCB D;  4XTC S;  4WJ3 M;  1BXT A;  1Q81 C;  4FF2 A;  5D65 A;  3S1Q H;  4YY3 Q;  1VQ4 A;  1N32 Q;  1L2F A;  4OX9 L;  2ZTE A;  4XT3 B;  1UUP A;  3U9O A;  2BCO A;  4R4I A;  1I6H H;  4A3E H;  4LAA A;  4FO2 A;  2KOL A;  4B3M L;  1CSP A;  1EYD A;  3SR1 A;  5IGG A;  1SFO H;  2O2L D;  3VR2 A;  1JWM D;  2VZA A;  3NTI A;  5DM6 3;  1N33 L;  4EX5 A;  4RWS C;  1A6X A;  2FIN B;  1A3U A;  3WOF A;  3G7L A;  1JE5 A;  2EJG C;  2KCM A;  4JI1 L;  1YNX A;  3ICE A;  1VDZ A;  4IUT A;  5KRU A;  3KF6 A;  2F3V A;  4JBK A;  2F0K A;  4K5X A;  3S9W A;  3OTO L;  1SNO A;  1EEI D;  4ID6 A;  5CMD A;  5IGD A;  2ES2 A;  3I2Z A;  4CJ2 C;  1HCZ A;  1C48 A;  4EQN A;  2N78 A;  1K3B C;  1EFW A;  4ZKB B;  2WAQ G;  1LO5 D;  4CDE C;  5JPN C;  3OTO Q;  1X3P A;  2ASB A;  4BY7 B;  1SBB B;  2NBF A;  1QNK A;  2K28 A;  4A3F G;  2L1B A;  1GO3 E;  1MHW C;  4QUC A;  1SR3 A;  2N88 A;  4FVM A;  4IOA A;  5CGK A;  3DLL A;  3FKI G;  5IYD H;  3V2T A;  2LS0 1;  1KRT A;  4NPS A;  3E9I A;  3NP8 A;  2XWB B;  4A3M H;  2E74 C;  3BZD B;  3A7A B;  4IOC A;  1PZK D;  5E4W C;  3HOU B;  1EY7 A;  1CM9 A;  3G6J B;  4KHZ A;  2ZXP A;  1JOQ A;  3ITP A;  1WTO A;  3U4Z A;  1XJV A;  5M3M H;  2E76 C;  2Y0S G;  1HPC A;  3TBI B;  4BXX G;  4JVZ A;  4H13 C;  3I4M G;  3H09 A;  3O13 A;  2EYM A;  2HCC A;  2WB1 E;  2ZJR A;  3W2D A;  2IX1 A;  4OON A;  3BVG A;  4DV4 L;  2OWO A;  3CCU A;  1T9H A;  1IL2 A;  4G7O C;  4LF5 Q;  2PQE A;  1KDC A;  1CK1 A;  2E2H B;  4UPA A;  5LMN L;  5CV4 A;  1EYC A;  1MIU A;  1I5F A;  4DXF A;  4DV2 Q;  1A3V A;  2BE5 C;  1FJG Q;  2MPM A;  2A6H C;  3K6O A;  1QZG A;  1WTW A;  1G91 A;  3X3N A;  4I7Z C;  3RLF A;  4C3H G;  5EPK A;  4R9W A;  4JYA Q;  2RHQ B;  4R4C A;  5M3M B;  3C46 A;  2K75 A;  4BA2 I;  5EJW A;  3KF8 A;  4JC0 A;  5CYU A;  2HHH Q;  2UXD Q;  1KDA A;  5ELE A;  1EZ8 A;  5KGU A;  3AB9 A;  4K6D A;  3DWA A;  2F0J A;  1W6K A;  2RDH A;  3FVQ A;  3K7A H;  3J7A F;  1WCM H;  3CME A;  4HAE A;  4C3J H;  2J4X A;  3QB3 A;  4DAP A;  3FRP B;  3KBG A;  1EY8 A;  3HS0 C;  2JA5 G;  2VQE Q;  3H6M A;  1NCV A;  4IUV A;  3OYY A;  1PH9 A;  4ZQ3 A;  3W1G A;  3OMC A;  1G8Z D;  3TS0 A;  1D5M C;  1UEB A;  3T1Y Q;  3K58 A;  3E3X A;  1TWC B;  2Z0S A;  3IAY A;  1A2T A;  5EPJ A;  4OX9 Q;  2L55 A;  2R93 G;  2QGQ A;  4HTH A;  1Y69 U;  3KFU A;  1VQE A;  1VQ7 A;  2ZJQ A;  1K8A C;  4N8X 1;  1NMG A;  4A93 G;  1SE4 A;  3M4P A;  1E0B A;  3KK7 A;  3HOV G;  3W3A A;  1WJJ A;  2BDO A;  4IPG A;  1EIF A;  2UUC Q;  1XNQ Q;  3HOV B;  1WCM B;  1Z9F A;  3JAM i;  3I56 A;  4KKT A;  5IOC A;  4ME3 A;  5GAH C;  1VQM A;  4A3B B;  3NEM A;  4C2M B;  1IYV A;  2ICI A;  1XX8 A;  3DMU A;  1PTO C;  3FP9 A;  4YHH Q;  1VQ5 A;  4KHP L;  3VA7 A;  1BNZ A;  4A3G H;  4GKK L;  1F9Q A;  4JI0 Q;  1ESF A;  1PZI D;  5J3B A;  1FD7 D;  5ELB A;  3EIV A;  3DWP A;  2K5Q A;  1X6O A;  1FYC A;  5EAY A;  4A3M B;  5C0X I;  1A3T A;  2QDB A;  4BBR H;  1NUC A;  2F4V Q;  3GTM B;  5K36 G;  4GNX B;  1KAA A;  3H0G G;  3OW2 A;  4NXM L;  4XQJ A;  1AZQ A;  4GLX A;  2VB3 X;  1VQO A;  3STB D;  3E9H A;  2EY2 A;  3Q22 A;  3Q6S A;  2O5J C;  3JAM E;  1KHI A;  5DNF A;  3K59 A;  3CCE A;  1O7L A;  3J80 L;  1VF5 C;  5H1S E;  4QQB X;  3CKI B;  5C6A A;  1SJE D;  1PH7 A;  2IWH A;  3EJI A;  4PMW A;  1CZW A;  1XNR L;  2EQS A;  1HTP A;  1PTO F;  4F88 A;  5LMU L;  2F0I A;  5LL6 S;  1QVG A;  1EY4 A;  2HDL A;  4YIJ A;  5FLM H;  1XMQ L;  3ULJ A;  5JEA G;  3H3V I;  2CVR A;  3PIP A;  3FDT A;  4DV6 Q;  1MKH A;  4X66 L;  3KLR A;  1ILP A;  3MXN A;  1V1Q A;  4K14 A;  2KEE A;  1WTP A;  1JT8 A;  4HN7 A;  1B8A A;  3H3V H;  2I46 A;  4IFD H;  2HIV A;  3JAM L;  2UXC L;  5JJI A;  3MA2 B;  3I4M H;  3GV6 A;  1CI3 M;  2EJF C;  3FKI H;  4B3T Q;  2CKZ B;  4KD3 A;  5C3E B;  1ZKO A;  3BDO A;  1LTB D;  5DLQ E;  1DOK A;  1HR0 L;  2R7Z H;  1ILQ A;  4F7X A;  4ZYS A;  4BY7 G;  1I6H B;  2C5C A;  3MXN B;  4DV5 L;  1VCI A;  4DNT B;  3IFD A;  5I6W A;  3K7A B;  1JOK A;  4K6L A;  4RH6 A;  3S2H B;  1BKB A;  4EVO A;  1H95 A;  1CZG A;  2F3W A;  3NK9 A;  3I8Z A;  4CKC A;  2KQ3 A;  3ND9 A;  3SEB A;  1JWS D;  1HZB A;  3WOE A;  4DR5 Q;  1EOT A;  4OO1 I;  4GN3 B;  3TP7 A;  1OO9 B;  2IHF A;  1Q3L A;  5COY A;  3L3O C;  3VR6 A;  5CC4 A;  2DY8 A;  3C1E A;  3DEP A;  4K8I A;  1I94 Q;  1LT4 D;  5FOB B;  1E2W A;  4DR3 L;  2R7Z B;  1SMX A;  2Z4H A;  2KHI A;  1BBX C;  2F0U A;  3VYS A;  2NVQ H;  1G6P A;  3GTG B;  3QIA A;  1OTC A;  3D4W A;  5EGT A;  1YJN A;  2R92 B;  4B3R Q;  1L0W A;  2PZT A;  2D0O A;  1N34 Q;  3J7A V;  2K14 A;  1OXU A;  5AJ3 L;  3I73 A;  2XTI A;  1Q1E A;  3PUZ A;  3PO3 H;  5AFW A;  2PZU A;  4X3S A;  1A62 A;  2JA7 B;  1H9M A;  4BBS G;  2B2W C;  3T1H L;  3D31 A;  4RFB A;  3NQI A;  3S1N B;  2KA7 A;  2L0C A;  4DXG A;  2JE6 I;  3S2D H;  1Q46 A;  4A3K H;  3T51 B;  3A8J E;  2GVB A;  3H94 A;  4A3C G;  1PFM A;  4JI7 L;  3CU7 A;  3G71 A;  1PH5 A;  3HOZ H;  5M3F H;  2PNH A;  4CGY B;  3CP0 A;  1B4O A;  1OXX K;  4CJ1 B;  2YV5 A;  2ATW A;  5KYI A;  3I4N H;  5EKK A;  3H3V C;  4JI8 Q;  2F0M A;  2QA4 A;  4BY7 H;  3J7A 5;  2IW3 A;  1YIJ A;  1PRT C;  1HFN A;  1V1P B;  1N9W A;  3HOW H;  2AUJ D;  2XN9 C;  4A3I B;  1PRT D;  1O7Y A;  3QO2 A;  1PHJ A;  1K9M C;  1PZJ D;  4DUY Q;  5M5X H;  3J81 E;  3SK8 A;  3Q23 A;  1QE6 A;  1YI2 A;  3K5M A;  2ZTC A;  1EOV A;  4RGO S;  3HOU H;  3DM1 A;  2UUB Q;  5EBC A;  1SDF A;  3NBH A;  4I7A A;  5CV9 A;  3GTG H;  3NTH A;  3S17 H;  5C4H A;  2Q8I B;  2VUM B;  3P7J A;  5JPM C;  1QJO A;  1UE1 A;  1M90 C;  3EBE A;  3MZ5 A;  1J5E Q;  1F9R A;  2R92 H;  3DUZ A;  1MSG A;  1CHQ D;  1NY4 A;  4A3D G;  1EWI A;  1WD0 A;  3I7F A;  1B3A A;  1X9N A;  1DJR D;  1EIH A;  4FNF A;  2JA6 B;  3NBH B;  2IHE A;  5T1G A;  3R8B A;  1PYW D;  1SJH D;  4O2D A;  1PTO B;  3GTK H;  4DR1 L;  4LFB Q;  4FXK C;  4KV6 A;  2MQH A;  3LNN A;  4NKL A;  4JOI A;  5EQ0 A;  3S1M B;  2OEO A;  4JI7 Q;  3D8G A;  3HOZ B;  4QL5 A;  4NMZ A;  1R9T H;  2M2L A;  1QOH A;  3PO2 G;  1BF4 A;  4BY1 B;  1UNS A;  3KDF B;  3TQY A;  4DR7 L;  1HZC A;  2B2W A;  2LFN A;  1C7Y A;  5JAV A;  4QJF A;  3RNU A;  1CT1 D;  3OPO A;  5DAU A;  5FLX L;  2ALY B;  1A0I A;  1MSH A;  1U4L A;  1E2Z A;  2PCF B;  1JMC A;  4LUZ A;  4CDD C;  1BCP F;  1IZ6 A;  2RA4 A;  5C4J B;  4R8N A;  2OTL A;  4NW2 A;  4ZUJ A;  1HR0 W;  5IOD A;  1N34 L;  1XMQ Q;  4XYO A;  5CV5 A;  3CCV A;  4ABN A;  1CFM A;  1UE5 A;  3C1F A;  1SYD A;  4DV7 L;  3I91 A;  4X65 L;  4RHS A;  1BCP B;  1ET6 A;  1NR4 A;  1C0A A;  4I65 A;  2EYP A;  1PH2 A;  1VQ9 A;  1IHZ A;  2EY5 A;  2EXZ A;  2K5N A;  4K2L A;  4JBJ A;  1I4H A;  3HKZ G;  3RUZ A;  4BS9 A;  5CBA E;  4A93 B;  1RF2 D;  2E2I H;  4F87 A;  3K7U C;  5IT9 L;  3OSO A;  5FK9 C;  2L11 A;  4IJH A;  2EIF A;  1EZ6 A;  2ZXR A;  4FXD A;  2NWG A;  2Z4I A;  1N8R C;  1D5Z C;  3CCL A;  5C3E G;  2RBM A;  2AMC B;  3A74 A;  5I6Y A;  3ZJY C;  1PTO H;  4A3D H;  1KAB A;  1BR9 A;  1TS4 A;  1WTX A;  2O5I C;  2HQE A;  1JC7 A;  2F0Q A;  3OMG A;  4Q5V A;  5GAE C;  1AFP A;  3U4V A;  2F52 A;  4AH6 A;  1LV9 A;  3PCO B;  2B63 G;  4LK1 C;  3TSS A;  5IT9 E;  4QIW B;  2AWO A;  4LFC L;  2UUC L;  1KD1 C;  3I4N G;  4KKS A;  1WI5 A;  1X55 A;  1M4V A;  3F2U A;  5F2D A;  1K8M A;  2Q8T A;  1EEF D;  2QDL A;  5KIX A;  2UXC Q;  3CMA A;  1FGB D;  1D5X C;  1DZ1 A;  4H7B A;  1B44 D;  1Y1V G;  2WB1 G;  2MO1 A;  4XYQ A;  3H15 A;  2E2J B;  2FJ2 A;  3J7Y W;  2CCZ A;  2KEN A;  1STN A;  5C4J H;  2WV6 D;  2RCF A;  3PMF A;  2B3G A;  3TME A;  3KBX A;  3RN2 A;  1STB A;  4V19 0;  3RN5 A;  2NB0 A;  3TDQ A;  4BY1 G;  2AQ2 B;  1XNR Q;  5IY0 A;  2C35 B;  1S5D D;  2KBN A;  4IPH A;  3CCS A;  1X3Q A;  4HCS A;  3Q0A A;  2D62 A;  2KED A;  2VQF Q;  1STG A;  1ZXT A;  3J81 c;  2K1B A;  2NVT H;  5A2Q E;  5M5W B;  4HR7 B;  1PH6 A;  4HMJ A;  1R9T B;  1XXG A;  3UDF A;  1SN8 A;  4IUP A;  2YU9 H;  2HHH L;  2M9V A;  4KHV A;  2K32 A;  5IP7 H;  2K33 A;  1HNW Q;  4L8J A;  1U4P A;  1PYS B;  4LF7 Q;  1B7Y B;  4DK6 C;  4X65 Q;  4K5W A;  4JK1 C;  4DV1 Q;  2BH2 A;  4LJZ C;  1Y14 B;  3BYY B;  1DOM A;  2I0Q A;  4KHP Q;  4IUR A;  3MEF A;  1SFO B;  1ZYR D;  2K01 A;  3K0X A;  1E24 A;  2IX3 A;  4KY5 A;  1Q1B A;  1M8A A;  1VQI A;  2DGY A;  4ODG A;  1LTG D;  2IJ0 A;  3A5U A;  1PLF A;  4IPD A;  3GP7 A;  5C3X A;  3GTL B;  3E6Z X;  1XNQ L;  1QVC A;  1T5X D;  1MD2 D;  4JI8 L;  2YU9 B;  4J6H A;  2PO4 A;  1FNV A;  3CCJ A;  3V96 A;  2ZJP A;  3GTP B;  3N52 A;  5IGF A;  2JSO A;  3JC6 6;  2R6G A;  1HZA A;  3QWN A;  2B63 H;  4DR4 L;  1K8O A;  1B9N A;  4KK7 A;  1D8L A;  1TQO A;  1Y8N B;  3CPW A;  2MFI A;  1KQS A;  1YHA A;  4FF4 A;  1HHV A;  3PQI A;  5CBE E;  4GLV B;  4ZK9 B;  1GUS A;  4DR1 Q;  1Y1V H;  2ICE C;  4G4K A;  4L5T A;  3T1H Q;  3D6C A;  1B53 A;  3A54 A;  1L1O C;  4PZ6 A;  1P8L A;  5JJZ A;  2EXD A;  1VQP A;  3OIQ A;  3MTS A;  3PO3 B;  3UE0 A;  1J8I A;  3ER0 A;  5IYC H;  3M4O B;  4N9T A;  1ASY A;  1PH1 A;  3AQQ A;  1QNU A;  3OOC A;  5M5W H;  4A75 A;  4A76 A;  3F8T A;  1DCZ A;  3CC7 A;  1BQQ T;  1NMF A;  2NN6 G;  4QGU A;  1IKL A;  1I4R A;  2BH8 A;  1V1O A;  2B2Y C;  3K80 C;  1S5C D;  4KY6 A;  4APV A;  2M00 A;  5EPL A;  1KXL A;  1LTT D;  5C4X H;  3GV3 A;  1SLJ A;  1GUG A;  1RCV D;  5CV8 A;  3EN2 A;  3L9A X;  4CDC C;  5C3E H;  1N36 Q;  4RAU C;  4DK0 A;  2R7D A;  2L9H A;  5C44 H;  5IP7 G;  5LHY 1;  5C3W A;  3A5Z B;  5HGT A;  2AKW B;  2RSO A;  1JJ2 A;  3HOX H;  1LLR D;  4LF5 L;  1DD2 A;  1GUO A;  4DR5 L;  2SNS A;  2BA1 A;  2UXB Q;  4GLA C;  5IE8 A;  1TWA H;  4DV4 Q;  2HT1 A;  1Q12 A;  5IP9 G;  2F0H A;  4CBV A;  1VQ8 A;  4A3K G;  1F9P A;  1IL8 A;  1N32 L;  1QB5 D;  4BXX H;  2F0F A;  3V05 A;  3J81 j;  5KNC A;  1AZP A;  2VUM G;  1TXY A;  1FR3 A;  2ZT9 C;  4OGQ C;  1T5E A;  5IYD G;  2NZH A;  3CC2 A;  1D7Q A;  1HFG A;  1PFB A;  2JQO A;  1EY0 A;  2Q8R E;  5G3L F;  4ZUI A;  5IYB H;  1PH3 A;  3MHB A;  4JBW A;  1SE2 A;  4GN4 B;  3PIO A;  4OL7 A;  2Q2H A;  1XYI A;  2E8G A;  3T16 A;  3P1H A;  3AU7 A;  2HCI A;  3NEL A;  1JQY D;  3EFX D;  1SMY C;  4DK1 A;  1AE3 A;  2RSN A;  3EVQ A;  4A3E G;  3HOW G;  4HIO A;  4P72 A;  2I07 B;  4K0K L;  3K5L A;  1TWF B;  4C3H H;  3DEO A;  3MC0 B;  2PW5 A;  5C0X H;  4X66 Q;  5E7N A;  4DV6 L;  3PUX A;  2F4I A;  4HIM A;  4LF6 L;  4LWC A;  1BDO A;  2VB2 X;  3DHQ A;  4DV3 Q;  4WRD A;  3SE0 A;  4DK3 C;  2XGT A;  4AQY Q;  1XMO L;  4M1U B;  5EKI A;  4JW0 A;  5EBD A;  4DR3 Q;  2WAQ E;  4WJ4 A;  2QW7 A;  4S3S A;  3GTJ H;  1LAB A;  2LY7 A;  4UP7 A;  5HY6 A;  2Y0S E;  4HIK A;  3SK4 A;  1EQQ A;  1WFQ A;  4JI1 Q;  3LWE A;  3T56 B;  4B9X A;  4X62 L;  2WP8 J;  4C3J G;  2ZTD A;  4JI2 L;  1I50 B;  3M7G A;  4C3I H;  2RKS A;  1C9O A;  4OIK A;  2JA5 H;  2OXP A;  1EY9 A;  4OIJ A;  2CW0 D;  4JI0 L;  4LNQ A;  2K50 A;  4GKK Q;  3MXU A;  2YYZ A;  3H0G B;  4YY3 L;  3LGJ A;  4YHH L;  3PGZ A;  1KTK A;  1Q8I A;  4QY7 A;  2SOB A;  5J22 A;  3D3R A;  3CCQ A;  5ELF A;  4U68 A;  4YCV A;  3GTO B;  5JJL A;  2EYO A;  1HUN A;  3UE1 A;  3TEH B;  4FXG C;  1O78 A;  2H5X A;  1GUT A;  1HJP A;  4X3K A;  4X64 Q;  1KRS A;  4P74 A;  4GNX C;  5JEA J;  4JV5 Q;  1STY A;  3HKS A;  1AEX A;  2E2I B;  1B1Z A;  3BU2 A;  4RGN A;  1SYG A;  3SDZ A;  3FPP A;  3E0E A;  1VQC A;  2K5H A;  4ZLT F;  2JA7 H;  3LWU A;  2DUD A;  2Q2U A;  1L0X B;  1GD7 A;  2EPB A;  4DGZ A;  1JB3 A;  3M3Y B;  1MBY A;  5A35 A;  1TWA B;  4JI2 Q;  1XTD A;  2FMM A;  2NVT B;  2VQE L;  3A56 A;  1BO0 A;  4LUV A;  4DR2 L;  1SE8 A;  4B08 A;  3I55 A;  4X3U A;  4KLK A;  1YNN D;  2L15 A;  2P5Z X;  4DFA A;  2F0V A;  2F0S A;  4A3L H;  1KNE A;  4OWW B;  3N6R A;  5C5M A;  5GRO A;  2B8F A;  1D1K A;  2KUM A;  5ELN A;  1LTS D;  3OIP A;  3HOX G;  2H4O A;  4L5S A;  3M9B A;  2Z1C A;  2NN6 H;  1J9O A;  4MTN A;  3K57 A;  1L0Y B;  1VQG A;  4LF8 L;  5COR A;  2ID0 A;  3PUV A;  4P73 A;  1GKH A;  2E5L L;  2N49 A;  2AUK A;  1AP0 A;  4HID A;  4R8I A;  1E7Z A;  5I2X A;  5A2Q L;  1E2V A;  4C3H B;  2JEB I;  2R93 H;  2ZXO A;  1VQJ A;  3VR5 A;  3MAQ A;  4JI6 L;  2A74 C;  1EYG A;  4UY8 C;  1WVL A;  1H9J A;  1HH2 P;  3HOV H;  1STH A;  1TS2 A;  2XSC A;  2B2T A;  2XIW A;  4FF3 A;  1ML0 D;  3I4N B;  1NAP A;  2RVL A;  4DA2 A;  4ULL A;  1PH4 A;  2G5D A;  1WOC A;  1GXD C;  3CQZ B;  4IZ8 A;  2B2V A;  1KL9 A;  3CXC A;  4MN3 A;  4CDF C;  2K4K A;  3BZC A;  5LL6 X;  3TRZ A;  4PV1 C;  3Q24 A;  1ONL A;  3T1Y L;  3KJP A;  4XDX A;  3GTQ H;  5K5P A;  1YEZ A;  2K5V A;  3LX0 A;  2EY1 A;  1PRT B;  2UXB L;  3E5S A;  1GOZ A;  1ICW A;  1B50 A;  1B70 B;  1VMP A;  4KKU A;  2ZM6 L;  2NZO A;  5DEH A;  5C5L A;  4BBR G;  4A3B G;  4YWM A;  4L5R C;  1MI2 A;  1YNJ D;  2NYZ D;  2QIL A;  1PTO D;  3S2D B;  2V4D A;  3GD7 A;  2IX0 A;  1Y1W H;  2KJX A;  1IXR A;  2HUG A;  4PZ7 A;  4OWT B;  3HFZ B;  4N8F A;  5E3F A;  2HIX A;  5C0X G;  1XMO Q;  2CQA A;  3EQL C;  1LUZ A;  2UXD L;  1RKN A;  2XWJ B;  2LKV A;  1LTL A;  1SYC A;  2DN8 A;  1G51 A;  1SNQ A;  1VS0 A;  4QUF A;  4JPB W;  2K05 A;  3FMC A;  3MVV A;  3CCM A;  4DUZ Q;  2JJQ A;  4LF6 Q;  3GTQ B;  1ICF B;  1VQF A;  2X6G A;  2WFW A;  2CQO A;  2H1E A;  3CCR A;  4NXN L;  4DV2 L;  2BDN A;  4RMF A;  4QB4 A;  2ZM6 Q;  2WII B;  4ILW A;  1CQF A;  1TWH H;  1TS3 A;  3QR8 A;  4WJW A;  4L6T B;  1YIT A;  3KOJ A;  2AHO B;  2BOS A;  4RCN A;  3A8K E;  4IFD I;  2JA5 B;  1HXY D;  1D6E C;  3J81 L;  1Y8P B;  5IGB A;  3C3L A;  3Q8D A;  3CRL C;  5ISR A;  2NVX B;  3I4L A;  3K5O A;  3KUP A;  1PA6 A;  1HQR D;  4C3I G;  1STA A;  3VR4 A;  1SSO A;  1VQB A;  3BDL A;  1IBK Q;  1U4R A;  1F77 A;  4A3C H;  3NXW A;  1XTC D;  4UAI A;  1KLG D;  3CD6 A;  4HJ7 A;  3S16 H;  3CHB D;  1GVP A;  1PYB A;  2F0N A;  2GN5 A;  3MEH A;  2VW9 A;  4DNR B;  2A68 C;  2JP1 A;  4XT1 B;  4PQX A;  1JCK B;  3PIO 3;  4YWL A;  3S2H H;  1TKW B;  1EIY B;  4X3T A;  5IYC G;  1F2M A;  1GM5 A;  5FO8 B;  3BDC A;  2NVX H;  2KEC A;  3M4Y A;  1VQ6 A;  2Z6K A;  5T1I A;  3BJU A;  4BWG B;  5BN3 A;  2E5L Q;  5C0X J;  3U58 A;  2JA8 H;  1DXM A;  4DV1 L;  3UDG A;  3QJY A;  5FLX c;  1AW7 A;  3SXH A;  3I4M B;  2VS1 A;  1HNW L;  2JA7 G;  5FJ8 G;  4MNO A;  1Z47 A;  3J80 E;  4IAL A;  4X6A H;  2RF4 A;  2I5M X;  3I70 A;  4JI5 Q;  1F2L A;  1SXT A;  2DNC A;  1W6J A;  1ESR A;  4RGM A;  1W2B A;  1TT2 A;  1PFS A;  2K6A A;  5FLX E;  2NVY B;  4DPG A;  3HOU G;  3RR5 A;  1A8V A;  2EYH A;  2EYL A;  2R92 G;  1KIX A;  3CC4 A;  1PH8 A;  4KMU C;  1H9S B;  1Y8O B;  2K03 A;  1TWH B;  1IBL Q;  1N33 Q;  2OCE A;  1QWY A;  2A1A A;  2LXK A;  5IWA Q;  4R4T A;  3TRE A;  4GZY C;  2WKD A;  4A3F B;  5I9O A;  2KCN A;  1EIG A;  5GAD C;  2NUC A;  3S16 B;  4DR4 Q;  3HOY G;  5ELD A;  3P20 A;  2CHB D;  4YCU A;  3S15 H;  1AE2 A;  5EKL A;  1LTI D;  1YNJ C;  4LW1 A;  4JI4 Q;  3GDE A;  2HQL A;  2I5L X;  3G4S A;  1H9R A;  3E0J A;  3HRZ C;  4FYD A;  2MUY A;  1TS5 A;  3DM3 A;  3DWQ A;  2F0E A;  3FEW X;  4IN3 A;  3CF5 A;  3DXJ C;  4TVA B;  1BCP C;  5HUR A;  4LFA L;  1HUM A;  1PMR A;  4QCL A;  3BS1 A;  2FFK B;  4LF9 L;  3AFP A;  1SRU A;  4LF4 Q;  1K83 B;  4WOR A;  4IJL A;  2SEB D;  3S24 A;  5J1Z A;  4OEM B;  1BBU A;  5M5Y H;  2XRS D;  2NZ1 D;  2PI2 E;  3JAM c;  1JJG A;  4X62 Q;  3STB C;  2R3Z A;  4V0B A;  1ASZ A;  3BYT B;  2A69 C;  4Y7N H;  1FNU A;  2XRQ D;  2YTY A;  2RDG A;  5FJ8 H;  5I9P A;  5ELC A;  1JWU D;  1R4P B;  3SHL A;  2WAC A;  4A3B H;  2G9H D;  1K0R A;  2J7Z A;  3VYU A;  2A6H D;  1E3P A;  1HTL D;  4DV7 Q;  4O1N A;  4DR2 Q;  1EU4 A;  2B2U A;  5J39 A;  1CKO A;  4JG2 A;  4RHR A;  4KN4 C;  2EYJ A;  4C56 C;  1F2Y A;  4JOI C;  2B2U C;  4DV0 L;  2CWA A;  2VXW A;  5M5X B;  4G7Z C;  2NTT A;  1X3E A;  3HOW B;  3QOL A;  3TP5 A;  1UE7 A;  1GJX A;  3PF5 A;  3KDF A;  2TSS A;  1ZEQ X;  1VQD A;  3S15 B;  2UU9 Q;  4DKA C;  1E1T A;  1LYL A;  1Q8K A;  3GTO H;  1BCP D;  2N55 A;  2B8G A;  3S14 H;  2PNR C;  3ERQ A;  1J6Q A;  4GOP C;  3PIP 3;  5DM7 3;  3F2D A;  3ULP A;  3NUC A;  2B63 B;  3NEN A;  1S72 A;  3WDN A;  1JB7 A;  1S5F D;  1KLU D;  1XWE A;  3I90 A;  3K0Y A;  3RLN A;  3T53 B;  5CV7 A;  3NWS A;  3AMU A;  2WKC A;  4G7H C;  1ZYR C;  1EU3 A;  5ELO A;  1TWG H;  3D6W A;  1B2T A;  3PUW A;  4IFD J;  2J0T D;  1YHQ A;  4MTK A;  3ZYY X;  4HJ9 A;  1EY5 A;  5M5Y B;  3GTM H;  1TWC H;  1PDQ A;  1O7Z A;  1G6Z A;  4O42 A;  1EY6 A;  1AH9 A;  4BBR B;  5KND A;  4Y7N B;  1I4P A;  1II3 A;  1U0L A;  1IYU A;  4HCE A;  1YVC A;  1ET9 A;  4A3F H;  4PNY A;  3TZD A;  2D9U A;  3F2C A;  2AWN A;  4BY1 H;  1IBM L;  5FKA C;  3PSI A;  3VYR A;  1OXT A;  3OW7 A;  5D3I B;  2RQX A;  2DJF C;  4HMI A;  1MGS A;  4NB3 A;  4A4I A;  2UUB L;  1BVS A;  2EYF A;  3AFQ A;  4A3M G;  1JIC A;  1MJC A;  1Y1V B;  2WB1 B;  4GKJ Q;  1NBW A;  1RL2 A;  1CA5 A;  2NVY H;  1QG7 A;  2BA0 A;  2RHS B;  3KF8 B;  2A19 A;  1Z6H A;  2G9D A;  1CKN B;  4KJO A;  4UDU C;  5GAG C;  3TS2 A;  1L1O A;  4TRD A;  5JVH 3;  5M3M G;  1Y1W B;  3FHW A;  1HNZ L;  3M7N A;  2A5H A;  4Q0F A;  1EWH A;  3A0J A;  4HED A;  4O0A A;  5BR8 Q;  4DR7 Q;  1KDB A;  2K5D A;  1EQR A;  1CQV A;  4A93 H;  2NVQ B;  3K81 C;  2AQ3 B;  2F0L A;  2B2T C;  4IUQ A;  5C4X B;  5D14 A;  4AYB E;  4EQ5 A;  1CKN A;  2A8V A;  3ERS X;  1Q90 A;  3MFG A;  3UDX A;  2A73 B;  4RGT A;  4P75 A;  3HOX B;  4R4Q A;  1HNZ Q;  2KVM A;  3CQZ H;  4A3J G;  5KYL A;  3S1Q B;  3L2P A;  5C44 B;  1SMY D;  1VQN A;  1JE4 A;  3W1B A;  4FDB A;  1A63 A;  1S5E D;  2D2C C;  4A3G G;  1EFI D;  4A3D B;  3G48 A;  5LMN W;  2UUA L;  2Z9H A;  4M8A A;  2FXQ A;  4B3R L;  1N36 L;  2EJM A;  3BVM A;  1SNM A;  4J8Q A;  1RTO A;  3R2T A;  4ZKC B;  4IO9 A;  2QCP X;  4LF7 L;  5C44 G;  1I4G A;  1S40 A;  1F2Z A;  3CRK C;  1WYD A;  1SNP A;  4A3J B;  5M9O A;  3C2P A;  1I94 L;  5I4D A;  1SND A;  2KCT A;  3KLS X;  4FP5 D;  3VYT A;  2MGS A;  1RTN A;  2PW7 A;  3FPU B;  3TP6 A;  3KLS A;  4DUY L;  1WD1 A;  2V1C C;  2EY6 A;  1SYE A;  4GNX A;  4JI3 Q;  1JR0 D;  1I3Q B;  4DR6 Q;  2VQF L;  3D0F A;  5C4X G;  2OTJ A;  2VL6 A;  5JEA H;  1GHK A;  1CUK A;  2EVB A;  2IT1 A;  1L1O B;  2C9O A;  2RDF A;  5E1F A;  3I4O A;  1HR0 Q;  3A7L A;  2HD3 A;  2Y0S B;  3TZU A;  2JN4 A;  2VUM H;  3GO5 A;  1C8C A;  2FHT A;  2KHS A;  2MP1 A;  1BUV T;  3M85 A;  4C3J B;  3S14 B;  4LMQ D;  5IYB G;  2PZW A;  1O7I A;  3NPP A;  4TQU S;  3VA5 A;  5I2Y A;  3GTJ B;  1K28 A;  3NE5 B;  4ME5 A;  3TN2 A;  4GOP A;  1ENC A;  1IW7 C;  1NNX A;  1I4X A;  4RCO A;  1G2T A;  2DY7 A;  1I6V C;  1QUQ B;  1PXU A;  1YZ6 A;  2B2Y A;  1UEA B;  1I4Q A;  1K3R A;  2Q2T A;  3QOJ A;  1IKM A;  1D1I A;  2NTS A;  3HEJ A;  2PQA A;  2A68 D;  1VQL A;  4LUO A;  2F0O A;  1SE3 A;  3NQT A;  1PFN A;  3NBI A;  2B39 A;  1U5K A;  5K36 H;  1JOO A;  2PYK A;  3H0G H;  2F1M A;  1IBM Q;  2Q2I A;  1OXS C;  3RZO B;  1BOS A;  4GOP B;  5M3F B;  5FLM G;  1WTQ A;  1CA6 A;  4J15 A;  3IL8 A;  3A55 A;  4AYB G;  2DNE A;  1QVF A;  3GQB A;  1YJW A;  3HOY B;  1Q86 C;  2IPK D;  5CR3 A;  1NTG A;  3URY A;  1M1K C;  2WAQ B;  4H0L C;  3KF6 B;  2GVA A;  4C2M H;  1K73 C;  3MWY W;  4K2K A;  3VDY A;  2TMP A;  5G3L D;  1S4Z A;  5HGQ A;  4KJN A;  5IP9 H;  4LFA Q;  1YJ9 A;  3W5O A;  3R3O A;  3OWF A;  4G57 A;  1SNC A;  3RZO H;  4BBS B;  1HNX Q;  2JA8 B;  2R61 A;  4B3T L;  2DJG C;  2AQ1 B;  1VQK A;  3GTP H;  1U9R A;  1SYB A;  4XIG S;  4DAV A;  2QEJ C;  4OO1 H;  4ALP A;  4R4O A;  4LFC Q;  4A3J H;  5FO9 B;  4IFD G;  3HOZ G;  4UP8 A;  3BZK A;  1HNX L;  2UU9 L;  4C1N K;  3J81 i;  1B9M A;  5IIF A;  4POF A;  4PZ8 A;  3NSW A;  4GS3 A;  3RMH A;  5IT9 c;  1WTR A;  5E4X A;  1V9P A;  1X56 A;  1RJT A;  4XXE A;  3S1R B;  4LFB L;  4IQZ A;  2R7Z G;  2MO0 A;  4Z9C B;  5NUC A;  1DGS A;  2MNA A;  3NHH A;  4IPC A;  1V43 A;  4B9W A;  1XPU A;  2CW0 C;  2KCC A;  1E22 A;  1K0S A;  2GA4 B;  4MZ9 A;  3NWT A;  4JI3 L;  1Q82 C;  3L7Z C;  4DR6 L;  1NR2 A;  2QEX A;  1LAC A;  1V8Q A;  2QKI C;  1FNW A;  4YWK A;  4NXM Q;  3P75 A;  4HSV A;  4A3L G;  1G29 1;  2F4V L;  2N3S A;  5FO7 B;  1OXV A;  1LT6 D;  1RIP A;  1PRT F;  1QZH A;  4BA1 I;  3QG1 A;  4RA8 A;  1Q7Y C;  1I50 H;  2JK8 A;  4C3I B;  1W3S A;  4RG1 A;  2E2H H;  4UP9 A;  2OT2 A;  2F0W A;  1CKM A;  1CSQ A;  2NN6 I;  4A3I G;  2A6E D;  2L4N A;  1QUQ A;  4LF4 L;  1X32 A;  2UUA Q;  3PO3 G;  2F3I A;  3I72 A;  1Z7T A;  1RHP A;  4KTA A;  1X65 A;  4ZAI A;  2JA6 H;  4BBS H;  1C4Q A;  1LT5 D;  1H9K A;  3J7Z C;  2F0D A;  4EQO A;  2JXM B;  2OQ0 A;  2Z6B A;  3HP3 A;  4K5V A;  4A3K B;  2F03 A;  2Z6K C;  1EUJ A;  1ENA A;  4CJ0 B;  4QIW E;  3HGB A;  2XNA C;  1UWV A;  1XPO A;  3PV0 A;  1LM0 A;  5JVG 3;  1NE3 A;  4AYB B;  3S1M H;  1E1O A;  1LTA D;  3EA6 A;  2PI2 A;  1DON A;  1X54 A;  5M3F G;  1UAP A;  3WWV A;  1MJE A;  4FF1 A;  2JEA I;  1VMC A;  3CW2 C;  2MHV A;  1U4M A;  4OO1 G;  2YTX A;  4KN7 C;  3UDI A;  4J1M A;  5IWA L;  2K5W A;  4AIM A;  1RD9 D;  3MXG A;  2E2J H;  2MJ8 A;  3S1R H;  4NP5 A;  3D4R A;  1KAW A;  3MFY A;  2XVS A;  1PV4 A;  2O4X A;  4YCW A;  4ZCK A;  4NXN Q;  3CPF A;  1TWG B;  2B29 A;  4DF7 A;  1J5E L;  3OWE B;  4WFN 3;  3F1Z A;  2HDM A;  4IUN A;  2F0G A;  3RLO A;  1DOL A;  1SEB D;  4EGV A;  2LMC B;  2I5H A;  1Y1W G;  3PF4 A;  1GHJ A;  3RD4 A;  4JYA L;  1A15 A;  2LSS A;  2K04 A;  4XQN A;  1A2U A;  4PMB A;  1B3Q A;  3TP8 A;  5D3D A;  1DM0 B;  5JJK A;  1BBW A;  4KY7 A;  2KHJ A;  4GN5 A;  3IRB A;  1EYA A;  2E2D C;  2RCN A;  1RDP D;  1D2B A;  4P2C B;  5GQO A;  4DAY A;  4H02 A;  1LT3 D;  5LMN Q;  1WCM G;  2EOT A;  4OEL B;  2F0P A;  1EL0 A;  4QF4 A;  2K7V A;  1YHB A;  3AEV A;  1LTR D;  4H44 C;  1STE A;  1JJC B;  1EQT A;  3K5N A;  2QF7 A;  2JA9 A;  5IGE A;  4Y52 H;  2Z8L A;  4DV5 Q;  4OWX B;  2B2V C;  3ULL A;  2VNU D;  2EDG A;  4DAY B;  1IBK L;  3KYH C;  3S1N H;  1PVO A;  4KD4 A;  5KNB A;  3KLW A;  4KI0 A;  4L5Q A;  4CHT B;  5BR8 L;  4PMC A;  5TSS A;  3PO2 H;  4IUU A;  5L37 A;  2WIN B;  2YTV A;  4EQP A;  4DN4 M;  3HZX A;  4N9P A;  1S3O A;  3G6E A;  2A6E C;  3T4A C;  4A3G B;  2F0T A;  5AJ3 Q;  1NJI C;  4LF8 Q;  1CHP D; 
#chains in the Genus database with same CATH homology
 3ND8 A;  2R93 B;  1ROD A;  2PMZ B;  1KNA A;  2EZV A;  4ZRZ A;  4U67 3;  5CV6 A;  1O80 A;  3BVZ A;  3OHX C;  1SYF A;  3S17 B;  3H91 A;  3D4D A;  4XQQ A;  1TY0 A;  2BE5 D;  1TU2 B;  4MIU A;  4NDX A;  5BN5 A;  3SK6 A;  2ENB A;  2D5D A;  1SAP A;  3ONA B;  2X69 A;  1IW7 D;  3IKJ A;  5KEE A;  3PUY A;  3T13 A;  3GTK B;  3R93 A;  4CKB A;  3RZD B;  1ENF A;  1CTM A;  1AN8 A;  1EWC A;  5JOB A;  5BN4 A;  4DU9 A;  5C4Z A;  1DYQ A;  3R2I A;  2A69 D;  3SK5 A;  3PO2 B;  4L63 B;  3X3M A;  4E6I A;  2IL8 A;  4HSP A;  3ERO A;  4C1N I;  2PPB C;  1YNN C;  2EE1 A;  1G2S A;  1GUW A;  3A8I E;  3NTK A;  3HG9 A;  3HKZ B;  4K8J A;  2OF1 A;  1NSN S;  1TY2 A;  4A3E B;  1S5B D;  2L12 A;  3VR3 A;  3UI2 A;  3MXP A;  2L5T A;  1TR5 A;  3FKI B;  1VF7 A;  1F9S A;  3SVM A;  1H9S A;  1TII D;  4QMG A;  4TSS A;  3U9S A;  1HA6 A;  1V1P A;  4F8M A;  4MHE A;  2FMC A;  1R4Q B;  4RKB A;  2X6L A;  1HRJ A;  3IFT A;  1EQV A;  2SNM A;  1GUN A;  2JYO A;  2E75 C;  1QIL A;  3I3C A;  4CKE A;  2SDF A;  4OHJ A;  3BG3 A;  5IGC A;  4TKO B;  1HA5 A;  1WTV A;  1TVX A;  1JOR A;  4RKL A;  1HQM C;  1QCB D;  4XTC S;  1BXT A;  4FF2 A;  5D65 A;  4XT3 B;  1UUP A;  3U9O A;  2BCO A;  4LAA A;  4FO2 A;  2KOL A;  1EYD A;  3SR1 A;  5IGG A;  2O2L D;  3VR2 A;  1JWM D;  5DM6 3;  3NTI A;  4RWS C;  1A6X A;  2FIN B;  1A3U A;  3WOF A;  3G7L A;  2EJG C;  1VDZ A;  4IUT A;  5KRU A;  2F3V A;  2F0K A;  4K5X A;  3S9W A;  1SNO A;  1EEI D;  4ID6 A;  5CMD A;  5IGD A;  4CJ2 C;  1HCZ A;  1C48 A;  4EQN A;  4ZKB B;  1LO5 D;  5JPN C;  1X3P A;  4BY7 B;  1SBB B;  2NBF A;  1QNK A;  2K28 A;  2L1B A;  4QUC A;  2N88 A;  4FVM A;  5CGK A;  3V2T A;  2LS0 1;  3NP8 A;  2XWB B;  2E74 C;  3BZD B;  3A7A B;  1PZK D;  5E4W C;  3HOU B;  1EY7 A;  1CM9 A;  3G6J B;  4KHZ A;  2ZXP A;  1JOQ A;  3ITP A;  1WTO A;  2E76 C;  1HPC A;  3TBI B;  4H13 C;  3H09 A;  3O13 A;  2EYM A;  2HCC A;  3W2D A;  2IX1 A;  3BVG A;  4G7O C;  2PQE A;  1KDC A;  1CK1 A;  2E2H B;  5CV4 A;  1EYC A;  4DXF A;  1A3V A;  2BE5 C;  2MPM A;  2A6H C;  3K6O A;  1WTW A;  1G91 A;  3X3N A;  4I7Z C;  3RLF A;  4C3H G;  5EPK A;  4R9W A;  5M3M B;  3C46 A;  4BA2 I;  5EJW A;  3KF8 A;  5CYU A;  1KDA A;  5ELE A;  1EZ8 A;  5KGU A;  3AB9 A;  4K6D A;  2F0J A;  3DWA A;  1W6K A;  2RDH A;  3FVQ A;  3J7A F;  4HAE A;  2J4X A;  3QB3 A;  4DAP A;  3FRP B;  3KBG A;  1EY8 A;  3HS0 C;  3H6M A;  1NCV A;  4IUV A;  4ZQ3 A;  3OMC A;  1G8Z D;  1D5M C;  3K58 A;  1TWC B;  3IAY A;  1A2T A;  5EPJ A;  2L55 A;  1Y69 U;  4HTH A;  1SE4 A;  1E0B A;  3KK7 A;  3W3A A;  2BDO A;  3HOV B;  1WCM B;  4KKT A;  5IOC A;  4A3B B;  4C2M B;  1IYV A;  2ICI A;  1XX8 A;  3DMU A;  1PTO C;  3VA7 A;  1BNZ A;  1F9Q A;  1ESF A;  1PZI D;  1FD7 D;  5ELB A;  3DWP A;  2K5Q A;  1FYC A;  4A3M B;  5C0X I;  1A3T A;  2QDB A;  1NUC A;  3GTM B;  5K36 G;  1KAA A;  4XQJ A;  1AZQ A;  2VB3 X;  2EY2 A;  3Q22 A;  3Q6S A;  2O5J C;  3JAM E;  5DNF A;  3K59 A;  1O7L A;  3J80 L;  1VF5 C;  3CKI B;  5C6A A;  1SJE D;  2IWH A;  3EJI A;  4PMW A;  1CZW A;  1HTP A;  1PTO F;  4F88 A;  2F0I A;  5LL6 S;  1EY4 A;  2HDL A;  4YIJ A;  5JEA G;  2CVR A;  3FDT A;  3KLR A;  1ILP A;  3MXN A;  4K14 A;  2KEE A;  1WTP A;  4HN7 A;  2I46 A;  4IFD H;  3JAM L;  3MA2 B;  3GV6 A;  1CI3 M;  2EJF C;  4KD3 A;  5C3E B;  1ZKO A;  3BDO A;  1LTB D;  1DOK A;  1ILQ A;  4F7X A;  4ZYS A;  1I6H B;  2C5C A;  1VCI A;  4DNT B;  3IFD A;  5I6W A;  3K7A B;  1JOK A;  4K6L A;  4RH6 A;  3S2H B;  4EVO A;  1CZG A;  2F3W A;  3NK9 A;  3I8Z A;  4CKC A;  2KQ3 A;  3ND9 A;  3SEB A;  1JWS D;  3WOE A;  1EOT A;  4OO1 I;  3TP7 A;  1OO9 B;  1Q3L A;  5COY A;  3L3O C;  3VR6 A;  5CC4 A;  2DY8 A;  3C1E A;  3DEP A;  4K8I A;  1LT4 D;  5FOB B;  1E2W A;  2R7Z B;  2Z4H A;  1BBX C;  2F0U A;  3VYS A;  3GTG B;  3QIA A;  3D4W A;  5EGT A;  2R92 B;  2PZT A;  3J7A V;  1OXU A;  3I73 A;  1Q1E A;  3PUZ A;  5AFW A;  2PZU A;  4X3S A;  2JA7 B;  1H9M A;  2B2W C;  3D31 A;  4RFB A;  3NQI A;  3S1N B;  2KA7 A;  2L0C A;  4DXG A;  2JE6 I;  3T51 B;  3A8J E;  3H94 A;  1PFM A;  3CU7 A;  4CGY B;  1B4O A;  1OXX K;  4CJ1 B;  5KYI A;  5EKK A;  3H3V C;  2F0M A;  2IW3 A;  1PRT C;  1HFN A;  1V1P B;  2AUJ D;  2XN9 C;  4A3I B;  1PRT D;  1O7Y A;  3QO2 A;  1PZJ D;  3J81 E;  3SK8 A;  3Q23 A;  1QE6 A;  3K5M A;  4RGO S;  3DM1 A;  5EBC A;  1SDF A;  3NBH A;  5CV9 A;  3NTH A;  5C4H A;  2Q8I B;  2VUM B;  3P7J A;  5JPM C;  1QJO A;  3MZ5 A;  1F9R A;  3DUZ A;  1MSG A;  1CHQ D;  1WD0 A;  1B3A A;  1DJR D;  1EIH A;  4FNF A;  2JA6 B;  5T1G A;  3R8B A;  1PYW D;  1SJH D;  1PTO B;  4FXK C;  4KV6 A;  3LNN A;  4NKL A;  5EQ0 A;  3S1M B;  2OEO A;  3D8G A;  3HOZ B;  4NMZ A;  2M2L A;  1QOH A;  1BF4 A;  4BY1 B;  1UNS A;  2B2W A;  2LFN A;  5JAV A;  1CT1 D;  3OPO A;  5DAU A;  5FLX L;  1MSH A;  1U4L A;  1E2Z A;  2PCF B;  1BCP F;  2RA4 A;  5C4J B;  4R8N A;  4NW2 A;  4ZUJ A;  5IOD A;  4XYO A;  5CV5 A;  4ABN A;  1CFM A;  3C1F A;  1SYD A;  3I91 A;  4RHS A;  1BCP B;  1ET6 A;  1NR4 A;  4I65 A;  2EYP A;  1IHZ A;  2EY5 A;  2EXZ A;  4K2L A;  1I4H A;  3RUZ A;  4BS9 A;  5CBA E;  4A93 B;  1RF2 D;  4F87 A;  5IT9 L;  3OSO A;  5FK9 C;  2L11 A;  1EZ6 A;  2ZXR A;  4FXD A;  2NWG A;  2Z4I A;  1D5Z C;  2RBM A;  5I6Y A;  1PTO H;  1KAB A;  1BR9 A;  1TS4 A;  1WTX A;  2O5I C;  2HQE A;  1JC7 A;  2F0Q A;  3OMG A;  4Q5V A;  1AFP A;  1LV9 A;  4LK1 C;  3TSS A;  5IT9 E;  4QIW B;  2AWO A;  4KKS A;  1M4V A;  3F2U A;  5F2D A;  1K8M A;  2Q8T A;  1EEF D;  5KIX A;  1FGB D;  1D5X C;  1DZ1 A;  4H7B A;  1B44 D;  4XYQ A;  2E2J B;  2FJ2 A;  3J7Y W;  1STN A;  2WV6 D;  3PMF A;  3TME A;  3KBX A;  1STB A;  4V19 0;  2NB0 A;  3TDQ A;  2AQ2 B;  1S5D D;  1X3Q A;  4HCS A;  3Q0A A;  2D62 A;  2KED A;  1STG A;  1ZXT A;  2K1B A;  5A2Q E;  5M5W B;  4HR7 B;  4HMJ A;  1R9T B;  1XXG A;  4IUP A;  2M9V A;  4KHV A;  2K32 A;  2K33 A;  1U4P A;  4L8J A;  4K5W A;  4JK1 C;  4LJZ C;  3BYY B;  1DOM A;  4IUR A;  1SFO B;  1ZYR D;  2K01 A;  2IX3 A;  4KY5 A;  1Q1B A;  1M8A A;  4ODG A;  1LTG D;  2IJ0 A;  1PLF A;  3GP7 A;  5C3X A;  3GTL B;  3E6Z X;  1T5X D;  1MD2 D;  2YU9 B;  4J6H A;  2PO4 A;  1FNV A;  3V96 A;  3GTP B;  3N52 A;  5IGF A;  2JSO A;  2R6G A;  3QWN A;  1K8O A;  1B9N A;  4KK7 A;  1TQO A;  1Y8N B;  1HHV A;  4FF4 A;  5CBE E;  4ZK9 B;  1GUS A;  2ICE C;  4G4K A;  3D6C A;  1B53 A;  3A54 A;  5JJZ A;  3OIQ A;  3MTS A;  3PO3 B;  1J8I A;  3M4O B;  4N9T A;  1QNU A;  3OOC A;  1DCZ A;  1BQQ T;  2NN6 G;  1IKL A;  1I4R A;  1V1O A;  2B2Y C;  1S5C D;  4KY6 A;  2M00 A;  5EPL A;  1LTT D;  3GV3 A;  1GUG A;  1RCV D;  5CV8 A;  3L9A X;  4RAU C;  4DK0 A;  2L9H A;  5LHY 1;  5C3W A;  5HGT A;  2RSO A;  1LLR D;  1DD2 A;  1GUO A;  2SNS A;  2BA1 A;  1Q12 A;  2F0H A;  4CBV A;  1F9P A;  1IL8 A;  1QB5 D;  2F0F A;  3V05 A;  5KNC A;  1AZP A;  1FR3 A;  2ZT9 C;  4OGQ C;  1T5E A;  1HFG A;  1PFB A;  1EY0 A;  2Q8R E;  5G3L F;  4ZUI A;  3MHB A;  4JBW A;  1SE2 A;  4OL7 A;  1XYI A;  3T16 A;  3P1H A;  3AU7 A;  2HCI A;  1JQY D;  3EFX D;  1SMY C;  4DK1 A;  3EVQ A;  2RSN A;  2I07 B;  3K5L A;  1TWF B;  3DEO A;  3MC0 B;  2PW5 A;  5C0X H;  3PUX A;  2F4I A;  1BDO A;  2VB2 X;  3DHQ A;  4WRD A;  3SE0 A;  4M1U B;  5EKI A;  5EBD A;  4S3S A;  1LAB A;  2LY7 A;  3SK4 A;  3LWE A;  3T56 B;  4B9X A;  2WP8 J;  4C3J G;  1I50 B;  3M7G A;  2RKS A;  4OIK A;  2OXP A;  1EY9 A;  4OIJ A;  2CW0 D;  3MXU A;  2YYZ A;  3H0G B;  1KTK A;  1Q8I A;  2SOB A;  5J22 A;  3D3R A;  5ELF A;  4U68 A;  3GTO B;  1HUN A;  2EYO A;  4FXG C;  1O78 A;  1GUT A;  4X3K A;  5JEA J;  1STY A;  1AEX A;  2E2I B;  1B1Z A;  4RGN A;  1SYG A;  3SDZ A;  3FPP A;  4ZLT F;  3LWU A;  1L0X B;  2EPB A;  4DGZ A;  1JB3 A;  3M3Y B;  1MBY A;  5A35 A;  1TWA B;  2FMM A;  2NVT B;  3A56 A;  1BO0 A;  4B08 A;  4X3U A;  1YNN D;  4DFA A;  2F0V A;  2F0S A;  1KNE A;  3N6R A;  5C5M A;  2B8F A;  1D1K A;  2KUM A;  1LTS D;  3OIP A;  2H4O A;  2Z1C A;  2NN6 H;  1J9O A;  3K57 A;  1L0Y B;  5COR A;  2ID0 A;  3PUV A;  2AUK A;  1AP0 A;  4R8I A;  5I2X A;  5A2Q L;  1E2V A;  4C3H B;  2JEB I;  2ZXO A;  3VR5 A;  3MAQ A;  2A74 C;  1WVL A;  1H9J A;  1STH A;  1TS2 A;  2XSC A;  2B2T A;  2XIW A;  4FF3 A;  1ML0 D;  3I4N B;  1NAP A;  2RVL A;  4DA2 A;  4ULL A;  1GXD C;  3CQZ B;  4IZ8 A;  2B2V A;  4MN3 A;  5LL6 X;  4PV1 C;  3Q24 A;  1ONL A;  4XDX A;  5K5P A;  3LX0 A;  2EY1 A;  1PRT B;  3E5S A;  1GOZ A;  1ICW A;  1B50 A;  1VMP A;  4KKU A;  5DEH A;  5C5L A;  1MI2 A;  1YNJ D;  2NYZ D;  2QIL A;  1PTO D;  3S2D B;  2V4D A;  3GD7 A;  2IX0 A;  2KJX A;  2HUG A;  5E3F A;  5C0X G;  2CQA A;  3EQL C;  1RKN A;  2XWJ B;  2LKV A;  1SYC A;  2DN8 A;  1SNQ A;  4QUF A;  2K05 A;  3FMC A;  3MVV A;  3GTQ B;  2X6G A;  2H1E A;  2BDN A;  4QB4 A;  2WII B;  4ILW A;  1CQF A;  4WJW A;  1TS3 A;  4L6T B;  2BOS A;  4RCN A;  3A8K E;  4IFD I;  2JA5 B;  1HXY D;  1D6E C;  3J81 L;  1Y8P B;  5IGB A;  3C3L A;  2NVX B;  3CRL C;  5ISR A;  3I4L A;  3K5O A;  3KUP A;  1HQR D;  4C3I G;  1STA A;  3VR4 A;  1SSO A;  3BDL A;  1U4R A;  1F77 A;  3NXW A;  1XTC D;  4UAI A;  1KLG D;  3CHB D;  2F0N A;  3MEH A;  4DNR B;  2A68 C;  2JP1 A;  4XT1 B;  4PQX A;  1JCK B;  3PIO 3;  1TKW B;  4X3T A;  1F2M A;  5FO8 B;  3BDC A;  2KEC A;  3M4Y A;  5T1I A;  4BWG B;  5BN3 A;  5C0X J;  1DXM A;  3QJY A;  1AW7 A;  3SXH A;  3I4M B;  3J80 E;  1Z47 A;  4IAL A;  3I70 A;  1F2L A;  1SXT A;  2DNC A;  1W6J A;  1ESR A;  4RGM A;  1TT2 A;  2K6A A;  5FLX E;  2NVY B;  2EYH A;  2EYL A;  4KMU C;  1H9S B;  1Y8O B;  2K03 A;  1TWH B;  1QWY A;  4GZY C;  2WKD A;  4A3F B;  5I9O A;  2KCN A;  1EIG A;  2NUC A;  3S16 B;  5ELD A;  3P20 A;  2CHB D;  5EKL A;  1LTI D;  1YNJ C;  1H9R A;  3E0J A;  3HRZ C;  4FYD A;  2MUY A;  1TS5 A;  3DWQ A;  2F0E A;  3FEW X;  4IN3 A;  3DXJ C;  5HUR A;  1BCP C;  1HUM A;  1PMR A;  4QCL A;  3BS1 A;  2FFK B;  1K83 B;  4WOR A;  2SEB D;  5J1Z A;  2XRS D;  2NZ1 D;  2R3Z A;  4V0B A;  3BYT B;  2A69 C;  1FNU A;  2XRQ D;  2RDG A;  5I9P A;  5ELC A;  1JWU D;  1R4P B;  3SHL A;  2WAC A;  2G9H D;  2J7Z A;  3VYU A;  2A6H D;  1HTL D;  4O1N A;  1EU4 A;  5J39 A;  2B2U A;  4RHR A;  4KN4 C;  2EYJ A;  4C56 C;  1F2Y A;  2B2U C;  2VXW A;  5M5X B;  4G7Z C;  2NTT A;  3HOW B;  3QOL A;  3TP5 A;  1GJX A;  2TSS A;  1ZEQ X;  3S15 B;  1BCP D;  2N55 A;  2B8G A;  2PNR C;  3ERQ A;  3PIP 3;  5DM7 3;  3NUC A;  2B63 B;  3WDN A;  1S5F D;  1KLU D;  1XWE A;  3I90 A;  3K0Y A;  3T53 B;  5CV7 A;  3NWS A;  3AMU A;  2WKC A;  4G7H C;  1ZYR C;  1EU3 A;  3D6W A;  1B2T A;  3PUW A;  4IFD J;  2J0T D;  3ZYY X;  1EY5 A;  5M5Y B;  1PDQ A;  1O7Z A;  1G6Z A;  4O42 A;  1EY6 A;  4BBR B;  5KND A;  4Y7N B;  1I4P A;  1II3 A;  1IYU A;  4HCE A;  1ET9 A;  4PNY A;  3TZD A;  2D9U A;  2AWN A;  5FKA C;  3VYR A;  1OXT A;  3OW7 A;  5D3I B;  2RQX A;  4HMI A;  1MGS A;  2EYF A;  1JIC A;  1Y1V B;  2WB1 B;  1CA5 A;  1QG7 A;  2BA0 A;  1Z6H A;  2G9D A;  4KJO A;  4UDU C;  4TRD A;  5JVH 3;  1Y1W B;  3M7N A;  2A5H A;  4Q0F A;  1EWH A;  4HED A;  1KDB A;  2K5D A;  1CQV A;  2NVQ B;  2AQ3 B;  2F0L A;  2B2T C;  4IUQ A;  5C4X B;  5D14 A;  1Q90 A;  3MFG A;  2A73 B;  4RGT A;  3HOX B;  2KVM A;  5KYL A;  3S1Q B;  5C44 B;  1SMY D;  1JE4 A;  1S5E D;  2D2C C;  1EFI D;  4A3D B;  4M8A A;  2EJM A;  3BVM A;  1SNM A;  4J8Q A;  1RTO A;  3R2T A;  4ZKC B;  2QCP X;  1I4G A;  1F2Z A;  3CRK C;  1SNP A;  4A3J B;  5M9O A;  3C2P A;  5I4D A;  1SND A;  4FP5 D;  3KLS X;  3VYT A;  2MGS A;  1RTN A;  2PW7 A;  3FPU B;  3TP6 A;  3KLS A;  1WD1 A;  2EY6 A;  1SYE A;  1JR0 D;  1I3Q B;  5JEA H;  1GHK A;  2EVB A;  2IT1 A;  2C9O A;  2RDF A;  5E1F A;  3A7L A;  2Y0S B;  3TZU A;  3GO5 A;  1C8C A;  2FHT A;  2KHS A;  2MP1 A;  1BUV T;  3M85 A;  4C3J B;  3S14 B;  4LMQ D;  2PZW A;  3NPP A;  4TQU S;  3VA5 A;  5I2Y A;  3GTJ B;  3NE5 B;  4ME5 A;  3TN2 A;  1ENC A;  1IW7 C;  1I4X A;  4RCO A;  1G2T A;  2DY7 A;  1I6V C;  1PXU A;  2B2Y A;  1UEA B;  1I4Q A;  3QOJ A;  1IKM A;  1D1I A;  2NTS A;  3HEJ A;  2A68 D;  2F0O A;  1SE3 A;  3NQT A;  1PFN A;  3NBI A;  2B39 A;  5K36 H;  1JOO A;  2PYK A;  2F1M A;  1OXS C;  3RZO B;  1BOS A;  1CA6 A;  1WTQ A;  5M3F B;  3IL8 A;  3A55 A;  2DNE A;  3GQB A;  3HOY B;  2IPK D;  5CR3 A;  3URY A;  2WAQ B;  4H0L C;  3MWY W;  4K2K A;  2TMP A;  5G3L D;  1S4Z A;  4KJN A;  3R3O A;  3OWF A;  4G57 A;  1SNC A;  4BBS B;  2JA8 B;  2R61 A;  2AQ1 B;  1U9R A;  1SYB A;  4XIG S;  4DAV A;  2QEJ C;  4OO1 H;  4IFD G;  5FO9 B;  4C1N K;  1B9M A;  5IIF A;  3NSW A;  3RMH A;  1WTR A;  5E4X A;  1RJT A;  4XXE A;  3S1R B;  4IQZ A;  4Z9C B;  5NUC A;  3NHH A;  1V43 A;  4B9W A;  2CW0 C;  2KCC A;  2GA4 B;  3NWT A;  3L7Z C;  1NR2 A;  1LAC A;  1V8Q A;  2QKI C;  1FNW A;  3P75 A;  4HSV A;  1G29 1;  5FO7 B;  1OXV A;  1LT6 D;  1PRT F;  4BA1 I;  3QG1 A;  4RA8 A;  4C3I B;  2OT2 A;  2F0W A;  2NN6 I;  2A6E D;  2L4N A;  1X32 A;  3I72 A;  1Z7T A;  1RHP A;  4KTA A;  4ZAI A;  1C4Q A;  1LT5 D;  1H9K A;  2F0D A;  4EQO A;  2JXM B;  3HP3 A;  4K5V A;  2F03 A;  4A3K B;  1ENA A;  4CJ0 B;  3HGB A;  2XNA C;  3PV0 A;  5JVG 3;  4AYB B;  1LTA D;  3EA6 A;  1DON A;  1UAP A;  2JEA I;  4FF1 A;  1VMC A;  2MHV A;  1U4M A;  4OO1 G;  4KN7 C;  4J1M A;  2K5W A;  1RD9 D;  3MXG A;  2MJ8 A;  4NP5 A;  3D4R A;  3MFY A;  2XVS A;  2O4X A;  1TWG B;  4DF7 A;  3OWE B;  4WFN 3;  4IUN A;  2HDM A;  2F0G A;  1DOL A;  1SEB D;  4EGV A;  2LMC B;  1GHJ A;  3RD4 A;  1A15 A;  2K04 A;  4XQN A;  1A2U A;  4PMB A;  3TP8 A;  5D3D A;  1DM0 B;  4KY7 A;  1D2B A;  1EYA A;  2E2D C;  1RDP D;  4P2C B;  4DAY A;  1LT3 D;  2EOT A;  2F0P A;  1EL0 A;  4QF4 A;  2K7V A;  1LTR D;  4H44 C;  1STE A;  1EQT A;  3K5N A;  2QF7 A;  5IGE A;  2Z8L A;  2B2V C;  2VNU D;  2EDG A;  4KD4 A;  5KNB A;  4KI0 A;  4CHT B;  4PMC A;  5TSS A;  4IUU A;  2WIN B;  4EQP A;  4DN4 M;  3HZX A;  4N9P A;  2A6E C;  3T4A C;  4A3G B;  2F0T A;  1CHP D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...