2Z1CA

Crystal structure of hypc from thermococcus kodakaraensis kod1
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
71
structure length
71
Chain Sequence
CLAVPGKVIEVNGPVAVVDFGGVKREVRLDLMPDTKPGDWVIVHTGFAIEKLDEKKAMEILEAWAEVEKAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of [NiFe] Hydrogenase Maturation Proteins HypC, HypD, and HypE: Insights into Cyanation Reaction by Thiol Redox Signaling
pubmed doi rcsb
source organism Thermococcus kodakarensis
molecule tags Chaperone, metal binding protein
molecule keywords Hydrogenase expression/formation protein HypC
total genus 17
structure length 71
sequence length 71
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2007-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01455 HupF_HypC HupF/HypC family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.970 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2z1cA00
3VYUA 2Z1CA 3D3RA 3VYSA 2OT2A 3VYRA 3VYTA
chains in the Genus database with same CATH superfamily
4RKBA 1AW7A 1FR3A 1Q90A 1EY8A 5J22A 1A63A 1N36Q 2WKDA 3PIOA 2LFNA 4PMBA 3D0FA 4BY1H 5M5XB 4EQOA 5C0XJ 4L8JA 3CCUA 1M8AA 1JB7A 2CVRA 1D6EC 3PUYA 4XQQA 4KY5A 1JCKB 4K2KA 3T53B 2GA4B 4DXFA 2MHVA 5JEAH 1BBUA 3G6EA 1TVXA 4NXML 1F9SA 1L1OB 3VR5A 2I0QA 3I2ZA 2K1BA 5D3DA 3H09A 1V1QA 2JA5H 4E6IA 1S5DD 2KEDA 1ICWA 1CTMA 3I72A 3M4QA 3WOEA 4A75A 5FLMG 2K14A 2OF1A 1ZYRD 2N55A 2E2IB 1VF5C 2TSSA 2CH4A 1PFNA 4L5QA 4A3EB 1JB3A 1ONLA 1PVOA 1LTLA 1IXRA 1XWEA 2VY3A 4Y7NH 3MEHA 5I6YA 1A6XA 2QEJC 1GUGA 1PH6A 1IBKL 1GKHA 4XDXA 1F2LA 1EY6A 5FLMH 3RN5A 5JEAJ 1SE2A 2FINB 5IGGA 3FKIG 3M7NA 3K5MA 1S40A 3BVMA 4ZYSA 1E2WA 1HH2P 4PNYA 4DR2Q 2EPBA 3PGZA 4V0BA 1NCVA 2AKWB 2G9DA 4AQYQ 3S2DH 4C1NK 4O0AA 1QVFA 1VS0A 1Y14B 1V1PB 3UDIA 2VL6A 3R2TA 1CM9A 5IE8A 4QY7A 2DY7A 4A3EH 1F2ZA 4DNTB 2JA5G 3K7UC 3CCSA 5D65A 1I3QH 2IPKD 1NMGA 1J9OA 3H94A 5EJWA 1Z6HA 3M4YA 5GAHC 1MHWC 2HDMA 2KCCA 3CPFA 5DAUA 4ALPA 3F2BA 2WV6D 4YCUA 1JMCA 1O7ZA 3BYYB 1IKLA 1TWCH 1MJEA 1QG7A 4BBRG 3CC7A 1VMPA 1OTCA 1B1ZA 1H95A 3CD6A 1L1OA 3EQLC 3J81j 4DUYL 1GXDC 2BCOA 4JBWA 4UHVA 1U4RA 3OMCA 1T5XD 4A3DG 2E2HH 1ML0D 3CCVA 4HIDA 2CKZB 4IPHA 2IHFA 4ZAIA 5DNFA 2F0PA 1NJIC 1PTOB 5AJ3Q 4BBSG 4A3BG 5FLXL 3K7AH 3MA2B 4LF4Q 2L15A 2E2IH 2CQOA 3FPPA 2XTIA 3T1HL 2F0HA 1QNUA 5M5XH 2VUMG 3K57A 1OXUA 1EYGA 2CFMA 3PF4A 3E0JA 4BBSH 4K6DA 4KY7A 4LFCQ 1TY0A 1M90C 2JA8B 5M3MB 1LTID 2A73B 3M4PA 1TWGH 2B2TC 2HUGA 3SK4A 2HIVA 2I5MX 2L55A 2RKSA 1HPCA 3I4NB 2OWOA 4LFBQ 3QJYA 3PQIA 2ASBA 4O2DA 1STNA 4DR6L 1TWHH 1F9PA 2F0DA 2O4XA 2ZJRA 1QCBD 5GROA 3J81i 1EWCA 3VDYA 1UWVA 4AIMA 3TP5A 4OIKA 4QIWB 5ISRA 5BR8L 4JI2Q 1Q8IA 1VQ9A 4L63B 3L0OA 5G3LF 4ME5A 3BZDB 2HT1A 4DV3Q 2PZUA 4KY6A 4KMUC 4KN4C 1Y1VH 2ICIA 3SEBA 2Z6BA 2B63B 1TXYA 5I2YA 2ATWA 3URYA 3R3OA 1DXMA 3I90A 5JVG3 3I70A 1SNOA 3KOJA 1Q1BA 2HHHQ 3K5LA 5IP7G 4BS9A 5LMUL 2AWNA 3T13A 1WCMG 3LGJA 2NUCA 2WB1B 1PRTB 3BYTB 4KLKA 1STBA 1QNKA 1IBLL 3A7LA 4FXDA 4KI0A 2F03A 2XSCA 1PTOH 1H9RA 3QOLA 3GTJB 4JYAQ 4S3SA 3A74A 3VA5A 3J80i 4X64Q 1WJJA 1Y1VG 4ZKCB 3K80C 3GTQB 3NXWA 1HCZA 4KK7A 3FKIB 2AUKA 4K14A 4DAYA 1ENFA 4PZ6A 3DWQA 4DR5Q 4A3IH 4DPGA 3DLLA 2PQAA 3U50C 2Y0SE 4APVA 3W2DA 4A3MG 4BWGB 5FOBB 2KCMA 2FHTA 3WOFA 4JYAL 1FNVA 3IFDA 1JWSD 4HCSA 3BS1A 2JA5B 5T1GA 2JA8H 4ID6A 4MTNA 2PMZB 1JQYD 5ELEA 4HJ7A 2GVBA 1D5MC 2YYZA 2OEOA 1HNZL 1A15A 4CDDC 3ONAB 4C3JG 4PMWA 1PLFA 4CJ2C 1Q12A 1TT2A 4GOPA 1ZXTA 3CCMA 3G71A 1STGA 3S17H 4FF2A 1I4QA 3CCQA 2NVTH 3AEVA 1GUNA 1N33L 2GVAA 4X62L 3BJUA 1I6HH 2JQOA 5JPMC 2D0OA 3SDZA 1PH4A 1YHBA 4BY1G 3ULPA 4JC0A 4N9TA 3KK7A 5A2QE 3S2DB 3BDLA 4HIKA 1VQPA 2FXQA 4XT3B 2NZ1D 2PO4A 4O42A 2K75A 1X3GA 3PUVA 4JBMA 2CWPA 3ZYYX 1B9MA 4MHEA 2EYJA 1DJRD 3I8ZA 1E3PA 5G3LD 4A3BB 1T5EA 4DK1A 5IYDG 3T1HQ 1MSGA 2F0IA 2N49A 2WINB 4DR2L 1BF4A 2EXDA 3GTPB 1PDQA 3MXNB 5IT9c 2IX3A 3T4AC 3T56B 3BVZA 1Y1VB 2JYOA 5KNCA 5F2DA 1HNXL 1E2VA 2JXMB 1M4VA 4RH6A 1OXXK 1S5BD 3HOYB 5TSSA 1VQHA 3TS0A 3I55A 2QDLA 1AP0A 2FFKB 1WTOA 4RFBA 2B2UC 1KTKA 4ZQ3A 1HHVA 1ESFA 4DV4Q 4LF8Q 4K8IA 1O80A 3GTLH 3NBHB 1ICFB 4DR3L 2EVBA 1MKHA 1A3VA 2PMZE 3PSIA 3PO2H 5EBDA 2I46A 5LMUQ 4WJ3M 2A8VA 1BXTA 3L2PA 2Q2TA 1XPOA 4OWWB 4DA2A 1J5EQ 3AQQA 1CQFA 3G7LA 2FMCA 4GNXC 4A3KG 1D2BA 1KQSA 1HFGA 3OSOA 5C4HA 4YY3Q 1JWUD 5CV6A 1SYDA 4I65A 2RVLA 4YHHL 2Q8RE 4KN7C 3D31A 3SR1A 2KQ3A 2A6EC 2H4OA 2XGTA 1BVSA 2G5DA 4DK3C 1CSQA 1BCPD 1HXYD 1CT1D 3W3AA 3DEOA 4A3IG 1N8RC 2OQ0A 4G57A 1NAPA 4A3JH 2I5HA 2HQEA 4H13C 1W2BA 3J7ZC 5H1SE 1PRTD 1PFBA 4XT1B 5HURA 3LNNA 3EVQA 4A3JB 1XTDA 1LV9A 2L1BA 4IOAA 1PYWD 4P72A 1KLGD 1N34Q 3PIPA 5AJ3L 4LFCL 1PZID 2SEBD 3D3RA 2KUMA 5LMNL 2B3GA 3KLWA 2JA9A 2RCFA 1SMXA 3CXCA 3L9AX 4DN4M 1EQRA 2Q8TA 4JV5L 2O2LD 4DR6Q 1I4HA 1NMFA 2BE5C 1KDCA 4TRDA 4AQYL 1G91A 1GM5A 3HG9A 1PMRA 4JI7Q 1C48A 2R3ZA 2EDGA 1X54A 4QJFA 3TRZA 4JBKA 1GJXA 3HOWB 1JT8A 1WTPA 2E75C 3M3YB 3ERSX 1PH9A 4IFDI 1WTQA 5EKIA 2EQSA 2KCTA 2MO0A 3MWYW 1WTHA 2NVTB 3HOWH 1KAAA 4FNFA 1P16A 2BH2A 3NELA 2A6HC 2JA7G 3CRKC 4NB3A 1OXTA 4A3LH 3K6OA 1KNEA 5LHY1 2MQHA 3C1FA 3FVQA 5BR8Q 3U9SA 1HQMC 3WDNA 4OHJA 3HP3A 4B08A 4DUYQ 4A3GB 3U4ZA 2XIWA 1K3BC 2RHQB 4C3HB 2PW5A 2B2YA 3QOJA 2L11A 3RZOB 2NVQB 4DXGA 2WB1E 3TS2A 1G6ZA 3RMHA 2R7ZG 4A93B 1IL2A 1SE8A 1D5ZC 4V190 2JN4A 1IYVA 5M5YH 5CC4A 3SK8A 1STYA 5BN4A 1BBWA 2B2VC 1CUKA 1L0YB 4KKSA 1V1OA 1SAPA 1Q82C 1HTPA 2OTLA 2F0OA 1ZYRC 1CFMA 5C0XI 3TDQA 3RLOA 5J39A 3JC66 3KUPA 3NK9A 3F2UA 4FF1A 2R92H 4JI5L 3X3NA 1TWHB 1VQGA 3P75A 1X3PA 3I56A 1WD0A 2ZJQA 1QB5D 3Q23A 3AFQA 3CF5A 2Z6KA 1CZWA 2NVQH 2WIIB 1LT5D 3OW2A 1QE6A 4BY7B 1K9MC 4KJOA 4H0LC 5C4XG 5IYDH 4LF6L 3HOVH 4QCLA 5IP9G 1A62A 1RF2D 2B2YC 2LY7A 1I6VC 4RHSA 3OPOA 2QEXA 1HUMA 4BA2I 3HKSA 4U68A 1YNND 1HNWQ 1EEID 2K04A 4AYBE 5EQ0A 1K8MA 1WCMB 1FJGQ 1IYJB 1C0AA 1P8LA 2J7ZA 2R92B 1WTWA 4JOIC 1D1KA 2DNEA 3A5UA 2EZVA 2JA7B 3TZDA 4YCWA 1IL8A 4L5RC 3OTOQ 2ZTCA 3QB3A 4G7OC 3J81L 3H15A 1Q1EA 3HZXA 4Q5VA 4JI6L 4B3SQ 3FRPB 2MNAA 3NE5B 3S16B 4BA1I 3ND8A 3HKZG 5KYLA 1VQNA 2HCCA 4OWTB 5I9PA 4A4IA 5K5PA 2GN5A 5C44G 5C3EB 4A3MB 3SVMA 4R1JA 2NTSA 2PI2E 5NUCA 3R93A 2JA6G 4OL7A 4OO1H 2KENA 3OOCA 1B50A 1B44D 3NPPA 4EGVA 4BBRB 4C3IB 3CC4A 4GKJL 2J4XA 5L37A 3EJIA 1WI5A 3MVVA 2NVXH 2O5IC 1HR0W 4JI0L 5LMNQ 3WWVA 4DAYB 2ZJPA 3STBC 3A8JE 4QL5A 2JA6H 1HA5A 3K7AB 3DMUA 4DU9A 1CZGA 5FK9C 3NTHA 4POGA 4BXXG 3CQZH 1XPUA 3GO5A 4HJAA 4YWLA 3DM1A 4N8FA 1W6JA 4M8AA 2PPBC 5IGDA 4OWXB 4B3MQ 2NWGA 4UDUC 2F0MA 2NZHA 1FL0A 5FKAC 4KKTA 2XRQD 2HQLA 1EFWA 3E5SA 2EYPA 3G48A 3O13A 1PXUA 2EYOA 5BN5A 2A19A 3DWAA 2K52A 3OIQA 2C35B 1Q8KA 2VUMB 4ABNA 5FO8B 2UUAQ 3LX0A 4IALA 1N34L 1DZ1A 4BBSB 4X6AH 5ELBA 1EYAA 2A68C 4DR7Q 4DF7A 5M5YB 3S1MB 1U9RA 2VUMH 1G291 1IW7D 1SE3A 5CYUA 3H3VC 4LJZC 2ZTDA 2KOLA 3B6YA 2MUYA 4IN3A 1I4GA 4A3LG 2PQEA 1VQJA 1LT4D 4CKEA 1RJTA 1SYFA 2D0PA 4IFDG 2F0TA 2IY5B 1CI3M 5C4XH 1KHIA 4M1UB 1C8CA 5IGBA 5C3EG 5C44B 2WFWA 1PTOC 3T1YL 2YU9H 3RLFA 4RA8A 3I4NG 1CHPD 1EIGA 4R4TA 2K32A 2L12A 3S14H 1LTSD 4R4IA 4LF6Q 3D6CA 5CMDA 2AQ3B 2R7DA 4K2LA 2RDGA 3KF8B 4I7ZC 4PG3A 4P74A 1H9SA 3H6MA 2R7ZH 1YITA 5KEEA 2E2JH 3T51B 3VYRA 3X3MA 2RBMA 3ULLA 3TSSA 4DR1L 5IYBG 4JI3Q 1WCMH 1DONA 3MAQA 2I07B 2KHIA 4PZ7A 3PUZA 4A3GH 3A5ZB 1STHA 1YNJC 3J81E 4BY7G 1HRJA 1I3QB 3IKJA 1Z9FA 2BDNA 4CHTB 1SNQA 5I9OA 2A68D 4POFA 3MXUA 1LACA 3S16H 2UU9L 1SYEA 4C2MH 4FYDA 2VQFL 2JEAI 3UDXA 4HJ8A 4A3BH 2Q8IB 1U4LA 2H5XA 2RHSB 1KD1C 3HOUH 3OWFA 3QO2A 1EOTA 2A6ED 1NR4A 3GTGH 1JWMD 2X6LA 3MXPA 1RKNA 2ID0A 3OTOL 1O7IA 1FNWA 1S5CD 4H02A 1HA6A 4JW0A 2DJGC 4IFDJ 4WRDA 1SYGA 1C4QA 2V1CC 1G2SA 1NY4A 1JORA 2M00A 4LF7L 3MXGA 3V05A 1E1OA 3K81C 1EZ6A 3EROA 3TMEA 3M4OB 2MGSA 2F0FA 1PYBA 3BZCA 3I73A 4DKAC 3S1NB 1LTAD 2Y0SG 1EOVA 4YHHQ 3S17B 1TS4A 2D2CC 4R8NA 4A76A 5M3MG 5IP7H 2E5LQ 3K0XA 1WTRA 3VR3A 4NPSA 1E7ZA 3ND9A 4C3IG 1WD1A 3PIO3 1PH7A 4KD3A 3S1QH 5FO9B 2NZOA 2KHJA 4C3HH 3GTQH 3DWPA 1XMQQ 4JI5Q 2EY5A 2Z4IA 5HGQA 5JEAG 1FD7D 1YJWA 4PQXA 2UXCL 4JI4L 3CCJA 1SDFA 4K5XA 1PYSB 2EY2A 3VYSA 3Q8DA 1ZEQX 1XJVA 1V9PA 2JEBI 1EY5A 5M3FH 1EFID 3GTKH 1GUWA 4BXXH 3PUXA 2O5JC 2N3SA 3TP7A 1SFOH 1WTXA 3Q24A 3S9WA 1VQIA 2K4KA 1G6PA 1HUNA 2DNCA 4K0KL 1XNRL 4HN7A 2DY8A 3GTMB 4DV2L 1O78A 1VQOA 4QIWE 1TWAB 3H0GG 3GV6A 3P20A 4CBVA 4XYOA 5I4DA 3AU7A 2LXKA 3TBIB 3PV0A 4JI6Q 3HOZG 2K5WA 1Q81C 4R4CA 3VR2A 2F0QA 2QGQA 3SK5A 3GTKB 5GADC 1YI2A 1EQVA 2RA4A 4JI1Q 1A8VA 1JOQA 3P1HA 4P73A 2SNSA 4G7ZC 4AYBG 3HOYG 4DNIA 1DOLA 2K05A 2TMPA 3HOYH 3J80c 4ZKBB 5COYA 4EVOA 2OXPA 4OGQC 3C3LA 1DGSA 4OIJA 4IQZA 4LWCA 4NXNQ 4I7AA 4HIOA 2VQFQ 2SOBA 4QMGA 4KKUA 1U0LA 1IBML 1Y1WH 1MD2D 3S2HB 4ME3A 5CR3A 1WTVA 2VS1A 3I4NH 4XQNA 4B3TL 3JAML 1SBBB 2FMMA 1D5XC 4JI3L 1X56A 3OWEB 4C3JB 1GO3E 2R93H 1A2TA 3EA6A 1Y8PB 2ALYB 2EJFC 3K5NA 1HR0L 3I4OA 2PZWA 2H1EA 4DAPA 5JAVA 2CH4W 2R92G 1GD7A 4YWKA 2AUJD 1CQVA 4IZ8A 4LF7Q 1E24A 4IPDA 4LF5Q 5KRUA 4KHPL 2KA7A 1TWFH 5E4XA 4A3CH 5IYCH 3J80E 3RNUA 1CA6A 3DUZA 3J81c 1QZGA 4B3SL 3GV3A 1KRTA 4MIUA 5C5MA 4CJ1B 1BBXC 3GTJH 2KECA 2Z6KC 3QWNA 2Q2UA 2UUCQ 2YV5A 1E1TA 1L2FA 4K6LA 1GOZA 5IWAQ 2NN6G 5EKLA 2JA8G 3PO3B 2R93B 2R6GA 3R8BA 1UEBA 3E3XA 5IP9H 4CDEC 2MO1A 2UXCQ 3C1EA 1BKBA 4IPGA 2RSOA 4XXEA 1DOKA 4HIMA 1I94Q 3ICEA 3S1MH 3RUZA 3T16A 1EYDA 3CCRA 1PA6A 4KTAA 2Y0SB 2B63H 4N8X1 4YCVA 1Y1WG 3AMUA 1V43A 3HKZE 4NKLA 2EXZA 3TN2A 4X3UA 2FJ2A 4K0KQ 4LUOA 4DK6C 2Z4HA 4FDBA 4NXMQ 2F4VQ 1ENAA 1N32Q 3J80L 4DNRB 3HOXH 1F2YA 1VQBA 1HNZQ 1SMYC 1JR0D 3I7FA 2WAQG 1XMOL 4JV5Q 1HZBA 4J6HA 4CKCA 1HJPA 1CHQD 3SXHA 4HAEA 1K0RA 3CPWA 1VQLA 3J7AV 2F0KA 4RHRA 3A8IE 5IYBH 4RGOS 1B9NA 1L0WA 5DM63 3VR6A 3TREA 1BDOA 4X64L 1PH2A 4PV1C 3NTKA 2AHOB 4B3RQ 5M3MH 3J7A5 1STEA 3I4LA 1LABA 4F88A 3SE0A 1TWAH 1CKNB 1LLRD 4IUQA 3I91A 3W1BA 1K73C 3VR4A 2B2WC 3I4MB 3D4RA 5CV8A 3Q6SA 1VQ6A 2WB1G 1UE1A 3A8KE 1PH5A 1EY4A 4LAAA 1S72A 2A6HD 3HOZB 1DCZA 2R7FA 3UI2A 2ZXPA 2RQXA 2ZTEA 5D3IB 4G7HC 2YU9B 3FEWX 2K03A 2UUAL 4EQ5A 3N6RA 1Q46A 3W1GA 3TZUA 2RSNA 4A3FH 4DR7L 2QKIC 4B9WA 1I4XA 2Q2HA 3S1RH 1QZHA 2J0TD 2UXDL 4XQJA 4RWSC 1NR2A 4LF8L 2RDFA 3NEMA 1TR5A 4IUVA 2QF7A 1ASZA 5CGKA 4BBRH 3LWEA 1SE4A 2F0UA 2K28A 3AB9A 2NVYB 2OQKA 5KIXA 2CCZA 3P7JA 2VW9A 1K8AC 5I6WA 2VNUD 4C3JH 2UXDQ 2A1AA 2DGYA 4JPBW 1EIHA 1AZQA 5HY6A 5A35A 3ULJA 3MFYA 4HMIA 1KAWA 1WVLA 1VF7A 5FO7B 4XYQA 5AFWA 2YTXA 1VQ7A 4ZRZA 2N88A 2D9UA 2OCEA 2PZTA 1PRTF 2F3IA 1UE7A 3NHHA 1FYCA 4R4OA 1B2TA 4JI4Q 5CV4A 1VQFA 1YVCA 5LL6X 2F0GA 3DHQA 3QR8A 1FJGL 3CHBD 3Q0AA 1Q3LA 4KV6A 5J3BA 1H9KA 3MZ5A 1Z47A 1MBYA 1S3OA 1IBKQ 1I50B 2MPMA 1VDZA 1CKMA 4IUPA 2K50A 3F1ZA 1G2TA 1GVPA 5CV5A 3NTIA 5CORA 4FVMA 1A3TA 4BY7H 4LFBL 4CKBA 3GTOH 3S15B 1RHPA 5EPLA 2QCPX 4C3IH 2PW7A 4PMCA 4EQPA 1EIFA 4TQUS 3C2PA 1HR0Q 3CW2C 2BDOA 3OIPA 2B8GA 4QUCA 5CV9A 1E0BA 1HQRD 1NTGA 2L0CA 2LSSA 1AE3A 4R9WA 1VQAA 3HEJA 1WFQA 5JJZA 3RZDH 1EY7A 3M7GA 1TWGB 4OO1I 2A5HA 2XVSA 2A69D 1BNZA 4A3KB 3CU7A 1SSOA 1BCPC 3KFUA 4J1MA 1H9JA 1EQQA 5IY0A 3ER0A 1B53A 5FLXE 5IT9L 2KCNA 1YJNA 5JJIA 4NXNL 2Q2IA 4X3SA 1QUQA 3H0GB 4JG2A 2UXBQ 1M1KC 3IRBA 1KDBA 4R8IA 3PMFA 5CBEE 3CRLC 5IGCA 1YNXA 3BVGA 5E7NA 5GQOA 4DV6L 2PNRC 1JE4A 1SMYD 3ERQA 3AYHB 1IHZA 2WKCA 1W6KA 1C7YA 1A2UA 1SYCA 4IUNA 2BA0A 2OT2A 3UDFA 1PFMA 3S2HH 5ELDA 3T1YQ 4UY8C 1I5FA 4ZUIA 1CKOA 3BG3A 1AEXA 5M3FB 1X3FA 3FP9A 3GTGB 3SK6A 4LMQD 1ET6A 1B7YB 4A3IB 1EEFD 2UUCL 2NN6H 4K5VA 3GTLB 2DN8A 1R9TH 4AH6A 4KHPQ 2IW3A 3RN2A 4CDCC 1UAPA 4C2MB 3CP0A 2IWHA 1ILQA 1QILA 1NBWA 1UNSA 3A56A 3UDGA 3FMCA 4DAVA 1DM0B 4JI2L 1PHJA 5CBAE 1AE2A 2F3WA 1LTGD 2CHBD 1O7YA 3D4DA 4MN3A 3MHBA 4DV4L 4LUZA 4P71A 1EL0A 4ZUJA 3H3VI 3OYYA 3A7AB 3VA7A 4DR3Q 2B39A 3OW7A 2IL8A 1LT6D 1B3AA 3CMAA 2K7VA 2JE6I 4B3RL 3JAME 1O7LA 2RF4A 1N32L 1V1PA 2EYMA 3A0JA 3K59A 2LS01 4DR4Q 1NUCA 4DV0Q 4JI7L 4L5SA 1SLJA 1S5FD 2E2DC 3MTSA 2CQAA 1U4PA 1J8IA 3FDTA 3EIVA 3ITPA 2X6GA 1K83H 2QILA 4IJHA 4RCOA 1EZ8A 1KIXA 4X65L 1B3QA 2BOSA 1G51A 2E76C 4IFDH 4FF3A 4DV7L 3PO2B 1JJCB 3HOWG 2B2WA 1VQMA 1SJED 1A3UA 5C44H 4DR4L 1D8LA 4IJLA 1LUZA 2B8FA 4C3HG 5M9OA 2K6AA 5A2QL 2F4IA 5IODA 2UUBQ 5C0XG 4OX9L 4X65Q 5JVH3 1F9QA 1Y69U 2EOTA 2WAQE 2YTVA 4B9XA 2N8NA 4WJ4A 3FHWA 2Z0SA 2A74C 5HGTA 5C4ZA 1EY0A 3KDFA 4ODGA 3JAMc 2EYLA 5IOCA 2VB2X 1PZJD 3MXNA 2I5LX 4K8JA 4LF5L 3GTMH 3KJOA 1ESRA 4UP9A 3VYTA 4JK1C 4N9PA 3J7YW 1JJ2A 2OTJA 1UEAB 2ICEC 2E2JB 2VXWA 1I4RA 5K36H 3CCLA 2EY1A 2M9VA 3NWSA 5IIFA 4QGUA 3S1NH 1Y1WB 3E9IA 1QOHA 1PH8A 4PZ8A 2IJ0A 1NSNS 3FKIH 5FJ8H 4OELB 1ZKOA 2EY6A 2B29A 2F0NA 5FJ8G 3N52A 1X32A 1BQQT 1TKWB 4FF4A 2DUDA 1SROA 2JK8A 3RZDB 5C4XB 1ASYA 1G8ZD 4GOPC 2X69A 1XMQL 2AWOA 2IHEA 5DLQE 3HOUB 1H9MA 1TU2B 3RLNA 1YZ6A 1SN8A 1H9SB 3K58A 4LNQA 4H44C 4P2CB 1VQKA 4BY1B 4GN3B 4IUTA 1EYCA 1TQOA 3HGBA 1JJGA 4GN5A 1LM0A 2ZXRA 2DJFC 4MTKA 1XYIA 2M2LA 4DFAA 4GNXB 1KC8C 3RR5A 3OHXC 4NW2A 4H7BA 4TSSA 3HKZB 5FLXc 4GKJQ 1SYBA 2F4VL 1D1IA 3GTPH 1XNQL 2LXJA 4RAUC 1L1OC 5IYCG 2NBFA 4GS3A 4QQBX 3MC0B 5E1FA 1TIID 4R4QA 2Z1CA 3PF5A 3BZKA 2JA7H 4EQNA 1Q7YC 1BCPF 5ELFA 2QA4A 3U58A 2F3VA 3HOXB 2D5DA 4KHZA 1GUSA 2HD3A 1A0IA 5C5LA 5ELCA 3S14B 1I50H 2MP1A 3A55A 5LL6S 1FVIA 4RGNA 2JA6B 1R4PB 1MJCA 3H3VH 2NVYH 4Y7NB 1MGSA 4HTHA 2PNHA 1X6OA 1LT3D 1RTOA 1BR9A 3NSWA 2K5VA 1XXGA 3E0EA 3NQIA 1SXTA 1N33Q 2Z9HA 3AFPA 2UXBL 4QB4A 1SEBD 3D4WA 1E22A 4LFAL 3W5OA 5C3WA 4YY3L 1UUPA 2B2VA 2XRSD 1L0XB 2SDFA 3TQYA 1EWIA 4IURA 3DEPA 2HCIA 3NWTA 1N36L 3QG1A 4OONA 1SNCA 3KF6A 2AQ2B 3BDOA 4RKLA 3SHLA 2LMCB 3STBD 1VCIA 4LFAQ 4FXGC 1Q86C 1ENCA 3S1QB 3UE1A 4DV7Q 1SRUA 4Q0FA 2IX0A 1VQEA 1LYLA 2E74C 4HSVA 1OXSC 2VB3X 3C46A 3M85A 4UP7A 1SNMA 4WJWA 3CKIB 4XTCS 1SJHD 1K3RA 1VQ5A 1ET9A 3GTOB 1RTNA 3S15H 1W3SA 1YBYA 3OMGA 4A3FB 1LTBD 1X3QA 2ZM6Q 4LF9Q 1CK1A 3CQZB 4OEMB 1I94L 1HZCA 2BH8A 5BN3A 1SNDA 2EJGC 3KBGA 4KJNA 4F7XA 1NNXA 2F0JA 1IYUA 1DOMA 2E2HB 2NVXB 3EFXD 1EWHA 3HS0C 4ULLA 2A69C 4CGYB 1LTTD 3NBHA 5M5WH 2IT1A 5DM73 2BA1A 3IAYA 4AYBB 3PUWA 4GOPB 4F8MA 3G6JB 1EU4A 3KJPA 1GHJA 1MI2A 4GKKQ 4GZYC 4NMZA 1YNJD 2E5LL 4DUZL 4C1NI 4EX5A 3HFZB 4DV5Q 2CW0C 1J5EL 2EYFA 1KXLA 2K5NA 2XN9C 4CJ0B 4HJ5A 1CKNA 1JOOA 2XNAC 4GNXA 2WACA 1QJOA 4TKOB 1KABA 1KNAA 1K28A 1Y8OB 3HOZH 1PZKD 2MFIA 1PRTC 1HFNA 5KGUA 3RD4A 2AMCB 4A93H 2B63G 3IL8A 1XNQQ 3SGIA 3TP6A 4U673 3L7ZC 2F0WA 5GAEC 1CA5A 2LKVA 3I4MG 3NQTA 3I4MH 1XMOQ 1S5ED 3HOUG 4HEDA 2HDLA 2C5CA 4X3TA 1B4OA 1JC7A 2K5DA 1YHAA 2K01A 1OO9B 1STAA 2N78A 4FO2A 2KBNA 4F87A 4HMJA 4DR5L 5M3FG 3V96A 2PYKA 4DV0L 1EQTA 1WYDA 4JVZA 3D6WA 2BE5D 1SFOB 4K5WA 3PCOB 2JP1A 1X9NA 4A93G 2R7ZB 2G9HD 3ZJYC 1XPRA 4L5TA 2KEEA 5EPJA 1TS3A 2B2UA 2RCNA 3K8AA 1YHQA 2R61A 3TEHB 1PFSA 1TWFB 2K33A 3EBEA 2L9HA 2ZXOA 3E6ZX 4X3KA 4X66Q 1XX8A 3CMEA 1D7QA 1KL9A 2F52A 1AFPA 5C6AA 2D62A 4J15A 4OX9Q 1PV4A 3KF6B 5EKKA 1S4ZA 1KDAA 4YWMA 2CW0D 1TWCB 3G4SA 4LUVA 2IX1A 5EPKA 3LWUA 2EE1A 3QIAA 2RDHA 1JE5A 4RMFA 3KLRA 4Z9CB 1JOKA 4G4KA 5KNBA 3H0GH 1RCVD 1LTRD 4JCVE 1HTLD 4KHVA 1EU3A 4DV2Q 1Y8NB 4GLXA 2PQAB 1V8QA 1F2MA 1WOCA 1HNWL 3F8TA 1T9HA 4CDFC 3NBIA 4O1NA 4HJ9A 3DM3A 2CWAA 4Y52H 5JJKA 2B2TA 2PI2A 4UPAA 1TS2A 4KD4A 4GN4B 3GDEA 4XIGS 1JICA 2SNMA 4A3MH 4IPCA 5C3EH 2ZM6L 4DV1L 2HIXA 4LF9L 2F0VA 1NE3A 2K5HA 5EBCA 1TY2A 4X62Q 4ZCKA 1IKMA 4NP5A 4ZLTF 1X3EA 2VQEL 2EJMA 3GP7A 4ILWA 5E4WC 4LF4L 3DXJC 1XNRQ 1IW7C 1DYQA 4GLAC 1KRSA 2XWJB 4IOCA 3J7AF 3RZOH 4DAMA 3D8GA 2WP8J 4RGMA 2ENBA 3CC2A 3KDFB 4RGTA 4GKKL 1AZPA 2F1MA 1OXVA 4GLVB 3MEFA 4MZ9A 4L6TB 1RODA 4JI0Q 5EGTA 4NDXA 1PTOD 4DGZA 4UAIA 5T1IA 1MSHA 5EAYA 4TVAB 4HR7B 2ES2A 1GUTA 5E3FA 5IWAL 1I4PA 2KHSA 1IBMQ 2V4DA 2HHHL 3EN2A 3L3OC 5GAGC 1BCPB 3NP8A 1HNXQ 5KNDA 4HCEA 3F2CA 3HRZC 3A54A 2NTTA 2ZT9C 3PO3H 3KLSX 2NN6I 1SNPA 3JAMi 2AQ1B 4WFN3 4DV5L 3V2TA 1EUJA 4OO1G 4IUUA 2JJQA 1YNNC 1X65A 1VQDA 4DV3L 3CAMA 1VQCA 2Z8LA 3TP8A 2KJXA 1C9OA 1PTOF 3M9BA 1AN8A 4B3TQ 1X55A 3NENA 4QUFA 1K0SA 3K5OA 5M5WB 3KBXA 1YIJA 2JSOA 4OXPA 4A3GG 3I3CA 1J6QA 1BOSA 3U4VA 1U4MA 3Q22A 1ILPA 4HSPA 5I2XA 1UE5A 1SR3A 5ELNA 3KYHC 2YTYA 1DD2A 3S1RB 2EYHA 1YJ9A 1B70B 2L5TA 4MNOA 3NUCA 5C4JB 3KF8A 2XWBB 3HOVB 5J1ZA 5KYIA 3VYUA 5JOBA 2QDBA 4A3KH 3F2DA 2C9OA 1FGUA 1B8AA 2KVMA 1I6HB 1HZAA 4LW1A 1EIYB 4A3JG 5C4JH 5IGEA 3R2IA 1UE6A 4DV6Q 2QW7A 1QVGA 1CSPA 1N9WA 1RIPA 4A3CG 4C56C 1IZ6A 3HOXG 1BUVT 1MIUA 2K5QA 3BDCA 2F0EA 3GQBA 4ZK9B 4WORA 3CCEA 4J8QA 1GUOA 5IT9E 3E9HA 1RL2A 4A3DH 4QF4A 4X66L 1LO5D 3PO3G 2R93G 3U9OA 1E2ZA 4IO9A 1AH9A 1KLUD 5LMNW 4JI8Q 3FPUB 4DV1Q 5K36G 3PIP3 4B3ML 2MJ8A 3K0YA 1BO0A 4P75A 4A3DB 1RDPD 2P5ZX 1XTCD 3UE0A 3PO2G 1R4QB 1FNUA 2WAQB 1RD9D 5D14A 3S24A 1U5KA 4JOIA 3M4OH 3BU2A 1IBLQ 1K8OA 1PH1A 1VQ4A 3M3YH 4DK0A 1K8GA 1VQ8A 1VMCA 1Z7TA 4FP5D 4YIJA 2E8GA 4JI8L 2EIFA 4A3EG 2VZAA 4LK1C 2UUBL 4DR1Q 1QVCA 1K83B 4DUZQ 5C0XH 3H91A 5DEHA 1GHKA 4RCNA 1R9TB 5ELOA 2NB0A 5CV7A 5IGFA 4FXKC 1TS5A 4RG1A 4UP8A 3MFGA 5JPNC 1II3A 3IFTA 1PH3A 1FGBD 1QUQB 1QWYA 5C3XA 2VQEQ 2L4NA 2PCFB 2F0LA 5JJLA 3HOVG 4A3FG 4JBJA 2UU9Q 2F0SA 1F77A 1EY9A 1YEZA 1F9RA 1HZ9A 2NYZD 3GD7A 3KLSA 4JI1L
chains in the Genus database with same CATH topology
4RKBA 1AW7A 1FR3A 1Q90A 1EY8A 5J22A 2WKDA 2LFNA 4PMBA 5M5XB 4EQOA 5C0XJ 4L8JA 1M8AA 2CVRA 1D6EC 3PUYA 4XQQA 4KY5A 1JCKB 4K2KA 3T53B 2GA4B 4DXFA 2MHVA 5JEAH 1TVXA 1F9SA 3VR5A 2K1BA 5D3DA 3H09A 4E6IA 1S5DD 2KEDA 1ICWA 1CTMA 3I72A 3WOEA 2OF1A 1ZYRD 2N55A 2E2IB 1VF5C 2TSSA 1PFNA 4A3EB 1JB3A 1ONLA 1XWEA 3MEHA 5I6YA 1A6XA 2QEJC 1GUGA 4XDXA 1F2LA 1EY6A 5JEAJ 1SE2A 2FINB 5IGGA 3M7NA 3K5MA 3BVMA 4ZYSA 1E2WA 4PNYA 2EPBA 4V0BA 1NCVA 2G9DA 4C1NK 1V1PB 3R2TA 1CM9A 2DY7A 1F2ZA 4DNTB 5D65A 2IPKD 1J9OA 3H94A 5EJWA 1Z6HA 3M4YA 2HDMA 2KCCA 5DAUA 2WV6D 1O7ZA 3BYYB 1IKLA 1QG7A 1VMPA 1B1ZA 3EQLC 1GXDC 2BCOA 4JBWA 1U4RA 3OMCA 1T5XD 1ML0D 4ZAIA 5DNFA 2F0PA 1PTOB 5FLXL 3MA2B 3FPPA 2F0HA 1QNUA 3K57A 1OXUA 3E0JA 4K6DA 4KY7A 1TY0A 2JA8B 5M3MB 1LTID 2A73B 2B2TC 2HUGA 3SK4A 2L55A 2RKSA 1HPCA 3I4NB 3QJYA 1STNA 1F9PA 2F0DA 2O4XA 1QCBD 1EWCA 3TP5A 4OIKA 4QIWB 5ISRA 1Q8IA 4L63B 5G3LF 4ME5A 3BZDB 2PZUA 4KY6A 4KMUC 4KN4C 2ICIA 3SEBA 2B63B 5I2YA 3URYA 3R3OA 1DXMA 3I90A 5JVG3 3I70A 1SNOA 1Q1BA 3K5LA 4BS9A 2AWNA 3T13A 2NUCA 2WB1B 1PRTB 3BYTB 1STBA 1QNKA 3A7LA 4FXDA 4KI0A 2F03A 2XSCA 1PTOH 1H9RA 3QOLA 3GTJB 4S3SA 3VA5A 4ZKCB 3GTQB 3NXWA 1HCZA 4KK7A 3FKIB 2AUKA 4K14A 4DAYA 1ENFA 3DWQA 3W2DA 4BWGB 5FOBB 2FHTA 3WOFA 1FNVA 3IFDA 1JWSD 4HCSA 3BS1A 2JA5B 5T1GA 4ID6A 2PMZB 1JQYD 5ELEA 1D5MC 2YYZA 2OEOA 1A15A 3ONAB 4C3JG 4PMWA 1PLFA 4CJ2C 1Q12A 1TT2A 1ZXTA 1STGA 4FF2A 1I4QA 1GUNA 5JPMC 3SDZA 4N9TA 3KK7A 5A2QE 3S2DB 3BDLA 4XT3B 2NZ1D 2PO4A 4O42A 3PUVA 3ZYYX 1B9MA 4MHEA 2EYJA 1DJRD 3I8ZA 4A3BB 5G3LD 1T5EA 4DK1A 1MSGA 2F0IA 2WINB 1BF4A 3GTPB 1PDQA 2IX3A 3T4AC 3T56B 3BVZA 1Y1VB 2JYOA 5KNCA 5F2DA 1E2VA 2JXMB 1M4VA 4RH6A 1OXXK 1S5BD 3HOYB 5TSSA 1AP0A 2FFKB 1WTOA 4RFBA 2B2UC 1KTKA 4ZQ3A 1HHVA 1ESFA 4K8IA 1O80A 2EVBA 1A3VA 5EBDA 2I46A 1BXTA 4DA2A 1CQFA 3G7LA 2FMCA 1D2BA 1HFGA 3OSOA 5C4HA 1JWUD 5CV6A 1SYDA 4I65A 2RVLA 2Q8RE 4KN7C 3D31A 3SR1A 2KQ3A 2A6EC 2H4OA 1BCPD 1HXYD 1CT1D 3W3AA 3DEOA 4G57A 1NAPA 2HQEA 4H13C 1PRTD 1PFBA 4XT1B 5HURA 3LNNA 3EVQA 4A3JB 1LV9A 2L1BA 1PYWD 1KLGD 1PZID 2SEBD 3D3RA 2KUMA 3L9AX 4DN4M 2Q8TA 2O2LD 1I4HA 2BE5C 1KDCA 4TRDA 1G91A 3HG9A 1PMRA 1C48A 2R3ZA 2EDGA 1GJXA 3HOWB 1WTPA 2E75C 3M3YB 4IFDI 1WTQA 5EKIA 3MWYW 2NVTB 1KAAA 4FNFA 2A6HC 3CRKC 1OXTA 3K6OA 1KNEA 5LHY1 3C1FA 3FVQA 3U9SA 1HQMC 3WDNA 4OHJA 3HP3A 4B08A 4A3GB 2XIWA 4C3HB 2PW5A 2B2YA 3QOJA 2L11A 3RZOB 2NVQB 4DXGA 1G6ZA 3RMHA 4A93B 1D5ZC 4V190 1IYVA 5CC4A 3SK8A 1STYA 5BN4A 2B2VC 1L0YB 4KKSA 1V1OA 1SAPA 1HTPA 2F0OA 1ZYRC 1CFMA 5C0XI 3TDQA 5J39A 3KUPA 3NK9A 3F2UA 4FF1A 3X3NA 1TWHB 3P75A 1X3PA 1WD0A 1QB5D 3Q23A 1CZWA 2WIIB 1LT5D 1QE6A 4BY7B 4KJOA 4H0LC 4QCLA 1RF2D 2B2YC 2LY7A 1I6VC 4RHSA 3OPOA 1HUMA 4BA2I 4U68A 1YNND 1EEID 2K04A 5EQ0A 1K8MA 1WCMB 2J7ZA 2R92B 1WTWA 1D1KA 2DNEA 2EZVA 2JA7B 3TZDA 1IL8A 3QB3A 4G7OC 3J81L 1Q1EA 3HZXA 4Q5VA 3FRPB 3NE5B 3S16B 4BA1I 3ND8A 5KYLA 2HCCA 5I9PA 5K5PA 5C3EB 4A3MB 3SVMA 2NTSA 5NUCA 3R93A 4OL7A 4OO1H 3OOCA 1B50A 1B44D 3NPPA 4EGVA 4BBRB 4C3IB 2J4XA 3EJIA 3MVVA 2O5IC 3A8JE 1HA5A 3K7AB 3DMUA 4DU9A 1CZGA 5FK9C 3NTHA 3GO5A 3DM1A 1W6JA 4M8AA 2PPBC 5IGDA 2NWGA 4UDUC 2F0MA 5FKAC 4KKTA 2XRQD 3E5SA 2EYPA 3O13A 1PXUA 2EYOA 5BN5A 3DWAA 3OIQA 2VUMB 4ABNA 5FO8B 3LX0A 4IALA 1DZ1A 4BBSB 5ELBA 1EYAA 2A68C 4DF7A 5M5YB 3S1MB 1U9RA 1G291 1IW7D 1SE3A 5CYUA 3H3VC 4LJZC 2KOLA 2MUYA 4IN3A 1I4GA 2PQEA 1LT4D 4CKEA 1RJTA 1SYFA 4IFDG 2F0TA 1CI3M 4M1UB 1C8CA 5IGBA 5C44B 1PTOC 3RLFA 4RA8A 1CHPD 1EIGA 2K32A 2L12A 1LTSD 3D6CA 5CMDA 2AQ3B 4K2LA 2RDGA 4I7ZC 1H9SA 3H6MA 5KEEA 3T51B 3VYRA 3X3MA 2RBMA 3TSSA 1DONA 3MAQA 2I07B 3PUZA 1STHA 1YNJC 3J81E 1HRJA 1I3QB 3IKJA 2BDNA 4CHTB 1SNQA 5I9OA 2A68D 3MXUA 1LACA 1SYEA 4FYDA 2JEAI 2Q8IB 1U4LA 3OWFA 3QO2A 1EOTA 2A6ED 1NR4A 1JWMD 2X6LA 3MXPA 1RKNA 2ID0A 1FNWA 1S5CD 1HA6A 4IFDJ 4WRDA 1SYGA 1C4QA 1G2SA 1JORA 2M00A 3MXGA 3V05A 1EZ6A 3EROA 3TMEA 3M4OB 2MGSA 2F0FA 3I73A 3S1NB 1LTAD 3S17B 1TS4A 2D2CC 4R8NA 1WTRA 3VR3A 3ND9A 4C3IG 1WD1A 3PIO3 4KD3A 5FO9B 3DWPA 2EY5A 2Z4IA 5JEAG 1FD7D 4PQXA 1SDFA 4K5XA 2EY2A 3VYSA 1ZEQX 2JEBI 1EY5A 1EFID 1GUWA 3PUXA 2O5JC 3TP7A 1WTXA 3Q24A 3S9WA 1HUNA 2DNCA 4HN7A 2DY8A 3GTMB 1O78A 1TWAB 3GV6A 3P20A 4CBVA 4XYOA 5I4DA 3AU7A 3TBIB 3PV0A 2K5WA 3VR2A 2F0QA 3SK5A 3GTKB 1EQVA 2RA4A 1JOQA 3P1HA 2SNSA 4G7ZC 1DOLA 2K05A 2TMPA 4ZKBB 5COYA 4EVOA 2OXPA 4OGQC 3C3LA 4OIJA 4IQZA 2SOBA 4QMGA 4KKUA 1MD2D 3S2HB 5CR3A 1WTVA 4XQNA 3JAML 1SBBB 2FMMA 1D5XC 3OWEB 4C3JB 1A2TA 3EA6A 1Y8PB 2EJFC 3K5NA 2PZWA 2H1EA 4DAPA 5JAVA 2AUJD 1CQVA 4IZ8A 5KRUA 2KA7A 5E4XA 3J80E 1CA6A 3DUZA 3GV3A 4MIUA 5C5MA 4CJ1B 1BBXC 2KECA 3QWNA 4K6LA 1GOZA 2NN6G 5EKLA 3PO3B 2R93B 2R6GA 3R8BA 3C1EA 2RSOA 4XXEA 1DOKA 3RUZA 3T16A 1EYDA 4KTAA 2Y0SB 3AMUA 1V43A 4NKLA 2EXZA 3TN2A 4X3UA 2FJ2A 2Z4HA 1ENAA 3J80L 4DNRB 1F2YA 1SMYC 1JR0D 4J6HA 4CKCA 1CHQD 3SXHA 4HAEA 3J7AV 2F0KA 4RHRA 3A8IE 4RGOS 1B9NA 5DM63 3VR6A 1BDOA 4PV1C 3NTKA 1STEA 3I4LA 1LABA 4F88A 3SE0A 1LLRD 4IUQA 3I91A 3VR4A 2B2WC 3I4MB 3D4RA 5CV8A 3Q6SA 3A8KE 1EY4A 4LAAA 2A6HD 3HOZB 1DCZA 3UI2A 2ZXPA 2RQXA 5D3IB 4G7HC 2YU9B 3FEWX 2K03A 3N6RA 3TZUA 2RSNA 2QKIC 4B9WA 1I4XA 2J0TD 4XQJA 4RWSC 1NR2A 2RDFA 1TR5A 4IUVA 2QF7A 5CGKA 3LWEA 1SE4A 2F0UA 2K28A 3AB9A 2NVYB 5KIXA 3P7JA 5I6WA 2VNUD 1EIHA 1AZQA 5A35A 3MFYA 4HMIA 1WVLA 1VF7A 5FO7B 4XYQA 5AFWA 4ZRZA 2N88A 2D9UA 2PZTA 1PRTF 3NHHA 1FYCA 1B2TA 5CV4A 5LL6X 2F0GA 3DHQA 3CHBD 3Q0AA 1Q3LA 4KV6A 1H9KA 3MZ5A 1Z47A 1MBYA 1I50B 2MPMA 1VDZA 4IUPA 1G2TA 5CV5A 3NTIA 5CORA 4FVMA 1A3TA 4CKBA 3S15B 1RHPA 5EPLA 2QCPX 2PW7A 4PMCA 4EQPA 4TQUS 3C2PA 2BDOA 3OIPA 2B8GA 4QUCA 5CV9A 1E0BA 1HQRD 2L0CA 4R9WA 3HEJA 5JJZA 1EY7A 3M7GA 1TWGB 4OO1I 2A5HA 2XVSA 2A69D 1BNZA 4A3KB 3CU7A 1SSOA 1BCPC 4J1MA 1H9JA 1B53A 5FLXE 5IT9L 2KCNA 4X3SA 3H0GB 1KDBA 4R8IA 3PMFA 5CBEE 3CRLC 5IGCA 3BVGA 2PNRC 1JE4A 1SMYD 3ERQA 1IHZA 2WKCA 1W6KA 1A2UA 1SYCA 4IUNA 2BA0A 2OT2A 1PFMA 5ELDA 4ZUIA 5M3FB 3BG3A 1AEXA 3GTGB 3SK6A 4LMQD 1ET6A 4A3IB 1EEFD 2NN6H 4K5VA 3GTLB 2DN8A 2IW3A 1UAPA 4C2MB 2IWHA 1ILQA 1QILA 1UNSA 3A56A 3FMCA 4DAVA 1DM0B 5CBAE 2F3WA 1LTGD 2CHBD 1O7YA 3D4DA 4MN3A 3MHBA 1EL0A 4ZUJA 3A7AB 3VA7A 2B39A 3OW7A 2IL8A 1LT6D 1B3AA 2K7VA 2JE6I 3JAME 1O7LA 1V1PA 2EYMA 3K59A 2LS01 1NUCA 1S5FD 2E2DC 3MTSA 2CQAA 1U4PA 1J8IA 3FDTA 3ITPA 2X6GA 4RCOA 2QILA 1EZ8A 2BOSA 2E76C 4IFDH 4FF3A 3PO2B 2B2WA 1SJED 1A3UA 2B8FA 4C3HG 5M9OA 2K6AA 5A2QL 2F4IA 5IODA 5C0XG 5JVH3 1F9QA 1Y69U 2EOTA 4B9XA 2A74C 5HGTA 5C4ZA 1EY0A 4ODGA 2EYLA 5IOCA 2VB2X 1PZJD 3MXNA 4K8JA 1ESRA 3VYTA 4JK1C 4N9PA 3J7YW 1UEAB 2ICEC 2E2JB 2VXWA 1I4RA 5K36H 2EY1A 2M9VA 3NWSA 5IIFA 1Y1WB 1QOHA 2IJ0A 1NSNS 1ZKOA 2EY6A 2F0NA 3N52A 1X32A 1BQQT 1TKWB 4FF4A 3RZDB 5C4XB 1G8ZD 2X69A 2AWOA 3HOUB 1H9MA 1TU2B 1H9SB 3K58A 4H44C 4P2CB 4BY1B 1EYCA 1TQOA 3HGBA 4IUTA 2ZXRA 1XYIA 2M2LA 4DFAA 3OHXC 4NW2A 4H7BA 4TSSA 3HKZB 1SYBA 1D1IA 4RAUC 2NBFA 3MC0B 5E1FA 1TIID 2Z1CA 4EQNA 1BCPF 5ELFA 2F3VA 3HOXB 2D5DA 4KHZA 1GUSA 5C5LA 5ELCA 3S14B 2MP1A 3A55A 5LL6S 4RGNA 2JA6B 1R4PB 4Y7NB 1MGSA 4HTHA 1LT3D 1RTOA 1BR9A 3NSWA 1XXGA 3NQIA 1SXTA 4QB4A 1SEBD 3D4WA 5C3WA 1UUPA 2B2VA 2XRSD 1L0XB 2SDFA 4IURA 3DEPA 2HCIA 3NWTA 3QG1A 1SNCA 2AQ2B 3BDOA 4RKLA 3SHLA 2LMCB 1VCIA 4FXGC 1ENCA 3S1QB 4Q0FA 2IX0A 2E74C 4HSVA 1OXSC 2VB3X 3C46A 3M85A 1SNMA 4WJWA 3CKIB 4XTCS 1SJHD 1ET9A 3GTOB 1RTNA 3OMGA 4A3FB 1LTBD 1X3QA 1CK1A 3CQZB 5BN3A 1SNDA 2EJGC 3KBGA 4KJNA 4F7XA 2NVXB 2F0JA 1IYUA 1DOMA 2E2HB 3EFXD 1EWHA 3HS0C 4ULLA 2A69C 4CGYB 1LTTD 3NBHA 2IT1A 5DM73 2BA1A 3IAYA 4AYBB 3PUWA 4F8MA 3G6JB 1EU4A 1GHJA 1MI2A 4GZYC 4NMZA 1YNJD 4C1NI 2CW0C 2EYFA 2XN9C 4CJ0B 1JOOA 2XNAC 2WACA 1QJOA 4TKOB 1KABA 1KNAA 1Y8OB 1PZKD 1PRTC 1HFNA 5KGUA 3RD4A 3IL8A 3TP6A 4U673 3L7ZC 2F0WA 1CA5A 2LKVA 3NQTA 1S5ED 4HEDA 2HDLA 2C5CA 4X3TA 1B4OA 1JC7A 2K5DA 2K01A 1OO9B 1STAA 4FO2A 4F87A 4HMJA 3V96A 2PYKA 1EQTA 3D6WA 2BE5D 1SFOB 4K5WA 2JP1A 2R7ZB 2G9HD 2KEEA 5EPJA 1TS3A 2B2UA 2R61A 1TWFB 2K33A 2L9HA 2ZXOA 3E6ZX 4X3KA 1XX8A 1AFPA 5C6AA 2D62A 5EKKA 1S4ZA 1KDAA 2CW0D 1TWCB 2IX1A 5EPKA 3LWUA 2EE1A 3QIAA 2RDHA 3KLRA 4Z9CB 1JOKA 4G4KA 5KNBA 1RCVD 1LTRD 1HTLD 4KHVA 1EU3A 1Y8NB 1V8QA 1F2MA 3NBIA 4O1NA 2B2TA 1TS2A 4KD4A 4XIGS 1JICA 2SNMA 2F0VA 5EBCA 1TY2A 1IKMA 4NP5A 4ZLTF 2EJMA 3GP7A 4ILWA 5E4WC 3DXJC 1IW7C 1DYQA 2XWJB 3J7AF 3D8GA 2WP8J 4RGMA 2ENBA 4RGTA 1AZPA 2F1MA 1OXVA 4L6TB 1RODA 5EGTA 4NDXA 1PTOD 4DGZA 4UAIA 5T1IA 1MSHA 4HR7B 1GUTA 5E3FA 1I4PA 2KHSA 2V4DA 3L3OC 1BCPB 3NP8A 5KNDA 4HCEA 3HRZC 3A54A 2NTTA 2ZT9C 3KLSX 2NN6I 1SNPA 2AQ1B 4WFN3 3V2TA 4OO1G 4IUUA 1YNNC 2Z8LA 3TP8A 2KJXA 1PTOF 1AN8A 4QUFA 3K5OA 5M5WB 3KBXA 2JSOA 3I3CA 1BOSA 1U4MA 3Q22A 1ILPA 4HSPA 5I2XA 1DD2A 3S1RB 2EYHA 2L5TA 3NUCA 5C4JB 3KF8A 2XWBB 3HOVB 5J1ZA 5KYIA 3VYUA 5JOBA 2QDBA 2C9OA 2KVMA 1I6HB 5IGEA 3R2IA 4C56C 1BUVT 2K5QA 3BDCA 3GQBA 2F0EA 4ZK9B 4WORA 4J8QA 1GUOA 5IT9E 4QF4A 1LO5D 3U9OA 1E2ZA 1KLUD 3FPUB 5K36G 3PIP3 2MJ8A 3K0YA 1BO0A 4A3DB 1RDPD 1XTCD 1R4QB 1FNUA 2WAQB 1RD9D 5D14A 1K8OA 4DK0A 1VMCA 1Z7TA 4FP5D 4YIJA 4LK1C 1K83B 5C0XH 3H91A 5DEHA 1GHKA 4RCNA 1R9TB 2NB0A 5CV7A 5IGFA 4FXKC 1TS5A 5JPNC 3MFGA 1II3A 3IFTA 1FGBD 1QWYA 5C3XA 2L4NA 2PCFB 2F0LA 2F0SA 1F77A 1EY9A 1F9RA 2NYZD 3GD7A 3KLSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VYU A;  2Z1C A;  3D3R A;  3VYS A;  2OT2 A;  3VYR A;  3VYT A; 
#chains in the Genus database with same CATH topology
 4RKB A;  1AW7 A;  1FR3 A;  1Q90 A;  1EY8 A;  5J22 A;  1A63 A;  1N36 Q;  2WKD A;  3PIO A;  2LFN A;  4PMB A;  3D0F A;  4BY1 H;  5M5X B;  4EQO A;  5C0X J;  4L8J A;  3CCU A;  1M8A A;  1JB7 A;  2CVR A;  1D6E C;  3PUY A;  4XQQ A;  4KY5 A;  1JCK B;  4K2K A;  3T53 B;  2GA4 B;  4DXF A;  2MHV A;  5JEA H;  1BBU A;  3G6E A;  1TVX A;  4NXM L;  1F9S A;  1L1O B;  3VR5 A;  2I0Q A;  3I2Z A;  2K1B A;  5D3D A;  3H09 A;  1V1Q A;  2JA5 H;  4E6I A;  1S5D D;  2KED A;  1ICW A;  1CTM A;  3I72 A;  3M4Q A;  3WOE A;  4A75 A;  5FLM G;  2K14 A;  2OF1 A;  1ZYR D;  2N55 A;  2E2I B;  1VF5 C;  2TSS A;  2CH4 A;  1PFN A;  4L5Q A;  4A3E B;  1JB3 A;  1ONL A;  1PVO A;  1LTL A;  1IXR A;  1XWE A;  2VY3 A;  4Y7N H;  3MEH A;  5I6Y A;  1A6X A;  2QEJ C;  1GUG A;  1PH6 A;  1IBK L;  1GKH A;  4XDX A;  1F2L A;  1EY6 A;  5FLM H;  3RN5 A;  5JEA J;  1SE2 A;  2FIN B;  5IGG A;  3FKI G;  3M7N A;  3K5M A;  1S40 A;  3BVM A;  4ZYS A;  1E2W A;  1HH2 P;  4PNY A;  4DR2 Q;  2EPB A;  3PGZ A;  4V0B A;  1NCV A;  2AKW B;  2G9D A;  4AQY Q;  3S2D H;  4C1N K;  4O0A A;  1QVF A;  1VS0 A;  1Y14 B;  1V1P B;  3UDI A;  2VL6 A;  3R2T A;  1CM9 A;  5IE8 A;  4QY7 A;  2DY7 A;  4A3E H;  1F2Z A;  4DNT B;  2JA5 G;  3K7U C;  3CCS A;  5D65 A;  1I3Q H;  2IPK D;  1NMG A;  1J9O A;  3H94 A;  5EJW A;  1Z6H A;  3M4Y A;  5GAH C;  1MHW C;  2HDM A;  2KCC A;  3CPF A;  5DAU A;  4ALP A;  3F2B A;  2WV6 D;  4YCU A;  1JMC A;  1O7Z A;  3BYY B;  1IKL A;  1TWC H;  1MJE A;  1QG7 A;  4BBR G;  3CC7 A;  1VMP A;  1OTC A;  1B1Z A;  1H95 A;  3CD6 A;  1L1O A;  3EQL C;  3J81 j;  4DUY L;  1GXD C;  2BCO A;  4JBW A;  4UHV A;  1U4R A;  3OMC A;  1T5X D;  4A3D G;  2E2H H;  1ML0 D;  3CCV A;  4HID A;  2CKZ B;  4IPH A;  2IHF A;  4ZAI A;  5DNF A;  2F0P A;  1NJI C;  1PTO B;  5AJ3 Q;  4BBS G;  4A3B G;  5FLX L;  3K7A H;  3MA2 B;  4LF4 Q;  2L15 A;  2E2I H;  2CQO A;  3FPP A;  2XTI A;  3T1H L;  2F0H A;  1QNU A;  5M5X H;  2VUM G;  3K57 A;  1OXU A;  1EYG A;  2CFM A;  3PF4 A;  3E0J A;  4BBS H;  4K6D A;  4KY7 A;  4LFC Q;  1TY0 A;  1M90 C;  2JA8 B;  5M3M B;  1LTI D;  2A73 B;  3M4P A;  1TWG H;  2B2T C;  2HUG A;  3SK4 A;  2HIV A;  2I5M X;  2L55 A;  2RKS A;  1HPC A;  3I4N B;  2OWO A;  4LFB Q;  3QJY A;  3PQI A;  2ASB A;  4O2D A;  1STN A;  4DR6 L;  1TWH H;  1F9P A;  2F0D A;  2O4X A;  2ZJR A;  1QCB D;  5GRO A;  3J81 i;  1EWC A;  3VDY A;  1UWV A;  4AIM A;  3TP5 A;  4OIK A;  4QIW B;  5ISR A;  5BR8 L;  4JI2 Q;  1Q8I A;  1VQ9 A;  4L63 B;  3L0O A;  5G3L F;  4ME5 A;  3BZD B;  2HT1 A;  4DV3 Q;  2PZU A;  4KY6 A;  4KMU C;  4KN4 C;  1Y1V H;  2ICI A;  3SEB A;  2Z6B A;  2B63 B;  1TXY A;  5I2Y A;  2ATW A;  3URY A;  3R3O A;  1DXM A;  3I90 A;  5JVG 3;  3I70 A;  1SNO A;  3KOJ A;  1Q1B A;  2HHH Q;  3K5L A;  5IP7 G;  4BS9 A;  5LMU L;  2AWN A;  3T13 A;  1WCM G;  3LGJ A;  2NUC A;  2WB1 B;  1PRT B;  3BYT B;  4KLK A;  1STB A;  1QNK A;  1IBL L;  3A7L A;  4FXD A;  4KI0 A;  2F03 A;  2XSC A;  1PTO H;  1H9R A;  3QOL A;  3GTJ B;  4JYA Q;  4S3S A;  3A74 A;  3VA5 A;  3J80 i;  4X64 Q;  1WJJ A;  1Y1V G;  4ZKC B;  3K80 C;  3GTQ B;  3NXW A;  1HCZ A;  4KK7 A;  3FKI B;  2AUK A;  4K14 A;  4DAY A;  1ENF A;  4PZ6 A;  3DWQ A;  4DR5 Q;  4A3I H;  4DPG A;  3DLL A;  2PQA A;  3U50 C;  2Y0S E;  4APV A;  3W2D A;  4A3M G;  4BWG B;  5FOB B;  2KCM A;  2FHT A;  3WOF A;  4JYA L;  1FNV A;  3IFD A;  1JWS D;  4HCS A;  3BS1 A;  2JA5 B;  5T1G A;  2JA8 H;  4ID6 A;  4MTN A;  2PMZ B;  1JQY D;  5ELE A;  4HJ7 A;  2GVB A;  1D5M C;  2YYZ A;  2OEO A;  1HNZ L;  1A15 A;  4CDD C;  3ONA B;  4C3J G;  4PMW A;  1PLF A;  4CJ2 C;  1Q12 A;  1TT2 A;  4GOP A;  1ZXT A;  3CCM A;  3G71 A;  1STG A;  3S17 H;  4FF2 A;  1I4Q A;  3CCQ A;  2NVT H;  3AEV A;  1GUN A;  1N33 L;  2GVA A;  4X62 L;  3BJU A;  1I6H H;  2JQO A;  5JPM C;  2D0O A;  3SDZ A;  1PH4 A;  1YHB A;  4BY1 G;  3ULP A;  4JC0 A;  4N9T A;  3KK7 A;  5A2Q E;  3S2D B;  3BDL A;  4HIK A;  1VQP A;  2FXQ A;  4XT3 B;  2NZ1 D;  2PO4 A;  4O42 A;  2K75 A;  1X3G A;  3PUV A;  4JBM A;  2CWP A;  3ZYY X;  1B9M A;  4MHE A;  2EYJ A;  1DJR D;  3I8Z A;  1E3P A;  5G3L D;  4A3B B;  1T5E A;  4DK1 A;  5IYD G;  3T1H Q;  1MSG A;  2F0I A;  2N49 A;  2WIN B;  4DR2 L;  1BF4 A;  2EXD A;  3GTP B;  1PDQ A;  3MXN B;  5IT9 c;  2IX3 A;  3T4A C;  3T56 B;  3BVZ A;  1Y1V B;  2JYO A;  5KNC A;  5F2D A;  1HNX L;  1E2V A;  2JXM B;  1M4V A;  4RH6 A;  1OXX K;  1S5B D;  3HOY B;  5TSS A;  1VQH A;  3TS0 A;  3I55 A;  2QDL A;  1AP0 A;  2FFK B;  1WTO A;  4RFB A;  2B2U C;  1KTK A;  4ZQ3 A;  1HHV A;  1ESF A;  4DV4 Q;  4LF8 Q;  4K8I A;  1O80 A;  3GTL H;  3NBH B;  1ICF B;  4DR3 L;  2EVB A;  1MKH A;  1A3V A;  2PMZ E;  3PSI A;  3PO2 H;  5EBD A;  2I46 A;  5LMU Q;  4WJ3 M;  2A8V A;  1BXT A;  3L2P A;  2Q2T A;  1XPO A;  4OWW B;  4DA2 A;  1J5E Q;  3AQQ A;  1CQF A;  3G7L A;  2FMC A;  4GNX C;  4A3K G;  1D2B A;  1KQS A;  1HFG A;  3OSO A;  5C4H A;  4YY3 Q;  1JWU D;  5CV6 A;  1SYD A;  4I65 A;  2RVL A;  4YHH L;  2Q8R E;  4KN7 C;  3D31 A;  3SR1 A;  2KQ3 A;  2A6E C;  2H4O A;  2XGT A;  1BVS A;  2G5D A;  4DK3 C;  1CSQ A;  1BCP D;  1HXY D;  1CT1 D;  3W3A A;  3DEO A;  4A3I G;  1N8R C;  2OQ0 A;  4G57 A;  1NAP A;  4A3J H;  2I5H A;  2HQE A;  4H13 C;  1W2B A;  3J7Z C;  5H1S E;  1PRT D;  1PFB A;  4XT1 B;  5HUR A;  3LNN A;  3EVQ A;  4A3J B;  1XTD A;  1LV9 A;  2L1B A;  4IOA A;  1PYW D;  4P72 A;  1KLG D;  1N34 Q;  3PIP A;  5AJ3 L;  4LFC L;  1PZI D;  2SEB D;  3D3R A;  2KUM A;  5LMN L;  2B3G A;  3KLW A;  2JA9 A;  2RCF A;  1SMX A;  3CXC A;  3L9A X;  4DN4 M;  1EQR A;  2Q8T A;  4JV5 L;  2O2L D;  4DR6 Q;  1I4H A;  1NMF A;  2BE5 C;  1KDC A;  4TRD A;  4AQY L;  1G91 A;  1GM5 A;  3HG9 A;  1PMR A;  4JI7 Q;  1C48 A;  2R3Z A;  2EDG A;  1X54 A;  4QJF A;  3TRZ A;  4JBK A;  1GJX A;  3HOW B;  1JT8 A;  1WTP A;  2E75 C;  3M3Y B;  3ERS X;  1PH9 A;  4IFD I;  1WTQ A;  5EKI A;  2EQS A;  2KCT A;  2MO0 A;  3MWY W;  1WTH A;  2NVT B;  3HOW H;  1KAA A;  4FNF A;  1P16 A;  2BH2 A;  3NEL A;  2A6H C;  2JA7 G;  3CRK C;  4NB3 A;  1OXT A;  4A3L H;  3K6O A;  1KNE A;  5LHY 1;  2MQH A;  3C1F A;  3FVQ A;  5BR8 Q;  3U9S A;  1HQM C;  3WDN A;  4OHJ A;  3HP3 A;  4B08 A;  4DUY Q;  4A3G B;  3U4Z A;  2XIW A;  1K3B C;  2RHQ B;  4C3H B;  2PW5 A;  2B2Y A;  3QOJ A;  2L11 A;  3RZO B;  2NVQ B;  4DXG A;  2WB1 E;  3TS2 A;  1G6Z A;  3RMH A;  2R7Z G;  4A93 B;  1IL2 A;  1SE8 A;  1D5Z C;  4V19 0;  2JN4 A;  1IYV A;  5M5Y H;  5CC4 A;  3SK8 A;  1STY A;  5BN4 A;  1BBW A;  2B2V C;  1CUK A;  1L0Y B;  4KKS A;  1V1O A;  1SAP A;  1Q82 C;  1HTP A;  2OTL A;  2F0O A;  1ZYR C;  1CFM A;  5C0X I;  3TDQ A;  3RLO A;  5J39 A;  3JC6 6;  3KUP A;  3NK9 A;  3F2U A;  4FF1 A;  2R92 H;  4JI5 L;  3X3N A;  1TWH B;  1VQG A;  3P75 A;  1X3P A;  3I56 A;  1WD0 A;  2ZJQ A;  1QB5 D;  3Q23 A;  3AFQ A;  3CF5 A;  2Z6K A;  1CZW A;  2NVQ H;  2WII B;  1LT5 D;  3OW2 A;  1QE6 A;  4BY7 B;  1K9M C;  4KJO A;  4H0L C;  5C4X G;  5IYD H;  4LF6 L;  3HOV H;  4QCL A;  5IP9 G;  1A62 A;  1RF2 D;  2B2Y C;  2LY7 A;  1I6V C;  4RHS A;  3OPO A;  2QEX A;  1HUM A;  4BA2 I;  3HKS A;  4U68 A;  1YNN D;  1HNW Q;  1EEI D;  2K04 A;  4AYB E;  5EQ0 A;  1K8M A;  1WCM B;  1FJG Q;  1IYJ B;  1C0A A;  1P8L A;  2J7Z A;  2R92 B;  1WTW A;  4JOI C;  1D1K A;  2DNE A;  3A5U A;  2EZV A;  2JA7 B;  3TZD A;  4YCW A;  1IL8 A;  4L5R C;  3OTO Q;  2ZTC A;  3QB3 A;  4G7O C;  3J81 L;  3H15 A;  1Q1E A;  3HZX A;  4Q5V A;  4JI6 L;  4B3S Q;  3FRP B;  2MNA A;  3NE5 B;  3S16 B;  4BA1 I;  3ND8 A;  3HKZ G;  5KYL A;  1VQN A;  2HCC A;  4OWT B;  5I9P A;  4A4I A;  5K5P A;  2GN5 A;  5C44 G;  5C3E B;  4A3M B;  3SVM A;  4R1J A;  2NTS A;  2PI2 E;  5NUC A;  3R93 A;  2JA6 G;  4OL7 A;  4OO1 H;  2KEN A;  3OOC A;  1B50 A;  1B44 D;  3NPP A;  4EGV A;  4BBR B;  4C3I B;  3CC4 A;  4GKJ L;  2J4X A;  5L37 A;  3EJI A;  1WI5 A;  3MVV A;  2NVX H;  2O5I C;  1HR0 W;  4JI0 L;  5LMN Q;  3WWV A;  4DAY B;  2ZJP A;  3STB C;  3A8J E;  4QL5 A;  2JA6 H;  1HA5 A;  3K7A B;  3DMU A;  4DU9 A;  1CZG A;  5FK9 C;  3NTH A;  4POG A;  4BXX G;  3CQZ H;  1XPU A;  3GO5 A;  4HJA A;  4YWL A;  3DM1 A;  4N8F A;  1W6J A;  4M8A A;  2PPB C;  5IGD A;  4OWX B;  4B3M Q;  2NWG A;  4UDU C;  2F0M A;  2NZH A;  1FL0 A;  5FKA C;  4KKT A;  2XRQ D;  2HQL A;  1EFW A;  3E5S A;  2EYP A;  3G48 A;  3O13 A;  1PXU A;  2EYO A;  5BN5 A;  2A19 A;  3DWA A;  2K52 A;  3OIQ A;  2C35 B;  1Q8K A;  2VUM B;  4ABN A;  5FO8 B;  2UUA Q;  3LX0 A;  4IAL A;  1N34 L;  1DZ1 A;  4BBS B;  4X6A H;  5ELB A;  1EYA A;  2A68 C;  4DR7 Q;  4DF7 A;  5M5Y B;  3S1M B;  1U9R A;  2VUM H;  1G29 1;  1IW7 D;  1SE3 A;  5CYU A;  3H3V C;  4LJZ C;  2ZTD A;  2KOL A;  3B6Y A;  2MUY A;  4IN3 A;  1I4G A;  4A3L G;  2PQE A;  1VQJ A;  1LT4 D;  4CKE A;  1RJT A;  1SYF A;  2D0P A;  4IFD G;  2F0T A;  2IY5 B;  1CI3 M;  5C4X H;  1KHI A;  4M1U B;  1C8C A;  5IGB A;  5C3E G;  5C44 B;  2WFW A;  1PTO C;  3T1Y L;  2YU9 H;  3RLF A;  4RA8 A;  3I4N G;  1CHP D;  1EIG A;  4R4T A;  2K32 A;  2L12 A;  3S14 H;  1LTS D;  4R4I A;  4LF6 Q;  3D6C A;  5CMD A;  2AQ3 B;  2R7D A;  4K2L A;  2RDG A;  3KF8 B;  4I7Z C;  4PG3 A;  4P74 A;  1H9S A;  3H6M A;  2R7Z H;  1YIT A;  5KEE A;  2E2J H;  3T51 B;  3VYR A;  3X3M A;  2RBM A;  3ULL A;  3TSS A;  4DR1 L;  5IYB G;  4JI3 Q;  1WCM H;  1DON A;  3MAQ A;  2I07 B;  2KHI A;  4PZ7 A;  3PUZ A;  4A3G H;  3A5Z B;  1STH A;  1YNJ C;  3J81 E;  4BY7 G;  1HRJ A;  1I3Q B;  3IKJ A;  1Z9F A;  2BDN A;  4CHT B;  1SNQ A;  5I9O A;  2A68 D;  4POF A;  3MXU A;  1LAC A;  3S16 H;  2UU9 L;  1SYE A;  4C2M H;  4FYD A;  2VQF L;  2JEA I;  3UDX A;  4HJ8 A;  4A3B H;  2Q8I B;  1U4L A;  2H5X A;  2RHS B;  1KD1 C;  3HOU H;  3OWF A;  3QO2 A;  1EOT A;  2A6E D;  1NR4 A;  3GTG H;  1JWM D;  2X6L A;  3MXP A;  1RKN A;  2ID0 A;  3OTO L;  1O7I A;  1FNW A;  1S5C D;  4H02 A;  1HA6 A;  4JW0 A;  2DJG C;  4IFD J;  4WRD A;  1SYG A;  1C4Q A;  2V1C C;  1G2S A;  1NY4 A;  1JOR A;  2M00 A;  4LF7 L;  3MXG A;  3V05 A;  1E1O A;  3K81 C;  1EZ6 A;  3ERO A;  3TME A;  3M4O B;  2MGS A;  2F0F A;  1PYB A;  3BZC A;  3I73 A;  4DKA C;  3S1N B;  1LTA D;  2Y0S G;  1EOV A;  4YHH Q;  3S17 B;  1TS4 A;  2D2C C;  4R8N A;  4A76 A;  5M3M G;  5IP7 H;  2E5L Q;  3K0X A;  1WTR A;  3VR3 A;  4NPS A;  1E7Z A;  3ND9 A;  4C3I G;  1WD1 A;  3PIO 3;  1PH7 A;  4KD3 A;  3S1Q H;  5FO9 B;  2NZO A;  2KHJ A;  4C3H H;  3GTQ H;  3DWP A;  1XMQ Q;  4JI5 Q;  2EY5 A;  2Z4I A;  5HGQ A;  5JEA G;  1FD7 D;  1YJW A;  4PQX A;  2UXC L;  4JI4 L;  3CCJ A;  1SDF A;  4K5X A;  1PYS B;  2EY2 A;  3VYS A;  3Q8D A;  1ZEQ X;  1XJV A;  1V9P A;  2JEB I;  1EY5 A;  5M3F H;  1EFI D;  3GTK H;  1GUW A;  4BXX H;  3PUX A;  2O5J C;  2N3S A;  3TP7 A;  1SFO H;  1WTX A;  3Q24 A;  3S9W A;  1VQI A;  2K4K A;  1G6P A;  1HUN A;  2DNC A;  4K0K L;  1XNR L;  4HN7 A;  2DY8 A;  3GTM B;  4DV2 L;  1O78 A;  1VQO A;  4QIW E;  1TWA B;  3H0G G;  3GV6 A;  3P20 A;  4CBV A;  4XYO A;  5I4D A;  3AU7 A;  2LXK A;  3TBI B;  3PV0 A;  4JI6 Q;  3HOZ G;  2K5W A;  1Q81 C;  4R4C A;  3VR2 A;  2F0Q A;  2QGQ A;  3SK5 A;  3GTK B;  5GAD C;  1YI2 A;  1EQV A;  2RA4 A;  4JI1 Q;  1A8V A;  1JOQ A;  3P1H A;  4P73 A;  2SNS A;  4G7Z C;  4AYB G;  3HOY G;  4DNI A;  1DOL A;  2K05 A;  2TMP A;  3HOY H;  3J80 c;  4ZKB B;  5COY A;  4EVO A;  2OXP A;  4OGQ C;  3C3L A;  1DGS A;  4OIJ A;  4IQZ A;  4LWC A;  4NXN Q;  4I7A A;  4HIO A;  2VQF Q;  2SOB A;  4QMG A;  4KKU A;  1U0L A;  1IBM L;  1Y1W H;  1MD2 D;  3S2H B;  4ME3 A;  5CR3 A;  1WTV A;  2VS1 A;  3I4N H;  4XQN A;  4B3T L;  3JAM L;  1SBB B;  2FMM A;  1D5X C;  4JI3 L;  1X56 A;  3OWE B;  4C3J B;  1GO3 E;  2R93 H;  1A2T A;  3EA6 A;  1Y8P B;  2ALY B;  2EJF C;  3K5N A;  1HR0 L;  3I4O A;  2PZW A;  2H1E A;  4DAP A;  5JAV A;  2CH4 W;  2R92 G;  1GD7 A;  4YWK A;  2AUJ D;  1CQV A;  4IZ8 A;  4LF7 Q;  1E24 A;  4IPD A;  4LF5 Q;  5KRU A;  4KHP L;  2KA7 A;  1TWF H;  5E4X A;  4A3C H;  5IYC H;  3J80 E;  3RNU A;  1CA6 A;  3DUZ A;  3J81 c;  1QZG A;  4B3S L;  3GV3 A;  1KRT A;  4MIU A;  5C5M A;  4CJ1 B;  1BBX C;  3GTJ H;  2KEC A;  2Z6K C;  3QWN A;  2Q2U A;  2UUC Q;  2YV5 A;  1E1T A;  1L2F A;  4K6L A;  1GOZ A;  5IWA Q;  2NN6 G;  5EKL A;  2JA8 G;  3PO3 B;  2R93 B;  2R6G A;  3R8B A;  1UEB A;  3E3X A;  5IP9 H;  4CDE C;  2MO1 A;  2UXC Q;  3C1E A;  1BKB A;  4IPG A;  2RSO A;  4XXE A;  1DOK A;  4HIM A;  1I94 Q;  3ICE A;  3S1M H;  3RUZ A;  3T16 A;  1EYD A;  3CCR A;  1PA6 A;  4KTA A;  2Y0S B;  2B63 H;  4N8X 1;  4YCV A;  1Y1W G;  3AMU A;  1V43 A;  3HKZ E;  4NKL A;  2EXZ A;  3TN2 A;  4X3U A;  2FJ2 A;  4K0K Q;  4LUO A;  4DK6 C;  2Z4H A;  4FDB A;  4NXM Q;  2F4V Q;  1ENA A;  1N32 Q;  3J80 L;  4DNR B;  3HOX H;  1F2Y A;  1VQB A;  1HNZ Q;  1SMY C;  1JR0 D;  3I7F A;  2WAQ G;  1XMO L;  4JV5 Q;  1HZB A;  4J6H A;  4CKC A;  1HJP A;  1CHQ D;  3SXH A;  4HAE A;  1K0R A;  3CPW A;  1VQL A;  3J7A V;  2F0K A;  4RHR A;  3A8I E;  5IYB H;  4RGO S;  1B9N A;  1L0W A;  5DM6 3;  3VR6 A;  3TRE A;  1BDO A;  4X64 L;  1PH2 A;  4PV1 C;  3NTK A;  2AHO B;  4B3R Q;  5M3M H;  3J7A 5;  1STE A;  3I4L A;  1LAB A;  4F88 A;  3SE0 A;  1TWA H;  1CKN B;  1LLR D;  4IUQ A;  3I91 A;  3W1B A;  1K73 C;  3VR4 A;  2B2W C;  3I4M B;  3D4R A;  5CV8 A;  3Q6S A;  1VQ6 A;  2WB1 G;  1UE1 A;  3A8K E;  1PH5 A;  1EY4 A;  4LAA A;  1S72 A;  2A6H D;  3HOZ B;  1DCZ A;  2R7F A;  3UI2 A;  2ZXP A;  2RQX A;  2ZTE A;  5D3I B;  4G7H C;  2YU9 B;  3FEW X;  2K03 A;  2UUA L;  4EQ5 A;  3N6R A;  1Q46 A;  3W1G A;  3TZU A;  2RSN A;  4A3F H;  4DR7 L;  2QKI C;  4B9W A;  1I4X A;  2Q2H A;  3S1R H;  1QZH A;  2J0T D;  2UXD L;  4XQJ A;  4RWS C;  1NR2 A;  4LF8 L;  2RDF A;  3NEM A;  1TR5 A;  4IUV A;  2QF7 A;  1ASZ A;  5CGK A;  4BBR H;  3LWE A;  1SE4 A;  2F0U A;  2K28 A;  3AB9 A;  2NVY B;  2OQK A;  5KIX A;  2CCZ A;  3P7J A;  2VW9 A;  1K8A C;  5I6W A;  2VNU D;  4C3J H;  2UXD Q;  2A1A A;  2DGY A;  4JPB W;  1EIH A;  1AZQ A;  5HY6 A;  5A35 A;  3ULJ A;  3MFY A;  4HMI A;  1KAW A;  1WVL A;  1VF7 A;  5FO7 B;  4XYQ A;  5AFW A;  2YTX A;  1VQ7 A;  4ZRZ A;  2N88 A;  2D9U A;  2OCE A;  2PZT A;  1PRT F;  2F3I A;  1UE7 A;  3NHH A;  1FYC A;  4R4O A;  1B2T A;  4JI4 Q;  5CV4 A;  1VQF A;  1YVC A;  5LL6 X;  2F0G A;  3DHQ A;  3QR8 A;  1FJG L;  3CHB D;  3Q0A A;  1Q3L A;  4KV6 A;  5J3B A;  1H9K A;  3MZ5 A;  1Z47 A;  1MBY A;  1S3O A;  1IBK Q;  1I50 B;  2MPM A;  1VDZ A;  1CKM A;  4IUP A;  2K50 A;  3F1Z A;  1G2T A;  1GVP A;  5CV5 A;  3NTI A;  5COR A;  4FVM A;  1A3T A;  4BY7 H;  4LFB L;  4CKB A;  3GTO H;  3S15 B;  1RHP A;  5EPL A;  2QCP X;  4C3I H;  2PW7 A;  4PMC A;  4EQP A;  1EIF A;  4TQU S;  3C2P A;  1HR0 Q;  3CW2 C;  2BDO A;  3OIP A;  2B8G A;  4QUC A;  5CV9 A;  1E0B A;  1HQR D;  1NTG A;  2L0C A;  2LSS A;  1AE3 A;  4R9W A;  1VQA A;  3HEJ A;  1WFQ A;  5JJZ A;  3RZD H;  1EY7 A;  3M7G A;  1TWG B;  4OO1 I;  2A5H A;  2XVS A;  2A69 D;  1BNZ A;  4A3K B;  3CU7 A;  1SSO A;  1BCP C;  3KFU A;  4J1M A;  1H9J A;  1EQQ A;  5IY0 A;  3ER0 A;  1B53 A;  5FLX E;  5IT9 L;  2KCN A;  1YJN A;  5JJI A;  4NXN L;  2Q2I A;  4X3S A;  1QUQ A;  3H0G B;  4JG2 A;  2UXB Q;  1M1K C;  3IRB A;  1KDB A;  4R8I A;  3PMF A;  5CBE E;  3CRL C;  5IGC A;  1YNX A;  3BVG A;  5E7N A;  5GQO A;  4DV6 L;  2PNR C;  1JE4 A;  1SMY D;  3ERQ A;  3AYH B;  1IHZ A;  2WKC A;  1W6K A;  1C7Y A;  1A2U A;  1SYC A;  4IUN A;  2BA0 A;  2OT2 A;  3UDF A;  1PFM A;  3S2H H;  5ELD A;  3T1Y Q;  4UY8 C;  1I5F A;  4ZUI A;  1CKO A;  3BG3 A;  1AEX A;  5M3F B;  1X3F A;  3FP9 A;  3GTG B;  3SK6 A;  4LMQ D;  1ET6 A;  1B7Y B;  4A3I B;  1EEF D;  2UUC L;  2NN6 H;  4K5V A;  3GTL B;  2DN8 A;  1R9T H;  4AH6 A;  4KHP Q;  2IW3 A;  3RN2 A;  4CDC C;  1UAP A;  4C2M B;  3CP0 A;  2IWH A;  1ILQ A;  1QIL A;  1NBW A;  1UNS A;  3A56 A;  3UDG A;  3FMC A;  4DAV A;  1DM0 B;  4JI2 L;  1PHJ A;  5CBA E;  1AE2 A;  2F3W A;  1LTG D;  2CHB D;  1O7Y A;  3D4D A;  4MN3 A;  3MHB A;  4DV4 L;  4LUZ A;  4P71 A;  1EL0 A;  4ZUJ A;  3H3V I;  3OYY A;  3A7A B;  3VA7 A;  4DR3 Q;  2B39 A;  3OW7 A;  2IL8 A;  1LT6 D;  1B3A A;  3CMA A;  2K7V A;  2JE6 I;  4B3R L;  3JAM E;  1O7L A;  2RF4 A;  1N32 L;  1V1P A;  2EYM A;  3A0J A;  3K59 A;  2LS0 1;  4DR4 Q;  1NUC A;  4DV0 Q;  4JI7 L;  4L5S A;  1SLJ A;  1S5F D;  2E2D C;  3MTS A;  2CQA A;  1U4P A;  1J8I A;  3FDT A;  3EIV A;  3ITP A;  2X6G A;  1K83 H;  2QIL A;  4IJH A;  4RCO A;  1EZ8 A;  1KIX A;  4X65 L;  1B3Q A;  2BOS A;  1G51 A;  2E76 C;  4IFD H;  4FF3 A;  4DV7 L;  3PO2 B;  1JJC B;  3HOW G;  2B2W A;  1VQM A;  1SJE D;  1A3U A;  5C44 H;  4DR4 L;  1D8L A;  4IJL A;  1LUZ A;  2B8F A;  4C3H G;  5M9O A;  2K6A A;  5A2Q L;  2F4I A;  5IOD A;  2UUB Q;  5C0X G;  4OX9 L;  4X65 Q;  5JVH 3;  1F9Q A;  1Y69 U;  2EOT A;  2WAQ E;  2YTV A;  4B9X A;  2N8N A;  4WJ4 A;  3FHW A;  2Z0S A;  2A74 C;  5HGT A;  5C4Z A;  1EY0 A;  3KDF A;  4ODG A;  3JAM c;  2EYL A;  5IOC A;  2VB2 X;  1PZJ D;  3MXN A;  2I5L X;  4K8J A;  4LF5 L;  3GTM H;  3KJO A;  1ESR A;  4UP9 A;  3VYT A;  4JK1 C;  4N9P A;  3J7Y W;  1JJ2 A;  2OTJ A;  1UEA B;  2ICE C;  2E2J B;  2VXW A;  1I4R A;  5K36 H;  3CCL A;  2EY1 A;  2M9V A;  3NWS A;  5IIF A;  4QGU A;  3S1N H;  1Y1W B;  3E9I A;  1QOH A;  1PH8 A;  4PZ8 A;  2IJ0 A;  1NSN S;  3FKI H;  5FJ8 H;  4OEL B;  1ZKO A;  2EY6 A;  2B29 A;  2F0N A;  5FJ8 G;  3N52 A;  1X32 A;  1BQQ T;  1TKW B;  4FF4 A;  2DUD A;  1SRO A;  2JK8 A;  3RZD B;  5C4X B;  1ASY A;  1G8Z D;  4GOP C;  2X69 A;  1XMQ L;  2AWO A;  2IHE A;  5DLQ E;  3HOU B;  1H9M A;  1TU2 B;  3RLN A;  1YZ6 A;  1SN8 A;  1H9S B;  3K58 A;  4LNQ A;  4H44 C;  4P2C B;  1VQK A;  4BY1 B;  4GN3 B;  4IUT A;  1EYC A;  1TQO A;  3HGB A;  1JJG A;  4GN5 A;  1LM0 A;  2ZXR A;  2DJF C;  4MTK A;  1XYI A;  2M2L A;  4DFA A;  4GNX B;  1KC8 C;  3RR5 A;  3OHX C;  4NW2 A;  4H7B A;  4TSS A;  3HKZ B;  5FLX c;  4GKJ Q;  1SYB A;  2F4V L;  1D1I A;  3GTP H;  1XNQ L;  2LXJ A;  4RAU C;  1L1O C;  5IYC G;  2NBF A;  4GS3 A;  4QQB X;  3MC0 B;  5E1F A;  1TII D;  4R4Q A;  2Z1C A;  3PF5 A;  3BZK A;  2JA7 H;  4EQN A;  1Q7Y C;  1BCP F;  5ELF A;  2QA4 A;  3U58 A;  2F3V A;  3HOX B;  2D5D A;  4KHZ A;  1GUS A;  2HD3 A;  1A0I A;  5C5L A;  5ELC A;  3S14 B;  1I50 H;  2MP1 A;  3A55 A;  5LL6 S;  1FVI A;  4RGN A;  2JA6 B;  1R4P B;  1MJC A;  3H3V H;  2NVY H;  4Y7N B;  1MGS A;  4HTH A;  2PNH A;  1X6O A;  1LT3 D;  1RTO A;  1BR9 A;  3NSW A;  2K5V A;  1XXG A;  3E0E A;  3NQI A;  1SXT A;  1N33 Q;  2Z9H A;  3AFP A;  2UXB L;  4QB4 A;  1SEB D;  3D4W A;  1E22 A;  4LFA L;  3W5O A;  5C3W A;  4YY3 L;  1UUP A;  2B2V A;  2XRS D;  1L0X B;  2SDF A;  3TQY A;  1EWI A;  4IUR A;  3DEP A;  2HCI A;  3NWT A;  1N36 L;  3QG1 A;  4OON A;  1SNC A;  3KF6 A;  2AQ2 B;  3BDO A;  4RKL A;  3SHL A;  2LMC B;  3STB D;  1VCI A;  4LFA Q;  4FXG C;  1Q86 C;  1ENC A;  3S1Q B;  3UE1 A;  4DV7 Q;  1SRU A;  4Q0F A;  2IX0 A;  1VQE A;  1LYL A;  2E74 C;  4HSV A;  1OXS C;  2VB3 X;  3C46 A;  3M85 A;  4UP7 A;  1SNM A;  4WJW A;  3CKI B;  4XTC S;  1SJH D;  1K3R A;  1VQ5 A;  1ET9 A;  3GTO B;  1RTN A;  3S15 H;  1W3S A;  1YBY A;  3OMG A;  4A3F B;  1LTB D;  1X3Q A;  2ZM6 Q;  4LF9 Q;  1CK1 A;  3CQZ B;  4OEM B;  1I94 L;  1HZC A;  2BH8 A;  5BN3 A;  1SND A;  2EJG C;  3KBG A;  4KJN A;  4F7X A;  1NNX A;  2F0J A;  1IYU A;  1DOM A;  2E2H B;  2NVX B;  3EFX D;  1EWH A;  3HS0 C;  4ULL A;  2A69 C;  4CGY B;  1LTT D;  3NBH A;  5M5W H;  2IT1 A;  5DM7 3;  2BA1 A;  3IAY A;  4AYB B;  3PUW A;  4GOP B;  4F8M A;  3G6J B;  1EU4 A;  3KJP A;  1GHJ A;  1MI2 A;  4GKK Q;  4GZY C;  4NMZ A;  1YNJ D;  2E5L L;  4DUZ L;  4C1N I;  4EX5 A;  3HFZ B;  4DV5 Q;  2CW0 C;  1J5E L;  2EYF A;  1KXL A;  2K5N A;  2XN9 C;  4CJ0 B;  4HJ5 A;  1CKN A;  1JOO A;  2XNA C;  4GNX A;  2WAC A;  1QJO A;  4TKO B;  1KAB A;  1KNA A;  1K28 A;  1Y8O B;  3HOZ H;  1PZK D;  2MFI A;  1PRT C;  1HFN A;  5KGU A;  3RD4 A;  2AMC B;  4A93 H;  2B63 G;  3IL8 A;  1XNQ Q;  3SGI A;  3TP6 A;  4U67 3;  3L7Z C;  2F0W A;  5GAE C;  1CA5 A;  2LKV A;  3I4M G;  3NQT A;  3I4M H;  1XMO Q;  1S5E D;  3HOU G;  4HED A;  2HDL A;  2C5C A;  4X3T A;  1B4O A;  1JC7 A;  2K5D A;  1YHA A;  2K01 A;  1OO9 B;  1STA A;  2N78 A;  4FO2 A;  2KBN A;  4F87 A;  4HMJ A;  4DR5 L;  5M3F G;  3V96 A;  2PYK A;  4DV0 L;  1EQT A;  1WYD A;  4JVZ A;  3D6W A;  2BE5 D;  1SFO B;  4K5W A;  3PCO B;  2JP1 A;  1X9N A;  4A93 G;  2R7Z B;  2G9H D;  3ZJY C;  1XPR A;  4L5T A;  2KEE A;  5EPJ A;  1TS3 A;  2B2U A;  2RCN A;  3K8A A;  1YHQ A;  2R61 A;  3TEH B;  1PFS A;  1TWF B;  2K33 A;  3EBE A;  2L9H A;  2ZXO A;  3E6Z X;  4X3K A;  4X66 Q;  1XX8 A;  3CME A;  1D7Q A;  1KL9 A;  2F52 A;  1AFP A;  5C6A A;  2D62 A;  4J15 A;  4OX9 Q;  1PV4 A;  3KF6 B;  5EKK A;  1S4Z A;  1KDA A;  4YWM A;  2CW0 D;  1TWC B;  3G4S A;  4LUV A;  2IX1 A;  5EPK A;  3LWU A;  2EE1 A;  3QIA A;  2RDH A;  1JE5 A;  4RMF A;  3KLR A;  4Z9C B;  1JOK A;  4G4K A;  5KNB A;  3H0G H;  1RCV D;  1LTR D;  4JCV E;  1HTL D;  4KHV A;  1EU3 A;  4DV2 Q;  1Y8N B;  4GLX A;  2PQA B;  1V8Q A;  1F2M A;  1WOC A;  1HNW L;  3F8T A;  1T9H A;  4CDF C;  3NBI A;  4O1N A;  4HJ9 A;  3DM3 A;  2CWA A;  4Y52 H;  5JJK A;  2B2T A;  2PI2 A;  4UPA A;  1TS2 A;  4KD4 A;  4GN4 B;  3GDE A;  4XIG S;  1JIC A;  2SNM A;  4A3M H;  4IPC A;  5C3E H;  2ZM6 L;  4DV1 L;  2HIX A;  4LF9 L;  2F0V A;  1NE3 A;  2K5H A;  5EBC A;  1TY2 A;  4X62 Q;  4ZCK A;  1IKM A;  4NP5 A;  4ZLT F;  1X3E A;  2VQE L;  2EJM A;  3GP7 A;  4ILW A;  5E4W C;  4LF4 L;  3DXJ C;  1XNR Q;  1IW7 C;  1DYQ A;  4GLA C;  1KRS A;  2XWJ B;  4IOC A;  3J7A F;  3RZO H;  4DAM A;  3D8G A;  2WP8 J;  4RGM A;  2ENB A;  3CC2 A;  3KDF B;  4RGT A;  4GKK L;  1AZP A;  2F1M A;  1OXV A;  4GLV B;  3MEF A;  4MZ9 A;  4L6T B;  1ROD A;  4JI0 Q;  5EGT A;  4NDX A;  1PTO D;  4DGZ A;  4UAI A;  5T1I A;  1MSH A;  5EAY A;  4TVA B;  4HR7 B;  2ES2 A;  1GUT A;  5E3F A;  5IWA L;  1I4P A;  2KHS A;  1IBM Q;  2V4D A;  2HHH L;  3EN2 A;  3L3O C;  5GAG C;  1BCP B;  3NP8 A;  1HNX Q;  5KND A;  4HCE A;  3F2C A;  3HRZ C;  3A54 A;  2NTT A;  2ZT9 C;  3PO3 H;  3KLS X;  2NN6 I;  1SNP A;  3JAM i;  2AQ1 B;  4WFN 3;  4DV5 L;  3V2T A;  1EUJ A;  4OO1 G;  4IUU A;  2JJQ A;  1YNN C;  1X65 A;  1VQD A;  4DV3 L;  3CAM A;  1VQC A;  2Z8L A;  3TP8 A;  2KJX A;  1C9O A;  1PTO F;  3M9B A;  1AN8 A;  4B3T Q;  1X55 A;  3NEN A;  4QUF A;  1K0S A;  3K5O A;  5M5W B;  3KBX A;  1YIJ A;  2JSO A;  4OXP A;  4A3G G;  3I3C A;  1J6Q A;  1BOS A;  3U4V A;  1U4M A;  3Q22 A;  1ILP A;  4HSP A;  5I2X A;  1UE5 A;  1SR3 A;  5ELN A;  3KYH C;  2YTY A;  1DD2 A;  3S1R B;  2EYH A;  1YJ9 A;  1B70 B;  2L5T A;  4MNO A;  3NUC A;  5C4J B;  3KF8 A;  2XWB B;  3HOV B;  5J1Z A;  5KYI A;  3VYU A;  5JOB A;  2QDB A;  4A3K H;  3F2D A;  2C9O A;  1FGU A;  1B8A A;  2KVM A;  1I6H B;  1HZA A;  4LW1 A;  1EIY B;  4A3J G;  5C4J H;  5IGE A;  3R2I A;  1UE6 A;  4DV6 Q;  2QW7 A;  1QVG A;  1CSP A;  1N9W A;  1RIP A;  4A3C G;  4C56 C;  1IZ6 A;  3HOX G;  1BUV T;  1MIU A;  2K5Q A;  3BDC A;  2F0E A;  3GQB A;  4ZK9 B;  4WOR A;  3CCE A;  4J8Q A;  1GUO A;  5IT9 E;  3E9H A;  1RL2 A;  4A3D H;  4QF4 A;  4X66 L;  1LO5 D;  3PO3 G;  2R93 G;  3U9O A;  1E2Z A;  4IO9 A;  1AH9 A;  1KLU D;  5LMN W;  4JI8 Q;  3FPU B;  4DV1 Q;  5K36 G;  3PIP 3;  4B3M L;  2MJ8 A;  3K0Y A;  1BO0 A;  4P75 A;  4A3D B;  1RDP D;  2P5Z X;  1XTC D;  3UE0 A;  3PO2 G;  1R4Q B;  1FNU A;  2WAQ B;  1RD9 D;  5D14 A;  3S24 A;  1U5K A;  4JOI A;  3M4O H;  3BU2 A;  1IBL Q;  1K8O A;  1PH1 A;  1VQ4 A;  3M3Y H;  4DK0 A;  1K8G A;  1VQ8 A;  1VMC A;  1Z7T A;  4FP5 D;  4YIJ A;  2E8G A;  4JI8 L;  2EIF A;  4A3E G;  2VZA A;  4LK1 C;  2UUB L;  4DR1 Q;  1QVC A;  1K83 B;  4DUZ Q;  5C0X H;  3H91 A;  5DEH A;  1GHK A;  4RCN A;  1R9T B;  5ELO A;  2NB0 A;  5CV7 A;  5IGF A;  4FXK C;  1TS5 A;  4RG1 A;  4UP8 A;  3MFG A;  5JPN C;  1II3 A;  3IFT A;  1PH3 A;  1FGB D;  1QUQ B;  1QWY A;  5C3X A;  2VQE Q;  2L4N A;  2PCF B;  2F0L A;  5JJL A;  3HOV G;  4A3F G;  4JBJ A;  2UU9 Q;  2F0S A;  1F77 A;  1EY9 A;  1YEZ A;  1F9R A;  1HZ9 A;  2NYZ D;  3GD7 A;  3KLS A;  4JI1 L; 
#chains in the Genus database with same CATH homology
 4RKB A;  1AW7 A;  1FR3 A;  1Q90 A;  1EY8 A;  5J22 A;  2WKD A;  2LFN A;  4PMB A;  5M5X B;  4EQO A;  5C0X J;  4L8J A;  1M8A A;  2CVR A;  1D6E C;  3PUY A;  4XQQ A;  4KY5 A;  1JCK B;  4K2K A;  3T53 B;  2GA4 B;  4DXF A;  2MHV A;  5JEA H;  1TVX A;  1F9S A;  3VR5 A;  2K1B A;  5D3D A;  3H09 A;  4E6I A;  1S5D D;  2KED A;  1ICW A;  1CTM A;  3I72 A;  3WOE A;  2OF1 A;  1ZYR D;  2N55 A;  2E2I B;  1VF5 C;  2TSS A;  1PFN A;  4A3E B;  1JB3 A;  1ONL A;  1XWE A;  3MEH A;  5I6Y A;  1A6X A;  2QEJ C;  1GUG A;  4XDX A;  1F2L A;  1EY6 A;  5JEA J;  1SE2 A;  2FIN B;  5IGG A;  3M7N A;  3K5M A;  3BVM A;  4ZYS A;  1E2W A;  4PNY A;  2EPB A;  4V0B A;  1NCV A;  2G9D A;  4C1N K;  1V1P B;  3R2T A;  1CM9 A;  2DY7 A;  1F2Z A;  4DNT B;  5D65 A;  2IPK D;  1J9O A;  3H94 A;  5EJW A;  1Z6H A;  3M4Y A;  2HDM A;  2KCC A;  5DAU A;  2WV6 D;  1O7Z A;  3BYY B;  1IKL A;  1QG7 A;  1VMP A;  1B1Z A;  3EQL C;  1GXD C;  2BCO A;  4JBW A;  1U4R A;  3OMC A;  1T5X D;  1ML0 D;  4ZAI A;  5DNF A;  2F0P A;  1PTO B;  5FLX L;  3MA2 B;  3FPP A;  2F0H A;  1QNU A;  3K57 A;  1OXU A;  3E0J A;  4K6D A;  4KY7 A;  1TY0 A;  2JA8 B;  5M3M B;  1LTI D;  2A73 B;  2B2T C;  2HUG A;  3SK4 A;  2L55 A;  2RKS A;  1HPC A;  3I4N B;  3QJY A;  1STN A;  1F9P A;  2F0D A;  2O4X A;  1QCB D;  1EWC A;  3TP5 A;  4OIK A;  4QIW B;  5ISR A;  1Q8I A;  4L63 B;  5G3L F;  4ME5 A;  3BZD B;  2PZU A;  4KY6 A;  4KMU C;  4KN4 C;  2ICI A;  3SEB A;  2B63 B;  5I2Y A;  3URY A;  3R3O A;  1DXM A;  3I90 A;  5JVG 3;  3I70 A;  1SNO A;  1Q1B A;  3K5L A;  4BS9 A;  2AWN A;  3T13 A;  2NUC A;  2WB1 B;  1PRT B;  3BYT B;  1STB A;  1QNK A;  3A7L A;  4FXD A;  4KI0 A;  2F03 A;  2XSC A;  1PTO H;  1H9R A;  3QOL A;  3GTJ B;  4S3S A;  3VA5 A;  4ZKC B;  3GTQ B;  3NXW A;  1HCZ A;  4KK7 A;  3FKI B;  2AUK A;  4K14 A;  4DAY A;  1ENF A;  3DWQ A;  3W2D A;  4BWG B;  5FOB B;  2FHT A;  3WOF A;  1FNV A;  3IFD A;  1JWS D;  4HCS A;  3BS1 A;  2JA5 B;  5T1G A;  4ID6 A;  2PMZ B;  1JQY D;  5ELE A;  1D5M C;  2YYZ A;  2OEO A;  1A15 A;  3ONA B;  4C3J G;  4PMW A;  1PLF A;  4CJ2 C;  1Q12 A;  1TT2 A;  1ZXT A;  1STG A;  4FF2 A;  1I4Q A;  1GUN A;  5JPM C;  3SDZ A;  4N9T A;  3KK7 A;  5A2Q E;  3S2D B;  3BDL A;  4XT3 B;  2NZ1 D;  2PO4 A;  4O42 A;  3PUV A;  3ZYY X;  1B9M A;  4MHE A;  2EYJ A;  1DJR D;  3I8Z A;  4A3B B;  5G3L D;  1T5E A;  4DK1 A;  1MSG A;  2F0I A;  2WIN B;  1BF4 A;  3GTP B;  1PDQ A;  2IX3 A;  3T4A C;  3T56 B;  3BVZ A;  1Y1V B;  2JYO A;  5KNC A;  5F2D A;  1E2V A;  2JXM B;  1M4V A;  4RH6 A;  1OXX K;  1S5B D;  3HOY B;  5TSS A;  1AP0 A;  2FFK B;  1WTO A;  4RFB A;  2B2U C;  1KTK A;  4ZQ3 A;  1HHV A;  1ESF A;  4K8I A;  1O80 A;  2EVB A;  1A3V A;  5EBD A;  2I46 A;  1BXT A;  4DA2 A;  1CQF A;  3G7L A;  2FMC A;  1D2B A;  1HFG A;  3OSO A;  5C4H A;  1JWU D;  5CV6 A;  1SYD A;  4I65 A;  2RVL A;  2Q8R E;  4KN7 C;  3D31 A;  3SR1 A;  2KQ3 A;  2A6E C;  2H4O A;  1BCP D;  1HXY D;  1CT1 D;  3W3A A;  3DEO A;  4G57 A;  1NAP A;  2HQE A;  4H13 C;  1PRT D;  1PFB A;  4XT1 B;  5HUR A;  3LNN A;  3EVQ A;  4A3J B;  1LV9 A;  2L1B A;  1PYW D;  1KLG D;  1PZI D;  2SEB D;  3D3R A;  2KUM A;  3L9A X;  4DN4 M;  2Q8T A;  2O2L D;  1I4H A;  2BE5 C;  1KDC A;  4TRD A;  1G91 A;  3HG9 A;  1PMR A;  1C48 A;  2R3Z A;  2EDG A;  1GJX A;  3HOW B;  1WTP A;  2E75 C;  3M3Y B;  4IFD I;  1WTQ A;  5EKI A;  3MWY W;  2NVT B;  1KAA A;  4FNF A;  2A6H C;  3CRK C;  1OXT A;  3K6O A;  1KNE A;  5LHY 1;  3C1F A;  3FVQ A;  3U9S A;  1HQM C;  3WDN A;  4OHJ A;  3HP3 A;  4B08 A;  4A3G B;  2XIW A;  4C3H B;  2PW5 A;  2B2Y A;  3QOJ A;  2L11 A;  3RZO B;  2NVQ B;  4DXG A;  1G6Z A;  3RMH A;  4A93 B;  1D5Z C;  4V19 0;  1IYV A;  5CC4 A;  3SK8 A;  1STY A;  5BN4 A;  2B2V C;  1L0Y B;  4KKS A;  1V1O A;  1SAP A;  1HTP A;  2F0O A;  1ZYR C;  1CFM A;  5C0X I;  3TDQ A;  5J39 A;  3KUP A;  3NK9 A;  3F2U A;  4FF1 A;  3X3N A;  1TWH B;  3P75 A;  1X3P A;  1WD0 A;  1QB5 D;  3Q23 A;  1CZW A;  2WII B;  1LT5 D;  1QE6 A;  4BY7 B;  4KJO A;  4H0L C;  4QCL A;  1RF2 D;  2B2Y C;  2LY7 A;  1I6V C;  4RHS A;  3OPO A;  1HUM A;  4BA2 I;  4U68 A;  1YNN D;  1EEI D;  2K04 A;  5EQ0 A;  1K8M A;  1WCM B;  2J7Z A;  2R92 B;  1WTW A;  1D1K A;  2DNE A;  2EZV A;  2JA7 B;  3TZD A;  1IL8 A;  3QB3 A;  4G7O C;  3J81 L;  1Q1E A;  3HZX A;  4Q5V A;  3FRP B;  3NE5 B;  3S16 B;  4BA1 I;  3ND8 A;  5KYL A;  2HCC A;  5I9P A;  5K5P A;  5C3E B;  4A3M B;  3SVM A;  2NTS A;  5NUC A;  3R93 A;  4OL7 A;  4OO1 H;  3OOC A;  1B50 A;  1B44 D;  3NPP A;  4EGV A;  4BBR B;  4C3I B;  2J4X A;  3EJI A;  3MVV A;  2O5I C;  3A8J E;  1HA5 A;  3K7A B;  3DMU A;  4DU9 A;  1CZG A;  5FK9 C;  3NTH A;  3GO5 A;  3DM1 A;  1W6J A;  4M8A A;  2PPB C;  5IGD A;  2NWG A;  4UDU C;  2F0M A;  5FKA C;  4KKT A;  2XRQ D;  3E5S A;  2EYP A;  3O13 A;  1PXU A;  2EYO A;  5BN5 A;  3DWA A;  3OIQ A;  2VUM B;  4ABN A;  5FO8 B;  3LX0 A;  4IAL A;  1DZ1 A;  4BBS B;  5ELB A;  1EYA A;  2A68 C;  4DF7 A;  5M5Y B;  3S1M B;  1U9R A;  1G29 1;  1IW7 D;  1SE3 A;  5CYU A;  3H3V C;  4LJZ C;  2KOL A;  2MUY A;  4IN3 A;  1I4G A;  2PQE A;  1LT4 D;  4CKE A;  1RJT A;  1SYF A;  4IFD G;  2F0T A;  1CI3 M;  4M1U B;  1C8C A;  5IGB A;  5C44 B;  1PTO C;  3RLF A;  4RA8 A;  1CHP D;  1EIG A;  2K32 A;  2L12 A;  1LTS D;  3D6C A;  5CMD A;  2AQ3 B;  4K2L A;  2RDG A;  4I7Z C;  1H9S A;  3H6M A;  5KEE A;  3T51 B;  3VYR A;  3X3M A;  2RBM A;  3TSS A;  1DON A;  3MAQ A;  2I07 B;  3PUZ A;  1STH A;  1YNJ C;  3J81 E;  1HRJ A;  1I3Q B;  3IKJ A;  2BDN A;  4CHT B;  1SNQ A;  5I9O A;  2A68 D;  3MXU A;  1LAC A;  1SYE A;  4FYD A;  2JEA I;  2Q8I B;  1U4L A;  3OWF A;  3QO2 A;  1EOT A;  2A6E D;  1NR4 A;  1JWM D;  2X6L A;  3MXP A;  1RKN A;  2ID0 A;  1FNW A;  1S5C D;  1HA6 A;  4IFD J;  4WRD A;  1SYG A;  1C4Q A;  1G2S A;  1JOR A;  2M00 A;  3MXG A;  3V05 A;  1EZ6 A;  3ERO A;  3TME A;  3M4O B;  2MGS A;  2F0F A;  3I73 A;  3S1N B;  1LTA D;  3S17 B;  1TS4 A;  2D2C C;  4R8N A;  1WTR A;  3VR3 A;  3ND9 A;  4C3I G;  1WD1 A;  3PIO 3;  4KD3 A;  5FO9 B;  3DWP A;  2EY5 A;  2Z4I A;  5JEA G;  1FD7 D;  4PQX A;  1SDF A;  4K5X A;  2EY2 A;  3VYS A;  1ZEQ X;  2JEB I;  1EY5 A;  1EFI D;  1GUW A;  3PUX A;  2O5J C;  3TP7 A;  1WTX A;  3Q24 A;  3S9W A;  1HUN A;  2DNC A;  4HN7 A;  2DY8 A;  3GTM B;  1O78 A;  1TWA B;  3GV6 A;  3P20 A;  4CBV A;  4XYO A;  5I4D A;  3AU7 A;  3TBI B;  3PV0 A;  2K5W A;  3VR2 A;  2F0Q A;  3SK5 A;  3GTK B;  1EQV A;  2RA4 A;  1JOQ A;  3P1H A;  2SNS A;  4G7Z C;  1DOL A;  2K05 A;  2TMP A;  4ZKB B;  5COY A;  4EVO A;  2OXP A;  4OGQ C;  3C3L A;  4OIJ A;  4IQZ A;  2SOB A;  4QMG A;  4KKU A;  1MD2 D;  3S2H B;  5CR3 A;  1WTV A;  4XQN A;  3JAM L;  1SBB B;  2FMM A;  1D5X C;  3OWE B;  4C3J B;  1A2T A;  3EA6 A;  1Y8P B;  2EJF C;  3K5N A;  2PZW A;  2H1E A;  4DAP A;  5JAV A;  2AUJ D;  1CQV A;  4IZ8 A;  5KRU A;  2KA7 A;  5E4X A;  3J80 E;  1CA6 A;  3DUZ A;  3GV3 A;  4MIU A;  5C5M A;  4CJ1 B;  1BBX C;  2KEC A;  3QWN A;  4K6L A;  1GOZ A;  2NN6 G;  5EKL A;  3PO3 B;  2R93 B;  2R6G A;  3R8B A;  3C1E A;  2RSO A;  4XXE A;  1DOK A;  3RUZ A;  3T16 A;  1EYD A;  4KTA A;  2Y0S B;  3AMU A;  1V43 A;  4NKL A;  2EXZ A;  3TN2 A;  4X3U A;  2FJ2 A;  2Z4H A;  1ENA A;  3J80 L;  4DNR B;  1F2Y A;  1SMY C;  1JR0 D;  4J6H A;  4CKC A;  1CHQ D;  3SXH A;  4HAE A;  3J7A V;  2F0K A;  4RHR A;  3A8I E;  4RGO S;  1B9N A;  5DM6 3;  3VR6 A;  1BDO A;  4PV1 C;  3NTK A;  1STE A;  3I4L A;  1LAB A;  4F88 A;  3SE0 A;  1LLR D;  4IUQ A;  3I91 A;  3VR4 A;  2B2W C;  3I4M B;  3D4R A;  5CV8 A;  3Q6S A;  3A8K E;  1EY4 A;  4LAA A;  2A6H D;  3HOZ B;  1DCZ A;  3UI2 A;  2ZXP A;  2RQX A;  5D3I B;  4G7H C;  2YU9 B;  3FEW X;  2K03 A;  3N6R A;  3TZU A;  2RSN A;  2QKI C;  4B9W A;  1I4X A;  2J0T D;  4XQJ A;  4RWS C;  1NR2 A;  2RDF A;  1TR5 A;  4IUV A;  2QF7 A;  5CGK A;  3LWE A;  1SE4 A;  2F0U A;  2K28 A;  3AB9 A;  2NVY B;  5KIX A;  3P7J A;  5I6W A;  2VNU D;  1EIH A;  1AZQ A;  5A35 A;  3MFY A;  4HMI A;  1WVL A;  1VF7 A;  5FO7 B;  4XYQ A;  5AFW A;  4ZRZ A;  2N88 A;  2D9U A;  2PZT A;  1PRT F;  3NHH A;  1FYC A;  1B2T A;  5CV4 A;  5LL6 X;  2F0G A;  3DHQ A;  3CHB D;  3Q0A A;  1Q3L A;  4KV6 A;  1H9K A;  3MZ5 A;  1Z47 A;  1MBY A;  1I50 B;  2MPM A;  1VDZ A;  4IUP A;  1G2T A;  5CV5 A;  3NTI A;  5COR A;  4FVM A;  1A3T A;  4CKB A;  3S15 B;  1RHP A;  5EPL A;  2QCP X;  2PW7 A;  4PMC A;  4EQP A;  4TQU S;  3C2P A;  2BDO A;  3OIP A;  2B8G A;  4QUC A;  5CV9 A;  1E0B A;  1HQR D;  2L0C A;  4R9W A;  3HEJ A;  5JJZ A;  1EY7 A;  3M7G A;  1TWG B;  4OO1 I;  2A5H A;  2XVS A;  2A69 D;  1BNZ A;  4A3K B;  3CU7 A;  1SSO A;  1BCP C;  4J1M A;  1H9J A;  1B53 A;  5FLX E;  5IT9 L;  2KCN A;  4X3S A;  3H0G B;  1KDB A;  4R8I A;  3PMF A;  5CBE E;  3CRL C;  5IGC A;  3BVG A;  2PNR C;  1JE4 A;  1SMY D;  3ERQ A;  1IHZ A;  2WKC A;  1W6K A;  1A2U A;  1SYC A;  4IUN A;  2BA0 A;  2OT2 A;  1PFM A;  5ELD A;  4ZUI A;  5M3F B;  3BG3 A;  1AEX A;  3GTG B;  3SK6 A;  4LMQ D;  1ET6 A;  4A3I B;  1EEF D;  2NN6 H;  4K5V A;  3GTL B;  2DN8 A;  2IW3 A;  1UAP A;  4C2M B;  2IWH A;  1ILQ A;  1QIL A;  1UNS A;  3A56 A;  3FMC A;  4DAV A;  1DM0 B;  5CBA E;  2F3W A;  1LTG D;  2CHB D;  1O7Y A;  3D4D A;  4MN3 A;  3MHB A;  1EL0 A;  4ZUJ A;  3A7A B;  3VA7 A;  2B39 A;  3OW7 A;  2IL8 A;  1LT6 D;  1B3A A;  2K7V A;  2JE6 I;  3JAM E;  1O7L A;  1V1P A;  2EYM A;  3K59 A;  2LS0 1;  1NUC A;  1S5F D;  2E2D C;  3MTS A;  2CQA A;  1U4P A;  1J8I A;  3FDT A;  3ITP A;  2X6G A;  4RCO A;  2QIL A;  1EZ8 A;  2BOS A;  2E76 C;  4IFD H;  4FF3 A;  3PO2 B;  2B2W A;  1SJE D;  1A3U A;  2B8F A;  4C3H G;  5M9O A;  2K6A A;  5A2Q L;  2F4I A;  5IOD A;  5C0X G;  5JVH 3;  1F9Q A;  1Y69 U;  2EOT A;  4B9X A;  2A74 C;  5HGT A;  5C4Z A;  1EY0 A;  4ODG A;  2EYL A;  5IOC A;  2VB2 X;  1PZJ D;  3MXN A;  4K8J A;  1ESR A;  3VYT A;  4JK1 C;  4N9P A;  3J7Y W;  1UEA B;  2ICE C;  2E2J B;  2VXW A;  1I4R A;  5K36 H;  2EY1 A;  2M9V A;  3NWS A;  5IIF A;  1Y1W B;  1QOH A;  2IJ0 A;  1NSN S;  1ZKO A;  2EY6 A;  2F0N A;  3N52 A;  1X32 A;  1BQQ T;  1TKW B;  4FF4 A;  3RZD B;  5C4X B;  1G8Z D;  2X69 A;  2AWO A;  3HOU B;  1H9M A;  1TU2 B;  1H9S B;  3K58 A;  4H44 C;  4P2C B;  4BY1 B;  1EYC A;  1TQO A;  3HGB A;  4IUT A;  2ZXR A;  1XYI A;  2M2L A;  4DFA A;  3OHX C;  4NW2 A;  4H7B A;  4TSS A;  3HKZ B;  1SYB A;  1D1I A;  4RAU C;  2NBF A;  3MC0 B;  5E1F A;  1TII D;  2Z1C A;  4EQN A;  1BCP F;  5ELF A;  2F3V A;  3HOX B;  2D5D A;  4KHZ A;  1GUS A;  5C5L A;  5ELC A;  3S14 B;  2MP1 A;  3A55 A;  5LL6 S;  4RGN A;  2JA6 B;  1R4P B;  4Y7N B;  1MGS A;  4HTH A;  1LT3 D;  1RTO A;  1BR9 A;  3NSW A;  1XXG A;  3NQI A;  1SXT A;  4QB4 A;  1SEB D;  3D4W A;  5C3W A;  1UUP A;  2B2V A;  2XRS D;  1L0X B;  2SDF A;  4IUR A;  3DEP A;  2HCI A;  3NWT A;  3QG1 A;  1SNC A;  2AQ2 B;  3BDO A;  4RKL A;  3SHL A;  2LMC B;  1VCI A;  4FXG C;  1ENC A;  3S1Q B;  4Q0F A;  2IX0 A;  2E74 C;  4HSV A;  1OXS C;  2VB3 X;  3C46 A;  3M85 A;  1SNM A;  4WJW A;  3CKI B;  4XTC S;  1SJH D;  1ET9 A;  3GTO B;  1RTN A;  3OMG A;  4A3F B;  1LTB D;  1X3Q A;  1CK1 A;  3CQZ B;  5BN3 A;  1SND A;  2EJG C;  3KBG A;  4KJN A;  4F7X A;  2NVX B;  2F0J A;  1IYU A;  1DOM A;  2E2H B;  3EFX D;  1EWH A;  3HS0 C;  4ULL A;  2A69 C;  4CGY B;  1LTT D;  3NBH A;  2IT1 A;  5DM7 3;  2BA1 A;  3IAY A;  4AYB B;  3PUW A;  4F8M A;  3G6J B;  1EU4 A;  1GHJ A;  1MI2 A;  4GZY C;  4NMZ A;  1YNJ D;  4C1N I;  2CW0 C;  2EYF A;  2XN9 C;  4CJ0 B;  1JOO A;  2XNA C;  2WAC A;  1QJO A;  4TKO B;  1KAB A;  1KNA A;  1Y8O B;  1PZK D;  1PRT C;  1HFN A;  5KGU A;  3RD4 A;  3IL8 A;  3TP6 A;  4U67 3;  3L7Z C;  2F0W A;  1CA5 A;  2LKV A;  3NQT A;  1S5E D;  4HED A;  2HDL A;  2C5C A;  4X3T A;  1B4O A;  1JC7 A;  2K5D A;  2K01 A;  1OO9 B;  1STA A;  4FO2 A;  4F87 A;  4HMJ A;  3V96 A;  2PYK A;  1EQT A;  3D6W A;  2BE5 D;  1SFO B;  4K5W A;  2JP1 A;  2R7Z B;  2G9H D;  2KEE A;  5EPJ A;  1TS3 A;  2B2U A;  2R61 A;  1TWF B;  2K33 A;  2L9H A;  2ZXO A;  3E6Z X;  4X3K A;  1XX8 A;  1AFP A;  5C6A A;  2D62 A;  5EKK A;  1S4Z A;  1KDA A;  2CW0 D;  1TWC B;  2IX1 A;  5EPK A;  3LWU A;  2EE1 A;  3QIA A;  2RDH A;  3KLR A;  4Z9C B;  1JOK A;  4G4K A;  5KNB A;  1RCV D;  1LTR D;  1HTL D;  4KHV A;  1EU3 A;  1Y8N B;  1V8Q A;  1F2M A;  3NBI A;  4O1N A;  2B2T A;  1TS2 A;  4KD4 A;  4XIG S;  1JIC A;  2SNM A;  2F0V A;  5EBC A;  1TY2 A;  1IKM A;  4NP5 A;  4ZLT F;  2EJM A;  3GP7 A;  4ILW A;  5E4W C;  3DXJ C;  1IW7 C;  1DYQ A;  2XWJ B;  3J7A F;  3D8G A;  2WP8 J;  4RGM A;  2ENB A;  4RGT A;  1AZP A;  2F1M A;  1OXV A;  4L6T B;  1ROD A;  5EGT A;  4NDX A;  1PTO D;  4DGZ A;  4UAI A;  5T1I A;  1MSH A;  4HR7 B;  1GUT A;  5E3F A;  1I4P A;  2KHS A;  2V4D A;  3L3O C;  1BCP B;  3NP8 A;  5KND A;  4HCE A;  3HRZ C;  3A54 A;  2NTT A;  2ZT9 C;  3KLS X;  2NN6 I;  1SNP A;  2AQ1 B;  4WFN 3;  3V2T A;  4OO1 G;  4IUU A;  1YNN C;  2Z8L A;  3TP8 A;  2KJX A;  1PTO F;  1AN8 A;  4QUF A;  3K5O A;  5M5W B;  3KBX A;  2JSO A;  3I3C A;  1BOS A;  1U4M A;  3Q22 A;  1ILP A;  4HSP A;  5I2X A;  1DD2 A;  3S1R B;  2EYH A;  2L5T A;  3NUC A;  5C4J B;  3KF8 A;  2XWB B;  3HOV B;  5J1Z A;  5KYI A;  3VYU A;  5JOB A;  2QDB A;  2C9O A;  2KVM A;  1I6H B;  5IGE A;  3R2I A;  4C56 C;  1BUV T;  2K5Q A;  3BDC A;  3GQB A;  2F0E A;  4ZK9 B;  4WOR A;  4J8Q A;  1GUO A;  5IT9 E;  4QF4 A;  1LO5 D;  3U9O A;  1E2Z A;  1KLU D;  3FPU B;  5K36 G;  3PIP 3;  2MJ8 A;  3K0Y A;  1BO0 A;  4A3D B;  1RDP D;  1XTC D;  1R4Q B;  1FNU A;  2WAQ B;  1RD9 D;  5D14 A;  1K8O A;  4DK0 A;  1VMC A;  1Z7T A;  4FP5 D;  4YIJ A;  4LK1 C;  1K83 B;  5C0X H;  3H91 A;  5DEH A;  1GHK A;  4RCN A;  1R9T B;  2NB0 A;  5CV7 A;  5IGF A;  4FXK C;  1TS5 A;  5JPN C;  3MFG A;  1II3 A;  3IFT A;  1FGB D;  1QWY A;  5C3X A;  2L4N A;  2PCF B;  2F0L A;  2F0S A;  1F77 A;  1EY9 A;  1F9R A;  2NYZ D;  3GD7 A;  3KLS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...