2Z1CA

Crystal structure of hypc from thermococcus kodakaraensis kod1
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
71
structure length
71
Chain Sequence
b'CLAVPGKVIEVNGPVAVVDFGGVKREVRLDLMPDTKPGDWVIVHTGFAIEKLDEKKAMEILEAWAEVEKAM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hydrogenase expression/formation protein HypC
publication title Crystal Structures of [NiFe] Hydrogenase Maturation Proteins HypC, HypD, and HypE: Insights into Cyanation Reaction by Thiol Redox Signaling
pubmed doi rcsb
source organism Thermococcus kodakarensis
molecule tags Chaperone, metal binding protein
total genus 17
structure length 71
sequence length 71
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2007-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01455 HupF_HypC HupF/HypC family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.970 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2z1cA00
3VYRA 3VYTA 2OT2A 3D3RA 3VYSA 2Z1CA 3VYUA
chains in the Genus database with same CATH superfamily
4RWSC 1B50A 5C44G 2RSNA 4JK1C 4BA1I 2VQEL 1AFPA 3BZKA 1G8ZD 3KYHC 1G6PA 4ZLTF 3M3YB 3M4OH 1E3PA 2K1BA 4DA2A 1GO3E 2I5MX 1QUQB 4TKOB 4JI8Q 5IYDH 1DGSA 3TP5A 5K5PA 2QEXA 1D1KA 3HOXH 4LF5Q 4JBMA 2EYLA 1YJWA 1SN8A 1TWFH 1Q1EA 2IL8A 1H9JA 1PTOB 4RGOS 3K58A 1S72A 5DM63 1HNZL 4LFAL 5DM73 4A3EH 3NP8A 2N78A 3PF5A 5CV9A 2JA8H 3C1EA 1EIGA 1EZ6A 4XQQA 4CKBA 1CSPA 4AH6A 4WFN3 1TS4A 2RHSB 4GLVB 4JVZA 3J7AF 4X65L 4O42A 2VXWA 1HR0Q 4JI4Q 1GHJA 1RL2A 4KV6A 4XT3B 2JXMB 1WD1A 3P75A 2MHVA 4DFAA 1DXMA 4DPGA 1VQDA 2HIVA 3RMHA 4ZAIA 3RZDB 4DK3C 4LFBQ 4O2DA 3NEMA 3MVVA 1NNXA 1RTNA 2KCNA 3FPUB 1XX8A 1EQQA 3I4MG 2IHEA 1F2MA 3GTMB 1S5DD 1SNCA 5JOBA 4HCSA 4OO1G 5C0XH 1X3FA 1HZ9A 4QMGA 5I9OA 2K5NA 5AJ3L 4JW0A 1IYJB 4DR2L 1GUTA 1SRUA 2BH8A 4IZ8A 4TRDA 2B2WC 2A6HD 4OELB 4A3FH 1V9PA 2YV5A 1VQFA 1AZPA 1N34L 2R92B 3I4MB 1EY7A 2B8FA 3CC7A 1QUQA 1TS5A 1WCMG 4GS3A 5IODA 1EWCA 1IBLL 2NBFA 5GAGC 2Y0SB 1YNJD 4K8JA 4HTHA 1L0YB 2YTYA 5M5WB 1CQVA 1YJ9A 5M5YB 4FXGC 2EVBA 1SFOB 2GN5A 3ULJA 1G91A 4A3JG 5FK9C 4A3IG 1KL9A 3BZCA 5JVH3 1PTOF 3S15H 1UEAB 4AIMA 1SMYD 3S14H 2RQXA 1B53A 3J7YW 4DR3Q 1GUGA 3TZDA 2R7DA 3HKZB 1U5KA 3PIP3 4A3DH 1LLRD 2UU9Q 4H13C 1WOCA 3GTQB 3I90A 5C4JH 1X6OA 3LNNA 1VQBA 3QB3A 4DK1A 1VQOA 5C3WA 3J81c 2MFIA 1HJPA 2ZJRA 3CMEA 4DR7L 3K7AB 2PI2E 4XQNA 4FDBA 1ASZA 1E2VA 3A0JA 3HOWG 1Q8IA 1J8IA 2YTVA 4C1NK 1G2SA 3K0YA 2M9VA 1HZCA 4Y7NH 3HOVH 3HOUG 4KY6A 3MA2B 4OGQC 1OO9B 4IQZA 4LF9L 4QUFA 1BUVT 1SNDA 1HHVA 1EQVA 3JAMc 2QA4A 1XMQQ 1D7QA 2B2UA 2EIFA 2Z6BA 4M8AA 1XWEA 4EQNA 4DV1L 1Q3LA 1YEZA 2L4NA 1PRTF 5TSSA 1SE2A 4WORA 1I4GA 3PO3G 4M1UB 5ELEA 2B2YC 1OXSC 3EQLC 3W1BA 2F0DA 2B2VA 5COYA 2F03A 1MSGA 1I4HA 3DM1A 2C9OA 4DV2L 5IWAQ 3TQYA 4HJ5A 1KNEA 1K9MC 1EY4A 4AYBG 1VQHA 2KCTA 2E2DC 3IRBA 4DXFA 1DOLA 3CQZH 3A5UA 1DCZA 5D65A 1STYA 2PW5A 1O7LA 1SYEA 1EY5A 1Q81C 1VQAA 5M5XB 3RZOB 4FF1A 1Z7TA 4K5WA 3AQQA 2VS1A 3MEHA 2HHHL 4B3TQ 4NPSA 3EROA 3GP7A 3Q6SA 2MO1A 1A0IA 1UE1A 3DWQA 1PYBA 5IYDG 3RLOA 2PI2A 4AYBB 4DAPA 3HOXG 3D3RA 3S1RH 3TP6A 1KC8C 3I56A 1EU4A 1IW7C 2Z8LA 2L9HA 1DYQA 3G7LA 3ULPA 1JOQA 2PYKA 4JI7Q 1YITA 4AYBE 2A6HC 4A3EG 2CW0D 3EJIA 2JA8G 1G291 3HZXA 3PV0A 4QIWB 1TWCH 4C3IB 1R4QB 2I5HA 1XJVA 3V2TA 4YWLA 3J81L 3CKIB 2VUMH 4IALA 1AE3A 1TWFB 4QIWE 3VYUA 5FOBB 3L2PA 2NWGA 1FGUA 3CCQA 1Q12A 4G7OC 1K8AC 2ICEC 3K8AA 2Z1CA 4A3EB 4G4KA 3A7LA 2PZWA 4R4IA 4JI5Q 3T4AC 3A54A 2A68D 3JAML 3AFQA 4TVAB 4JC0A 3HOYH 1H9SA 3DXJC 1WFQA 4BY7H 1O7YA 1I6VC 3E5SA 3E9HA 5IP9H 1SMYC 4RH6A 1LM0A 3CXCA 2I0QA 1Y14B 1V1QA 1ET6A 3NBHB 4HIDA 1ZYRC 1I4PA 2NN6H 5C0XG 1Y8PB 1OTCA 1PRTD 3TEHB 4POGA 2DY7A 2KENA 4A3MB 3K7UC 1PYWD 1U4PA 5IT9E 2R93H 4N8FA 2XTIA 3I8ZA 4R8NA 4A3FG 3SK8A 2RVLA 3T1YQ 2H4OA 1LV9A 2UUBL 3KBGA 4V190 1KXLA 4K6LA 1VQMA 1G6ZA 4MZ9A 3KBXA 5EPLA 1G51A 4PZ8A 1CT1D 2ZTEA 2R7ZH 3S1MH 3K5LA 4JPBW 3PUYA 5HURA 1JWUD 4FVMA 2UXCQ 1XPOA 1P16A 1NR4A 4C3HH 4A3BH 4IFDI 2PQEA 2E2HB 4KHPQ 1GXDC 3UDXA 2LSSA 4EQOA 1O7IA 1S40A 1T5XD 3CCSA 1CZGA 2KUMA 3CPWA 5ELBA 1JICA 2NVXH 3GTJB 3E0JA 4JI0Q 4YCUA 1BF4A 4JV5Q 1XPRA 4GKKQ 3SVMA 1NE3A 1LACA 3HKSA 1EEID 5DEHA 4GN3B 2MNAA 2CQOA 1KRSA 2EXDA 2OTLA 3G6EA 2JA6B 1PH9A 1ESFA 3I73A 4G7HC 1EWHA 2LY7A 4X66Q 2XRQD 2DNEA 4A3DG 3QO2A 3I7FA 4X3UA 1ZEQX 1HXYD 3K0XA 4IJHA 4RAUC 2JA9A 2JEBI 3KF6B 4ABNA 5M9OA 2Z0SA 1BVSA 5JVG3 1TVXA 5EGTA 3H94A 2WB1B 3SXHA 2XNAC 1HTLD 2L5TA 4E6IA 4A93H 4I7ZC 3S15B 3MAQA 3KFUA 2MUYA 2Z6KC 2Z4HA 4LUVA 1W3SA 2F4VQ 3SDZA 3HOVG 3GTPH 3KLRA 4JCVE 4IUUA 5C4JB 4H0LC 5FO8B 1X3GA 2E2IB 1MSHA 3CF5A 2QEJC 1C0AA 3MXNA 3OWFA 2VB2X 1PTOC 3FKIH 2RF4A 1HUMA 1IL2A 1ESRA 2FMCA 2RHQB 5A2QL 2PZTA 5ELCA 1YZ6A 4DR5Q 2I07B 4Y7NB 2A6ED 4DV0Q 4UPAA 1L1OB 4GKJQ 1K83B 1HR0L 4OX9L 3TRZA 1QNUA 1Q8KA 2CWAA 3P7JA 1CSQA 1STHA 4NP5A 2J0TD 1FL0A 1U0LA 2HCCA 5GADC 1L0XB 2RDHA 2EPBA 5K36H 3GO5A 4K2LA 1E7ZA 5BR8Q 4LF7L 3TDQA 1AE2A 5DLQE 1YHBA 4XQJA 3GTOH 1I3QH 5LMNW 2K6AA 3AEVA 4IPHA 1EY9A 5I9PA 3VR6A 4K5XA 1QVGA 4KTAA 1SR3A 2F3IA 4X62Q 1FVIA 4DAYB 1OXVA 5I2YA 3BDCA 3S1NH 1SYCA 4ID6A 3OTOQ 5KRUA 3PO2H 2CWPA 5LHY1 1HA5A 4H7BA 2I5LX 2NZOA 1YBYA 2RBMA 4IPCA 2R3ZA 1SE8A 1KLUD 2MJ8A 4NXMQ 4MIUA 1XMOQ 4HIOA 1XTDA 2FINB 4CDFC 2XSCA 4HEDA 3WDNA 5IP7H 3CW2C 2VNUD 2NVTB 2PMZE 2SEBD 2VUMG 3A8KE 1K3RA 1F2LA 1PH1A 4V0BA 2C5CA 3HOZH 2K75A 4FXKC 3S2DB 1MGSA 3PF4A 4B3RQ 4ILWA 4K6DA 2F0EA 4RGMA 1K8MA 4KJNA 1VCIA 2HT1A 1LT4D 4JI6Q 2D2CC 3U58A 5D14A 3I4NH 4DR3L 4GNXA 3HOYG 3HFZB 1TWCB 1JJCB 4BY7G 2E2JB 2Z4IA 4AQYL 5IP9G 4JI1Q 2NZ1D 2NN6G 4GOPB 2F0IA 1X3EA 2FJ2A 1PFMA 1JE4A 2R93G 1ET9A 4XYQA 1JORA 2F0OA 2GVAA 1BBWA 1S4ZA 2WFWA 2KA7A 3O13A 1EWIA 4A75A 4DAYA 1VMCA 1N36Q 1J5EL 4HIMA 3D4RA 2EYHA 2R7ZG 4A4IA 1HUNA 2IX0A 5FLXE 4FF3A 4C3HG 4A3BG 5EKKA 4POFA 1ENCA 3S17H 3OOCA 3D0FA 4IUQA 1T5EA 1PH7A 5KYIA 3NENA 3PIO3 2QF7A 1UE6A 5ELNA 3H0GH 3VYTA 4K14A 3S16B 1II3A 4HSPA 3RD4A 1CUKA 1S5FD 2OTJA 2D0OA 2VQFL 4EQ5A 4RHRA 4QUCA 4B08A 2AQ2B 3T51B 4DF7A 2YU9H 2K5VA 1DOMA 1K8GA 3BJUA 1H9KA 2B29A 1B7YB 3W5OA 2RA4A 1JWMD 5LMNQ 4DV3Q 1SSOA 3NWSA 2EYJA 2WINB 2F3VA 2NVYH 2AUJD 3TS2A 4A93G 2EY5A 4R4CA 3M4PA 1TWHB 1IBMQ 1V8QA 1HNXL 2O2LD 4GOPA 4Q0FA 2JA5H 2Q2TA 1HQMC 2OF1A 3I3CA 2F0KA 3I72A 5KNCA 4DUZQ 4DV5L 5M3MB 3UI2A 1OXUA 3NSWA 1GUOA 5C3XA 4JI7L 5ELDA 4DR4L 3I2ZA 1JOKA 2JQOA 1TWGH 3FEWX 4A93B 1RHPA 3FKIG 2KCCA 4MNOA 3W2DA 1QOHA 2VY3A 1KDBA 2EJMA 4DV7Q 3TP7A 3GTPB 2CHBD 1PDQA 2IPKD 1TS3A 2ZM6Q 3GV3A 1SNMA 2HQEA 5C44B 4OHJA 2MGSA 1Y1WH 1VQ7A 3I4LA 4FNFA 4JI2Q 3A56A 3F2BA 3H3VI 3D6WA 4DR1Q 5K36G 3FKIB 4IUNA 4BBSH 4CDDC 4WJWA 3CAMA 4O0AA 2K5WA 1IHZA 3NBIA 4KN4C 2WV6D 3AYHB 3IFTA 3W3AA 3K5MA 1G2TA 3GTGH 1EYDA 1D2BA 1PLFA 1HFNA 5FO7B 2KECA 4LF8L 5M3FH 4OO1I 1YNNC 3PO2G 4KY7A 3IAYA 4ME3A 4DAMA 1YIJA 2F0PA 2SNMA 3IL8A 3GTOB 1HZBA 3D8GA 1V43A 4OL7A 5IT9c 4F87A 3H09A 3HP3A 1ENFA 4CKEA 1F9RA 3K5NA 1IW7D 1VQ6A 3DWAA 4DV6Q 2NUCA 2UXCL 5IP7G 5NUCA 1VQ9A 3CCVA 2ZJPA 1W6JA 2A74C 2PZUA 2WACA 1B2TA 4A76A 2E5LQ 2JA7H 3IFDA 3KDFA 4JOIA 3R8BA 3HOZG 2BCOA 4BY1H 2IJ0A 2ZT9C 4JV5L 2LS01 2SDFA 3NUCA 1BO0A 4JG2A 5EBCA 3MXUA 3WWVA 3CC4A 1VQNA 1EOTA 4FF4A 3RLNA 4LWCA 3EA6A 3S2HB 3I4NG 1XPUA 1CA5A 1B4OA 2IX1A 2ASBA 3C3LA 3AFPA 1TWAH 5CV4A 2K5DA 3BYYB 1XNRQ 5JJIA 4PMBA 2KJXA 1FNVA 1A62A 1NMGA 1O78A 2K32A 1ASYA 1KAAA 2UUAL 1I6HH 1LTGD 1WCMB 3KLSX 4C56C 1NMFA 4DKAC 5A35A 2E75C 3NTIA 1F9SA 3HS0C 3ZYYX 1CZWA 1ZYRD 4OONA 3SE0A 1NBWA 1VQIA 3I4NB 1N8RC 2F0HA 2F0VA 1NCVA 4CHTB 4C2MH 5E4XA 1JMCA 5FKAC 4FXDA 4IFDH 4NXNL 4A3JB 4HR7B 4CDEC 2V1CC 5DAUA 1VQJA 2BA0A 4A3IB 4GLAC 1Y69U 3M7NA 2CCZA 3VYRA 3NELA 1RDPD 4R4TA 5IYCH 2ZTCA 1CHPD 1JB3A 2B2TC 1DONA 5FJ8H 2BOSA 3FDTA 3GDEA 4XTCS 5JAVA 2QCPX 2N88A 2F3WA 3R2IA 1HPCA 3VR3A 4IFDJ 3H0GG 4IURA 4YHHL 3LWUA 2L1BA 1QVCA 4N8X1 3PCOB 2B8GA 3NHHA 1HNWL 3FPPA 3MC0B 2LKVA 1L1OC 1ICFB 1I94Q 5IT9L 3M9BA 2C35B 1D8LA 5C4HA 1FJGQ 4KK7A 4IUVA 3S17B 1JJGA 3HOWB 3FRPB 4JBJA 3NWTA 1YHAA 3HOUB 2M2LA 4I7AA 3T56B 1QZGA 3MTSA 1H9SB 2WKCA 2F1MA 5E4WC 1BCPB 5GAEC 1ILPA 1S5CD 3DHQA 1VQ5A 5EBDA 4OWWB 4P75A 4DUYQ 4X62L 4IOCA 4RG1A 2RCNA 3ICEA 4JYAQ 1VQ8A 4TQUS 1CKMA 4XDXA 4B3SQ 1VF7A 3BZDB 3FMCA 4IJLA 4ME5A 3OTOL 2YU9B 1I4XA 1SJED 3FHWA 4BBRH 3PO3B 2JA5G 1F2YA 1CQFA 1PH2A 5GQOA 3HGBA 3IKJA 2EQSA 1GUNA 1B8AA 1N33L 2PNHA 2NVYB 1XMOL 4B9XA 2EOTA 3CCRA 3OHXC 3TS0A 3KJOA 4LF6Q 3CCLA 5C4ZA 4DR6L 3UDIA 2EE1A 4A3GH 1PTOD 1MKHA 4UHVA 2LXKA 4UP7A 4LK1C 2ENBA 1LTLA 4K0KL 5LMUQ 1EIYB 1J6QA 1Y1WG 1AW7A 4NW2A 1SMXA 5G3LF 3M4OB 3LGJA 2BE5C 4KHVA 5KIXA 3JAMi 2F0NA 1PH6A 3HOXB 4LJZC 5JJZA 4BBSG 4PMWA 3H91A 2L11A 4DK6C 2VQEQ 4JI1L 4F88A 2K4KA 2WP8J 1TIID 5GROA 2DJFC 5J1ZA 4KY5A 4X6AH 2EY6A 2JA8B 4X64Q 2KEDA 4ZYSA 5M3FG 2PQAB 5C0XI 4ZK9B 4QQBX 2BDOA 2CKZB 4ZUJA 1W2BA 3TBIB 4HAEA 5ISRA 2ICIA 1IBKQ 4BBSB 1N36L 3CPFA 1ONLA 3OW7A 4QCLA 2QKIC 4KN7C 3AU7A 2G5DA 3OWEB 4DU9A 4N9TA 3CCEA 2XVSA 4LFCL 4X65Q 4HCEA 4YWKA 1C8CA 2ZJQA 3A8JE 2JA7G 3MXNB 5EJWA 4HIKA 1PZJD 3QG1A 3C2PA 4BY1G 4LF4L 5C6AA 1O80A 1VQLA 3D4WA 1QB5D 2V4DA 1STGA 1PH3A 2I46A 4CDCC 3S1QH 3CRLC 1W6KA 3PUWA 1A3UA 5E7NA 3L9AX 1E22A 1VQPA 1V1PA 1BR9A 1AN8A 4A3FB 1XNQL 3PIPA 2UUCL 2JA7B 3F1ZA 3S9WA 2JYOA 4PV1C 1S5ED 3QR8A 4KKUA 5C5LA 1EQRA 4QY7A 1Q1BA 3BVZA 4K2KA 1SAPA 5AJ3Q 2K04A 4DR2Q 1ILQA 2SNSA 2AKWB 1I4RA 4DV4L 1QE6A 4RGNA 4H44C 1WVLA 3U4VA 3D4DA 1GKHA 4CGYB 4KKTA 3OW2A 4R1JA 1VQKA 4IFDG 2ID0A 3I91A 4DUZL 3VYSA 4JI3L 4DNIA 2AHOB 5ELOA 1WTPA 5LL6S 1ML0D 5G3LD 2PQAA 1IBLQ 1OXXK 5IYCG 1SDFA 1GUWA 1Z6HA 4C3JH 4XIGS 2N49A 3BU2A 3S14B 4JI8L 5FJ8G 4DXGA 2G9HD 3X3NA 3ND9A 4LF5L 2ZXOA 4A3DB 2F0WA 2F0FA 5IGDA 2TMPA 2CVRA 1L0WA 1ENAA 2JK8A 1EU3A 4C2MB 1Q86C 1C7YA 5JPNC 4KHZA 2MP1A 5KYLA 1JCKB 3J80i 1IKMA 3A55A 1B70B 1V1OA 3T13A 1PHJA 3R93A 3VA5A 4QF4A 3HRZC 1PTOH 1GVPA 4J1MA 2Q8TA 4PZ7A 5KGUA 4U673 4DN4M 2E76C 3HOVB 3F2UA 5C3EH 2IT1A 2N55A 4JI4L 3FVQA 4GNXB 1K0SA 3DEPA 3RUZA 5IIFA 5FLMH 1E2ZA 2AMCB 1B9MA 3E3XA 5FLXL 1EOVA 3DEOA 1GOZA 1VDZA 3MXPA 4LFBL 4IO9A 2B2WA 3GV6A 1WTVA 4RGTA 2O5IC 4BBRG 1CM9A 4C1NI 1YHQA 1M90C 1KQSA 2JE6I 4K8IA 5AFWA 1KABA 2B3GA 3MXGA 3RZDH 4RKBA 3WOFA 3J7A5 1N9WA 3DMUA 4GLXA 3BVMA 1STAA 5I4DA 1H95A 4X3KA 4OIKA 2R61A 1C48A 1A3TA 4DNTB 1E24A 2D0PA 1CTMA 3SHLA 3H3VC 4A3GG 3CQZB 3P20A 4P2CB 1YJNA 1A3VA 4DV2Q 2B2UC 1STNA 1K73C 2PMZB 4KJOA 3RN2A 2WAQG 5L37A 4X3SA 3EVQA 1BOSA 1I4QA 2WKDA 2IHFA 3FP9A 1PFBA 2EYPA 1LTID 3S1RB 2HUGA 2B2VC 2KOLA 3M4YA 2R92H 3EBEA 3C46A 4A3GB 1U4RA 1EIFA 2K28A 3KF8A 2HHHQ 1SYGA 5ELFA 2K50A 1TY0A 1UE7A 4YY3Q 5IGBA 5M5YH 2KHJA 2NN6I 1TXYA 1TKWB 1PA6A 2WAQE 2UU9L 3SR1A 2VUMB 4L6TB 1EYCA 2EJFC 1YNND 4HMIA 4S3SA 3NE5B 2EY2A 2K01A 1KAWA 4OWXB 1X9NA 2OT2A 3SEBA 1B3AA 1EFWA 4OXPA 3GTKH 3GTQH 1NSNS 3HOYB 2B2YA 4BY7B 3MFGA 2E74C 3L3OC 1Z9FA 4BS9A 2FXQA 2RCFA 1TU2B 2HIXA 4WJ4A 2GVBA 1XMQL 3K7AH 1SNOA 1STBA 1VQCA 3T1HQ 1K3BC 3VR5A 1CKNB 4DNRB 4KLKA 2R93B 3QOLA 3WOEA 3GTLH 4IPGA 1DD2A 1KTKA 5IY0A 1F9QA 5IOCA 1PZID 4UY8C 1ZKOA 1RF2D 3A74A 1RCVD 1DM0B 3J80E 3S1MB 2R7ZB 5IWAL 5D3DA 1NR2A 3STBD 5HGTA 3A7AB 3Q24A 4C3HB 5CBAE 4A3BB 2K52A 3URYA 4B3MQ 5EAYA 5J3BA 1WTQA 4JYAL 3KOJA 1VF5C 3B6YA 1JQYD 4Z9CB 2NVXB 4ODGA 3QOJA 4TSSA 3AB9A 3Q8DA 2JN4A 4B9WA 5JEAH 2EYMA 5D3IB 4EGVA 2F0QA 3CRKC 4MTKA 3U4ZA 4B3TL 4J6HA 4C3JG 2XWBB 1CA6A 3AMUA 1X56A 2DN8A 2HD3A 4PZ6A 1QJOA 1M4VA 4ZKBB 5EKIA 2VB3X 1H9MA 3N6RA 4IPDA 5JEAJ 4QGUA 3KLWA 1A15A 1EY6A 3KDFB 2IY5B 5IGGA 4O1NA 1Y1VH 2PPBC 1QILA 2QGQA 1GJXA 4C3JB 3VA7A 1LYLA 1LT3D 1SEBD 1S5BD 4NB3A 3U9SA 4F7XA 2KVMA 2RSOA 3Q22A 1FYCA 1Q90A 2XIWA 5CV8A 5C3EG 1CKNA 3CP0A 1HRJA 4MTNA 4EQPA 2L15A 5EPJA 5FLMG 2EZVA 5IGCA 4L8JA 4UAIA 2TSSA 4C3IH 2PNRC 3BVGA 1F9PA 2JSOA 4MHEA 4JI5L 4RCOA 2AQ1B 4X64L 1EL0A 1JE5A 2R7FA 1ICWA 3OYYA 4IOAA 3CCUA 1IBKL 5C3EB 1DOKA 1CHQD 1IZ6A 1DJRD 2LXJA 3RN5A 4FO2A 1KDAA 3EIVA 3PQIA 4F8MA 2Q2HA 1E1OA 3T1YL 3G48A 4OX9Q 1A2UA 1I3QB 1YNXA 1EFID 2QW7A 3CCJA 2LFNA 1AEXA 1EY0A 1HTPA 2A73B 1SROA 4A3MH 1RODA 5EPKA 2LMCB 2J4XA 4G7ZC 5E3FA 3S1NB 4KHPL 4LF7Q 1WTHA 3S24A 2JP1A 4UP9A 3PO2B 2R92G 1K8OA 5E1FA 4JBKA 5EQ0A 2BE5D 4YIJA 1HA6A 3NQTA 4JI0L 1EYGA 4ZUIA 1UNSA 4GKKL 3F2DA 1UAPA 1SNQA 1PRTB 2Y0SG 2E2HH 3E9IA 3CU7A 1PVOA 1NJIC 1TY2A 2RDGA 1X55A 3N52A 2Z6KA 1PZKD 5H1SE 3BDOA 1D1IA 4X66L 3GTJH 3E6ZX 3UDFA 2IW3A 2K14A 3STBC 2L55A 3NQIA 4QL5A 1N32Q 1HZAA 2A19A 4LUZA 4CKCA 3BG3A 2OWOA 5C0XJ 3HOZB 5CV5A 3H6MA 2JA6H 5CV7A 2QILA 1IYVA 5JJLA 2CFMA 4LMQD 3HKZG 2AQ3B 3Q23A 1UE5A 4R9WA 4QJFA 1IL8A 4OEMB 1AZQA 4Y52H 2JJQA 3RR5A 3OIQA 2EYOA 2KCMA 2F4VL 3PIOA 4HJAA 4A3LH 1ZXTA 2Y0SE 4R4OA 1FNUA 3M4QA 2CH4W 4J8QA 1NY4A 4P71A 1MJEA 1HFGA 1D5XC 1RKNA 3SK5A 5IGEA 2KEEA 1IXRA 3T16A 4APVA 2D5DA 1O7ZA 3L7ZC 4AQYQ 2A8VA 3GTKB 1TS2A 1SNPA 1SE4A 3P1HA 1LO5D 4DR5L 4DV0L 2N3SA 2E2IH 4GKJL 1LTSD 3HKZE 4I65A 1CK1A 4YWMA 4HJ7A 5IE8A 4KD4A 2KHSA 3UDGA 3UE0A 2UXBQ 1I50H 1SJHD 1HQRD 2H5XA 2OCEA 2F4IA 1LTBD 1Q82C 3MZ5A 4A3KH 2AWOA 2MPMA 3KUPA 4P74A 4GNXC 3EN2A 1MHWC 4UP8A 4FYDA 3K6OA 3OPOA 3DM3A 4H02A 5BR8L 3GTLB 1PH8A 1K83H 4HJ9A 1J5EQ 4HJ8A 3PSIA 2G9DA 3H0GB 1EY8A 4RKLA 5JEAG 1KRTA 1JR0D 4WJ3M 3SK6A 2K33A 4LNQA 4EX5A 3K59A 1QWYA 3NPPA 2FFKB 1TR5A 2ZTDA 4IUTA 4MN3A 2MQHA 2K5HA 2VW9A 3TMEA 3CD6A 2X69A 2J7ZA 4L5TA 2Q2IA 4XT1B 1R9TH 4ALPA 2QDLA 1PXUA 2MO0A 2O4XA 1YVCA 2O5JC 1PMRA 2VQFQ 2RDFA 3UE1A 1WTOA 3G71A 1BNZA 3TSSA 4NXML 1QG7A 1Y1VG 1Z47A 3GQBA 3VDYA 2D9UA 1I5FA 1BBUA 1NUCA 1SBBB 3J81i 2UXDQ 1SXTA 1NTGA 1B1ZA 1U9RA 2JA5B 4K5VA 1V1PB 1RD9D 3TP8A 4B3RL 4PNYA 3J7AV 4BA2I 3I55A 4WRDA 4JI6L 3ND8A 4C3IG 2NVTH 3HEJA 4FF2A 1STEA 1HNXQ 1TWGB 2CH4A 1Y1VB 1AP0A 4YY3L 1C4QA 1VQ4A 1EUJA 1CFMA 4HSVA 4PQXA 3ERQA 4DV5Q 5BN5A 1Q46A 2F0TA 3K81C 3U50C 3S2DH 3ULLA 1GM5A 1JOOA 3QJYA 4DR4Q 4RCNA 2DGYA 2H1EA 1EEFD 4P73A 4ULLA 1C9OA 5CR3A 3F2CA 1MI2A 1Y1WB 2OEOA 2E2JH 1KHIA 3EFXD 3ITPA 1MD2D 3A5ZB 4GOPC 2RKSA 1JC7A 2NVQH 2F0MA 1K0RA 1HNZQ 1PFSA 3PUVA 1YNJC 1YI2A 4LFAQ 2A69D 4RHSA 4U68A 4GN4B 3C1FA 4A3MG 2HCIA 1D5MC 3X3MA 2XRSD 1BBXC 4N9PA 2X6GA 3TREA 3T1HL 1BCPF 1H9RA 3GTGB 3SGIA 5BN3A 4JBWA 5M3FB 1KD1C 4BXXH 4GZYC 1D5ZC 1GUSA 1JB7A 3I70A 5FLXc 2AUKA 4LUOA 2DNCA 5I6YA 4L63B 1FGBD 5C4XH 4IUPA 4LW1A 1FNWA 1LTAD 1RTOA 1KNAA 2BDNA 5HGQA 3BYTB 3E0EA 3W1GA 3M7GA 1NAPA 3K80C 3MWYW 4LF8Q 3PGZA 1FR3A 4B3ML 3U9OA 3J80c 5KNBA 2NTTA 3K57A 2NZHA 3NTKA 5IYBH 3S16H 1BQQT 2SOBA 5T1GA 3SK4A 5CBEE 4BY1B 5LMNL 4DV3L 1X54A 4A3CH 2JA6G 1WTXA 1EQTA 2E8GA 2FHTA 1E0BA 3DWPA 5CORA 2B63H 5CGKA 4GN5A 4NMZA 1IBML 1LTTD 1UWVA 1BDOA 5DNFA 1N34Q 4A3LG 1TWAB 4ZRZA 3NXWA 2A5HA 3CMAA 2WB1G 4ZKCB 3A8IE 3D31A 1CKOA 4UDUC 1PV4A 1I6HB 2ALYB 2B39A 3NTHA 1TWHH 4HN7A 1IKLA 1A2TA 1RIPA 2IX3A 3R3OA 2YYZA 1QVFA 1XXGA 4JOIC 5M3MH 1MJCA 3BDLA 3MFYA 3J81j 3M85A 4DV7L 2UUAQ 3PUXA 1QZHA 2K7VA 3VR4A 1JT8A 1SYFA 1LUZA 4FP5D 3M3YH 1LTRD 2ZM6L 2OQ0A 2Q8IB 5CC4A 1EIHA 4NKLA 5IGFA 4KKSA 5EKLA 2L12A 3KF8B 4HMJA 4LAAA 4A3KG 2BH2A 1KDCA 4DAVA 4JI2L 2VZAA 3J81E 2F0SA 3NBHA 4PG3A 3ER0A 2A1AA 2WB1E 2BA1A 2KHIA 4DR1L 1RJTA 1LT5D 2HQLA 2PO4A 4KMUC 4NXNQ 3F8TA 5C44H 2YTXA 1BCPD 4DR7Q 2DY8A 3OMCA 4OWTB 4CJ2C 4L5SA 3BS1A 1U4LA 3CCMA 3JAME 1I50B 3DLLA 4A3KB 1B44D 4ZQ3A 4PMCA 2L0CA 4LF9Q 4YHHQ 2KQ3A 2CW0C 1BKBA 1TQOA 1Y8NB 2XWJB 1QCBD 4DV1Q 3J80L 2HDMA 1HNWQ 2N8NA 1T9HA 1SYDA 4CJ0B 1JWSD 1HCZA 5HY6A 4DV6L 3ZJYC 4L5QA 2K03A 4R4QA 2A69C 1QNKA 2ZXPA 5C5MA 2E5LL 2P5ZX 4BBRB 2EDGA 3GTMH 1LT6D 1R9TB 3L0OA 1AH9A 5JJKA 3PMFA 1WTWA 2A68C 1WYDA 3H3VH 3OSOA 4DK0A 1E1TA 2HDLA 1D6EC 3KLSA 4OIJA 1M1KC 2XGTA 2Q2UA 4J15A 1SE3A 1UUPA 4QB4A 4X3TA 3OMGA 3TN2A 2FMMA 3KF6A 2IWHA 1WTRA 2NYZD 4RFBA 1SLJA 3MHBA 5F2DA 3I4MH 1PRTC 2VL6A 3RLFA 5GAHC 1XNRL 1DZ1A 1N32L 1XTCD 3CC2A 4OO1H 3DUZA 1N33Q 3MEFA 2WAQB 4BWGB 3S2HH 1WJJA 1X65A 4CBVA 5M5WH 1SYBA 1VQGA 2B2TA 2EYFA 4Q5VA 2Z9HA 2EY1A 4DR6Q 3K5OA 1SFOH 5CYUA 1GD7A 3RNUA 1B9NA 1MBYA 1L2FA 1EYAA 3I4OA 3ERSX 3JC66 4K0KQ 1PH4A 1S3OA 1WCMH 4IN3A 5KNDA 1A8VA 1WD0A 1WI5A 1M8AA 1A6XA 1UEBA 2F0JA 3VR2A 1VQEA 1X3QA 1CI3M 1L1OA 4ZCKA 4XXEA 1XYIA 5JPMC 4XYOA 1X32A 2ES2A 5I6WA 3QIAA 3LX0A 3CHBD 1HR0W 4BXXG 2F0LA 4A3JH 1MIUA 4RA8A 2NVQB 5C4XG 2QDBA 4KD3A 4A3IH 4YCVA 1KIXA 4KI0A 1TT2A 2ZXRA 2NB0A 1B3QA 3D6CA 2DUDA 5CV6A 2XN9C 2UXBL 1FD7D 4EVOA 2GA4B 3GD7A 1PFNA 1I94L 3J7ZC 5A2QE 1VMPA 1FJGL 5CMDA 2DJGC 1OXTA 1F77A 5IYBG 3OIPA 1P8LA 2EXZA 3KJPA 2JEAI 5C4XB 4NDXA 3R2TA 3LWEA 4A3CG 3G6JB 1F2ZA 2ATWA 4L5RC 2B63G 2OQKA 2PW7A 5KEEA 1X3PA 4DUYL 1EZ8A 4LFCQ 3T53B 1PH5A 3NK9A 3S1QB 2K05A 3TZUA 1KLGD 2UUBQ 2M00A 3HOWH 4B3SL 4G57A 2Q8RE 5LL6X 1JJ2A 1BCPC 2D62A 3HOUH 1PYSB 1R4PB 4LF4Q 2NTSA 2CQAA 1IYUA 2KBNA 1U4MA 3V96A 3KK7A 1K28A 1BXTA 3PUZA 2AWNA 3H15A 2B63B 5FO9B 2A6EC 3ONAB 1HH2P 1XNQQ 2EJGC 3PO3H 4LF6L 3V05A 2UUCQ 4YCWA 2F0UA 5M3MG 3Q0AA 2WIIB 5M5XH 3RZOH 2UXDL 3HG9A 1Y8OB 5J22A 5J39A 4P72A 5BN4A 4CJ1B 4DGZA 5LMUL 1A63A 4DV4Q 2X6LA 1Q7YC 4RMFA 1GHKA 2R6GA 1LABA 3G4SA 5I2XA 4R8IA 2F0GA 1E2WA 2PCFB 3QWNA 1J9OA 2OXPA 5T1IA 1VS0A 4JI3Q 2K5QA 2F52A
chains in the Genus database with same CATH topology
4RWSC 1B50A 2RSNA 4JK1C 4BA1I 1AFPA 1G8ZD 4ZLTF 3M3YB 2K1BA 4DA2A 4TKOB 3TP5A 5K5PA 1D1KA 2EYLA 1Q1EA 2IL8A 1H9JA 1PTOB 4RGOS 3K58A 5DM63 5DM73 3NP8A 5CV9A 3C1EA 1EIGA 1EZ6A 4XQQA 4CKBA 4WFN3 1TS4A 3J7AF 4O42A 2VXWA 1GHJA 4KV6A 4XT3B 2JXMB 1WD1A 3P75A 2MHVA 4DFAA 1DXMA 3RMHA 4ZAIA 3RZDB 3MVVA 1RTNA 2KCNA 3FPUB 1XX8A 1F2MA 3GTMB 1S5DD 1SNCA 5JOBA 4HCSA 4OO1G 5C0XH 4QMGA 5I9OA 1GUTA 4IZ8A 4TRDA 2B2WC 2A6HD 1AZPA 2R92B 3I4MB 1EY7A 2B8FA 1TS5A 5IODA 1EWCA 2NBFA 2Y0SB 1YNJD 4K8JA 4HTHA 1L0YB 5M5WB 1CQVA 5M5YB 4FXGC 2EVBA 1SFOB 1G91A 5FK9C 5JVH3 1PTOF 1UEAB 1SMYD 2RQXA 1B53A 3J7YW 1GUGA 3TZDA 3HKZB 3PIP3 1LLRD 4H13C 3GTQB 3I90A 3LNNA 3QB3A 4DK1A 5C3WA 3K7AB 4XQNA 1E2VA 1Q8IA 1J8IA 4C1NK 1G2SA 3K0YA 2M9VA 4KY6A 3MA2B 4OGQC 1OO9B 4IQZA 4QUFA 1BUVT 1SNDA 1HHVA 1EQVA 2B2UA 4M8AA 1XWEA 4EQNA 1Q3LA 2L4NA 1PRTF 5TSSA 1SE2A 4WORA 1I4GA 4M1UB 5ELEA 2B2YC 1OXSC 3EQLC 2F0DA 2B2VA 5COYA 2F03A 1MSGA 1I4HA 3DM1A 2C9OA 1KNEA 1EY4A 2E2DC 4DXFA 1DOLA 1DCZA 5D65A 1STYA 2PW5A 1O7LA 1SYEA 1EY5A 5M5XB 3RZOB 4FF1A 1Z7TA 4K5WA 3MEHA 3EROA 3GP7A 3Q6SA 3DWQA 4AYBB 4DAPA 3D3RA 3TP6A 1EU4A 1IW7C 2Z8LA 2L9HA 1DYQA 3G7LA 1JOQA 2PYKA 2A6HC 2CW0D 3EJIA 1G291 3HZXA 3PV0A 4QIWB 4C3IB 1R4QB 3V2TA 3J81L 3CKIB 4IALA 1TWFB 3VYUA 5FOBB 2NWGA 1Q12A 4G7OC 2ICEC 2Z1CA 4A3EB 3A7LA 2PZWA 4G4KA 3T4AC 3A54A 2A68D 3JAML 1H9SA 3DXJC 1O7YA 1I6VC 3E5SA 1SMYC 4RH6A 1ET6A 1ZYRC 1I4PA 2NN6H 5C0XG 1Y8PB 1PRTD 2DY7A 4A3MB 1PYWD 1U4PA 5IT9E 3I8ZA 4R8NA 3SK8A 2RVLA 2H4OA 1LV9A 3KBGA 4V190 4K6LA 1G6ZA 3KBXA 5EPLA 1CT1D 3K5LA 3PUYA 5HURA 1JWUD 4FVMA 1NR4A 4IFDI 2E2HB 2PQEA 1GXDC 4EQOA 1T5XD 1CZGA 2KUMA 5ELBA 1JICA 3GTJB 3E0JA 1BF4A 3SVMA 1LACA 1EEID 5DEHA 2JA6B 1ESFA 3I73A 4G7HC 1EWHA 2LY7A 2XRQD 2DNEA 3QO2A 4X3UA 1ZEQX 1HXYD 4RAUC 2JEBI 4ABNA 5JVG3 5M9OA 1TVXA 5EGTA 3H94A 2WB1B 3SXHA 2XNAC 1HTLD 2L5TA 4E6IA 4I7ZC 3S15B 3MAQA 2MUYA 2Z4HA 3SDZA 3KLRA 4IUUA 5C4JB 4H0LC 5FO8B 2E2IB 1MSHA 2QEJC 3MXNA 2VB2X 3OWFA 1PTOC 1HUMA 1ESRA 2FMCA 5A2QL 2PZTA 5ELCA 2I07B 4Y7NB 2A6ED 1K83B 1QNUA 3P7JA 1STHA 4NP5A 2J0TD 2HCCA 1L0XB 2RDHA 2EPBA 5K36H 3GO5A 4K2LA 3TDQA 4XQJA 2K6AA 1EY9A 5I9PA 3VR6A 4K5XA 4KTAA 1OXVA 5I2YA 3BDCA 1SYCA 4ID6A 5KRUA 5LHY1 1HA5A 4H7BA 2RBMA 2R3ZA 1KLUD 2MJ8A 4MIUA 2FINB 2XSCA 4HEDA 3WDNA 2VNUD 2NVTB 2SEBD 3A8KE 1F2LA 4V0BA 2C5CA 4FXKC 3S2DB 1MGSA 4ILWA 4K6DA 2F0EA 4RGMA 1K8MA 4KJNA 1VCIA 1LT4D 2D2CC 5D14A 1TWCB 2E2JB 2Z4IA 2NZ1D 2NN6G 2F0IA 2FJ2A 1PFMA 1JE4A 1ET9A 4XYQA 1JORA 2F0OA 1S4ZA 2KA7A 3O13A 4DAYA 1VMCA 3D4RA 2EYHA 1HUNA 2IX0A 5FLXE 4FF3A 4C3HG 5EKKA 1ENCA 3OOCA 4IUQA 1T5EA 5KYIA 3PIO3 2QF7A 3VYTA 4K14A 3S16B 1II3A 4HSPA 3RD4A 1S5FD 4RHRA 4QUCA 4B08A 2AQ2B 3T51B 4DF7A 1DOMA 1H9KA 2RA4A 1JWMD 1SSOA 3NWSA 2EYJA 2WINB 2F3VA 2AUJD 2EY5A 1TWHB 1V8QA 2O2LD 4Q0FA 1HQMC 2OF1A 3I3CA 2F0KA 3I72A 5KNCA 5M3MB 3UI2A 1OXUA 3NSWA 1GUOA 5C3XA 5ELDA 1JOKA 3FEWX 4A93B 1RHPA 2KCCA 3W2DA 1QOHA 1KDBA 2EJMA 3TP7A 3GTPB 2CHBD 1PDQA 2IPKD 1TS3A 3GV3A 1SNMA 2HQEA 5C44B 4OHJA 2MGSA 3I4LA 4FNFA 3A56A 3D6WA 5K36G 3FKIB 4IUNA 4WJWA 2K5WA 1IHZA 3NBIA 4KN4C 2WV6D 3IFTA 3W3AA 3K5MA 1G2TA 1EYDA 1D2BA 1PLFA 1HFNA 5FO7B 2KECA 4OO1I 1YNNC 4KY7A 3IAYA 2F0PA 2SNMA 3IL8A 3GTOB 3D8GA 1V43A 4OL7A 4F87A 3H09A 3HP3A 1ENFA 4CKEA 1F9RA 3K5NA 1IW7D 3DWAA 2NUCA 5NUCA 1W6JA 2A74C 2PZUA 2WACA 1B2TA 3IFDA 3R8BA 2BCOA 2IJ0A 2ZT9C 2LS01 2SDFA 3NUCA 1BO0A 5EBCA 3MXUA 1EOTA 4FF4A 3EA6A 3S2HB 1CA5A 1B4OA 2IX1A 3C3LA 5CV4A 2K5DA 3BYYB 4PMBA 2KJXA 1FNVA 1O78A 2K32A 1KAAA 1LTGD 1WCMB 3KLSX 4C56C 5A35A 2E75C 3NTIA 1F9SA 3HS0C 3ZYYX 1CZWA 1ZYRD 3SE0A 3I4NB 2F0HA 2F0VA 1NCVA 4CHTB 5E4XA 5FKAC 4FXDA 4IFDH 4A3JB 4HR7B 5DAUA 2BA0A 4A3IB 1Y69U 3M7NA 3VYRA 1RDPD 1CHPD 1JB3A 2B2TC 1DONA 2BOSA 3FDTA 4XTCS 5JAVA 2QCPX 2N88A 2F3WA 3R2IA 1HPCA 3VR3A 4IFDJ 4IURA 3LWUA 2L1BA 2B8GA 3NHHA 3FPPA 3MC0B 2LKVA 5IT9L 5C4HA 4KK7A 4IUVA 3S17B 3HOWB 3FRPB 3NWTA 3HOUB 2M2LA 3T56B 3MTSA 1H9SB 2WKCA 2F1MA 5E4WC 1BCPB 1ILPA 1S5CD 3DHQA 5EBDA 4TQUS 4XDXA 1VF7A 3BZDB 3FMCA 4ME5A 2YU9B 1I4XA 1SJED 3PO3B 1F2YA 1CQFA 3HGBA 3IKJA 1GUNA 2NVYB 4B9XA 2EOTA 3OHXC 5C4ZA 2EE1A 1PTOD 4LK1C 2ENBA 1AW7A 4NW2A 5G3LF 3M4OB 2BE5C 4KHVA 5KIXA 2F0NA 3HOXB 4LJZC 5JJZA 4PMWA 3H91A 2L11A 4F88A 2WP8J 1TIID 5J1ZA 4KY5A 2EY6A 2JA8B 2KEDA 4ZYSA 5C0XI 4ZK9B 2BDOA 4ZUJA 3TBIB 4HAEA 5ISRA 2ICIA 4BBSB 1ONLA 3OW7A 4QCLA 2QKIC 4KN7C 3AU7A 3OWEB 4DU9A 4N9TA 2XVSA 4HCEA 1C8CA 3A8JE 5EJWA 1PZJD 3QG1A 3C2PA 5C6AA 1O80A 3D4WA 1QB5D 2V4DA 1STGA 2I46A 3CRLC 1W6KA 3PUWA 1A3UA 3L9AX 1V1PA 1BR9A 1AN8A 4A3FB 2JA7B 3S9WA 2JYOA 4PV1C 1S5ED 4KKUA 5C5LA 1Q1BA 3BVZA 4K2KA 1SAPA 2K04A 1ILQA 2SNSA 1I4RA 1QE6A 4RGNA 4H44C 1WVLA 3D4DA 4CGYB 4KKTA 4IFDG 2ID0A 3I91A 3VYSA 1WTPA 5LL6S 1ML0D 5G3LD 1OXXK 1SDFA 1GUWA 1Z6HA 4XIGS 3S14B 4DXGA 2G9HD 3X3NA 3ND9A 2ZXOA 4A3DB 2F0WA 2F0FA 5IGDA 2TMPA 2CVRA 1ENAA 4C2MB 1EU3A 5JPNC 4KHZA 2MP1A 5KYLA 1JCKB 1IKMA 3A55A 1V1OA 3T13A 3R93A 3VA5A 4QF4A 3HRZC 1PTOH 4J1MA 2Q8TA 5KGUA 4U673 4DN4M 2E76C 3HOVB 3F2UA 2IT1A 2N55A 3FVQA 3DEPA 3RUZA 5IIFA 1E2ZA 1B9MA 5FLXL 3DEOA 1GOZA 1VDZA 3MXPA 2B2WA 3GV6A 1WTVA 4RGTA 2O5IC 1CM9A 4C1NI 2JE6I 4K8IA 5AFWA 1KABA 3MXGA 4RKBA 3WOFA 3DMUA 3BVMA 1STAA 5I4DA 4X3KA 4OIKA 2R61A 1C48A 1A3TA 4DNTB 3SHLA 1CTMA 3H3VC 3CQZB 3P20A 4P2CB 1A3VA 2B2UC 1STNA 2PMZB 4KJOA 4X3SA 3EVQA 1BOSA 1I4QA 2WKDA 1PFBA 2EYPA 1LTID 3S1RB 2HUGA 2B2VC 2KOLA 3M4YA 3C46A 4A3GB 1U4RA 3KF8A 2K28A 1SYGA 5ELFA 1TY0A 5IGBA 2NN6I 1TKWB 3SR1A 2VUMB 4L6TB 1EYCA 2EJFC 1YNND 4HMIA 4S3SA 3NE5B 2EY2A 2K01A 2OT2A 3SEBA 1B3AA 1NSNS 3HOYB 2B2YA 4BY7B 3MFGA 2E74C 3L3OC 4BS9A 1TU2B 1SNOA 1STBA 3VR5A 4DNRB 2R93B 3QOLA 3WOEA 1DD2A 1KTKA 1F9QA 5IOCA 1PZID 1ZKOA 1RF2D 1RCVD 1DM0B 3J80E 3S1MB 2R7ZB 5D3DA 1NR2A 5HGTA 3A7AB 3Q24A 4C3HB 5CBAE 4A3BB 3URYA 1WTQA 1VF5C 1JQYD 4Z9CB 2NVXB 4ODGA 3QOJA 4TSSA 3AB9A 4B9WA 5JEAH 2EYMA 4EGVA 5D3IB 2F0QA 3CRKC 4J6HA 4C3JG 2XWBB 1CA6A 3AMUA 2DN8A 1QJOA 1M4VA 4ZKBB 5EKIA 2VB3X 1H9MA 3N6RA 5JEAJ 1A15A 1EY6A 5IGGA 4O1NA 2PPBC 1QILA 1GJXA 4C3JB 3VA7A 3U9SA 4F7XA 1LT3D 1SEBD 1S5BD 2KVMA 2RSOA 3Q22A 1FYCA 1Q90A 2XIWA 5CV8A 1HRJA 4EQPA 5EPJA 2EZVA 5IGCA 4L8JA 4UAIA 2TSSA 2PNRC 3BVGA 1F9PA 2JSOA 4MHEA 4RCOA 2AQ1B 1EL0A 1ICWA 5C3EB 1DOKA 1CHQD 1DJRD 4FO2A 1KDAA 4F8MA 1A2UA 1I3QB 1EFID 2LFNA 1AEXA 1EY0A 1HTPA 2A73B 1RODA 5EPKA 2LMCB 2J4XA 4G7ZC 5E3FA 3S1NB 2JP1A 3PO2B 1K8OA 5E1FA 5EQ0A 2BE5D 4YIJA 1HA6A 3NQTA 4ZUIA 1UNSA 1UAPA 1SNQA 1PRTB 3CU7A 1TY2A 2RDGA 3N52A 1PZKD 3BDOA 1D1IA 3E6ZX 2IW3A 2L55A 3NQIA 4CKCA 3BG3A 5C0XJ 3HOZB 5CV5A 3H6MA 5CV7A 2QILA 1IYVA 4LMQD 2AQ3B 3Q23A 4R9WA 1IL8A 1AZQA 3OIQA 2EYOA 1ZXTA 1FNUA 4J8QA 5IGEA 1HFGA 1D5XC 1RKNA 3SK5A 2KEEA 3T16A 2D5DA 1O7ZA 3L7ZC 3GTKB 1TS2A 1SNPA 1SE4A 3P1HA 1LO5D 1LTSD 4I65A 1CK1A 4KD4A 2KHSA 1SJHD 1HQRD 2F4IA 1LTBD 3MZ5A 2AWOA 2MPMA 3KUPA 4FYDA 3K6OA 3OPOA 3GTLB 2G9DA 3H0GB 1EY8A 4RKLA 5JEAG 1JR0D 3SK6A 2K33A 3K59A 1QWYA 3NPPA 2FFKB 1TR5A 4IUTA 4MN3A 3TMEA 2X69A 2J7ZA 4XT1B 1PXUA 2O4XA 2O5JC 1PMRA 2RDFA 1WTOA 1BNZA 3TSSA 1QG7A 1Z47A 3GQBA 2D9UA 1NUCA 1SBBB 1SXTA 1B1ZA 1U9RA 2JA5B 4K5VA 1V1PB 1RD9D 3TP8A 4PNYA 3J7AV 4BA2I 4WRDA 3ND8A 4C3IG 3HEJA 4FF2A 1STEA 1TWGB 1Y1VB 1AP0A 1C4QA 4HSVA 1CFMA 4PQXA 3ERQA 5BN5A 2F0TA 1JOOA 3QJYA 4RCNA 2H1EA 1EEFD 4ULLA 5CR3A 1MI2A 1Y1WB 2OEOA 3EFXD 3ITPA 1MD2D 2RKSA 1JC7A 2F0MA 3PUVA 1YNJC 2A69D 4RHSA 4U68A 3C1FA 2HCIA 1D5MC 3X3MA 2XRSD 1BBXC 4N9PA 2X6GA 1BCPF 1H9RA 3GTGB 5BN3A 4JBWA 5M3FB 4GZYC 1D5ZC 1GUSA 3I70A 2AUKA 2DNCA 5I6YA 4L63B 1FGBD 4IUPA 1FNWA 1LTAD 1RTOA 1KNAA 2BDNA 3BYTB 3M7GA 1NAPA 3MWYW 1FR3A 3U9OA 5KNBA 2NTTA 3K57A 3NTKA 1BQQT 2SOBA 5T1GA 3SK4A 5CBEE 4BY1B 1WTXA 1EQTA 2FHTA 1E0BA 3DWPA 5CORA 5CGKA 4NMZA 1LTTD 1BDOA 5DNFA 1TWAB 4ZRZA 3NXWA 2A5HA 4ZKCB 3A8IE 3D31A 4UDUC 1I6HB 2B39A 3NTHA 4HN7A 1IKLA 1A2TA 2IX3A 3R3OA 2YYZA 1XXGA 3BDLA 3MFYA 3M85A 3PUXA 2K7VA 3VR4A 1SYFA 4FP5D 1LTRD 2Q8IB 5CC4A 1EIHA 4NKLA 5IGFA 4KKSA 5EKLA 2L12A 4HMJA 4LAAA 1KDCA 4DAVA 3J81E 2F0SA 3NBHA 2BA1A 1RJTA 1LT5D 2PO4A 4KMUC 1BCPD 2DY8A 3OMCA 4CJ2C 3BS1A 1U4LA 3JAME 1I50B 4A3KB 1B44D 4ZQ3A 4PMCA 2L0CA 2KQ3A 2CW0C 1TQOA 1Y8NB 2XWJB 1QCBD 3J80L 2HDMA 4CJ0B 1SYDA 1JWSD 1HCZA 2K03A 2A69C 1QNKA 2ZXPA 5C5MA 4BBRB 2EDGA 1LT6D 1R9TB 3PMFA 1WTWA 2A68C 3OSOA 4DK0A 2HDLA 1D6EC 3KLSA 4OIJA 1SE3A 1UUPA 4QB4A 4X3TA 3OMGA 3TN2A 2FMMA 2IWHA 1WTRA 2NYZD 4RFBA 3MHBA 5F2DA 1PRTC 3RLFA 1DZ1A 1XTCD 4OO1H 3DUZA 2WAQB 4BWGB 4CBVA 1SYBA 2B2TA 2EYFA 4Q5VA 2EY1A 3K5OA 5CYUA 1B9NA 1MBYA 1EYAA 4IN3A 5KNDA 1WD0A 1M8AA 1A6XA 2F0JA 3VR2A 1X3QA 1CI3M 4XXEA 1XYIA 5JPMC 4XYOA 1X32A 5I6WA 3QIAA 3LX0A 3CHBD 2F0LA 4RA8A 2NVQB 2QDBA 4KD3A 4KI0A 1TT2A 2ZXRA 2NB0A 3D6CA 5CV6A 2XN9C 1FD7D 4EVOA 2GA4B 3GD7A 1PFNA 5A2QE 1VMPA 5CMDA 1OXTA 1F77A 3OIPA 2EXZA 2JEAI 5C4XB 4NDXA 3R2TA 3LWEA 3G6JB 1F2ZA 2PW7A 5KEEA 1X3PA 1EZ8A 3T53B 3NK9A 3S1QB 2K05A 3TZUA 1KLGD 2M00A 4G57A 2Q8RE 5LL6X 1BCPC 2D62A 1R4PB 2NTSA 2CQAA 1IYUA 1U4MA 3V96A 3KK7A 1BXTA 3PUZA 2AWNA 2B63B 5FO9B 2A6EC 3ONAB 2EJGC 3V05A 2F0UA 3Q0AA 2WIIB 3HG9A 1Y8OB 5J22A 5J39A 5BN4A 4CJ1B 4DGZA 2X6LA 1GHKA 2R6GA 1LABA 5I2XA 4R8IA 2F0GA 1E2WA 2PCFB 3QWNA 1J9OA 2OXPA 5T1IA 2K5QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VYR A;  3VYT A;  2OT2 A;  3D3R A;  3VYS A;  2Z1C A;  3VYU A; 
#chains in the Genus database with same CATH topology
 4RWS C;  1B50 A;  5C44 G;  2RSN A;  4JK1 C;  4BA1 I;  2VQE L;  1AFP A;  3BZK A;  1G8Z D;  3KYH C;  1G6P A;  4ZLT F;  3M3Y B;  3M4O H;  1E3P A;  2K1B A;  4DA2 A;  1GO3 E;  2I5M X;  1QUQ B;  4TKO B;  4JI8 Q;  5IYD H;  1DGS A;  3TP5 A;  5K5P A;  2QEX A;  1D1K A;  3HOX H;  4LF5 Q;  4JBM A;  2EYL A;  1YJW A;  1SN8 A;  1TWF H;  1Q1E A;  2IL8 A;  1H9J A;  1PTO B;  4RGO S;  3K58 A;  1S72 A;  5DM6 3;  1HNZ L;  4LFA L;  5DM7 3;  4A3E H;  3NP8 A;  2N78 A;  3PF5 A;  5CV9 A;  2JA8 H;  3C1E A;  1EIG A;  1EZ6 A;  4XQQ A;  4CKB A;  1CSP A;  4AH6 A;  4WFN 3;  1TS4 A;  2RHS B;  4GLV B;  4JVZ A;  3J7A F;  4X65 L;  4O42 A;  2VXW A;  1HR0 Q;  4JI4 Q;  1GHJ A;  1RL2 A;  4KV6 A;  4XT3 B;  2JXM B;  1WD1 A;  3P75 A;  2MHV A;  4DFA A;  1DXM A;  4DPG A;  1VQD A;  2HIV A;  3RMH A;  4ZAI A;  3RZD B;  4DK3 C;  4LFB Q;  4O2D A;  3NEM A;  3MVV A;  1NNX A;  1RTN A;  2KCN A;  3FPU B;  1XX8 A;  1EQQ A;  3I4M G;  2IHE A;  1F2M A;  3GTM B;  1S5D D;  1SNC A;  5JOB A;  4HCS A;  4OO1 G;  5C0X H;  1X3F A;  1HZ9 A;  4QMG A;  5I9O A;  2K5N A;  5AJ3 L;  4JW0 A;  1IYJ B;  4DR2 L;  1GUT A;  1SRU A;  2BH8 A;  4IZ8 A;  4TRD A;  2B2W C;  2A6H D;  4OEL B;  4A3F H;  1V9P A;  2YV5 A;  1VQF A;  1AZP A;  1N34 L;  2R92 B;  3I4M B;  1EY7 A;  2B8F A;  3CC7 A;  1QUQ A;  1TS5 A;  1WCM G;  4GS3 A;  5IOD A;  1EWC A;  1IBL L;  2NBF A;  5GAG C;  2Y0S B;  1YNJ D;  4K8J A;  4HTH A;  1L0Y B;  2YTY A;  5M5W B;  1CQV A;  1YJ9 A;  5M5Y B;  4FXG C;  2EVB A;  1SFO B;  2GN5 A;  3ULJ A;  1G91 A;  4A3J G;  5FK9 C;  4A3I G;  1KL9 A;  3BZC A;  5JVH 3;  1PTO F;  3S15 H;  1UEA B;  4AIM A;  1SMY D;  3S14 H;  2RQX A;  1B53 A;  3J7Y W;  4DR3 Q;  1GUG A;  3TZD A;  2R7D A;  3HKZ B;  1U5K A;  3PIP 3;  4A3D H;  1LLR D;  2UU9 Q;  4H13 C;  1WOC A;  3GTQ B;  3I90 A;  5C4J H;  1X6O A;  3LNN A;  1VQB A;  3QB3 A;  4DK1 A;  1VQO A;  5C3W A;  3J81 c;  2MFI A;  1HJP A;  2ZJR A;  3CME A;  4DR7 L;  3K7A B;  2PI2 E;  4XQN A;  4FDB A;  1ASZ A;  1E2V A;  3A0J A;  3HOW G;  1Q8I A;  1J8I A;  2YTV A;  4C1N K;  1G2S A;  3K0Y A;  2M9V A;  1HZC A;  4Y7N H;  3HOV H;  3HOU G;  4KY6 A;  3MA2 B;  4OGQ C;  1OO9 B;  4IQZ A;  4LF9 L;  4QUF A;  1BUV T;  1SND A;  1HHV A;  1EQV A;  3JAM c;  2QA4 A;  1XMQ Q;  1D7Q A;  2B2U A;  2EIF A;  2Z6B A;  4M8A A;  1XWE A;  4EQN A;  4DV1 L;  1Q3L A;  1YEZ A;  2L4N A;  1PRT F;  5TSS A;  1SE2 A;  4WOR A;  1I4G A;  3PO3 G;  4M1U B;  5ELE A;  2B2Y C;  1OXS C;  3EQL C;  3W1B A;  2F0D A;  2B2V A;  5COY A;  2F03 A;  1MSG A;  1I4H A;  3DM1 A;  2C9O A;  4DV2 L;  5IWA Q;  3TQY A;  4HJ5 A;  1KNE A;  1K9M C;  1EY4 A;  4AYB G;  1VQH A;  2KCT A;  2E2D C;  3IRB A;  4DXF A;  1DOL A;  3CQZ H;  3A5U A;  1DCZ A;  5D65 A;  1STY A;  2PW5 A;  1O7L A;  1SYE A;  1EY5 A;  1Q81 C;  1VQA A;  5M5X B;  3RZO B;  4FF1 A;  1Z7T A;  4K5W A;  3AQQ A;  2VS1 A;  3MEH A;  2HHH L;  4B3T Q;  4NPS A;  3ERO A;  3GP7 A;  3Q6S A;  2MO1 A;  1A0I A;  1UE1 A;  3DWQ A;  1PYB A;  5IYD G;  3RLO A;  2PI2 A;  4AYB B;  4DAP A;  3HOX G;  3D3R A;  3S1R H;  3TP6 A;  1KC8 C;  3I56 A;  1EU4 A;  1IW7 C;  2Z8L A;  2L9H A;  1DYQ A;  3G7L A;  3ULP A;  1JOQ A;  2PYK A;  4JI7 Q;  1YIT A;  4AYB E;  2A6H C;  4A3E G;  2CW0 D;  3EJI A;  2JA8 G;  1G29 1;  3HZX A;  3PV0 A;  4QIW B;  1TWC H;  4C3I B;  1R4Q B;  2I5H A;  1XJV A;  3V2T A;  4YWL A;  3J81 L;  3CKI B;  2VUM H;  4IAL A;  1AE3 A;  1TWF B;  4QIW E;  3VYU A;  5FOB B;  3L2P A;  2NWG A;  1FGU A;  3CCQ A;  1Q12 A;  4G7O C;  1K8A C;  2ICE C;  3K8A A;  2Z1C A;  4A3E B;  4G4K A;  3A7L A;  2PZW A;  4R4I A;  4JI5 Q;  3T4A C;  3A54 A;  2A68 D;  3JAM L;  3AFQ A;  4TVA B;  4JC0 A;  3HOY H;  1H9S A;  3DXJ C;  1WFQ A;  4BY7 H;  1O7Y A;  1I6V C;  3E5S A;  3E9H A;  5IP9 H;  1SMY C;  4RH6 A;  1LM0 A;  3CXC A;  2I0Q A;  1Y14 B;  1V1Q A;  1ET6 A;  3NBH B;  4HID A;  1ZYR C;  1I4P A;  2NN6 H;  5C0X G;  1Y8P B;  1OTC A;  1PRT D;  3TEH B;  4POG A;  2DY7 A;  2KEN A;  4A3M B;  3K7U C;  1PYW D;  1U4P A;  5IT9 E;  2R93 H;  4N8F A;  2XTI A;  3I8Z A;  4R8N A;  4A3F G;  3SK8 A;  2RVL A;  3T1Y Q;  2H4O A;  1LV9 A;  2UUB L;  3KBG A;  4V19 0;  1KXL A;  4K6L A;  1VQM A;  1G6Z A;  4MZ9 A;  3KBX A;  5EPL A;  1G51 A;  4PZ8 A;  1CT1 D;  2ZTE A;  2R7Z H;  3S1M H;  3K5L A;  4JPB W;  3PUY A;  5HUR A;  1JWU D;  4FVM A;  2UXC Q;  1XPO A;  1P16 A;  1NR4 A;  4C3H H;  4A3B H;  4IFD I;  2PQE A;  2E2H B;  4KHP Q;  1GXD C;  3UDX A;  2LSS A;  4EQO A;  1O7I A;  1S40 A;  1T5X D;  3CCS A;  1CZG A;  2KUM A;  3CPW A;  5ELB A;  1JIC A;  2NVX H;  3GTJ B;  3E0J A;  4JI0 Q;  4YCU A;  1BF4 A;  4JV5 Q;  1XPR A;  4GKK Q;  3SVM A;  1NE3 A;  1LAC A;  3HKS A;  1EEI D;  5DEH A;  4GN3 B;  2MNA A;  2CQO A;  1KRS A;  2EXD A;  2OTL A;  3G6E A;  2JA6 B;  1PH9 A;  1ESF A;  3I73 A;  4G7H C;  1EWH A;  2LY7 A;  4X66 Q;  2XRQ D;  2DNE A;  4A3D G;  3QO2 A;  3I7F A;  4X3U A;  1ZEQ X;  1HXY D;  3K0X A;  4IJH A;  4RAU C;  2JA9 A;  2JEB I;  3KF6 B;  4ABN A;  5M9O A;  2Z0S A;  1BVS A;  5JVG 3;  1TVX A;  5EGT A;  3H94 A;  2WB1 B;  3SXH A;  2XNA C;  1HTL D;  2L5T A;  4E6I A;  4A93 H;  4I7Z C;  3S15 B;  3MAQ A;  3KFU A;  2MUY A;  2Z6K C;  2Z4H A;  4LUV A;  1W3S A;  2F4V Q;  3SDZ A;  3HOV G;  3GTP H;  3KLR A;  4JCV E;  4IUU A;  5C4J B;  4H0L C;  5FO8 B;  1X3G A;  2E2I B;  1MSH A;  3CF5 A;  2QEJ C;  1C0A A;  3MXN A;  3OWF A;  2VB2 X;  1PTO C;  3FKI H;  2RF4 A;  1HUM A;  1IL2 A;  1ESR A;  2FMC A;  2RHQ B;  5A2Q L;  2PZT A;  5ELC A;  1YZ6 A;  4DR5 Q;  2I07 B;  4Y7N B;  2A6E D;  4DV0 Q;  4UPA A;  1L1O B;  4GKJ Q;  1K83 B;  1HR0 L;  4OX9 L;  3TRZ A;  1QNU A;  1Q8K A;  2CWA A;  3P7J A;  1CSQ A;  1STH A;  4NP5 A;  2J0T D;  1FL0 A;  1U0L A;  2HCC A;  5GAD C;  1L0X B;  2RDH A;  2EPB A;  5K36 H;  3GO5 A;  4K2L A;  1E7Z A;  5BR8 Q;  4LF7 L;  3TDQ A;  1AE2 A;  5DLQ E;  1YHB A;  4XQJ A;  3GTO H;  1I3Q H;  5LMN W;  2K6A A;  3AEV A;  4IPH A;  1EY9 A;  5I9P A;  3VR6 A;  4K5X A;  1QVG A;  4KTA A;  1SR3 A;  2F3I A;  4X62 Q;  1FVI A;  4DAY B;  1OXV A;  5I2Y A;  3BDC A;  3S1N H;  1SYC A;  4ID6 A;  3OTO Q;  5KRU A;  3PO2 H;  2CWP A;  5LHY 1;  1HA5 A;  4H7B A;  2I5L X;  2NZO A;  1YBY A;  2RBM A;  4IPC A;  2R3Z A;  1SE8 A;  1KLU D;  2MJ8 A;  4NXM Q;  4MIU A;  1XMO Q;  4HIO A;  1XTD A;  2FIN B;  4CDF C;  2XSC A;  4HED A;  3WDN A;  5IP7 H;  3CW2 C;  2VNU D;  2NVT B;  2PMZ E;  2SEB D;  2VUM G;  3A8K E;  1K3R A;  1F2L A;  1PH1 A;  4V0B A;  2C5C A;  3HOZ H;  2K75 A;  4FXK C;  3S2D B;  1MGS A;  3PF4 A;  4B3R Q;  4ILW A;  4K6D A;  2F0E A;  4RGM A;  1K8M A;  4KJN A;  1VCI A;  2HT1 A;  1LT4 D;  4JI6 Q;  2D2C C;  3U58 A;  5D14 A;  3I4N H;  4DR3 L;  4GNX A;  3HOY G;  3HFZ B;  1TWC B;  1JJC B;  4BY7 G;  2E2J B;  2Z4I A;  4AQY L;  5IP9 G;  4JI1 Q;  2NZ1 D;  2NN6 G;  4GOP B;  2F0I A;  1X3E A;  2FJ2 A;  1PFM A;  1JE4 A;  2R93 G;  1ET9 A;  4XYQ A;  1JOR A;  2F0O A;  2GVA A;  1BBW A;  1S4Z A;  2WFW A;  2KA7 A;  3O13 A;  1EWI A;  4A75 A;  4DAY A;  1VMC A;  1N36 Q;  1J5E L;  4HIM A;  3D4R A;  2EYH A;  2R7Z G;  4A4I A;  1HUN A;  2IX0 A;  5FLX E;  4FF3 A;  4C3H G;  4A3B G;  5EKK A;  4POF A;  1ENC A;  3S17 H;  3OOC A;  3D0F A;  4IUQ A;  1T5E A;  1PH7 A;  5KYI A;  3NEN A;  3PIO 3;  2QF7 A;  1UE6 A;  5ELN A;  3H0G H;  3VYT A;  4K14 A;  3S16 B;  1II3 A;  4HSP A;  3RD4 A;  1CUK A;  1S5F D;  2OTJ A;  2D0O A;  2VQF L;  4EQ5 A;  4RHR A;  4QUC A;  4B08 A;  2AQ2 B;  3T51 B;  4DF7 A;  2YU9 H;  2K5V A;  1DOM A;  1K8G A;  3BJU A;  1H9K A;  2B29 A;  1B7Y B;  3W5O A;  2RA4 A;  1JWM D;  5LMN Q;  4DV3 Q;  1SSO A;  3NWS A;  2EYJ A;  2WIN B;  2F3V A;  2NVY H;  2AUJ D;  3TS2 A;  4A93 G;  2EY5 A;  4R4C A;  3M4P A;  1TWH B;  1IBM Q;  1V8Q A;  1HNX L;  2O2L D;  4GOP A;  4Q0F A;  2JA5 H;  2Q2T A;  1HQM C;  2OF1 A;  3I3C A;  2F0K A;  3I72 A;  5KNC A;  4DUZ Q;  4DV5 L;  5M3M B;  3UI2 A;  1OXU A;  3NSW A;  1GUO A;  5C3X A;  4JI7 L;  5ELD A;  4DR4 L;  3I2Z A;  1JOK A;  2JQO A;  1TWG H;  3FEW X;  4A93 B;  1RHP A;  3FKI G;  2KCC A;  4MNO A;  3W2D A;  1QOH A;  2VY3 A;  1KDB A;  2EJM A;  4DV7 Q;  3TP7 A;  3GTP B;  2CHB D;  1PDQ A;  2IPK D;  1TS3 A;  2ZM6 Q;  3GV3 A;  1SNM A;  2HQE A;  5C44 B;  4OHJ A;  2MGS A;  1Y1W H;  1VQ7 A;  3I4L A;  4FNF A;  4JI2 Q;  3A56 A;  3F2B A;  3H3V I;  3D6W A;  4DR1 Q;  5K36 G;  3FKI B;  4IUN A;  4BBS H;  4CDD C;  4WJW A;  3CAM A;  4O0A A;  2K5W A;  1IHZ A;  3NBI A;  4KN4 C;  2WV6 D;  3AYH B;  3IFT A;  3W3A A;  3K5M A;  1G2T A;  3GTG H;  1EYD A;  1D2B A;  1PLF A;  1HFN A;  5FO7 B;  2KEC A;  4LF8 L;  5M3F H;  4OO1 I;  1YNN C;  3PO2 G;  4KY7 A;  3IAY A;  4ME3 A;  4DAM A;  1YIJ A;  2F0P A;  2SNM A;  3IL8 A;  3GTO B;  1HZB A;  3D8G A;  1V43 A;  4OL7 A;  5IT9 c;  4F87 A;  3H09 A;  3HP3 A;  1ENF A;  4CKE A;  1F9R A;  3K5N A;  1IW7 D;  1VQ6 A;  3DWA A;  4DV6 Q;  2NUC A;  2UXC L;  5IP7 G;  5NUC A;  1VQ9 A;  3CCV A;  2ZJP A;  1W6J A;  2A74 C;  2PZU A;  2WAC A;  1B2T A;  4A76 A;  2E5L Q;  2JA7 H;  3IFD A;  3KDF A;  4JOI A;  3R8B A;  3HOZ G;  2BCO A;  4BY1 H;  2IJ0 A;  2ZT9 C;  4JV5 L;  2LS0 1;  2SDF A;  3NUC A;  1BO0 A;  4JG2 A;  5EBC A;  3MXU A;  3WWV A;  3CC4 A;  1VQN A;  1EOT A;  4FF4 A;  3RLN A;  4LWC A;  3EA6 A;  3S2H B;  3I4N G;  1XPU A;  1CA5 A;  1B4O A;  2IX1 A;  2ASB A;  3C3L A;  3AFP A;  1TWA H;  5CV4 A;  2K5D A;  3BYY B;  1XNR Q;  5JJI A;  4PMB A;  2KJX A;  1FNV A;  1A62 A;  1NMG A;  1O78 A;  2K32 A;  1ASY A;  1KAA A;  2UUA L;  1I6H H;  1LTG D;  1WCM B;  3KLS X;  4C56 C;  1NMF A;  4DKA C;  5A35 A;  2E75 C;  3NTI A;  1F9S A;  3HS0 C;  3ZYY X;  1CZW A;  1ZYR D;  4OON A;  3SE0 A;  1NBW A;  1VQI A;  3I4N B;  1N8R C;  2F0H A;  2F0V A;  1NCV A;  4CHT B;  4C2M H;  5E4X A;  1JMC A;  5FKA C;  4FXD A;  4IFD H;  4NXN L;  4A3J B;  4HR7 B;  4CDE C;  2V1C C;  5DAU A;  1VQJ A;  2BA0 A;  4A3I B;  4GLA C;  1Y69 U;  3M7N A;  2CCZ A;  3VYR A;  3NEL A;  1RDP D;  4R4T A;  5IYC H;  2ZTC A;  1CHP D;  1JB3 A;  2B2T C;  1DON A;  5FJ8 H;  2BOS A;  3FDT A;  3GDE A;  4XTC S;  5JAV A;  2QCP X;  2N88 A;  2F3W A;  3R2I A;  1HPC A;  3VR3 A;  4IFD J;  3H0G G;  4IUR A;  4YHH L;  3LWU A;  2L1B A;  1QVC A;  4N8X 1;  3PCO B;  2B8G A;  3NHH A;  1HNW L;  3FPP A;  3MC0 B;  2LKV A;  1L1O C;  1ICF B;  1I94 Q;  5IT9 L;  3M9B A;  2C35 B;  1D8L A;  5C4H A;  1FJG Q;  4KK7 A;  4IUV A;  3S17 B;  1JJG A;  3HOW B;  3FRP B;  4JBJ A;  3NWT A;  1YHA A;  3HOU B;  2M2L A;  4I7A A;  3T56 B;  1QZG A;  3MTS A;  1H9S B;  2WKC A;  2F1M A;  5E4W C;  1BCP B;  5GAE C;  1ILP A;  1S5C D;  3DHQ A;  1VQ5 A;  5EBD A;  4OWW B;  4P75 A;  4DUY Q;  4X62 L;  4IOC A;  4RG1 A;  2RCN A;  3ICE A;  4JYA Q;  1VQ8 A;  4TQU S;  1CKM A;  4XDX A;  4B3S Q;  1VF7 A;  3BZD B;  3FMC A;  4IJL A;  4ME5 A;  3OTO L;  2YU9 B;  1I4X A;  1SJE D;  3FHW A;  4BBR H;  3PO3 B;  2JA5 G;  1F2Y A;  1CQF A;  1PH2 A;  5GQO A;  3HGB A;  3IKJ A;  2EQS A;  1GUN A;  1B8A A;  1N33 L;  2PNH A;  2NVY B;  1XMO L;  4B9X A;  2EOT A;  3CCR A;  3OHX C;  3TS0 A;  3KJO A;  4LF6 Q;  3CCL A;  5C4Z A;  4DR6 L;  3UDI A;  2EE1 A;  4A3G H;  1PTO D;  1MKH A;  4UHV A;  2LXK A;  4UP7 A;  4LK1 C;  2ENB A;  1LTL A;  4K0K L;  5LMU Q;  1EIY B;  1J6Q A;  1Y1W G;  1AW7 A;  4NW2 A;  1SMX A;  5G3L F;  3M4O B;  3LGJ A;  2BE5 C;  4KHV A;  5KIX A;  3JAM i;  2F0N A;  1PH6 A;  3HOX B;  4LJZ C;  5JJZ A;  4BBS G;  4PMW A;  3H91 A;  2L11 A;  4DK6 C;  2VQE Q;  4JI1 L;  4F88 A;  2K4K A;  2WP8 J;  1TII D;  5GRO A;  2DJF C;  5J1Z A;  4KY5 A;  4X6A H;  2EY6 A;  2JA8 B;  4X64 Q;  2KED A;  4ZYS A;  5M3F G;  2PQA B;  5C0X I;  4ZK9 B;  4QQB X;  2BDO A;  2CKZ B;  4ZUJ A;  1W2B A;  3TBI B;  4HAE A;  5ISR A;  2ICI A;  1IBK Q;  4BBS B;  1N36 L;  3CPF A;  1ONL A;  3OW7 A;  4QCL A;  2QKI C;  4KN7 C;  3AU7 A;  2G5D A;  3OWE B;  4DU9 A;  4N9T A;  3CCE A;  2XVS A;  4LFC L;  4X65 Q;  4HCE A;  4YWK A;  1C8C A;  2ZJQ A;  3A8J E;  2JA7 G;  3MXN B;  5EJW A;  4HIK A;  1PZJ D;  3QG1 A;  3C2P A;  4BY1 G;  4LF4 L;  5C6A A;  1O80 A;  1VQL A;  3D4W A;  1QB5 D;  2V4D A;  1STG A;  1PH3 A;  2I46 A;  4CDC C;  3S1Q H;  3CRL C;  1W6K A;  3PUW A;  1A3U A;  5E7N A;  3L9A X;  1E22 A;  1VQP A;  1V1P A;  1BR9 A;  1AN8 A;  4A3F B;  1XNQ L;  3PIP A;  2UUC L;  2JA7 B;  3F1Z A;  3S9W A;  2JYO A;  4PV1 C;  1S5E D;  3QR8 A;  4KKU A;  5C5L A;  1EQR A;  4QY7 A;  1Q1B A;  3BVZ A;  4K2K A;  1SAP A;  5AJ3 Q;  2K04 A;  4DR2 Q;  1ILQ A;  2SNS A;  2AKW B;  1I4R A;  4DV4 L;  1QE6 A;  4RGN A;  4H44 C;  1WVL A;  3U4V A;  3D4D A;  1GKH A;  4CGY B;  4KKT A;  3OW2 A;  4R1J A;  1VQK A;  4IFD G;  2ID0 A;  3I91 A;  4DUZ L;  3VYS A;  4JI3 L;  4DNI A;  2AHO B;  5ELO A;  1WTP A;  5LL6 S;  1ML0 D;  5G3L D;  2PQA A;  1IBL Q;  1OXX K;  5IYC G;  1SDF A;  1GUW A;  1Z6H A;  4C3J H;  4XIG S;  2N49 A;  3BU2 A;  3S14 B;  4JI8 L;  5FJ8 G;  4DXG A;  2G9H D;  3X3N A;  3ND9 A;  4LF5 L;  2ZXO A;  4A3D B;  2F0W A;  2F0F A;  5IGD A;  2TMP A;  2CVR A;  1L0W A;  1ENA A;  2JK8 A;  1EU3 A;  4C2M B;  1Q86 C;  1C7Y A;  5JPN C;  4KHZ A;  2MP1 A;  5KYL A;  1JCK B;  3J80 i;  1IKM A;  3A55 A;  1B70 B;  1V1O A;  3T13 A;  1PHJ A;  3R93 A;  3VA5 A;  4QF4 A;  3HRZ C;  1PTO H;  1GVP A;  4J1M A;  2Q8T A;  4PZ7 A;  5KGU A;  4U67 3;  4DN4 M;  2E76 C;  3HOV B;  3F2U A;  5C3E H;  2IT1 A;  2N55 A;  4JI4 L;  3FVQ A;  4GNX B;  1K0S A;  3DEP A;  3RUZ A;  5IIF A;  5FLM H;  1E2Z A;  2AMC B;  1B9M A;  3E3X A;  5FLX L;  1EOV A;  3DEO A;  1GOZ A;  1VDZ A;  3MXP A;  4LFB L;  4IO9 A;  2B2W A;  3GV6 A;  1WTV A;  4RGT A;  2O5I C;  4BBR G;  1CM9 A;  4C1N I;  1YHQ A;  1M90 C;  1KQS A;  2JE6 I;  4K8I A;  5AFW A;  1KAB A;  2B3G A;  3MXG A;  3RZD H;  4RKB A;  3WOF A;  3J7A 5;  1N9W A;  3DMU A;  4GLX A;  3BVM A;  1STA A;  5I4D A;  1H95 A;  4X3K A;  4OIK A;  2R61 A;  1C48 A;  1A3T A;  4DNT B;  1E24 A;  2D0P A;  1CTM A;  3SHL A;  3H3V C;  4A3G G;  3CQZ B;  3P20 A;  4P2C B;  1YJN A;  1A3V A;  4DV2 Q;  2B2U C;  1STN A;  1K73 C;  2PMZ B;  4KJO A;  3RN2 A;  2WAQ G;  5L37 A;  4X3S A;  3EVQ A;  1BOS A;  1I4Q A;  2WKD A;  2IHF A;  3FP9 A;  1PFB A;  2EYP A;  1LTI D;  3S1R B;  2HUG A;  2B2V C;  2KOL A;  3M4Y A;  2R92 H;  3EBE A;  3C46 A;  4A3G B;  1U4R A;  1EIF A;  2K28 A;  3KF8 A;  2HHH Q;  1SYG A;  5ELF A;  2K50 A;  1TY0 A;  1UE7 A;  4YY3 Q;  5IGB A;  5M5Y H;  2KHJ A;  2NN6 I;  1TXY A;  1TKW B;  1PA6 A;  2WAQ E;  2UU9 L;  3SR1 A;  2VUM B;  4L6T B;  1EYC A;  2EJF C;  1YNN D;  4HMI A;  4S3S A;  3NE5 B;  2EY2 A;  2K01 A;  1KAW A;  4OWX B;  1X9N A;  2OT2 A;  3SEB A;  1B3A A;  1EFW A;  4OXP A;  3GTK H;  3GTQ H;  1NSN S;  3HOY B;  2B2Y A;  4BY7 B;  3MFG A;  2E74 C;  3L3O C;  1Z9F A;  4BS9 A;  2FXQ A;  2RCF A;  1TU2 B;  2HIX A;  4WJ4 A;  2GVB A;  1XMQ L;  3K7A H;  1SNO A;  1STB A;  1VQC A;  3T1H Q;  1K3B C;  3VR5 A;  1CKN B;  4DNR B;  4KLK A;  2R93 B;  3QOL A;  3WOE A;  3GTL H;  4IPG A;  1DD2 A;  1KTK A;  5IY0 A;  1F9Q A;  5IOC A;  1PZI D;  4UY8 C;  1ZKO A;  1RF2 D;  3A74 A;  1RCV D;  1DM0 B;  3J80 E;  3S1M B;  2R7Z B;  5IWA L;  5D3D A;  1NR2 A;  3STB D;  5HGT A;  3A7A B;  3Q24 A;  4C3H B;  5CBA E;  4A3B B;  2K52 A;  3URY A;  4B3M Q;  5EAY A;  5J3B A;  1WTQ A;  4JYA L;  3KOJ A;  1VF5 C;  3B6Y A;  1JQY D;  4Z9C B;  2NVX B;  4ODG A;  3QOJ A;  4TSS A;  3AB9 A;  3Q8D A;  2JN4 A;  4B9W A;  5JEA H;  2EYM A;  5D3I B;  4EGV A;  2F0Q A;  3CRK C;  4MTK A;  3U4Z A;  4B3T L;  4J6H A;  4C3J G;  2XWB B;  1CA6 A;  3AMU A;  1X56 A;  2DN8 A;  2HD3 A;  4PZ6 A;  1QJO A;  1M4V A;  4ZKB B;  5EKI A;  2VB3 X;  1H9M A;  3N6R A;  4IPD A;  5JEA J;  4QGU A;  3KLW A;  1A15 A;  1EY6 A;  3KDF B;  2IY5 B;  5IGG A;  4O1N A;  1Y1V H;  2PPB C;  1QIL A;  2QGQ A;  1GJX A;  4C3J B;  3VA7 A;  1LYL A;  1LT3 D;  1SEB D;  1S5B D;  4NB3 A;  3U9S A;  4F7X A;  2KVM A;  2RSO A;  3Q22 A;  1FYC A;  1Q90 A;  2XIW A;  5CV8 A;  5C3E G;  1CKN A;  3CP0 A;  1HRJ A;  4MTN A;  4EQP A;  2L15 A;  5EPJ A;  5FLM G;  2EZV A;  5IGC A;  4L8J A;  4UAI A;  2TSS A;  4C3I H;  2PNR C;  3BVG A;  1F9P A;  2JSO A;  4MHE A;  4JI5 L;  4RCO A;  2AQ1 B;  4X64 L;  1EL0 A;  1JE5 A;  2R7F A;  1ICW A;  3OYY A;  4IOA A;  3CCU A;  1IBK L;  5C3E B;  1DOK A;  1CHQ D;  1IZ6 A;  1DJR D;  2LXJ A;  3RN5 A;  4FO2 A;  1KDA A;  3EIV A;  3PQI A;  4F8M A;  2Q2H A;  1E1O A;  3T1Y L;  3G48 A;  4OX9 Q;  1A2U A;  1I3Q B;  1YNX A;  1EFI D;  2QW7 A;  3CCJ A;  2LFN A;  1AEX A;  1EY0 A;  1HTP A;  2A73 B;  1SRO A;  4A3M H;  1ROD A;  5EPK A;  2LMC B;  2J4X A;  4G7Z C;  5E3F A;  3S1N B;  4KHP L;  4LF7 Q;  1WTH A;  3S24 A;  2JP1 A;  4UP9 A;  3PO2 B;  2R92 G;  1K8O A;  5E1F A;  4JBK A;  5EQ0 A;  2BE5 D;  4YIJ A;  1HA6 A;  3NQT A;  4JI0 L;  1EYG A;  4ZUI A;  1UNS A;  4GKK L;  3F2D A;  1UAP A;  1SNQ A;  1PRT B;  2Y0S G;  2E2H H;  3E9I A;  3CU7 A;  1PVO A;  1NJI C;  1TY2 A;  2RDG A;  1X55 A;  3N52 A;  2Z6K A;  1PZK D;  5H1S E;  3BDO A;  1D1I A;  4X66 L;  3GTJ H;  3E6Z X;  3UDF A;  2IW3 A;  2K14 A;  3STB C;  2L55 A;  3NQI A;  4QL5 A;  1N32 Q;  1HZA A;  2A19 A;  4LUZ A;  4CKC A;  3BG3 A;  2OWO A;  5C0X J;  3HOZ B;  5CV5 A;  3H6M A;  2JA6 H;  5CV7 A;  2QIL A;  1IYV A;  5JJL A;  2CFM A;  4LMQ D;  3HKZ G;  2AQ3 B;  3Q23 A;  1UE5 A;  4R9W A;  4QJF A;  1IL8 A;  4OEM B;  1AZQ A;  4Y52 H;  2JJQ A;  3RR5 A;  3OIQ A;  2EYO A;  2KCM A;  2F4V L;  3PIO A;  4HJA A;  4A3L H;  1ZXT A;  2Y0S E;  4R4O A;  1FNU A;  3M4Q A;  2CH4 W;  4J8Q A;  1NY4 A;  4P71 A;  1MJE A;  1HFG A;  1D5X C;  1RKN A;  3SK5 A;  5IGE A;  2KEE A;  1IXR A;  3T16 A;  4APV A;  2D5D A;  1O7Z A;  3L7Z C;  4AQY Q;  2A8V A;  3GTK B;  1TS2 A;  1SNP A;  1SE4 A;  3P1H A;  1LO5 D;  4DR5 L;  4DV0 L;  2N3S A;  2E2I H;  4GKJ L;  1LTS D;  3HKZ E;  4I65 A;  1CK1 A;  4YWM A;  4HJ7 A;  5IE8 A;  4KD4 A;  2KHS A;  3UDG A;  3UE0 A;  2UXB Q;  1I50 H;  1SJH D;  1HQR D;  2H5X A;  2OCE A;  2F4I A;  1LTB D;  1Q82 C;  3MZ5 A;  4A3K H;  2AWO A;  2MPM A;  3KUP A;  4P74 A;  4GNX C;  3EN2 A;  1MHW C;  4UP8 A;  4FYD A;  3K6O A;  3OPO A;  3DM3 A;  4H02 A;  5BR8 L;  3GTL B;  1PH8 A;  1K83 H;  4HJ9 A;  1J5E Q;  4HJ8 A;  3PSI A;  2G9D A;  3H0G B;  1EY8 A;  4RKL A;  5JEA G;  1KRT A;  1JR0 D;  4WJ3 M;  3SK6 A;  2K33 A;  4LNQ A;  4EX5 A;  3K59 A;  1QWY A;  3NPP A;  2FFK B;  1TR5 A;  2ZTD A;  4IUT A;  4MN3 A;  2MQH A;  2K5H A;  2VW9 A;  3TME A;  3CD6 A;  2X69 A;  2J7Z A;  4L5T A;  2Q2I A;  4XT1 B;  1R9T H;  4ALP A;  2QDL A;  1PXU A;  2MO0 A;  2O4X A;  1YVC A;  2O5J C;  1PMR A;  2VQF Q;  2RDF A;  3UE1 A;  1WTO A;  3G71 A;  1BNZ A;  3TSS A;  4NXM L;  1QG7 A;  1Y1V G;  1Z47 A;  3GQB A;  3VDY A;  2D9U A;  1I5F A;  1BBU A;  1NUC A;  1SBB B;  3J81 i;  2UXD Q;  1SXT A;  1NTG A;  1B1Z A;  1U9R A;  2JA5 B;  4K5V A;  1V1P B;  1RD9 D;  3TP8 A;  4B3R L;  4PNY A;  3J7A V;  4BA2 I;  3I55 A;  4WRD A;  4JI6 L;  3ND8 A;  4C3I G;  2NVT H;  3HEJ A;  4FF2 A;  1STE A;  1HNX Q;  1TWG B;  2CH4 A;  1Y1V B;  1AP0 A;  4YY3 L;  1C4Q A;  1VQ4 A;  1EUJ A;  1CFM A;  4HSV A;  4PQX A;  3ERQ A;  4DV5 Q;  5BN5 A;  1Q46 A;  2F0T A;  3K81 C;  3U50 C;  3S2D H;  3ULL A;  1GM5 A;  1JOO A;  3QJY A;  4DR4 Q;  4RCN A;  2DGY A;  2H1E A;  1EEF D;  4P73 A;  4ULL A;  1C9O A;  5CR3 A;  3F2C A;  1MI2 A;  1Y1W B;  2OEO A;  2E2J H;  1KHI A;  3EFX D;  3ITP A;  1MD2 D;  3A5Z B;  4GOP C;  2RKS A;  1JC7 A;  2NVQ H;  2F0M A;  1K0R A;  1HNZ Q;  1PFS A;  3PUV A;  1YNJ C;  1YI2 A;  4LFA Q;  2A69 D;  4RHS A;  4U68 A;  4GN4 B;  3C1F A;  4A3M G;  2HCI A;  1D5M C;  3X3M A;  2XRS D;  1BBX C;  4N9P A;  2X6G A;  3TRE A;  3T1H L;  1BCP F;  1H9R A;  3GTG B;  3SGI A;  5BN3 A;  4JBW A;  5M3F B;  1KD1 C;  4BXX H;  4GZY C;  1D5Z C;  1GUS A;  1JB7 A;  3I70 A;  5FLX c;  2AUK A;  4LUO A;  2DNC A;  5I6Y A;  4L63 B;  1FGB D;  5C4X H;  4IUP A;  4LW1 A;  1FNW A;  1LTA D;  1RTO A;  1KNA A;  2BDN A;  5HGQ A;  3BYT B;  3E0E A;  3W1G A;  3M7G A;  1NAP A;  3K80 C;  3MWY W;  4LF8 Q;  3PGZ A;  1FR3 A;  4B3M L;  3U9O A;  3J80 c;  5KNB A;  2NTT A;  3K57 A;  2NZH A;  3NTK A;  5IYB H;  3S16 H;  1BQQ T;  2SOB A;  5T1G A;  3SK4 A;  5CBE E;  4BY1 B;  5LMN L;  4DV3 L;  1X54 A;  4A3C H;  2JA6 G;  1WTX A;  1EQT A;  2E8G A;  2FHT A;  1E0B A;  3DWP A;  5COR A;  2B63 H;  5CGK A;  4GN5 A;  4NMZ A;  1IBM L;  1LTT D;  1UWV A;  1BDO A;  5DNF A;  1N34 Q;  4A3L G;  1TWA B;  4ZRZ A;  3NXW A;  2A5H A;  3CMA A;  2WB1 G;  4ZKC B;  3A8I E;  3D31 A;  1CKO A;  4UDU C;  1PV4 A;  1I6H B;  2ALY B;  2B39 A;  3NTH A;  1TWH H;  4HN7 A;  1IKL A;  1A2T A;  1RIP A;  2IX3 A;  3R3O A;  2YYZ A;  1QVF A;  1XXG A;  4JOI C;  5M3M H;  1MJC A;  3BDL A;  3MFY A;  3J81 j;  3M85 A;  4DV7 L;  2UUA Q;  3PUX A;  1QZH A;  2K7V A;  3VR4 A;  1JT8 A;  1SYF A;  1LUZ A;  4FP5 D;  3M3Y H;  1LTR D;  2ZM6 L;  2OQ0 A;  2Q8I B;  5CC4 A;  1EIH A;  4NKL A;  5IGF A;  4KKS A;  5EKL A;  2L12 A;  3KF8 B;  4HMJ A;  4LAA A;  4A3K G;  2BH2 A;  1KDC A;  4DAV A;  4JI2 L;  2VZA A;  3J81 E;  2F0S A;  3NBH A;  4PG3 A;  3ER0 A;  2A1A A;  2WB1 E;  2BA1 A;  2KHI A;  4DR1 L;  1RJT A;  1LT5 D;  2HQL A;  2PO4 A;  4KMU C;  4NXN Q;  3F8T A;  5C44 H;  2YTX A;  1BCP D;  4DR7 Q;  2DY8 A;  3OMC A;  4OWT B;  4CJ2 C;  4L5S A;  3BS1 A;  1U4L A;  3CCM A;  3JAM E;  1I50 B;  3DLL A;  4A3K B;  1B44 D;  4ZQ3 A;  4PMC A;  2L0C A;  4LF9 Q;  4YHH Q;  2KQ3 A;  2CW0 C;  1BKB A;  1TQO A;  1Y8N B;  2XWJ B;  1QCB D;  4DV1 Q;  3J80 L;  2HDM A;  1HNW Q;  2N8N A;  1T9H A;  1SYD A;  4CJ0 B;  1JWS D;  1HCZ A;  5HY6 A;  4DV6 L;  3ZJY C;  4L5Q A;  2K03 A;  4R4Q A;  2A69 C;  1QNK A;  2ZXP A;  5C5M A;  2E5L L;  2P5Z X;  4BBR B;  2EDG A;  3GTM H;  1LT6 D;  1R9T B;  3L0O A;  1AH9 A;  5JJK A;  3PMF A;  1WTW A;  2A68 C;  1WYD A;  3H3V H;  3OSO A;  4DK0 A;  1E1T A;  2HDL A;  1D6E C;  3KLS A;  4OIJ A;  1M1K C;  2XGT A;  2Q2U A;  4J15 A;  1SE3 A;  1UUP A;  4QB4 A;  4X3T A;  3OMG A;  3TN2 A;  2FMM A;  3KF6 A;  2IWH A;  1WTR A;  2NYZ D;  4RFB A;  1SLJ A;  3MHB A;  5F2D A;  3I4M H;  1PRT C;  2VL6 A;  3RLF A;  5GAH C;  1XNR L;  1DZ1 A;  1N32 L;  1XTC D;  3CC2 A;  4OO1 H;  3DUZ A;  1N33 Q;  3MEF A;  2WAQ B;  4BWG B;  3S2H H;  1WJJ A;  1X65 A;  4CBV A;  5M5W H;  1SYB A;  1VQG A;  2B2T A;  2EYF A;  4Q5V A;  2Z9H A;  2EY1 A;  4DR6 Q;  3K5O A;  1SFO H;  5CYU A;  1GD7 A;  3RNU A;  1B9N A;  1MBY A;  1L2F A;  1EYA A;  3I4O A;  3ERS X;  3JC6 6;  4K0K Q;  1PH4 A;  1S3O A;  1WCM H;  4IN3 A;  5KND A;  1A8V A;  1WD0 A;  1WI5 A;  1M8A A;  1A6X A;  1UEB A;  2F0J A;  3VR2 A;  1VQE A;  1X3Q A;  1CI3 M;  1L1O A;  4ZCK A;  4XXE A;  1XYI A;  5JPM C;  4XYO A;  1X32 A;  2ES2 A;  5I6W A;  3QIA A;  3LX0 A;  3CHB D;  1HR0 W;  4BXX G;  2F0L A;  4A3J H;  1MIU A;  4RA8 A;  2NVQ B;  5C4X G;  2QDB A;  4KD3 A;  4A3I H;  4YCV A;  1KIX A;  4KI0 A;  1TT2 A;  2ZXR A;  2NB0 A;  1B3Q A;  3D6C A;  2DUD A;  5CV6 A;  2XN9 C;  2UXB L;  1FD7 D;  4EVO A;  2GA4 B;  3GD7 A;  1PFN A;  1I94 L;  3J7Z C;  5A2Q E;  1VMP A;  1FJG L;  5CMD A;  2DJG C;  1OXT A;  1F77 A;  5IYB G;  3OIP A;  1P8L A;  2EXZ A;  3KJP A;  2JEA I;  5C4X B;  4NDX A;  3R2T A;  3LWE A;  4A3C G;  3G6J B;  1F2Z A;  2ATW A;  4L5R C;  2B63 G;  2OQK A;  2PW7 A;  5KEE A;  1X3P A;  4DUY L;  1EZ8 A;  4LFC Q;  3T53 B;  1PH5 A;  3NK9 A;  3S1Q B;  2K05 A;  3TZU A;  1KLG D;  2UUB Q;  2M00 A;  3HOW H;  4B3S L;  4G57 A;  2Q8R E;  5LL6 X;  1JJ2 A;  1BCP C;  2D62 A;  3HOU H;  1PYS B;  1R4P B;  4LF4 Q;  2NTS A;  2CQA A;  1IYU A;  2KBN A;  1U4M A;  3V96 A;  3KK7 A;  1K28 A;  1BXT A;  3PUZ A;  2AWN A;  3H15 A;  2B63 B;  5FO9 B;  2A6E C;  3ONA B;  1HH2 P;  1XNQ Q;  2EJG C;  3PO3 H;  4LF6 L;  3V05 A;  2UUC Q;  4YCW A;  2F0U A;  5M3M G;  3Q0A A;  2WII B;  5M5X H;  3RZO H;  2UXD L;  3HG9 A;  1Y8O B;  5J22 A;  5J39 A;  4P72 A;  5BN4 A;  4CJ1 B;  4DGZ A;  5LMU L;  1A63 A;  4DV4 Q;  2X6L A;  1Q7Y C;  4RMF A;  1GHK A;  2R6G A;  1LAB A;  3G4S A;  5I2X A;  4R8I A;  2F0G A;  1E2W A;  2PCF B;  3QWN A;  1J9O A;  2OXP A;  5T1I A;  1VS0 A;  4JI3 Q;  2K5Q A;  2F52 A; 
#chains in the Genus database with same CATH homology
 4RWS C;  1B50 A;  2RSN A;  4JK1 C;  4BA1 I;  1AFP A;  1G8Z D;  4ZLT F;  3M3Y B;  2K1B A;  4DA2 A;  4TKO B;  3TP5 A;  5K5P A;  1D1K A;  2EYL A;  1Q1E A;  2IL8 A;  1H9J A;  1PTO B;  4RGO S;  3K58 A;  5DM6 3;  5DM7 3;  3NP8 A;  5CV9 A;  3C1E A;  1EIG A;  1EZ6 A;  4XQQ A;  4CKB A;  4WFN 3;  1TS4 A;  3J7A F;  4O42 A;  2VXW A;  1GHJ A;  4KV6 A;  4XT3 B;  2JXM B;  1WD1 A;  3P75 A;  2MHV A;  4DFA A;  1DXM A;  3RMH A;  4ZAI A;  3RZD B;  3MVV A;  1RTN A;  2KCN A;  3FPU B;  1XX8 A;  1F2M A;  3GTM B;  1S5D D;  1SNC A;  5JOB A;  4HCS A;  4OO1 G;  5C0X H;  4QMG A;  5I9O A;  1GUT A;  4IZ8 A;  4TRD A;  2B2W C;  2A6H D;  1AZP A;  2R92 B;  3I4M B;  1EY7 A;  2B8F A;  1TS5 A;  5IOD A;  1EWC A;  2NBF A;  2Y0S B;  1YNJ D;  4K8J A;  4HTH A;  1L0Y B;  5M5W B;  1CQV A;  5M5Y B;  4FXG C;  2EVB A;  1SFO B;  1G91 A;  5FK9 C;  5JVH 3;  1PTO F;  1UEA B;  1SMY D;  2RQX A;  1B53 A;  3J7Y W;  1GUG A;  3TZD A;  3HKZ B;  3PIP 3;  1LLR D;  4H13 C;  3GTQ B;  3I90 A;  3LNN A;  3QB3 A;  4DK1 A;  5C3W A;  3K7A B;  4XQN A;  1E2V A;  1Q8I A;  1J8I A;  4C1N K;  1G2S A;  3K0Y A;  2M9V A;  4KY6 A;  3MA2 B;  4OGQ C;  1OO9 B;  4IQZ A;  4QUF A;  1BUV T;  1SND A;  1HHV A;  1EQV A;  2B2U A;  4M8A A;  1XWE A;  4EQN A;  1Q3L A;  2L4N A;  1PRT F;  5TSS A;  1SE2 A;  4WOR A;  1I4G A;  4M1U B;  5ELE A;  2B2Y C;  1OXS C;  3EQL C;  2F0D A;  2B2V A;  5COY A;  2F03 A;  1MSG A;  1I4H A;  3DM1 A;  2C9O A;  1KNE A;  1EY4 A;  2E2D C;  4DXF A;  1DOL A;  1DCZ A;  5D65 A;  1STY A;  2PW5 A;  1O7L A;  1SYE A;  1EY5 A;  5M5X B;  3RZO B;  4FF1 A;  1Z7T A;  4K5W A;  3MEH A;  3ERO A;  3GP7 A;  3Q6S A;  3DWQ A;  4AYB B;  4DAP A;  3D3R A;  3TP6 A;  1EU4 A;  1IW7 C;  2Z8L A;  2L9H A;  1DYQ A;  3G7L A;  1JOQ A;  2PYK A;  2A6H C;  2CW0 D;  3EJI A;  1G29 1;  3HZX A;  3PV0 A;  4QIW B;  4C3I B;  1R4Q B;  3V2T A;  3J81 L;  3CKI B;  4IAL A;  1TWF B;  3VYU A;  5FOB B;  2NWG A;  1Q12 A;  4G7O C;  2ICE C;  2Z1C A;  4A3E B;  3A7L A;  2PZW A;  4G4K A;  3T4A C;  3A54 A;  2A68 D;  3JAM L;  1H9S A;  3DXJ C;  1O7Y A;  1I6V C;  3E5S A;  1SMY C;  4RH6 A;  1ET6 A;  1ZYR C;  1I4P A;  2NN6 H;  5C0X G;  1Y8P B;  1PRT D;  2DY7 A;  4A3M B;  1PYW D;  1U4P A;  5IT9 E;  3I8Z A;  4R8N A;  3SK8 A;  2RVL A;  2H4O A;  1LV9 A;  3KBG A;  4V19 0;  4K6L A;  1G6Z A;  3KBX A;  5EPL A;  1CT1 D;  3K5L A;  3PUY A;  5HUR A;  1JWU D;  4FVM A;  1NR4 A;  4IFD I;  2E2H B;  2PQE A;  1GXD C;  4EQO A;  1T5X D;  1CZG A;  2KUM A;  5ELB A;  1JIC A;  3GTJ B;  3E0J A;  1BF4 A;  3SVM A;  1LAC A;  1EEI D;  5DEH A;  2JA6 B;  1ESF A;  3I73 A;  4G7H C;  1EWH A;  2LY7 A;  2XRQ D;  2DNE A;  3QO2 A;  4X3U A;  1ZEQ X;  1HXY D;  4RAU C;  2JEB I;  4ABN A;  5JVG 3;  5M9O A;  1TVX A;  5EGT A;  3H94 A;  2WB1 B;  3SXH A;  2XNA C;  1HTL D;  2L5T A;  4E6I A;  4I7Z C;  3S15 B;  3MAQ A;  2MUY A;  2Z4H A;  3SDZ A;  3KLR A;  4IUU A;  5C4J B;  4H0L C;  5FO8 B;  2E2I B;  1MSH A;  2QEJ C;  3MXN A;  2VB2 X;  3OWF A;  1PTO C;  1HUM A;  1ESR A;  2FMC A;  5A2Q L;  2PZT A;  5ELC A;  2I07 B;  4Y7N B;  2A6E D;  1K83 B;  1QNU A;  3P7J A;  1STH A;  4NP5 A;  2J0T D;  2HCC A;  1L0X B;  2RDH A;  2EPB A;  5K36 H;  3GO5 A;  4K2L A;  3TDQ A;  4XQJ A;  2K6A A;  1EY9 A;  5I9P A;  3VR6 A;  4K5X A;  4KTA A;  1OXV A;  5I2Y A;  3BDC A;  1SYC A;  4ID6 A;  5KRU A;  5LHY 1;  1HA5 A;  4H7B A;  2RBM A;  2R3Z A;  1KLU D;  2MJ8 A;  4MIU A;  2FIN B;  2XSC A;  4HED A;  3WDN A;  2VNU D;  2NVT B;  2SEB D;  3A8K E;  1F2L A;  4V0B A;  2C5C A;  4FXK C;  3S2D B;  1MGS A;  4ILW A;  4K6D A;  2F0E A;  4RGM A;  1K8M A;  4KJN A;  1VCI A;  1LT4 D;  2D2C C;  5D14 A;  1TWC B;  2E2J B;  2Z4I A;  2NZ1 D;  2NN6 G;  2F0I A;  2FJ2 A;  1PFM A;  1JE4 A;  1ET9 A;  4XYQ A;  1JOR A;  2F0O A;  1S4Z A;  2KA7 A;  3O13 A;  4DAY A;  1VMC A;  3D4R A;  2EYH A;  1HUN A;  2IX0 A;  5FLX E;  4FF3 A;  4C3H G;  5EKK A;  1ENC A;  3OOC A;  4IUQ A;  1T5E A;  5KYI A;  3PIO 3;  2QF7 A;  3VYT A;  4K14 A;  3S16 B;  1II3 A;  4HSP A;  3RD4 A;  1S5F D;  4RHR A;  4QUC A;  4B08 A;  2AQ2 B;  3T51 B;  4DF7 A;  1DOM A;  1H9K A;  2RA4 A;  1JWM D;  1SSO A;  3NWS A;  2EYJ A;  2WIN B;  2F3V A;  2AUJ D;  2EY5 A;  1TWH B;  1V8Q A;  2O2L D;  4Q0F A;  1HQM C;  2OF1 A;  3I3C A;  2F0K A;  3I72 A;  5KNC A;  5M3M B;  3UI2 A;  1OXU A;  3NSW A;  1GUO A;  5C3X A;  5ELD A;  1JOK A;  3FEW X;  4A93 B;  1RHP A;  2KCC A;  3W2D A;  1QOH A;  1KDB A;  2EJM A;  3TP7 A;  3GTP B;  2CHB D;  1PDQ A;  2IPK D;  1TS3 A;  3GV3 A;  1SNM A;  2HQE A;  5C44 B;  4OHJ A;  2MGS A;  3I4L A;  4FNF A;  3A56 A;  3D6W A;  5K36 G;  3FKI B;  4IUN A;  4WJW A;  2K5W A;  1IHZ A;  3NBI A;  4KN4 C;  2WV6 D;  3IFT A;  3W3A A;  3K5M A;  1G2T A;  1EYD A;  1D2B A;  1PLF A;  1HFN A;  5FO7 B;  2KEC A;  4OO1 I;  1YNN C;  4KY7 A;  3IAY A;  2F0P A;  2SNM A;  3IL8 A;  3GTO B;  3D8G A;  1V43 A;  4OL7 A;  4F87 A;  3H09 A;  3HP3 A;  1ENF A;  4CKE A;  1F9R A;  3K5N A;  1IW7 D;  3DWA A;  2NUC A;  5NUC A;  1W6J A;  2A74 C;  2PZU A;  2WAC A;  1B2T A;  3IFD A;  3R8B A;  2BCO A;  2IJ0 A;  2ZT9 C;  2LS0 1;  2SDF A;  3NUC A;  1BO0 A;  5EBC A;  3MXU A;  1EOT A;  4FF4 A;  3EA6 A;  3S2H B;  1CA5 A;  1B4O A;  2IX1 A;  3C3L A;  5CV4 A;  2K5D A;  3BYY B;  4PMB A;  2KJX A;  1FNV A;  1O78 A;  2K32 A;  1KAA A;  1LTG D;  1WCM B;  3KLS X;  4C56 C;  5A35 A;  2E75 C;  3NTI A;  1F9S A;  3HS0 C;  3ZYY X;  1CZW A;  1ZYR D;  3SE0 A;  3I4N B;  2F0H A;  2F0V A;  1NCV A;  4CHT B;  5E4X A;  5FKA C;  4FXD A;  4IFD H;  4A3J B;  4HR7 B;  5DAU A;  2BA0 A;  4A3I B;  1Y69 U;  3M7N A;  3VYR A;  1RDP D;  1CHP D;  1JB3 A;  2B2T C;  1DON A;  2BOS A;  3FDT A;  4XTC S;  5JAV A;  2QCP X;  2N88 A;  2F3W A;  3R2I A;  1HPC A;  3VR3 A;  4IFD J;  4IUR A;  3LWU A;  2L1B A;  2B8G A;  3NHH A;  3FPP A;  3MC0 B;  2LKV A;  5IT9 L;  5C4H A;  4KK7 A;  4IUV A;  3S17 B;  3HOW B;  3FRP B;  3NWT A;  3HOU B;  2M2L A;  3T56 B;  3MTS A;  1H9S B;  2WKC A;  2F1M A;  5E4W C;  1BCP B;  1ILP A;  1S5C D;  3DHQ A;  5EBD A;  4TQU S;  4XDX A;  1VF7 A;  3BZD B;  3FMC A;  4ME5 A;  2YU9 B;  1I4X A;  1SJE D;  3PO3 B;  1F2Y A;  1CQF A;  3HGB A;  3IKJ A;  1GUN A;  2NVY B;  4B9X A;  2EOT A;  3OHX C;  5C4Z A;  2EE1 A;  1PTO D;  4LK1 C;  2ENB A;  1AW7 A;  4NW2 A;  5G3L F;  3M4O B;  2BE5 C;  4KHV A;  5KIX A;  2F0N A;  3HOX B;  4LJZ C;  5JJZ A;  4PMW A;  3H91 A;  2L11 A;  4F88 A;  2WP8 J;  1TII D;  5J1Z A;  4KY5 A;  2EY6 A;  2JA8 B;  2KED A;  4ZYS A;  5C0X I;  4ZK9 B;  2BDO A;  4ZUJ A;  3TBI B;  4HAE A;  5ISR A;  2ICI A;  4BBS B;  1ONL A;  3OW7 A;  4QCL A;  2QKI C;  4KN7 C;  3AU7 A;  3OWE B;  4DU9 A;  4N9T A;  2XVS A;  4HCE A;  1C8C A;  3A8J E;  5EJW A;  1PZJ D;  3QG1 A;  3C2P A;  5C6A A;  1O80 A;  3D4W A;  1QB5 D;  2V4D A;  1STG A;  2I46 A;  3CRL C;  1W6K A;  3PUW A;  1A3U A;  3L9A X;  1V1P A;  1BR9 A;  1AN8 A;  4A3F B;  2JA7 B;  3S9W A;  2JYO A;  4PV1 C;  1S5E D;  4KKU A;  5C5L A;  1Q1B A;  3BVZ A;  4K2K A;  1SAP A;  2K04 A;  1ILQ A;  2SNS A;  1I4R A;  1QE6 A;  4RGN A;  4H44 C;  1WVL A;  3D4D A;  4CGY B;  4KKT A;  4IFD G;  2ID0 A;  3I91 A;  3VYS A;  1WTP A;  5LL6 S;  1ML0 D;  5G3L D;  1OXX K;  1SDF A;  1GUW A;  1Z6H A;  4XIG S;  3S14 B;  4DXG A;  2G9H D;  3X3N A;  3ND9 A;  2ZXO A;  4A3D B;  2F0W A;  2F0F A;  5IGD A;  2TMP A;  2CVR A;  1ENA A;  4C2M B;  1EU3 A;  5JPN C;  4KHZ A;  2MP1 A;  5KYL A;  1JCK B;  1IKM A;  3A55 A;  1V1O A;  3T13 A;  3R93 A;  3VA5 A;  4QF4 A;  3HRZ C;  1PTO H;  4J1M A;  2Q8T A;  5KGU A;  4U67 3;  4DN4 M;  2E76 C;  3HOV B;  3F2U A;  2IT1 A;  2N55 A;  3FVQ A;  3DEP A;  3RUZ A;  5IIF A;  1E2Z A;  1B9M A;  5FLX L;  3DEO A;  1GOZ A;  1VDZ A;  3MXP A;  2B2W A;  3GV6 A;  1WTV A;  4RGT A;  2O5I C;  1CM9 A;  4C1N I;  2JE6 I;  4K8I A;  5AFW A;  1KAB A;  3MXG A;  4RKB A;  3WOF A;  3DMU A;  3BVM A;  1STA A;  5I4D A;  4X3K A;  4OIK A;  2R61 A;  1C48 A;  1A3T A;  4DNT B;  3SHL A;  1CTM A;  3H3V C;  3CQZ B;  3P20 A;  4P2C B;  1A3V A;  2B2U C;  1STN A;  2PMZ B;  4KJO A;  4X3S A;  3EVQ A;  1BOS A;  1I4Q A;  2WKD A;  1PFB A;  2EYP A;  1LTI D;  3S1R B;  2HUG A;  2B2V C;  2KOL A;  3M4Y A;  3C46 A;  4A3G B;  1U4R A;  3KF8 A;  2K28 A;  1SYG A;  5ELF A;  1TY0 A;  5IGB A;  2NN6 I;  1TKW B;  3SR1 A;  2VUM B;  4L6T B;  1EYC A;  2EJF C;  1YNN D;  4HMI A;  4S3S A;  3NE5 B;  2EY2 A;  2K01 A;  2OT2 A;  3SEB A;  1B3A A;  1NSN S;  3HOY B;  2B2Y A;  4BY7 B;  3MFG A;  2E74 C;  3L3O C;  4BS9 A;  1TU2 B;  1SNO A;  1STB A;  3VR5 A;  4DNR B;  2R93 B;  3QOL A;  3WOE A;  1DD2 A;  1KTK A;  1F9Q A;  5IOC A;  1PZI D;  1ZKO A;  1RF2 D;  1RCV D;  1DM0 B;  3J80 E;  3S1M B;  2R7Z B;  5D3D A;  1NR2 A;  5HGT A;  3A7A B;  3Q24 A;  4C3H B;  5CBA E;  4A3B B;  3URY A;  1WTQ A;  1VF5 C;  1JQY D;  4Z9C B;  2NVX B;  4ODG A;  3QOJ A;  4TSS A;  3AB9 A;  4B9W A;  5JEA H;  2EYM A;  4EGV A;  5D3I B;  2F0Q A;  3CRK C;  4J6H A;  4C3J G;  2XWB B;  1CA6 A;  3AMU A;  2DN8 A;  1QJO A;  1M4V A;  4ZKB B;  5EKI A;  2VB3 X;  1H9M A;  3N6R A;  5JEA J;  1A15 A;  1EY6 A;  5IGG A;  4O1N A;  2PPB C;  1QIL A;  1GJX A;  4C3J B;  3VA7 A;  3U9S A;  4F7X A;  1LT3 D;  1SEB D;  1S5B D;  2KVM A;  2RSO A;  3Q22 A;  1FYC A;  1Q90 A;  2XIW A;  5CV8 A;  1HRJ A;  4EQP A;  5EPJ A;  2EZV A;  5IGC A;  4L8J A;  4UAI A;  2TSS A;  2PNR C;  3BVG A;  1F9P A;  2JSO A;  4MHE A;  4RCO A;  2AQ1 B;  1EL0 A;  1ICW A;  5C3E B;  1DOK A;  1CHQ D;  1DJR D;  4FO2 A;  1KDA A;  4F8M A;  1A2U A;  1I3Q B;  1EFI D;  2LFN A;  1AEX A;  1EY0 A;  1HTP A;  2A73 B;  1ROD A;  5EPK A;  2LMC B;  2J4X A;  4G7Z C;  5E3F A;  3S1N B;  2JP1 A;  3PO2 B;  1K8O A;  5E1F A;  5EQ0 A;  2BE5 D;  4YIJ A;  1HA6 A;  3NQT A;  4ZUI A;  1UNS A;  1UAP A;  1SNQ A;  1PRT B;  3CU7 A;  1TY2 A;  2RDG A;  3N52 A;  1PZK D;  3BDO A;  1D1I A;  3E6Z X;  2IW3 A;  2L55 A;  3NQI A;  4CKC A;  3BG3 A;  5C0X J;  3HOZ B;  5CV5 A;  3H6M A;  5CV7 A;  2QIL A;  1IYV A;  4LMQ D;  2AQ3 B;  3Q23 A;  4R9W A;  1IL8 A;  1AZQ A;  3OIQ A;  2EYO A;  1ZXT A;  1FNU A;  4J8Q A;  5IGE A;  1HFG A;  1D5X C;  1RKN A;  3SK5 A;  2KEE A;  3T16 A;  2D5D A;  1O7Z A;  3L7Z C;  3GTK B;  1TS2 A;  1SNP A;  1SE4 A;  3P1H A;  1LO5 D;  1LTS D;  4I65 A;  1CK1 A;  4KD4 A;  2KHS A;  1SJH D;  1HQR D;  2F4I A;  1LTB D;  3MZ5 A;  2AWO A;  2MPM A;  3KUP A;  4FYD A;  3K6O A;  3OPO A;  3GTL B;  2G9D A;  3H0G B;  1EY8 A;  4RKL A;  5JEA G;  1JR0 D;  3SK6 A;  2K33 A;  3K59 A;  1QWY A;  3NPP A;  2FFK B;  1TR5 A;  4IUT A;  4MN3 A;  3TME A;  2X69 A;  2J7Z A;  4XT1 B;  1PXU A;  2O4X A;  2O5J C;  1PMR A;  2RDF A;  1WTO A;  1BNZ A;  3TSS A;  1QG7 A;  1Z47 A;  3GQB A;  2D9U A;  1NUC A;  1SBB B;  1SXT A;  1B1Z A;  1U9R A;  2JA5 B;  4K5V A;  1V1P B;  1RD9 D;  3TP8 A;  4PNY A;  3J7A V;  4BA2 I;  4WRD A;  3ND8 A;  4C3I G;  3HEJ A;  4FF2 A;  1STE A;  1TWG B;  1Y1V B;  1AP0 A;  1C4Q A;  4HSV A;  1CFM A;  4PQX A;  3ERQ A;  5BN5 A;  2F0T A;  1JOO A;  3QJY A;  4RCN A;  2H1E A;  1EEF D;  4ULL A;  5CR3 A;  1MI2 A;  1Y1W B;  2OEO A;  3EFX D;  3ITP A;  1MD2 D;  2RKS A;  1JC7 A;  2F0M A;  3PUV A;  1YNJ C;  2A69 D;  4RHS A;  4U68 A;  3C1F A;  2HCI A;  1D5M C;  3X3M A;  2XRS D;  1BBX C;  4N9P A;  2X6G A;  1BCP F;  1H9R A;  3GTG B;  5BN3 A;  4JBW A;  5M3F B;  4GZY C;  1D5Z C;  1GUS A;  3I70 A;  2AUK A;  2DNC A;  5I6Y A;  4L63 B;  1FGB D;  4IUP A;  1FNW A;  1LTA D;  1RTO A;  1KNA A;  2BDN A;  3BYT B;  3M7G A;  1NAP A;  3MWY W;  1FR3 A;  3U9O A;  5KNB A;  2NTT A;  3K57 A;  3NTK A;  1BQQ T;  2SOB A;  5T1G A;  3SK4 A;  5CBE E;  4BY1 B;  1WTX A;  1EQT A;  2FHT A;  1E0B A;  3DWP A;  5COR A;  5CGK A;  4NMZ A;  1LTT D;  1BDO A;  5DNF A;  1TWA B;  4ZRZ A;  3NXW A;  2A5H A;  4ZKC B;  3A8I E;  3D31 A;  4UDU C;  1I6H B;  2B39 A;  3NTH A;  4HN7 A;  1IKL A;  1A2T A;  2IX3 A;  3R3O A;  2YYZ A;  1XXG A;  3BDL A;  3MFY A;  3M85 A;  3PUX A;  2K7V A;  3VR4 A;  1SYF A;  4FP5 D;  1LTR D;  2Q8I B;  5CC4 A;  1EIH A;  4NKL A;  5IGF A;  4KKS A;  5EKL A;  2L12 A;  4HMJ A;  4LAA A;  1KDC A;  4DAV A;  3J81 E;  2F0S A;  3NBH A;  2BA1 A;  1RJT A;  1LT5 D;  2PO4 A;  4KMU C;  1BCP D;  2DY8 A;  3OMC A;  4CJ2 C;  3BS1 A;  1U4L A;  3JAM E;  1I50 B;  4A3K B;  1B44 D;  4ZQ3 A;  4PMC A;  2L0C A;  2KQ3 A;  2CW0 C;  1TQO A;  1Y8N B;  2XWJ B;  1QCB D;  3J80 L;  2HDM A;  4CJ0 B;  1SYD A;  1JWS D;  1HCZ A;  2K03 A;  2A69 C;  1QNK A;  2ZXP A;  5C5M A;  4BBR B;  2EDG A;  1LT6 D;  1R9T B;  3PMF A;  1WTW A;  2A68 C;  3OSO A;  4DK0 A;  2HDL A;  1D6E C;  3KLS A;  4OIJ A;  1SE3 A;  1UUP A;  4QB4 A;  4X3T A;  3OMG A;  3TN2 A;  2FMM A;  2IWH A;  1WTR A;  2NYZ D;  4RFB A;  3MHB A;  5F2D A;  1PRT C;  3RLF A;  1DZ1 A;  1XTC D;  4OO1 H;  3DUZ A;  2WAQ B;  4BWG B;  4CBV A;  1SYB A;  2B2T A;  2EYF A;  4Q5V A;  2EY1 A;  3K5O A;  5CYU A;  1B9N A;  1MBY A;  1EYA A;  4IN3 A;  5KND A;  1WD0 A;  1M8A A;  1A6X A;  2F0J A;  3VR2 A;  1X3Q A;  1CI3 M;  4XXE A;  1XYI A;  5JPM C;  4XYO A;  1X32 A;  5I6W A;  3QIA A;  3LX0 A;  3CHB D;  2F0L A;  4RA8 A;  2NVQ B;  2QDB A;  4KD3 A;  4KI0 A;  1TT2 A;  2ZXR A;  2NB0 A;  3D6C A;  5CV6 A;  2XN9 C;  1FD7 D;  4EVO A;  2GA4 B;  3GD7 A;  1PFN A;  5A2Q E;  1VMP A;  5CMD A;  1OXT A;  1F77 A;  3OIP A;  2EXZ A;  2JEA I;  5C4X B;  4NDX A;  3R2T A;  3LWE A;  3G6J B;  1F2Z A;  2PW7 A;  5KEE A;  1X3P A;  1EZ8 A;  3T53 B;  3NK9 A;  3S1Q B;  2K05 A;  3TZU A;  1KLG D;  2M00 A;  4G57 A;  2Q8R E;  5LL6 X;  1BCP C;  2D62 A;  1R4P B;  2NTS A;  2CQA A;  1IYU A;  1U4M A;  3V96 A;  3KK7 A;  1BXT A;  3PUZ A;  2AWN A;  2B63 B;  5FO9 B;  2A6E C;  3ONA B;  2EJG C;  3V05 A;  2F0U A;  3Q0A A;  2WII B;  3HG9 A;  1Y8O B;  5J22 A;  5J39 A;  5BN4 A;  4CJ1 B;  4DGZ A;  2X6L A;  1GHK A;  2R6G A;  1LAB A;  5I2X A;  4R8I A;  2F0G A;  1E2W A;  2PCF B;  3QWN A;  1J9O A;  2OXP A;  5T1I A;  2K5Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...