2Z1CA

Crystal structure of hypc from thermococcus kodakaraensis kod1
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
71
structure length
71
Chain Sequence
CLAVPGKVIEVNGPVAVVDFGGVKREVRLDLMPDTKPGDWVIVHTGFAIEKLDEKKAMEILEAWAEVEKAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of [NiFe] Hydrogenase Maturation Proteins HypC, HypD, and HypE: Insights into Cyanation Reaction by Thiol Redox Signaling
pubmed doi rcsb
source organism Thermococcus kodakarensis
molecule tags Chaperone, metal binding protein
molecule keywords Hydrogenase expression/formation protein HypC
total genus 17
structure length 71
sequence length 71
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2007-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01455 HupF_HypC HupF/HypC family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.970 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2z1cA00
3D3RA 3VYTA 3VYSA 2OT2A 3VYUA 2Z1CA 3VYRA
chains in the Genus database with same CATH superfamily
5ISRA 2I07B 4FXDA 4DXGA 3NQIA 1TS4A 1V1QA 3BZDB 1Q8KA 2F0HA 1XMOL 4GN5A 3J80L 5A35A 4WRDA 4XQQA 4PG3A 4DUZQ 2MJ8A 1EYDA 3VDYA 4EQPA 5C6AA 1C4QA 2QW7A 4JG2A 5J22A 1FJGL 4JV5Q 4GOPA 2IX0A 2OT2A 1STGA 1KRTA 4FVMA 3S14B 3TZDA 4BBSB 4BY1G 3QR8A 1P8LA 4LFAQ 2MO0A 5DM73 4ULLA 4OO1I 2OEOA 1B4OA 2K5VA 4K6DA 2F0FA 5IGCA 2O5IC 3HOZG 4A93G 1WYDA 2EXDA 5I2XA 3G6JB 1F9PA 5CYUA 1GUTA 1GHKA 1ZEQX 1EEID 3VR6A 3T1HQ 2DY8A 3D4RA 5JPMC 4JYAL 2QEJC 1I4XA 1I4QA 1JWMD 2XGTA 1XPOA 5AJ3Q 1CKOA 4K5VA 4A3LG 4B3SQ 1STNA 3DWPA 2K5HA 2QKIC 1LTSD 5DNFA 1I94Q 5C3WA 1MJEA 2K1BA 2NN6H 1GUSA 1PH1A 1YBYA 4R4OA 3ONAB 2OF1A 2QCPX 3SDZA 5D65A 1I6HB 2F0WA 4TRDA 4ZLTF 4R8IA 3RZOH 3J80E 2WFWA 4FO2A 1KLGD 2TMPA 1CSPA 3S2DB 4ILWA 4LF5L 2F3WA 3CPWA 4DV4L 3I70A 4GLXA 5GADC 4ME5A 1E0BA 1EUJA 2YU9B 3SGIA 1IW7C 1ASYA 1A62A 2B8GA 3TMEA 2A19A 4BY7H 1LT5D 2QDBA 3CP0A 4C56C 5FO7B 1F9RA 3RR5A 1VQFA 1LUZA 1S5BD 1PYBA 3TP7A 5KIXA 1SNCA 4YY3Q 1Y8PB 5IODA 3KLSX 3MXGA 5I4DA 1LV9A 1MKHA 1FGBD 1CKNA 1J6QA 3IFDA 3IKJA 4H44C 4PMCA 5DLQE 4ZAIA 4BY1H 2FMMA 1LTBD 5CV6A 1NY4A 3LWEA 1C48A 2UXBL 3PUYA 5NUCA 2NWGA 3VYSA 4A4IA 2A6EC 1FNWA 3X3NA 1EU3A 3IRBA 3S2HB 1TVXA 1LT6D 1KTKA 2YTXA 2JA8G 4GLAC 2A6ED 2CWAA 3NXWA 3A8KE 4FDBA 1E7ZA 2EYFA 5FJ8H 4G7OC 4O2DA 3PIP3 1E2VA 1VQ9A 2KHJA 5C4XB 4A3GH 3W1BA 4H02A 5IP9H 1I50B 4LFBQ 5CR3A 2CH4A 2K5WA 4IPDA 1PRTB 4DNIA 2DGYA 1STEA 1TY0A 3I56A 1XWEA 4QMGA 1F2LA 1HTPA 2MO1A 2O2LD 3H0GB 3ER0A 1PH4A 3OWEB 4KHVA 1V1PA 3CCQA 5JVH3 2DNCA 1PFNA 3NP8A 1SNOA 2B2UC 3D6WA 1VQEA 5JPNC 4ABNA 1YJWA 4A93H 4R1JA 4C3JH 3M4QA 4ZYSA 3GTKB 1A2TA 1C7YA 2IWHA 2AWOA 2KEEA 2OQKA 1VQAA 1G291 4DR1L 3LX0A 1E1OA 2CHBD 1U4LA 3F2CA 3BVMA 1IKLA 4QL5A 1NR4A 4B3TL 4TQUS 1RODA 3G71A 2F3VA 1H9SA 3NTKA 2WV6D 5LL6S 1PH9A 3HOUB 5I2YA 1B70B 1ZXTA 3LGJA 3PV0A 2HCCA 5IWAQ 1SYCA 4RAUC 1TS3A 1KLUD 2R93B 1DZ1A 2ENBA 2F0UA 2B2TC 2WINB 2Y0SG 2Q8IB 4A3IG 5AFWA 4OWWB 3H0GH 2JA6G 4IFDJ 5ELOA 1JICA 1U0LA 2E2IH 5IT9E 1SE4A 4KLKA 4DR3L 4IN3A 3S15H 4TSSA 3RMHA 1Y1WG 1YHBA 2LY7A 1I3QB 4CDEC 4JYAQ 5M5YB 2CW0C 4RWSC 1PA6A 3H15A 1TWGB 2AQ3B 2L11A 4JVZA 2CFMA 1K9MC 1B53A 5DM63 4FF1A 4MTKA 3HRZC 1YZ6A 1R9TH 3ULPA 1XNQL 4JW0A 4PNYA 3VR4A 1NUCA 3ITPA 1QE6A 4DAPA 2PZWA 2UXBQ 4LF9Q 4HMJA 3T51B 5K5PA 3GV6A 3I4LA 3CCRA 1PH2A 4XYQA 5IYBG 4C3HG 2ZM6Q 1MI2A 3PF4A 4GNXC 5I6YA 1FGUA 4CKEA 4K5WA 1HQRD 1MGSA 1AN8A 1H9MA 3GTKH 3S1QH 3I55A 2Q2IA 4C3JB 1TWAB 1G51A 4CJ0B 1KIXA 1LTAD 1IYVA 1VQNA 1ZKOA 2RKSA 1BVSA 3VYUA 1DGSA 1JB7A 3E9HA 4JOIC 4KD4A 2F0SA 1KHIA 4DK1A 1JE4A 1SN8A 2QDLA 4K2KA 4RGMA 3F1ZA 5LMNW 1J8IA 2EQSA 2C9OA 4RG1A 3W5OA 2B2YC 2OQ0A 5FO8B 4L5SA 4JI7Q 2F0EA 3T13A 4DV0Q 1MHWC 4K5XA 5BR8Q 4M8AA 5KEEA 4HJAA 1I50H 5IT9L 2R93H 2YYZA 4GS3A 2RDFA 3JAMc 2OXPA 5IYCH 5LMNQ 3DM1A 4WFN3 1BBUA 2A6HD 3NBHB 3GTPB 3KF8A 5C44H 4OX9Q 3E3XA 3OW7A 5M3FB 3JAML 1YVCA 3GTGB 5C4XG 4JI2Q 4KJNA 4NB3A 2F0NA 2D62A 2ZTDA 4DUYL 2D2CC 4EQNA 3T1HL 1JJCB 1PTOH 4ZUJA 3J80c 3NK9A 3NHHA 2RSOA 1XYIA 1QZGA 4Y52H 2WKDA 1HNWQ 2BH2A 2JQOA 3S1MB 2PZTA 2K52A 4DV3L 4B3SL 3A7AB 4HN7A 1CI3M 3CC4A 1HXYD 4P74A 1SYEA 3HOYB 3C3LA 3T4AC 2HD3A 1IBMQ 3HFZB 5JEAH 4A75A 2VQFL 1EIHA 4CJ2C 3NPPA 4L6TB 4C1NI 3U50C 1WI5A 2VS1A 3NWTA 1PDQA 3OHXC 4DR6Q 2J0TD 1QVGA 3ZJYC 2QEXA 5C0XI 2CCZA 1TWFB 1M90C 4OEMB 2E2JB 5LHY1 4IJHA 2VB3X 1X3FA 1E1TA 3NQTA 1EY7A 4A3KG 4YY3L 3BVZA 2L9HA 3J7A5 1K73C 1JORA 4QY7A 2PW5A 3U9OA 4LF6L 4GOPC 3CKIB 4EGVA 4EQOA 3BDCA 1RDPD 5C4XH 3RZDH 1ILPA 2IX1A 1PRTF 4P73A 4A3GG 1SMXA 3J7AF 3Q6SA 1EQVA 4GN3B 1J5EL 4MIUA 2I5HA 4RHSA 4A3IH 3ICEA 5IYCG 4F7XA 4DUYQ 2UUCL 2JA7G 3BYTB 3VYTA 5C0XH 1QJOA 2D0PA 3T53B 2Z8LA 4YCWA 4YHHQ 2GVAA 1HNZL 4V190 2AQ1B 3QO2A 2JA8B 3TP8A 1U5KA 3H6MA 2VZAA 1G2TA 4LNQA 1X3QA 3OTOL 3M7NA 1D7QA 1PH5A 1WJJA 2AMCB 1X3PA 1PV4A 1EWCA 3H94A 4BWGB 2RCNA 2ASBA 4CHTB 3BZCA 4CGYB 2MFIA 3K57A 1Y69U 3TRZA 1B7YB 3K81C 2KCNA 1HFNA 4C2MH 1UWVA 1SYDA 4RCOA 1I3QH 5CBAE 3K80C 2ZT9C 2JEAI 4POFA 2F4VQ 3EBEA 2E2JH 1Q81C 1EIYB 2HDLA 2IL8A 3OMGA 1NSNS 1YNJC 4JPBW 5D14A 1S5FD 1Y1WH 1HJPA 2QF7A 3HP3A 3PO3G 4K8IA 2IW3A 1EY8A 1I4PA 4RKLA 2CWPA 4X3UA 4DK3C 3P75A 2L0CA 3TBIB 3VR5A 1EQQA 4XT3B 1A3VA 1X3GA 4B3RQ 3RN5A 1PH6A 4X65Q 5ELDA 2SDFA 3EN2A 5EPKA 4K8JA 1U4RA 4JK1C 4KD3A 5JJLA 3T1YQ 1GXDC 1L1OB 2R3ZA 1K3RA 1O7IA 1LTID 1G8ZD 1XMOQ 4JI6L 5CV4A 4C3IB 1YI2A 3I73A 3HOWH 3K0XA 1JB3A 2PQAB 1JWSD 3K59A 4DNTB 1CT1D 3M4PA 4G7HC 4N9PA 4A3DB 4F8MA 3HOXB 2BCOA 3VR2A 4DU9A 1BCPB 4HCEA 1DOKA 1PFMA 2UXCL 1CSQA 2C5CA 4K6LA 4JI1Q 1BCPF 1RKNA 1TWCB 3KOJA 2HQLA 1VQGA 4L5QA 3F2BA 1PH3A 3S1NH 4UP9A 1L0YB 1RIPA 1UE1A 3HS0C 3R2IA 4XIGS 1CQVA 1D5MC 2NTSA 5M3MG 5BN5A 2I46A 5CGKA 1XTCD 1HZ9A 5C0XJ 2DN8A 1RCVD 1N34L 2WP8J 1AP0A 3K6OA 4FF3A 1DCZA 1DOLA 2KCCA 4NMZA 4DV6Q 1VQBA 3I4MB 2LKVA 5FLXc 1UE5A 2KHIA 4ZUIA 1CTMA 4LWCA 4KN4C 4NPSA 3NEMA 2NN6I 1W2BA 2F0OA 1SEBD 1K83H 2ZJPA 1I4GA 4ZK9B 3T1YL 5DAUA 4OWXB 3BZKA 4U673 1F2YA 5FO9B 2B2VC 1PXUA 3NELA 5G3LF 3FRPB 2RBMA 2Q8TA 5HGQA 2HDMA 1VQ6A 4A3BH 5EBCA 3R3OA 1Y14B 1SNMA 3BYYB 4DR5L 1NBWA 4FXKC 1GD7A 2B2TA 2E2HB 2F4IA 4QF4A 3BVGA 4HIDA 1SSOA 1VQ7A 4L8JA 4GOPB 3G48A 3MXNA 1Q3LA 2ZJQA 4BY1B 1I4HA 2MQHA 5ELNA 5GQOA 5IGDA 2VQEL 1SNDA 3S15B 5C5LA 4NXMQ 5E4WC 3HOZB 3U9SA 2EY6A 4CDFC 2EXZA 3A0JA 4C3IG 5BN4A 1NE3A 4ODGA 3WWVA 2G9DA 2EJFC 1SR3A 1SFOH 1LO5D 1PTOC 1G2SA 3E9IA 3I72A 5KYLA 1EZ6A 3HG9A 4U68A 3OOCA 3HOUH 1DONA 4HAEA 3K5NA 3UE1A 2HHHQ 4JBJA 1HH2P 1PRTC 1DYQA 3HOUG 4QB4A 1KC8C 3AEVA 5LMNL 4GN4B 2F52A 4O42A 3I8ZA 3TSSA 3N6RA 4LF7Q 3RZOB 1UAPA 3RUZA 2K01A 1HNXL 4POGA 1TT2A 1B8AA 3K7AB 2V1CC 3KBXA 4EX5A 4H7BA 4X62L 1T5EA 1GUOA 4JOIA 1SYFA 4TKOB 2XRQD 3MZ5A 1RJTA 1OXSC 1B1ZA 1YEZA 2EVBA 5BR8L 1FYCA 1QNUA 1S40A 2A69C 3KDFB 4OHJA 1H9SB 5C44G 3I90A 2PYKA 2YTVA 4EQ5A 2NB0A 5C44B 2M9VA 1HPCA 1X65A 1HUMA 3CD6A 2B2VA 1WCMH 1Y8OB 3F2DA 3PO2H 1KDAA 2JSOA 1MSGA 5DEHA 3STBD 4A3BG 2VUMB 3PIOA 4A3FG 1XJVA 4CDDC 3FKIB 4FNFA 1VQLA 3KLRA 1IBKQ 4A3FB 3QOLA 2EYOA 5CV7A 3O13A 4DV3Q 3UDFA 1K3BC 1STAA 2AHOB 3CC7A 1NJIC 1I94L 3VR3A 2H4OA 5IIFA 2JA7B 4O0AA 1K8GA 2ALYB 3KDFA 1SJED 4WORA 2HQEA 2O5JC 1S5CD 1SYBA 3EROA 1LACA 2AUKA 1HNXQ 1WTPA 1XX8A 3W1GA 1WFQA 2K50A 2D5DA 1PZKD 3LNNA 4Q5VA 4J8QA 2E5LQ 3SE0A 5J3BA 5IE8A 1WTWA 4MNOA 2D9UA 4JI0L 5JJKA 3K7AH 1C0AA 3ERQA 2IPKD 5M3MH 2UXCQ 5T1GA 1Q7YC 2I5MX 1O80A 2NZOA 3I4MG 1VDZA 3OIPA 2BE5C 1CK1A 1KDBA 3M9BA 3S17B 1TKWB 1I6VC 4ZRZA 3GTGH 4DR7L 3R93A 4FF2A 4WJ4A 4IFDG 1OXUA 1CA6A 1HZBA 3KLSA 2E74C 3SK8A 1O78A 2YTYA 2Z1CA 1FNVA 4NXML 2UXDQ 2RCFA 1PH7A 4QIWB 4QCLA 4KY6A 3AFPA 2JEBI 5A2QE 4P71A 2K03A 3ERSX 1WTXA 2MPMA 1K8OA 3CC2A 3TP6A 4LF4L 1EWHA 2WAQG 1AEXA 4CDCC 4HJ5A 1X55A 4A3KH 1JE5A 4R4CA 1HR0W 4JI5Q 4RGOS 3D6CA 3L7ZC 1JWUD 1Y1VG 4LFCL 1HR0L 4JI8Q 3URYA 1N32L 2WACA 2JN4A 1VF5C 4IOCA 4A3EG 1LTTD 2G9HD 3OMCA 4DNRB 1LT3D 1WTRA 4A3BB 1EL0A 4CBVA 4IJLA 3GTJB 2R7ZH 3EVQA 2R7DA 4NP5A 1U9RA 1ICFB 1AE3A 4OL7A 1PZJD 4LJZC 4R4TA 3NBIA 4A76A 4BBRH 3E0JA 4IUVA 5EPJA 4L5TA 4J15A 4RCNA 3K0YA 3AQQA 2K05A 2NVXB 3RLOA 3FKIH 5KRUA 2K33A 3CHBD 4JI1L 2K04A 3MAQA 1LTGD 1Z7TA 2UUAQ 3J7YW 2XSCA 2E2IB 4X64Q 1JJ2A 1IYUA 5KGUA 3IFTA 5E7NA 2QGQA 1IKMA 2JXMB 2NUCA 2ICIA 2GVBA 1L1OC 1WCMG 3W2DA 3H09A 2HT1A 4NKLA 4KKTA 3TS2A 2N49A 4X66Q 3CCSA 4HTHA 1EY6A 5CV8A 5I6WA 3S1RH 4EVOA 2Y0SE 1HTLD 1CFMA 1XTDA 2QA4A 2RSNA 3NBHA 4QUFA 4MN3A 3I4OA 4DV1Q 1IBLL 1VQ4A 2R7ZB 3M3YH 1L0XB 2PMZE 3PUXA 1QUQB 3I4NH 1EIFA 1D5ZC 3PUZA 4BA1I 4BBRG 2NVQH 5C3XA 2VXWA 1ONLA 1Y1VB 1TWGH 5K36H 4A93B 1BR9A 2LSSA 5LMUQ 5IYBH 3EIVA 2BOSA 3A55A 4B3ML 2X69A 3MFGA 3FPPA 2H1EA 3L3OC 2F1MA 4AYBB 2FXQA 4O1NA 4X66L 2N3SA 1GJXA 1VQ5A 2R7FA 2DJGC 1KDCA 1E2ZA 2O4XA 2A68C 3S2DH 2JA6B 3HOWG 2NVQB 5KNBA 4GNXA 2PQAA 3FMCA 1MJCA 3SXHA 3HOWB 2F0MA 1QNKA 4JI3L 1N33Q 1VQIA 4DK6C 2NN6G 3GTLB 1W6KA 5M3MB 3V96A 4IFDH 4NXNQ 3DMUA 3FVQA 4HIMA 5C4JB 1WD1A 4PMWA 5J39A 3HOYG 4A3JG 1HUNA 2HIVA 1RD9D 2NVTB 3JAME 2NBFA 1X6OA 1GOZA 3QOJA 2B63H 1H9RA 4K2LA 3HOVH 3I4MH 1A3TA 2D0OA 3A5ZB 1CKNB 2A1AA 3RZDB 5EBDA 4C3JG 4HJ8A 2B8FA 1H9KA 5IOCA 1CHQD 5K36G 2EZVA 1TS2A 4OGQC 3AMUA 2IHFA 3AU7A 4DV2L 4YWKA 2F0GA 4NW2A 1DOMA 3K5OA 1TS5A 3N52A 2ZXPA 1M8AA 3HKZB 1ASZA 1HNWL 1OXVA 1U4PA 2KHSA 3JC66 3J7ZC 4JI2L 2B63B 4CKCA 2EOTA 3GTQB 2CW0D 3QJYA 3SEBA 1A2UA 2EYLA 4G57A 3S24A 2UUBL 4DV6L 3STBC 4DFAA 3HOYH 1L2FA 1O7YA 3RLNA 3RLFA 5L37A 4X64L 1Q82C 3L0OA 1PFBA 1PTOF 5M5XH 4DF7A 4DR2Q 1W3SA 2EPBA 1F2MA 2I0QA 2L12A 3NSWA 4UPAA 1UUPA 2WB1G 4FP5D 2F3IA 1O7LA 1NMFA 3PF5A 4K0KQ 4A3KB 4WJWA 1A15A 3PO3H 3A74A 1Q46A 1SE2A 2J4XA 1AW7A 3VA7A 2I5LX 1QVCA 3H91A 4HR7B 2K7VA 2C35B 3NTHA 1B3AA 2A8VA 1P16A 1O7ZA 4JV5L 1D8LA 1PHJA 2UU9Q 4HMIA 1JOQA 4C2MB 1WVLA 2ID0A 1SBBB 1VQDA 1JJGA 2FMCA 2VY3A 3T56B 4LF9L 4JI8L 1EY9A 4P72A 1MD2D 3HKZE 2ZM6L 2ZXOA 3LWUA 3GP7A 1A63A 1IW7D 4AYBG 1X54A 1KXLA 1VS0A 3HOVG 2CKZB 2XVSA 4AIMA 3S1QB 3E0EA 4KHPQ 3KJOA 4BA2I 3S9WA 3V2TA 2BE5D 1STYA 2BH8A 4KY7A 5KNDA 1XNRQ 1LLRD 1Z47A 2KJXA 1GKHA 1BKBA 1YNNC 3MXPA 3D4WA 3GTQH 3U58A 5IP7G 1F9QA 4R9WA 1GM5A 3A8IE 4FF4A 1SNPA 4FYDA 1JC7A 2HCIA 4JI4L 4N9TA 4V0BA 1JQYD 2JA7H 2F03A 2PQEA 1SRUA 2WIIB 2F0LA 2FINB 2UUBQ 1HR0Q 1IHZA 5FKAC 5CV9A 3TREA 2JA6H 3KYHC 4XXEA 1EYCA 2F0QA 1T9HA 5M9OA 2KECA 4ZKCB 5JOBA 3Q0AA 1YIJA 5EGTA 1CA5A 3DWAA 3UI2A 2UU9L 4KY5A 1Q12A 2EYMA 2A68D 1R4PB 1WCMB 1H9JA 1FD7D 4IUTA 5M5WB 1TWHB 3TN2A 1STBA 4KKSA 4AH6A 1Q8IA 2HUGA 1NTGA 1UE7A 1V9PA 1JOOA 1VQPA 5CMDA 4BXXG 3IL8A 1UE6A 1XMQQ 2EY2A 4YWLA 3K5LA 2F0IA 3OIQA 2ZXRA 4JC0A 1B9NA 1FVIA 5C4JH 3I4NB 1PYSB 4JCVE 1XXGA 3X3MA 2NZHA 2P5ZX 3GTJH 4LF8L 3KLWA 1PTOB 4BY7G 1EIGA 1EY0A 1EZ8A 1J5EQ 2UUAL 2B2WA 2EY5A 4A3MH 5M3FH 1VQOA 2HHHL 2E8GA 2RF4A 2N78A 5GROA 2NVYH 1QVFA 2NTTA 4XT1B 3C1FA 1V43A 1Q1EA 1EQTA 4BS9A 4DAVA 5E4XA 3M4OB 3KBGA 1B50A 3ULJA 1UEBA 2SEBD 1PTOD 2G5DA 2VL6A 5M5WH 1HA5A 3DWQA 1VQHA 1NR2A 5IP9G 1W6JA 1SE3A 1I4RA 1QB5D 1ESFA 3NE5B 3J81i 1B2TA 1SNQA 1KQSA 2WKCA 2UUCQ 5G3LD 1PLFA 2JK8A 2KCMA 1LT4D 1U4MA 4A3MB 3ZYYX 4C3HB 2BA0A 1TWAH 2KEDA 1OXXK 2JA9A 3F2UA 4E6IA 1SDFA 4DR4L 3KUPA 1ICWA 3DM3A 2R92G 2LS01 2EE1A 4DPGA 1HFGA 1KRSA 3EFXD 3PUWA 2VB2X 3CU7A 4C1NK 1X56A 4DV0L 4F88A 5JEAG 3GTMH 1N32Q 4CKBA 3MTSA 1M1KC 4DV1L 1X9NA 3TP5A 2JA5H 1A6XA 4G7ZC 3KFUA 1HA6A 5I9PA 5JJZA 2CH4W 3QG1A 1JMCA 3RD4A 4XQJA 4RGNA 3C46A 2RHQB 1FJGQ 2QILA 4IUQA 5C4ZA 4OO1H 1WTVA 3QIAA 4OELB 4R4IA 3FEWX 4DUZL 1PMRA 2PI2A 4IPGA 4B08A 1E22A 2GA4B 1H95A 3CCUA 2JE6I 1BNZA 3EJIA 2K5DA 4DR2L 3CCVA 2NYZD 2VUMH 4JBWA 1TIID 2XN9C 4X6AH 1TR5A 4A3GB 3M4OH 1V1OA 4HSPA 5D3DA 1ENCA 4HEDA 3PO2B 2R93G 5IP7H 3SK5A 2NVYB 1Y8NB 2R6GA 2MP1A 1TU2B 2Z6BA 2PNRC 1Q1BA 1G6PA 2ICEC 2KVMA 2OTLA 1BCPC 2RVLA 4LK1C 3PMFA 2PPBC 4MTNA 4Z9CB 4WJ3M 4APVA 3AB9A 3A7LA 1VF7A 2K5NA 1QG7A 1WTHA 4P2CB 1VMPA 4DV2Q 3FP9A 3S1MH 3HZXA 3FDTA 2B29A 3CXCA 3JAMi 3CQZB 5EKKA 1I5FA 3GTOH 3S16H 5IWAL 3CMAA 2IX3A 2NZ1D 4M1UB 1TWHH 1S5DD 4HJ9A 3L2PA 4DV5L 2LXKA 4KMUC 2R7ZG 2IJ0A 1YITA 4DR1Q 3D8GA 4H0LC 4CJ1B 3I4NG 4IUPA 4LMQD 1KAAA 1D1KA 1BQQT 5C3EB 2B63G 3PO3B 1VQCA 3P7JA 4NXNL 3WDNA 4R4QA 3U4VA 2PI2E 5F2DA 1VMCA 2VUMG 1K0SA 1EY4A 1YJNA 5EJWA 3HOVB 2E2HH 4LF7L 4IPCA 5TSSA 1I6HH 1L1OA 2A73B 5HGTA 3D31A 5M5XB 1Z9FA 3S2HH 1AZQA 1ZYRC 1FL0A 2JA8H 4X62Q 3T16A 3G4SA 3FKIG 4KJOA 4IQZA 1DXMA 4ME3A 2KBNA 4IURA 4OXPA 1QOHA 4AYBE 3PIO3 3HKZG 4RHRA 1F77A 1R4QB 4RH6A 4X3KA 2VW9A 5EAYA 5GAEC 1CZWA 1K83B 1GHJA 2MHVA 4OONA 2CQOA 1IL2A 3NUCA 1IXRA 1S5ED 2L4NA 4DR4Q 2EYPA 5LMUL 2A6HC 4HCSA 4KN7C 4B9XA 5FLMG 1EYGA 5GAGC 1BBWA 4LUOA 4A3JB 2HIXA 3J80i 5FLMH 1S72A 4IFDI 2KOLA 3J81E 5LL6X 3EQLC 3DEOA 3A56A 1A3UA 4GNXB 4DR3Q 4QQBX 1K0RA 1PRTD 3PCOB 1ET6A 4YCUA 4DAYB 3S1NB 4KHPL 3DEPA 3V05A 4RGTA 3ND9A 3CCJA 1TWCH 1VQKA 1C9OA 2WB1E 4PV1C 4PQXA 3K7UC 2VNUD 5HURA 5EKLA 1CZGA 4DV7Q 4YCVA 1GUWA 4F87A 2XWJB 5IGBA 3H0GG 4IALA 2OTJA 2ZTCA 1E3PA 4IOAA 1AH9A 2WAQB 3CRKC 1DJRD 4KK7A 5J1ZA 3C1EA 1SYGA 4YWMA 1HRJA 3QB3A 5CORA 4AQYL 1SMYC 3D4DA 2Q2HA 3MA2B 3M3YB 3OTOQ 4HJ7A 3MEFA 2L5TA 3W3AA 3PO2G 3WOEA 1B3QA 2F0DA 3GO5A 3KF8B 1BF4A 2N88A 4XTCS 3Q23A 1BDOA 4H13C 1B9MA 2LFNA 2F4VL 4LAAA 5FLXE 1EFWA 3GQBA 2K32A 1N33L 1X32A 2AQ2B 1EWIA 1SE8A 4L5RC 1LYLA 3OWFA 2PCFB 5JAVA 2JA5G 1A0IA 1ML0D 3H3VH 1Y1WB 2RDGA 1GUGA 4A3DG 3KK7A 4XYOA 3HOZH 1XNQQ 2BDNA 4DV4Q 1HCZA 2A5HA 2M00A 1MSHA 2SNSA 4GKKQ 4KKUA 3SHLA 2PO4A 3QWNA 4QJFA 1EU4A 4J1MA 3U4ZA 5JVG3 2SNMA 4DA2A 4N8FA 3M4YA 1UNSA 3K8AA 5JEAJ 4BXXH 3P20A 4RKBA 3K58A 4A3EH 2JYOA 2E76C 5IY0A 1BCPD 4HSVA 4DGZA 4ZCKA 1LABA 3FPUB 3HEJA 4IZ8A 3BG3A 4LF6Q 1NNXA 3FHWA 3TEHB 3J81L 2EJMA 4RMFA 2Z0SA 4ID6A 1N9WA 2A69D 2JP1A 1AE2A 1II3A 4N8X1 4UY8C 3CF5A 3CW2C 1EY5A 3UDXA 3CAMA 4X65L 1PFSA 1E2WA 1LM0A 2N55A 4DKAC 5KNCA 1ESRA 5EQ0A 1JT8A 3SR1A 3I2ZA 4ALPA 4A3EB 4UP7A 2OWOA 1STHA 1S3OA 1ILQA 3BDOA 2ES2A 4GKKL 2L15A 3HOXG 4OO1G 1TY2A 1PVOA 1CM9A 3KF6A 3GD7A 4NDXA 4UDUC 4IO9A 2B2WC 2AWNA 2K28A 5ELBA 1C8CA 3G6EA 5C3EH 3MC0B 2B2UA 1WTOA 5M3FG 1RL2A 3PGZA 4A3MG 4R8NA 4BY7B 3R8BA 2Y0SB 3VA5A 1CQFA 1GUNA 2BDOA 2YU9H 4BBRB 2UXDL 1B44D 2DNEA 1SAPA 1TWFH 2KUMA 2MGSA 1J9OA 4DK0A 2K4KA 4YIJA 5IYDH 5FOBB 4LF5Q 2VQEQ 1N8RC 4A3DH 2AUJD 5T1IA 3TZUA 1JR0D 1OO9B 4ZQ3A 4RA8A 5IT9c 2RQXA 3CQZH 4C3IH 4K14A 1SROA 1NAPA 3G7LA 3M7GA 1EYAA 1SXTA 3PUVA 1QWYA 2K6AA 2L55A 3OPOA 3J81j 1HNZQ 2CQAA 4I7ZC 4A3CH 5H1SE 1CHPD 5CBEE 2H5XA 1UEAB 1XMQL 4Q0FA 1RTOA 3OYYA 3CPFA 2F0VA 2CVRA 2A74C 2DUDA 1NCVA 2DY7A 5AJ3L 1L0WA 5C0XG 1ENAA 4X3TA 2J7ZA 1ET9A 3MWYW 3D3RA 3H3VC 3RN2A 3ND8A 3OSOA 4JBMA 3A5UA 4LF4Q 4UHVA 4MZ9A 1HZAA 1BUVT 4PZ8A 4HIOA 1PYWD 1Z6HA 4PZ7A 4DXFA 2VQFQ 3BJUA 3RNUA 3J7AV 1SMYD 5FJ8G 2MNAA 4FXGC 1A8VA 3DUZA 3DLLA 3GV3A 3PQIA 4MHEA 1Q86C 2EYHA 2XNAC 1ENFA 4LUZA 1OXTA 2F0TA 2B3GA 2KA7A 3P1HA 5GAHC 4G4KA 2JA5B 3BU2A 4DR7Q 3GTOB 1KL9A 5IYDG 2Q2TA 4XQNA 3GTMB 2M2LA 3UE0A 1LTRD 1FR3A 2NVTH 3BS1A 1IL8A 3SK6A 5KYIA 1KNEA 4JI6Q 4X3SA 3ULLA 1V8QA 2ZTEA 5JJIA 4A3IB 1MBYA 3GTLH 1F2ZA 2KCTA 3J81c 2XTIA 3E6ZX 1GO3E 3NTIA 4B3MQ 4I65A 3Q8DA 2K75A 4JI7L 2EJGC 3CMEA 2WAQE 4YHHL 1VQMA 1CKMA 2B2YA 3I91A 4JI3Q 2ATWA 3MFYA 2YV5A 2JJQA 2F0KA 2RDHA 1FNUA 2IT1A 3HGBA 4LUVA 2TSSA 5C5MA 1K8MA 3Q24A 4A3FH 5C3EG 3GTPH 5M5YH 5COYA 1TQOA 4DR5Q 4OWTB 4QIWE 4AQYQ 1IBKL 2WB1B 1KNAA 2V4DA 3MEHA 3PSIA 4IPHA 4B3TQ 2Z9HA 1HHVA 4DV5Q 1EQRA 1QILA 1RTNA 1YNND 3I7FA 3AYHB 1VCIA 1JOKA 1K28A 3MXUA 4GKJL 2F0PA 4TVAB 2Q8RE 1AFPA 1X3EA 2R61A 3EA6A 3S17H 3AFQA 1BOSA 3S16B 2DJFC 3KJPA 3TDQA 2EYJA 2PZUA 2LXJA 5BN3A 1KD1C 4A3CG 2Z4HA 1IBML 1DD2A 2N8NA 5IGEA 3A54A 5E3FA 3SK4A 1MIUA 1PH8A 1LTLA 1G91A 3MXNB 2BA1A 1QUQA 1EEFD 4DR6L 1EOTA 1M4VA 3SVMA 1T5XD 2X6LA 3MVVA 2Q2UA 3S1RB 4JBKA 4J6HA 5ELEA 4ZKBB 1N34Q 4LFBL 3OW2A 2PMZB 4K0KL 5CC4A 2PW7A 1S4ZA 1WTQA 1PZID 2FHTA 5ELCA 3K5MA 4GKJQ 1YNXA 1SFOB 2XRSD 2XWBB 3TS0A 4PZ6A 2EIFA 3CRLC 1BO0A 1JCKB 3TQYA 3HKSA 2Z4IA 1YNJD 3KF6B 2AKWB 1CUKA 2KQ3A 2IY5B 3E5SA 3S14H 1BXTA 5C4HA 4GLVB 1ZYRD 2Z6KA 1YHQA 5IGFA 4BBSH 2B39A 4DAMA 2MUYA 1IBLQ 2NVXH 4LFCQ 1IZ6A 1EFID 3UDGA 1G6ZA 4KHZA 5FK9C 3NENA 1SJHD 1XPRA 3MHBA 1GVPA 4LF8Q 5CV5A 4QGUA 1Q90A 1VQ8A 1SLJA 4UAIA 2EY1A 2E5LL 5EPLA 4IUUA 4BBSG 1WOCA 5I9OA 5IGGA 3BDLA 5E1FA 5FLXL 2XIWA 3NWSA 4Y7NB 1WD0A 3VYRA 4KV6A 1VQJA 5ELFA 1N36L 3H3VI 3I3CA 3DXJC 2IHEA 4LFAL 2GN5A 2PNHA 4B3RL 1R9TB 3PIPA 2FFKB 4GZYC 2K14A 4C3HH 1TXYA 4KTAA 2K5QA 3L9AX 4I7AA 3B6YA 3CCMA 5HY6A 1DM0B 2KENA 2ZJRA 4HIKA 1EOVA 3C2PA 2R92H 5EKIA 3CCLA 2X6GA 5D3IB 3WOFA 1HZCA 4DAYA 1QCBD 2SOBA 4DV7L 2FJ2A 2OCEA 3A8JE 1YHAA 2LMCB 3IAYA 4PMBA 4DN4M 3R2TA 4UP8A 1D1IA 1IYJB 3F8TA 3CCEA 1YJ9A 4JI0Q 4LW1A 4XDXA 3Q22A 1F9SA 4IUNA 3M85A 1XNRL 4P75A 1AZPA 1D6EC 4B9WA 4OX9L 2E75C 2E2DC 2R92B 4JI4Q 1NMGA 3D0FA 4A3JH 1Y1VH 1E24A 3HOXH 1QZHA 4S3SA 1BBXC 1KABA 1XPUA 2EDGA 5A2QL 1RF2D 3UDIA 1OTCA 1N36Q 1D2BA 1RHPA 2Z6KC 1KAWA 4L63B 2L1BA 1K8AC 4Y7NH 4OIKA 4QUCA 4OIJA 4JI5L 1D5XC 1HQMC 2RA4A 3DHQA 4RFBA 4A3LH 2RHSB 1V1PB 3GDEA 2F0JA 4KI0A
chains in the Genus database with same CATH topology
5ISRA 2I07B 4FXDA 4DXGA 3NQIA 1TS4A 3BZDB 2F0HA 3J80L 5A35A 4WRDA 4XQQA 2MJ8A 1EYDA 4EQPA 5C6AA 1C4QA 5J22A 2IX0A 2OT2A 1STGA 4FVMA 3S14B 3TZDA 4BBSB 5DM73 4ULLA 4OO1I 2OEOA 1B4OA 4K6DA 2F0FA 5IGCA 2O5IC 5I2XA 3G6JB 1F9PA 5CYUA 1GUTA 1GHKA 1ZEQX 1EEID 3VR6A 2DY8A 3D4RA 5JPMC 2QEJC 1I4XA 1I4QA 1JWMD 4K5VA 1STNA 3DWPA 2QKIC 1LTSD 5DNFA 5C3WA 2K1BA 2NN6H 1GUSA 3ONAB 2OF1A 2QCPX 3SDZA 5D65A 1I6HB 2F0WA 4TRDA 4ZLTF 4R8IA 3J80E 4FO2A 1KLGD 2TMPA 3S2DB 4ILWA 2F3WA 3I70A 4ME5A 1E0BA 2YU9B 1IW7C 2B8GA 3TMEA 1LT5D 2QDBA 4C56C 5FO7B 1F9RA 1S5BD 3TP7A 5KIXA 1SNCA 1Y8PB 5IODA 3KLSX 3MXGA 5I4DA 1LV9A 1FGBD 3IKJA 3IFDA 4H44C 4PMCA 4ZAIA 2FMMA 1LTBD 5CV6A 3LWEA 1C48A 3PUYA 5NUCA 2NWGA 3VYSA 2A6EC 1FNWA 3X3NA 1EU3A 3S2HB 1TVXA 1LT6D 1KTKA 2A6ED 3A8KE 3NXWA 2EYFA 4G7OC 3PIP3 1E2VA 5C4XB 1I50B 5CR3A 2K5WA 1PRTB 1STEA 1TY0A 1XWEA 4QMGA 1F2LA 1HTPA 2O2LD 3H0GB 3OWEB 4KHVA 1V1PA 5JVH3 2DNCA 1PFNA 3NP8A 1SNOA 2B2UC 3D6WA 5JPNC 4ABNA 4ZYSA 3GTKB 1A2TA 2IWHA 2AWOA 2KEEA 1G291 3LX0A 2CHBD 1U4LA 3BVMA 1IKLA 1NR4A 4TQUS 1RODA 2F3VA 1H9SA 3NTKA 2WV6D 5LL6S 3HOUB 5I2YA 1ZXTA 3PV0A 2HCCA 1SYCA 4RAUC 1TS3A 1KLUD 2R93B 1DZ1A 2ENBA 2F0UA 2B2TC 2WINB 2Q8IB 5AFWA 4IFDJ 1JICA 5IT9E 1SE4A 4IN3A 4TSSA 3RMHA 2LY7A 1I3QB 5M5YB 2CW0C 4RWSC 1TWGB 2AQ3B 2L11A 1B53A 5DM63 4FF1A 3HRZC 4PNYA 3VR4A 1NUCA 3ITPA 1QE6A 4DAPA 2PZWA 4HMJA 3T51B 5K5PA 3GV6A 3I4LA 4XYQA 4C3HG 1MI2A 5I6YA 4CKEA 4K5WA 1HQRD 1MGSA 1AN8A 1H9MA 4C3JB 1TWAB 4CJ0B 1LTAD 1IYVA 1ZKOA 2RKSA 3VYUA 4KD4A 2F0SA 4DK1A 1JE4A 4K2KA 4RGMA 1J8IA 2C9OA 2B2YC 5FO8B 2F0EA 3T13A 4K5XA 4M8AA 5KEEA 5IT9L 2YYZA 2RDFA 2OXPA 3DM1A 4WFN3 2A6HD 3GTPB 3KF8A 3OW7A 5M3FB 3JAML 3GTGB 2F0NA 4KJNA 2D62A 2D2CC 4EQNA 1PTOH 4ZUJA 3NK9A 3NHHA 2RSOA 1XYIA 2WKDA 3S1MB 2PZTA 3A7AB 4HN7A 1CI3M 1HXYD 1SYEA 3HOYB 3C3LA 3T4AC 5JEAH 1EIHA 4CJ2C 3NPPA 4L6TB 4C1NI 3NWTA 1PDQA 3OHXC 2J0TD 5C0XI 1TWFB 2E2JB 5LHY1 2VB3X 3NQTA 1EY7A 3BVZA 2L9HA 1JORA 2PW5A 3U9OA 3CKIB 4EGVA 4EQOA 3BDCA 1RDPD 1ILPA 2IX1A 1PRTF 3J7AF 3Q6SA 1EQVA 4MIUA 4RHSA 4F7XA 3BYTB 3VYTA 5C0XH 1QJOA 3T53B 2Z8LA 4V190 2AQ1B 3QO2A 2JA8B 3TP8A 3H6MA 1G2TA 1X3QA 3M7NA 1X3PA 1EWCA 3H94A 4BWGB 4CHTB 4CGYB 3K57A 1Y69U 2KCNA 1HFNA 1SYDA 4RCOA 5CBAE 2ZT9C 2JEAI 2HDLA 2IL8A 3OMGA 1NSNS 1YNJC 5D14A 1S5FD 2QF7A 3HP3A 4K8IA 2IW3A 1EY8A 1I4PA 4RKLA 4X3UA 3P75A 2L0CA 3TBIB 3VR5A 4XT3B 1A3VA 5ELDA 2SDFA 5EPKA 4K8JA 1U4RA 4JK1C 4KD3A 1GXDC 2R3ZA 1LTID 1G8ZD 5CV4A 4C3IB 3I73A 1JB3A 3K59A 1JWSD 4DNTB 1CT1D 4G7HC 4N9PA 4A3DB 4F8MA 3HOXB 2BCOA 3VR2A 4DU9A 1BCPB 4HCEA 1DOKA 1PFMA 2C5CA 4K6LA 1BCPF 1RKNA 1TWCB 1L0YB 3R2IA 4XIGS 3HS0C 1CQVA 1D5MC 2NTSA 5BN5A 2I46A 5CGKA 1XTCD 5C0XJ 2DN8A 1RCVD 2WP8J 1AP0A 3K6OA 4FF3A 1DCZA 1DOLA 2KCCA 4NMZA 3I4MB 2LKVA 4ZUIA 1CTMA 4KN4C 2NN6I 2F0OA 1SEBD 1I4GA 4ZK9B 5DAUA 4U673 1F2YA 5FO9B 2B2VC 1PXUA 5G3LF 3FRPB 2RBMA 2Q8TA 2HDMA 5EBCA 3R3OA 1SNMA 3BYYB 4FXKC 2B2TA 2E2HB 2F4IA 4QF4A 3BVGA 1SSOA 4L8JA 3MXNA 1Q3LA 4BY1B 1I4HA 5IGDA 1SNDA 3S15B 5C5LA 5E4WC 3HOZB 3U9SA 2EY6A 2EXZA 5BN4A 4C3IG 4ODGA 2G9DA 2EJFC 1LO5D 1PTOC 1G2SA 5KYLA 3I72A 1EZ6A 4U68A 3HG9A 3OOCA 1DONA 4HAEA 3K5NA 1PRTC 1DYQA 4QB4A 4O42A 3I8ZA 3TSSA 3N6RA 3RZOB 1UAPA 3RUZA 2K01A 1TT2A 3K7AB 3KBXA 4H7BA 1T5EA 1GUOA 1SYFA 4TKOB 2XRQD 3MZ5A 1RJTA 1OXSC 1B1ZA 2EVBA 1FYCA 1QNUA 2A69C 4OHJA 1H9SB 3I90A 2PYKA 2NB0A 5C44B 2M9VA 1HPCA 1HUMA 2B2VA 1Y8OB 1KDAA 2JSOA 1MSGA 5DEHA 2VUMB 3FKIB 4FNFA 3KLRA 4A3FB 3QOLA 2EYOA 5CV7A 3O13A 1STAA 3VR3A 2H4OA 5IIFA 2JA7B 1SJED 4WORA 2HQEA 2O5JC 1S5CD 1SYBA 3EROA 1LACA 2AUKA 1WTPA 1XX8A 2D5DA 1PZKD 3LNNA 4Q5VA 4J8QA 3SE0A 1WTWA 2D9UA 3ERQA 2IPKD 5T1GA 1O80A 1VDZA 3OIPA 2BE5C 1CK1A 1KDBA 3S17B 1TKWB 1I6VC 4ZRZA 3R93A 4FF2A 4IFDG 1OXUA 1CA6A 3KLSA 2E74C 3SK8A 1O78A 2Z1CA 1FNVA 4QIWB 4QCLA 4KY6A 2JEBI 5A2QE 2K03A 1WTXA 2MPMA 1K8OA 3TP6A 1EWHA 1AEXA 4RGOS 3D6CA 3L7ZC 1JWUD 3URYA 2WACA 1VF5C 1LTTD 2G9HD 3OMCA 4DNRB 1LT3D 1WTRA 4A3BB 1EL0A 4CBVA 3GTJB 3EVQA 4NP5A 1U9RA 4OL7A 1PZJD 4LJZC 3NBIA 3E0JA 4IUVA 5EPJA 4RCNA 3K0YA 2K05A 2NVXB 5KRUA 2K33A 3CHBD 3MAQA 2K04A 1LTGD 1Z7TA 3J7YW 2XSCA 2E2IB 1IYUA 5KGUA 3IFTA 1IKMA 2JXMB 2NUCA 2ICIA 3W2DA 3H09A 4NKLA 4KKTA 4HTHA 1EY6A 5CV8A 5I6WA 4EVOA 1HTLD 1CFMA 2RSNA 3NBHA 4QUFA 4MN3A 2R7ZB 1L0XB 3PUXA 1D5ZC 3PUZA 4BA1I 5C3XA 2VXWA 1ONLA 1Y1VB 5K36H 4A93B 1BR9A 2BOSA 3A55A 2X69A 3MFGA 3FPPA 2H1EA 3L3OC 2F1MA 4AYBB 4O1NA 1GJXA 1KDCA 1E2ZA 2O4XA 2A68C 2JA6B 2NVQB 5KNBA 3FMCA 3SXHA 3HOWB 2F0MA 1QNKA 3GTLB 2NN6G 1W6KA 5M3MB 3V96A 4IFDH 3DMUA 3FVQA 5C4JB 1WD1A 4PMWA 5J39A 1HUNA 1RD9D 2NVTB 3JAME 2NBFA 1GOZA 3QOJA 1H9RA 4K2LA 1A3TA 3RZDB 5EBDA 4C3JG 2B8FA 1H9KA 5IOCA 1CHQD 5K36G 2EZVA 1TS2A 4OGQC 3AMUA 3AU7A 2F0GA 4NW2A 1DOMA 3K5OA 1TS5A 3N52A 2ZXPA 1M8AA 3HKZB 1OXVA 1U4PA 2KHSA 2B63B 4CKCA 2EOTA 3GTQB 2CW0D 3QJYA 3SEBA 1A2UA 2EYLA 4G57A 4DFAA 1O7YA 3RLFA 1PFBA 1PTOF 4DF7A 2EPBA 1F2MA 2L12A 3NSWA 1UUPA 4FP5D 1O7LA 4A3KB 4WJWA 1A15A 1SE2A 2J4XA 1AW7A 3VA7A 3H91A 4HR7B 2K7VA 3NTHA 1B3AA 1O7ZA 4HMIA 1JOQA 4C2MB 1WVLA 2ID0A 1SBBB 2FMCA 3T56B 1EY9A 1MD2D 2ZXOA 3LWUA 3GP7A 1IW7D 2XVSA 3S1QB 4BA2I 3S9WA 3V2TA 2BE5D 1STYA 4KY7A 5KNDA 1LLRD 1Z47A 2KJXA 3D4WA 1YNNC 3MXPA 1F9QA 4R9WA 3A8IE 4FF4A 1SNPA 4FYDA 1JC7A 2HCIA 4N9TA 4V0BA 1JQYD 2F03A 2PQEA 2WIIB 2F0LA 2FINB 1IHZA 5FKAC 5CV9A 4XXEA 1EYCA 2F0QA 5M9OA 2KECA 4ZKCB 5JOBA 3Q0AA 5EGTA 1CA5A 3DWAA 3UI2A 4KY5A 1Q12A 2EYMA 2A68D 1R4PB 1WCMB 1H9JA 1FD7D 4IUTA 5M5WB 1TWHB 3TN2A 1STBA 4KKSA 1Q8IA 2HUGA 1JOOA 5CMDA 3IL8A 2EY2A 3K5LA 2F0IA 3OIQA 2ZXRA 1B9NA 3I4NB 1XXGA 3X3MA 1PTOB 1EIGA 1EY0A 1EZ8A 2B2WA 2EY5A 2NTTA 4XT1B 3C1FA 1V43A 1Q1EA 1EQTA 4BS9A 4DAVA 5E4XA 3M4OB 3KBGA 1B50A 2SEBD 1PTOD 1HA5A 3DWQA 1NR2A 1W6JA 1SE3A 1I4RA 1QB5D 1ESFA 3NE5B 1B2TA 1SNQA 2WKCA 5G3LD 1PLFA 1LT4D 1U4MA 4A3MB 3ZYYX 4C3HB 2BA0A 2KEDA 1OXXK 3F2UA 4E6IA 1SDFA 3KUPA 1ICWA 2LS01 2EE1A 1HFGA 3EFXD 3PUWA 2VB2X 3CU7A 4C1NK 4F88A 5JEAG 4CKBA 3MTSA 3TP5A 1A6XA 4G7ZC 1HA6A 5I9PA 5JJZA 3QG1A 3RD4A 4XQJA 4RGNA 3C46A 2QILA 4IUQA 5C4ZA 4OO1H 1WTVA 3QIAA 3FEWX 1PMRA 4B08A 2GA4B 2JE6I 1BNZA 3EJIA 2K5DA 2NYZD 4JBWA 1TIID 2XN9C 1TR5A 4A3GB 1V1OA 4HSPA 5D3DA 1ENCA 4HEDA 3PO2B 3SK5A 2NVYB 1Y8NB 2R6GA 2MP1A 1TU2B 2PNRC 1Q1BA 2ICEC 2KVMA 1BCPC 2RVLA 4LK1C 3PMFA 2PPBC 4Z9CB 3AB9A 3A7LA 1VF7A 1QG7A 4P2CB 1VMPA 3HZXA 3FDTA 3CQZB 5EKKA 2IX3A 2NZ1D 4M1UB 1S5DD 4KMUC 2IJ0A 3D8GA 4H0LC 4CJ1B 4IUPA 4LMQD 1KAAA 1D1KA 1BQQT 5C3EB 3PO3B 3P7JA 3WDNA 5F2DA 1VMCA 1EY4A 5EJWA 3HOVB 5TSSA 2A73B 5HGTA 3D31A 5M5XB 1AZQA 1ZYRC 3T16A 4KJOA 4IQZA 1DXMA 4IURA 1QOHA 3PIO3 4RHRA 1F77A 1R4QB 4RH6A 4X3KA 1CZWA 1K83B 1GHJA 2MHVA 3NUCA 1S5ED 2L4NA 2EYPA 2A6HC 4HCSA 4KN7C 4B9XA 4A3JB 4IFDI 2KOLA 3J81E 5LL6X 3EQLC 3DEOA 3A56A 1A3UA 1PRTD 1ET6A 3S1NB 3DEPA 3V05A 4RGTA 3ND9A 4PV1C 4PQXA 2VNUD 5HURA 5EKLA 1CZGA 1GUWA 4F87A 2XWJB 5IGBA 4IALA 2WAQB 3CRKC 1DJRD 4KK7A 5J1ZA 3C1EA 1SYGA 1HRJA 3QB3A 5CORA 1SMYC 3D4DA 3MA2B 3M3YB 2L5TA 3W3AA 3WOEA 2F0DA 3GO5A 1BF4A 2N88A 4XTCS 3Q23A 1BDOA 4H13C 1B9MA 2LFNA 4LAAA 5FLXE 3GQBA 2K32A 1X32A 2AQ2B 3OWFA 2PCFB 5JAVA 1ML0D 1Y1WB 2RDGA 1GUGA 3KK7A 4XYOA 2BDNA 1HCZA 2A5HA 2M00A 1MSHA 2SNSA 4KKUA 3SHLA 2PO4A 3QWNA 1EU4A 4J1MA 5JVG3 2SNMA 4DA2A 3M4YA 1UNSA 5JEAJ 3P20A 4RKBA 3K58A 2JYOA 2E76C 1BCPD 4HSVA 4DGZA 1LABA 3FPUB 3HEJA 4IZ8A 3BG3A 3J81L 2EJMA 4ID6A 2A69D 2JP1A 1II3A 1EY5A 1E2WA 2N55A 5KNCA 1ESRA 5EQ0A 3SR1A 4A3EB 1STHA 1ILQA 3BDOA 4OO1G 1TY2A 1CM9A 4NDXA 3GD7A 4UDUC 2B2WC 2AWNA 2K28A 5ELBA 1C8CA 3MC0B 2B2UA 1WTOA 4BY7B 4R8NA 3R8BA 2Y0SB 3VA5A 1CQFA 1GUNA 2BDOA 4BBRB 1B44D 2DNEA 1SAPA 2KUMA 2MGSA 1J9OA 4DK0A 4YIJA 5FOBB 2AUJD 5T1IA 3TZUA 1JR0D 1OO9B 4ZQ3A 4RA8A 2RQXA 4K14A 1NAPA 3G7LA 3M7GA 1EYAA 1SXTA 3PUVA 1QWYA 2K6AA 2L55A 3OPOA 2CQAA 4I7ZC 1CHPD 5CBEE 1UEAB 4Q0FA 1RTOA 2F0VA 2CVRA 2A74C 1NCVA 2DY7A 5C0XG 1ENAA 4X3TA 2J7ZA 1ET9A 3MWYW 3D3RA 3H3VC 3ND8A 3OSOA 1BUVT 1PYWD 1Z6HA 4DXFA 3J7AV 1SMYD 4FXGC 3DUZA 3GV3A 4MHEA 2EYHA 2XNAC 1ENFA 1OXTA 2F0TA 2KA7A 3P1HA 4G4KA 2JA5B 3GTOB 4XQNA 3GTMB 2M2LA 1LTRD 1FR3A 3BS1A 1IL8A 3SK6A 5KYIA 1KNEA 4X3SA 1V8QA 4A3IB 1MBYA 1F2ZA 3E6ZX 3NTIA 4I65A 2EJGC 2B2YA 3I91A 3MFYA 2RDHA 2F0KA 1FNUA 2IT1A 3HGBA 5C5MA 2TSSA 3Q24A 1K8MA 5COYA 1TQOA 2WB1B 1KNAA 2V4DA 3MEHA 1HHVA 1RTNA 1QILA 1YNND 1VCIA 1JOKA 3MXUA 2F0PA 2Q8RE 1AFPA 2R61A 3EA6A 1BOSA 3S16B 3TDQA 2EYJA 2PZUA 5BN3A 2Z4HA 1DD2A 5IGEA 3A54A 5E3FA 3SK4A 1G91A 2BA1A 1EEFD 1EOTA 1M4VA 3SVMA 1T5XD 2X6LA 3MVVA 3S1RB 4J6HA 5ELEA 4ZKBB 2PMZB 5CC4A 2PW7A 1S4ZA 1WTQA 1PZID 2FHTA 3K5MA 1SFOB 2XRSD 2XWBB 3CRLC 1BO0A 1JCKB 2Z4IA 1YNJD 2KQ3A 3E5SA 1BXTA 5C4HA 1ZYRD 5IGFA 2B39A 2MUYA 1EFID 1G6ZA 4KHZA 5FK9C 1SJHD 3MHBA 5CV5A 1Q90A 4UAIA 2EY1A 5EPLA 4IUUA 5I9OA 5IGGA 3BDLA 5E1FA 5FLXL 2XIWA 3NWSA 4Y7NB 1WD0A 3VYRA 4KV6A 5ELFA 3I3CA 3DXJC 1R9TB 2FFKB 4GZYC 3L9AX 2K5QA 4KTAA 1DM0B 3C2PA 5EKIA 2X6GA 5D3IB 3WOFA 4DAYA 1QCBD 2SOBA 2FJ2A 3A8JE 2LMCB 3IAYA 4PMBA 4DN4M 3R2TA 1D1IA 4XDXA 3Q22A 1F9SA 4IUNA 3M85A 1AZPA 1D6EC 4B9WA 2E75C 2E2DC 2R92B 4S3SA 1BBXC 1KABA 2EDGA 5A2QL 1RF2D 1D2BA 1RHPA 4L63B 2L1BA 4OIKA 4QUCA 4OIJA 1D5XC 1HQMC 2RA4A 3DHQA 4RFBA 5ELCA 1V1PB 2F0JA 4KI0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D3R A;  3VYT A;  3VYS A;  2OT2 A;  3VYU A;  2Z1C A;  3VYR A; 
#chains in the Genus database with same CATH topology
 5ISR A;  2I07 B;  4FXD A;  4DXG A;  3NQI A;  1TS4 A;  1V1Q A;  3BZD B;  1Q8K A;  2F0H A;  1XMO L;  4GN5 A;  3J80 L;  5A35 A;  4WRD A;  4XQQ A;  4PG3 A;  4DUZ Q;  2MJ8 A;  1EYD A;  3VDY A;  4EQP A;  5C6A A;  1C4Q A;  2QW7 A;  4JG2 A;  5J22 A;  1FJG L;  4JV5 Q;  4GOP A;  2IX0 A;  2OT2 A;  1STG A;  1KRT A;  4FVM A;  3S14 B;  3TZD A;  4BBS B;  4BY1 G;  3QR8 A;  1P8L A;  4LFA Q;  2MO0 A;  5DM7 3;  4ULL A;  4OO1 I;  2OEO A;  1B4O A;  2K5V A;  4K6D A;  2F0F A;  5IGC A;  2O5I C;  3HOZ G;  4A93 G;  1WYD A;  2EXD A;  5I2X A;  3G6J B;  1F9P A;  5CYU A;  1GUT A;  1GHK A;  1ZEQ X;  1EEI D;  3VR6 A;  3T1H Q;  2DY8 A;  3D4R A;  5JPM C;  4JYA L;  2QEJ C;  1I4X A;  1I4Q A;  1JWM D;  2XGT A;  1XPO A;  5AJ3 Q;  1CKO A;  4K5V A;  4A3L G;  4B3S Q;  1STN A;  3DWP A;  2K5H A;  2QKI C;  1LTS D;  5DNF A;  1I94 Q;  5C3W A;  1MJE A;  2K1B A;  2NN6 H;  1GUS A;  1PH1 A;  1YBY A;  4R4O A;  3ONA B;  2OF1 A;  2QCP X;  3SDZ A;  5D65 A;  1I6H B;  2F0W A;  4TRD A;  4ZLT F;  4R8I A;  3RZO H;  3J80 E;  2WFW A;  4FO2 A;  1KLG D;  2TMP A;  1CSP A;  3S2D B;  4ILW A;  4LF5 L;  2F3W A;  3CPW A;  4DV4 L;  3I70 A;  4GLX A;  5GAD C;  4ME5 A;  1E0B A;  1EUJ A;  2YU9 B;  3SGI A;  1IW7 C;  1ASY A;  1A62 A;  2B8G A;  3TME A;  2A19 A;  4BY7 H;  1LT5 D;  2QDB A;  3CP0 A;  4C56 C;  5FO7 B;  1F9R A;  3RR5 A;  1VQF A;  1LUZ A;  1S5B D;  1PYB A;  3TP7 A;  5KIX A;  1SNC A;  4YY3 Q;  1Y8P B;  5IOD A;  3KLS X;  3MXG A;  5I4D A;  1LV9 A;  1MKH A;  1FGB D;  1CKN A;  1J6Q A;  3IFD A;  3IKJ A;  4H44 C;  4PMC A;  5DLQ E;  4ZAI A;  4BY1 H;  2FMM A;  1LTB D;  5CV6 A;  1NY4 A;  3LWE A;  1C48 A;  2UXB L;  3PUY A;  5NUC A;  2NWG A;  3VYS A;  4A4I A;  2A6E C;  1FNW A;  3X3N A;  1EU3 A;  3IRB A;  3S2H B;  1TVX A;  1LT6 D;  1KTK A;  2YTX A;  2JA8 G;  4GLA C;  2A6E D;  2CWA A;  3NXW A;  3A8K E;  4FDB A;  1E7Z A;  2EYF A;  5FJ8 H;  4G7O C;  4O2D A;  3PIP 3;  1E2V A;  1VQ9 A;  2KHJ A;  5C4X B;  4A3G H;  3W1B A;  4H02 A;  5IP9 H;  1I50 B;  4LFB Q;  5CR3 A;  2CH4 A;  2K5W A;  4IPD A;  1PRT B;  4DNI A;  2DGY A;  1STE A;  1TY0 A;  3I56 A;  1XWE A;  4QMG A;  1F2L A;  1HTP A;  2MO1 A;  2O2L D;  3H0G B;  3ER0 A;  1PH4 A;  3OWE B;  4KHV A;  1V1P A;  3CCQ A;  5JVH 3;  2DNC A;  1PFN A;  3NP8 A;  1SNO A;  2B2U C;  3D6W A;  1VQE A;  5JPN C;  4ABN A;  1YJW A;  4A93 H;  4R1J A;  4C3J H;  3M4Q A;  4ZYS A;  3GTK B;  1A2T A;  1C7Y A;  2IWH A;  2AWO A;  2KEE A;  2OQK A;  1VQA A;  1G29 1;  4DR1 L;  3LX0 A;  1E1O A;  2CHB D;  1U4L A;  3F2C A;  3BVM A;  1IKL A;  4QL5 A;  1NR4 A;  4B3T L;  4TQU S;  1ROD A;  3G71 A;  2F3V A;  1H9S A;  3NTK A;  2WV6 D;  5LL6 S;  1PH9 A;  3HOU B;  5I2Y A;  1B70 B;  1ZXT A;  3LGJ A;  3PV0 A;  2HCC A;  5IWA Q;  1SYC A;  4RAU C;  1TS3 A;  1KLU D;  2R93 B;  1DZ1 A;  2ENB A;  2F0U A;  2B2T C;  2WIN B;  2Y0S G;  2Q8I B;  4A3I G;  5AFW A;  4OWW B;  3H0G H;  2JA6 G;  4IFD J;  5ELO A;  1JIC A;  1U0L A;  2E2I H;  5IT9 E;  1SE4 A;  4KLK A;  4DR3 L;  4IN3 A;  3S15 H;  4TSS A;  3RMH A;  1Y1W G;  1YHB A;  2LY7 A;  1I3Q B;  4CDE C;  4JYA Q;  5M5Y B;  2CW0 C;  4RWS C;  1PA6 A;  3H15 A;  1TWG B;  2AQ3 B;  2L11 A;  4JVZ A;  2CFM A;  1K9M C;  1B53 A;  5DM6 3;  4FF1 A;  4MTK A;  3HRZ C;  1YZ6 A;  1R9T H;  3ULP A;  1XNQ L;  4JW0 A;  4PNY A;  3VR4 A;  1NUC A;  3ITP A;  1QE6 A;  4DAP A;  2PZW A;  2UXB Q;  4LF9 Q;  4HMJ A;  3T51 B;  5K5P A;  3GV6 A;  3I4L A;  3CCR A;  1PH2 A;  4XYQ A;  5IYB G;  4C3H G;  2ZM6 Q;  1MI2 A;  3PF4 A;  4GNX C;  5I6Y A;  1FGU A;  4CKE A;  4K5W A;  1HQR D;  1MGS A;  1AN8 A;  1H9M A;  3GTK H;  3S1Q H;  3I55 A;  2Q2I A;  4C3J B;  1TWA B;  1G51 A;  4CJ0 B;  1KIX A;  1LTA D;  1IYV A;  1VQN A;  1ZKO A;  2RKS A;  1BVS A;  3VYU A;  1DGS A;  1JB7 A;  3E9H A;  4JOI C;  4KD4 A;  2F0S A;  1KHI A;  4DK1 A;  1JE4 A;  1SN8 A;  2QDL A;  4K2K A;  4RGM A;  3F1Z A;  5LMN W;  1J8I A;  2EQS A;  2C9O A;  4RG1 A;  3W5O A;  2B2Y C;  2OQ0 A;  5FO8 B;  4L5S A;  4JI7 Q;  2F0E A;  3T13 A;  4DV0 Q;  1MHW C;  4K5X A;  5BR8 Q;  4M8A A;  5KEE A;  4HJA A;  1I50 H;  5IT9 L;  2R93 H;  2YYZ A;  4GS3 A;  2RDF A;  3JAM c;  2OXP A;  5IYC H;  5LMN Q;  3DM1 A;  4WFN 3;  1BBU A;  2A6H D;  3NBH B;  3GTP B;  3KF8 A;  5C44 H;  4OX9 Q;  3E3X A;  3OW7 A;  5M3F B;  3JAM L;  1YVC A;  3GTG B;  5C4X G;  4JI2 Q;  4KJN A;  4NB3 A;  2F0N A;  2D62 A;  2ZTD A;  4DUY L;  2D2C C;  4EQN A;  3T1H L;  1JJC B;  1PTO H;  4ZUJ A;  3J80 c;  3NK9 A;  3NHH A;  2RSO A;  1XYI A;  1QZG A;  4Y52 H;  2WKD A;  1HNW Q;  2BH2 A;  2JQO A;  3S1M B;  2PZT A;  2K52 A;  4DV3 L;  4B3S L;  3A7A B;  4HN7 A;  1CI3 M;  3CC4 A;  1HXY D;  4P74 A;  1SYE A;  3HOY B;  3C3L A;  3T4A C;  2HD3 A;  1IBM Q;  3HFZ B;  5JEA H;  4A75 A;  2VQF L;  1EIH A;  4CJ2 C;  3NPP A;  4L6T B;  4C1N I;  3U50 C;  1WI5 A;  2VS1 A;  3NWT A;  1PDQ A;  3OHX C;  4DR6 Q;  2J0T D;  1QVG A;  3ZJY C;  2QEX A;  5C0X I;  2CCZ A;  1TWF B;  1M90 C;  4OEM B;  2E2J B;  5LHY 1;  4IJH A;  2VB3 X;  1X3F A;  1E1T A;  3NQT A;  1EY7 A;  4A3K G;  4YY3 L;  3BVZ A;  2L9H A;  3J7A 5;  1K73 C;  1JOR A;  4QY7 A;  2PW5 A;  3U9O A;  4LF6 L;  4GOP C;  3CKI B;  4EGV A;  4EQO A;  3BDC A;  1RDP D;  5C4X H;  3RZD H;  1ILP A;  2IX1 A;  1PRT F;  4P73 A;  4A3G G;  1SMX A;  3J7A F;  3Q6S A;  1EQV A;  4GN3 B;  1J5E L;  4MIU A;  2I5H A;  4RHS A;  4A3I H;  3ICE A;  5IYC G;  4F7X A;  4DUY Q;  2UUC L;  2JA7 G;  3BYT B;  3VYT A;  5C0X H;  1QJO A;  2D0P A;  3T53 B;  2Z8L A;  4YCW A;  4YHH Q;  2GVA A;  1HNZ L;  4V19 0;  2AQ1 B;  3QO2 A;  2JA8 B;  3TP8 A;  1U5K A;  3H6M A;  2VZA A;  1G2T A;  4LNQ A;  1X3Q A;  3OTO L;  3M7N A;  1D7Q A;  1PH5 A;  1WJJ A;  2AMC B;  1X3P A;  1PV4 A;  1EWC A;  3H94 A;  4BWG B;  2RCN A;  2ASB A;  4CHT B;  3BZC A;  4CGY B;  2MFI A;  3K57 A;  1Y69 U;  3TRZ A;  1B7Y B;  3K81 C;  2KCN A;  1HFN A;  4C2M H;  1UWV A;  1SYD A;  4RCO A;  1I3Q H;  5CBA E;  3K80 C;  2ZT9 C;  2JEA I;  4POF A;  2F4V Q;  3EBE A;  2E2J H;  1Q81 C;  1EIY B;  2HDL A;  2IL8 A;  3OMG A;  1NSN S;  1YNJ C;  4JPB W;  5D14 A;  1S5F D;  1Y1W H;  1HJP A;  2QF7 A;  3HP3 A;  3PO3 G;  4K8I A;  2IW3 A;  1EY8 A;  1I4P A;  4RKL A;  2CWP A;  4X3U A;  4DK3 C;  3P75 A;  2L0C A;  3TBI B;  3VR5 A;  1EQQ A;  4XT3 B;  1A3V A;  1X3G A;  4B3R Q;  3RN5 A;  1PH6 A;  4X65 Q;  5ELD A;  2SDF A;  3EN2 A;  5EPK A;  4K8J A;  1U4R A;  4JK1 C;  4KD3 A;  5JJL A;  3T1Y Q;  1GXD C;  1L1O B;  2R3Z A;  1K3R A;  1O7I A;  1LTI D;  1G8Z D;  1XMO Q;  4JI6 L;  5CV4 A;  4C3I B;  1YI2 A;  3I73 A;  3HOW H;  3K0X A;  1JB3 A;  2PQA B;  1JWS D;  3K59 A;  4DNT B;  1CT1 D;  3M4P A;  4G7H C;  4N9P A;  4A3D B;  4F8M A;  3HOX B;  2BCO A;  3VR2 A;  4DU9 A;  1BCP B;  4HCE A;  1DOK A;  1PFM A;  2UXC L;  1CSQ A;  2C5C A;  4K6L A;  4JI1 Q;  1BCP F;  1RKN A;  1TWC B;  3KOJ A;  2HQL A;  1VQG A;  4L5Q A;  3F2B A;  1PH3 A;  3S1N H;  4UP9 A;  1L0Y B;  1RIP A;  1UE1 A;  3HS0 C;  3R2I A;  4XIG S;  1CQV A;  1D5M C;  2NTS A;  5M3M G;  5BN5 A;  2I46 A;  5CGK A;  1XTC D;  1HZ9 A;  5C0X J;  2DN8 A;  1RCV D;  1N34 L;  2WP8 J;  1AP0 A;  3K6O A;  4FF3 A;  1DCZ A;  1DOL A;  2KCC A;  4NMZ A;  4DV6 Q;  1VQB A;  3I4M B;  2LKV A;  5FLX c;  1UE5 A;  2KHI A;  4ZUI A;  1CTM A;  4LWC A;  4KN4 C;  4NPS A;  3NEM A;  2NN6 I;  1W2B A;  2F0O A;  1SEB D;  1K83 H;  2ZJP A;  1I4G A;  4ZK9 B;  3T1Y L;  5DAU A;  4OWX B;  3BZK A;  4U67 3;  1F2Y A;  5FO9 B;  2B2V C;  1PXU A;  3NEL A;  5G3L F;  3FRP B;  2RBM A;  2Q8T A;  5HGQ A;  2HDM A;  1VQ6 A;  4A3B H;  5EBC A;  3R3O A;  1Y14 B;  1SNM A;  3BYY B;  4DR5 L;  1NBW A;  4FXK C;  1GD7 A;  2B2T A;  2E2H B;  2F4I A;  4QF4 A;  3BVG A;  4HID A;  1SSO A;  1VQ7 A;  4L8J A;  4GOP B;  3G48 A;  3MXN A;  1Q3L A;  2ZJQ A;  4BY1 B;  1I4H A;  2MQH A;  5ELN A;  5GQO A;  5IGD A;  2VQE L;  1SND A;  3S15 B;  5C5L A;  4NXM Q;  5E4W C;  3HOZ B;  3U9S A;  2EY6 A;  4CDF C;  2EXZ A;  3A0J A;  4C3I G;  5BN4 A;  1NE3 A;  4ODG A;  3WWV A;  2G9D A;  2EJF C;  1SR3 A;  1SFO H;  1LO5 D;  1PTO C;  1G2S A;  3E9I A;  3I72 A;  5KYL A;  1EZ6 A;  3HG9 A;  4U68 A;  3OOC A;  3HOU H;  1DON A;  4HAE A;  3K5N A;  3UE1 A;  2HHH Q;  4JBJ A;  1HH2 P;  1PRT C;  1DYQ A;  3HOU G;  4QB4 A;  1KC8 C;  3AEV A;  5LMN L;  4GN4 B;  2F52 A;  4O42 A;  3I8Z A;  3TSS A;  3N6R A;  4LF7 Q;  3RZO B;  1UAP A;  3RUZ A;  2K01 A;  1HNX L;  4POG A;  1TT2 A;  1B8A A;  3K7A B;  2V1C C;  3KBX A;  4EX5 A;  4H7B A;  4X62 L;  1T5E A;  1GUO A;  4JOI A;  1SYF A;  4TKO B;  2XRQ D;  3MZ5 A;  1RJT A;  1OXS C;  1B1Z A;  1YEZ A;  2EVB A;  5BR8 L;  1FYC A;  1QNU A;  1S40 A;  2A69 C;  3KDF B;  4OHJ A;  1H9S B;  5C44 G;  3I90 A;  2PYK A;  2YTV A;  4EQ5 A;  2NB0 A;  5C44 B;  2M9V A;  1HPC A;  1X65 A;  1HUM A;  3CD6 A;  2B2V A;  1WCM H;  1Y8O B;  3F2D A;  3PO2 H;  1KDA A;  2JSO A;  1MSG A;  5DEH A;  3STB D;  4A3B G;  2VUM B;  3PIO A;  4A3F G;  1XJV A;  4CDD C;  3FKI B;  4FNF A;  1VQL A;  3KLR A;  1IBK Q;  4A3F B;  3QOL A;  2EYO A;  5CV7 A;  3O13 A;  4DV3 Q;  3UDF A;  1K3B C;  1STA A;  2AHO B;  3CC7 A;  1NJI C;  1I94 L;  3VR3 A;  2H4O A;  5IIF A;  2JA7 B;  4O0A A;  1K8G A;  2ALY B;  3KDF A;  1SJE D;  4WOR A;  2HQE A;  2O5J C;  1S5C D;  1SYB A;  3ERO A;  1LAC A;  2AUK A;  1HNX Q;  1WTP A;  1XX8 A;  3W1G A;  1WFQ A;  2K50 A;  2D5D A;  1PZK D;  3LNN A;  4Q5V A;  4J8Q A;  2E5L Q;  3SE0 A;  5J3B A;  5IE8 A;  1WTW A;  4MNO A;  2D9U A;  4JI0 L;  5JJK A;  3K7A H;  1C0A A;  3ERQ A;  2IPK D;  5M3M H;  2UXC Q;  5T1G A;  1Q7Y C;  2I5M X;  1O80 A;  2NZO A;  3I4M G;  1VDZ A;  3OIP A;  2BE5 C;  1CK1 A;  1KDB A;  3M9B A;  3S17 B;  1TKW B;  1I6V C;  4ZRZ A;  3GTG H;  4DR7 L;  3R93 A;  4FF2 A;  4WJ4 A;  4IFD G;  1OXU A;  1CA6 A;  1HZB A;  3KLS A;  2E74 C;  3SK8 A;  1O78 A;  2YTY A;  2Z1C A;  1FNV A;  4NXM L;  2UXD Q;  2RCF A;  1PH7 A;  4QIW B;  4QCL A;  4KY6 A;  3AFP A;  2JEB I;  5A2Q E;  4P71 A;  2K03 A;  3ERS X;  1WTX A;  2MPM A;  1K8O A;  3CC2 A;  3TP6 A;  4LF4 L;  1EWH A;  2WAQ G;  1AEX A;  4CDC C;  4HJ5 A;  1X55 A;  4A3K H;  1JE5 A;  4R4C A;  1HR0 W;  4JI5 Q;  4RGO S;  3D6C A;  3L7Z C;  1JWU D;  1Y1V G;  4LFC L;  1HR0 L;  4JI8 Q;  3URY A;  1N32 L;  2WAC A;  2JN4 A;  1VF5 C;  4IOC A;  4A3E G;  1LTT D;  2G9H D;  3OMC A;  4DNR B;  1LT3 D;  1WTR A;  4A3B B;  1EL0 A;  4CBV A;  4IJL A;  3GTJ B;  2R7Z H;  3EVQ A;  2R7D A;  4NP5 A;  1U9R A;  1ICF B;  1AE3 A;  4OL7 A;  1PZJ D;  4LJZ C;  4R4T A;  3NBI A;  4A76 A;  4BBR H;  3E0J A;  4IUV A;  5EPJ A;  4L5T A;  4J15 A;  4RCN A;  3K0Y A;  3AQQ A;  2K05 A;  2NVX B;  3RLO A;  3FKI H;  5KRU A;  2K33 A;  3CHB D;  4JI1 L;  2K04 A;  3MAQ A;  1LTG D;  1Z7T A;  2UUA Q;  3J7Y W;  2XSC A;  2E2I B;  4X64 Q;  1JJ2 A;  1IYU A;  5KGU A;  3IFT A;  5E7N A;  2QGQ A;  1IKM A;  2JXM B;  2NUC A;  2ICI A;  2GVB A;  1L1O C;  1WCM G;  3W2D A;  3H09 A;  2HT1 A;  4NKL A;  4KKT A;  3TS2 A;  2N49 A;  4X66 Q;  3CCS A;  4HTH A;  1EY6 A;  5CV8 A;  5I6W A;  3S1R H;  4EVO A;  2Y0S E;  1HTL D;  1CFM A;  1XTD A;  2QA4 A;  2RSN A;  3NBH A;  4QUF A;  4MN3 A;  3I4O A;  4DV1 Q;  1IBL L;  1VQ4 A;  2R7Z B;  3M3Y H;  1L0X B;  2PMZ E;  3PUX A;  1QUQ B;  3I4N H;  1EIF A;  1D5Z C;  3PUZ A;  4BA1 I;  4BBR G;  2NVQ H;  5C3X A;  2VXW A;  1ONL A;  1Y1V B;  1TWG H;  5K36 H;  4A93 B;  1BR9 A;  2LSS A;  5LMU Q;  5IYB H;  3EIV A;  2BOS A;  3A55 A;  4B3M L;  2X69 A;  3MFG A;  3FPP A;  2H1E A;  3L3O C;  2F1M A;  4AYB B;  2FXQ A;  4O1N A;  4X66 L;  2N3S A;  1GJX A;  1VQ5 A;  2R7F A;  2DJG C;  1KDC A;  1E2Z A;  2O4X A;  2A68 C;  3S2D H;  2JA6 B;  3HOW G;  2NVQ B;  5KNB A;  4GNX A;  2PQA A;  3FMC A;  1MJC A;  3SXH A;  3HOW B;  2F0M A;  1QNK A;  4JI3 L;  1N33 Q;  1VQI A;  4DK6 C;  2NN6 G;  3GTL B;  1W6K A;  5M3M B;  3V96 A;  4IFD H;  4NXN Q;  3DMU A;  3FVQ A;  4HIM A;  5C4J B;  1WD1 A;  4PMW A;  5J39 A;  3HOY G;  4A3J G;  1HUN A;  2HIV A;  1RD9 D;  2NVT B;  3JAM E;  2NBF A;  1X6O A;  1GOZ A;  3QOJ A;  2B63 H;  1H9R A;  4K2L A;  3HOV H;  3I4M H;  1A3T A;  2D0O A;  3A5Z B;  1CKN B;  2A1A A;  3RZD B;  5EBD A;  4C3J G;  4HJ8 A;  2B8F A;  1H9K A;  5IOC A;  1CHQ D;  5K36 G;  2EZV A;  1TS2 A;  4OGQ C;  3AMU A;  2IHF A;  3AU7 A;  4DV2 L;  4YWK A;  2F0G A;  4NW2 A;  1DOM A;  3K5O A;  1TS5 A;  3N52 A;  2ZXP A;  1M8A A;  3HKZ B;  1ASZ A;  1HNW L;  1OXV A;  1U4P A;  2KHS A;  3JC6 6;  3J7Z C;  4JI2 L;  2B63 B;  4CKC A;  2EOT A;  3GTQ B;  2CW0 D;  3QJY A;  3SEB A;  1A2U A;  2EYL A;  4G57 A;  3S24 A;  2UUB L;  4DV6 L;  3STB C;  4DFA A;  3HOY H;  1L2F A;  1O7Y A;  3RLN A;  3RLF A;  5L37 A;  4X64 L;  1Q82 C;  3L0O A;  1PFB A;  1PTO F;  5M5X H;  4DF7 A;  4DR2 Q;  1W3S A;  2EPB A;  1F2M A;  2I0Q A;  2L12 A;  3NSW A;  4UPA A;  1UUP A;  2WB1 G;  4FP5 D;  2F3I A;  1O7L A;  1NMF A;  3PF5 A;  4K0K Q;  4A3K B;  4WJW A;  1A15 A;  3PO3 H;  3A74 A;  1Q46 A;  1SE2 A;  2J4X A;  1AW7 A;  3VA7 A;  2I5L X;  1QVC A;  3H91 A;  4HR7 B;  2K7V A;  2C35 B;  3NTH A;  1B3A A;  2A8V A;  1P16 A;  1O7Z A;  4JV5 L;  1D8L A;  1PHJ A;  2UU9 Q;  4HMI A;  1JOQ A;  4C2M B;  1WVL A;  2ID0 A;  1SBB B;  1VQD A;  1JJG A;  2FMC A;  2VY3 A;  3T56 B;  4LF9 L;  4JI8 L;  1EY9 A;  4P72 A;  1MD2 D;  3HKZ E;  2ZM6 L;  2ZXO A;  3LWU A;  3GP7 A;  1A63 A;  1IW7 D;  4AYB G;  1X54 A;  1KXL A;  1VS0 A;  3HOV G;  2CKZ B;  2XVS A;  4AIM A;  3S1Q B;  3E0E A;  4KHP Q;  3KJO A;  4BA2 I;  3S9W A;  3V2T A;  2BE5 D;  1STY A;  2BH8 A;  4KY7 A;  5KND A;  1XNR Q;  1LLR D;  1Z47 A;  2KJX A;  1GKH A;  1BKB A;  1YNN C;  3MXP A;  3D4W A;  3GTQ H;  3U58 A;  5IP7 G;  1F9Q A;  4R9W A;  1GM5 A;  3A8I E;  4FF4 A;  1SNP A;  4FYD A;  1JC7 A;  2HCI A;  4JI4 L;  4N9T A;  4V0B A;  1JQY D;  2JA7 H;  2F03 A;  2PQE A;  1SRU A;  2WII B;  2F0L A;  2FIN B;  2UUB Q;  1HR0 Q;  1IHZ A;  5FKA C;  5CV9 A;  3TRE A;  2JA6 H;  3KYH C;  4XXE A;  1EYC A;  2F0Q A;  1T9H A;  5M9O A;  2KEC A;  4ZKC B;  5JOB A;  3Q0A A;  1YIJ A;  5EGT A;  1CA5 A;  3DWA A;  3UI2 A;  2UU9 L;  4KY5 A;  1Q12 A;  2EYM A;  2A68 D;  1R4P B;  1WCM B;  1H9J A;  1FD7 D;  4IUT A;  5M5W B;  1TWH B;  3TN2 A;  1STB A;  4KKS A;  4AH6 A;  1Q8I A;  2HUG A;  1NTG A;  1UE7 A;  1V9P A;  1JOO A;  1VQP A;  5CMD A;  4BXX G;  3IL8 A;  1UE6 A;  1XMQ Q;  2EY2 A;  4YWL A;  3K5L A;  2F0I A;  3OIQ A;  2ZXR A;  4JC0 A;  1B9N A;  1FVI A;  5C4J H;  3I4N B;  1PYS B;  4JCV E;  1XXG A;  3X3M A;  2NZH A;  2P5Z X;  3GTJ H;  4LF8 L;  3KLW A;  1PTO B;  4BY7 G;  1EIG A;  1EY0 A;  1EZ8 A;  1J5E Q;  2UUA L;  2B2W A;  2EY5 A;  4A3M H;  5M3F H;  1VQO A;  2HHH L;  2E8G A;  2RF4 A;  2N78 A;  5GRO A;  2NVY H;  1QVF A;  2NTT A;  4XT1 B;  3C1F A;  1V43 A;  1Q1E A;  1EQT A;  4BS9 A;  4DAV A;  5E4X A;  3M4O B;  3KBG A;  1B50 A;  3ULJ A;  1UEB A;  2SEB D;  1PTO D;  2G5D A;  2VL6 A;  5M5W H;  1HA5 A;  3DWQ A;  1VQH A;  1NR2 A;  5IP9 G;  1W6J A;  1SE3 A;  1I4R A;  1QB5 D;  1ESF A;  3NE5 B;  3J81 i;  1B2T A;  1SNQ A;  1KQS A;  2WKC A;  2UUC Q;  5G3L D;  1PLF A;  2JK8 A;  2KCM A;  1LT4 D;  1U4M A;  4A3M B;  3ZYY X;  4C3H B;  2BA0 A;  1TWA H;  2KED A;  1OXX K;  2JA9 A;  3F2U A;  4E6I A;  1SDF A;  4DR4 L;  3KUP A;  1ICW A;  3DM3 A;  2R92 G;  2LS0 1;  2EE1 A;  4DPG A;  1HFG A;  1KRS A;  3EFX D;  3PUW A;  2VB2 X;  3CU7 A;  4C1N K;  1X56 A;  4DV0 L;  4F88 A;  5JEA G;  3GTM H;  1N32 Q;  4CKB A;  3MTS A;  1M1K C;  4DV1 L;  1X9N A;  3TP5 A;  2JA5 H;  1A6X A;  4G7Z C;  3KFU A;  1HA6 A;  5I9P A;  5JJZ A;  2CH4 W;  3QG1 A;  1JMC A;  3RD4 A;  4XQJ A;  4RGN A;  3C46 A;  2RHQ B;  1FJG Q;  2QIL A;  4IUQ A;  5C4Z A;  4OO1 H;  1WTV A;  3QIA A;  4OEL B;  4R4I A;  3FEW X;  4DUZ L;  1PMR A;  2PI2 A;  4IPG A;  4B08 A;  1E22 A;  2GA4 B;  1H95 A;  3CCU A;  2JE6 I;  1BNZ A;  3EJI A;  2K5D A;  4DR2 L;  3CCV A;  2NYZ D;  2VUM H;  4JBW A;  1TII D;  2XN9 C;  4X6A H;  1TR5 A;  4A3G B;  3M4O H;  1V1O A;  4HSP A;  5D3D A;  1ENC A;  4HED A;  3PO2 B;  2R93 G;  5IP7 H;  3SK5 A;  2NVY B;  1Y8N B;  2R6G A;  2MP1 A;  1TU2 B;  2Z6B A;  2PNR C;  1Q1B A;  1G6P A;  2ICE C;  2KVM A;  2OTL A;  1BCP C;  2RVL A;  4LK1 C;  3PMF A;  2PPB C;  4MTN A;  4Z9C B;  4WJ3 M;  4APV A;  3AB9 A;  3A7L A;  1VF7 A;  2K5N A;  1QG7 A;  1WTH A;  4P2C B;  1VMP A;  4DV2 Q;  3FP9 A;  3S1M H;  3HZX A;  3FDT A;  2B29 A;  3CXC A;  3JAM i;  3CQZ B;  5EKK A;  1I5F A;  3GTO H;  3S16 H;  5IWA L;  3CMA A;  2IX3 A;  2NZ1 D;  4M1U B;  1TWH H;  1S5D D;  4HJ9 A;  3L2P A;  4DV5 L;  2LXK A;  4KMU C;  2R7Z G;  2IJ0 A;  1YIT A;  4DR1 Q;  3D8G A;  4H0L C;  4CJ1 B;  3I4N G;  4IUP A;  4LMQ D;  1KAA A;  1D1K A;  1BQQ T;  5C3E B;  2B63 G;  3PO3 B;  1VQC A;  3P7J A;  4NXN L;  3WDN A;  4R4Q A;  3U4V A;  2PI2 E;  5F2D A;  1VMC A;  2VUM G;  1K0S A;  1EY4 A;  1YJN A;  5EJW A;  3HOV B;  2E2H H;  4LF7 L;  4IPC A;  5TSS A;  1I6H H;  1L1O A;  2A73 B;  5HGT A;  3D31 A;  5M5X B;  1Z9F A;  3S2H H;  1AZQ A;  1ZYR C;  1FL0 A;  2JA8 H;  4X62 Q;  3T16 A;  3G4S A;  3FKI G;  4KJO A;  4IQZ A;  1DXM A;  4ME3 A;  2KBN A;  4IUR A;  4OXP A;  1QOH A;  4AYB E;  3PIO 3;  3HKZ G;  4RHR A;  1F77 A;  1R4Q B;  4RH6 A;  4X3K A;  2VW9 A;  5EAY A;  5GAE C;  1CZW A;  1K83 B;  1GHJ A;  2MHV A;  4OON A;  2CQO A;  1IL2 A;  3NUC A;  1IXR A;  1S5E D;  2L4N A;  4DR4 Q;  2EYP A;  5LMU L;  2A6H C;  4HCS A;  4KN7 C;  4B9X A;  5FLM G;  1EYG A;  5GAG C;  1BBW A;  4LUO A;  4A3J B;  2HIX A;  3J80 i;  5FLM H;  1S72 A;  4IFD I;  2KOL A;  3J81 E;  5LL6 X;  3EQL C;  3DEO A;  3A56 A;  1A3U A;  4GNX B;  4DR3 Q;  4QQB X;  1K0R A;  1PRT D;  3PCO B;  1ET6 A;  4YCU A;  4DAY B;  3S1N B;  4KHP L;  3DEP A;  3V05 A;  4RGT A;  3ND9 A;  3CCJ A;  1TWC H;  1VQK A;  1C9O A;  2WB1 E;  4PV1 C;  4PQX A;  3K7U C;  2VNU D;  5HUR A;  5EKL A;  1CZG A;  4DV7 Q;  4YCV A;  1GUW A;  4F87 A;  2XWJ B;  5IGB A;  3H0G G;  4IAL A;  2OTJ A;  2ZTC A;  1E3P A;  4IOA A;  1AH9 A;  2WAQ B;  3CRK C;  1DJR D;  4KK7 A;  5J1Z A;  3C1E A;  1SYG A;  4YWM A;  1HRJ A;  3QB3 A;  5COR A;  4AQY L;  1SMY C;  3D4D A;  2Q2H A;  3MA2 B;  3M3Y B;  3OTO Q;  4HJ7 A;  3MEF A;  2L5T A;  3W3A A;  3PO2 G;  3WOE A;  1B3Q A;  2F0D A;  3GO5 A;  3KF8 B;  1BF4 A;  2N88 A;  4XTC S;  3Q23 A;  1BDO A;  4H13 C;  1B9M A;  2LFN A;  2F4V L;  4LAA A;  5FLX E;  1EFW A;  3GQB A;  2K32 A;  1N33 L;  1X32 A;  2AQ2 B;  1EWI A;  1SE8 A;  4L5R C;  1LYL A;  3OWF A;  2PCF B;  5JAV A;  2JA5 G;  1A0I A;  1ML0 D;  3H3V H;  1Y1W B;  2RDG A;  1GUG A;  4A3D G;  3KK7 A;  4XYO A;  3HOZ H;  1XNQ Q;  2BDN A;  4DV4 Q;  1HCZ A;  2A5H A;  2M00 A;  1MSH A;  2SNS A;  4GKK Q;  4KKU A;  3SHL A;  2PO4 A;  3QWN A;  4QJF A;  1EU4 A;  4J1M A;  3U4Z A;  5JVG 3;  2SNM A;  4DA2 A;  4N8F A;  3M4Y A;  1UNS A;  3K8A A;  5JEA J;  4BXX H;  3P20 A;  4RKB A;  3K58 A;  4A3E H;  2JYO A;  2E76 C;  5IY0 A;  1BCP D;  4HSV A;  4DGZ A;  4ZCK A;  1LAB A;  3FPU B;  3HEJ A;  4IZ8 A;  3BG3 A;  4LF6 Q;  1NNX A;  3FHW A;  3TEH B;  3J81 L;  2EJM A;  4RMF A;  2Z0S A;  4ID6 A;  1N9W A;  2A69 D;  2JP1 A;  1AE2 A;  1II3 A;  4N8X 1;  4UY8 C;  3CF5 A;  3CW2 C;  1EY5 A;  3UDX A;  3CAM A;  4X65 L;  1PFS A;  1E2W A;  1LM0 A;  2N55 A;  4DKA C;  5KNC A;  1ESR A;  5EQ0 A;  1JT8 A;  3SR1 A;  3I2Z A;  4ALP A;  4A3E B;  4UP7 A;  2OWO A;  1STH A;  1S3O A;  1ILQ A;  3BDO A;  2ES2 A;  4GKK L;  2L15 A;  3HOX G;  4OO1 G;  1TY2 A;  1PVO A;  1CM9 A;  3KF6 A;  3GD7 A;  4NDX A;  4UDU C;  4IO9 A;  2B2W C;  2AWN A;  2K28 A;  5ELB A;  1C8C A;  3G6E A;  5C3E H;  3MC0 B;  2B2U A;  1WTO A;  5M3F G;  1RL2 A;  3PGZ A;  4A3M G;  4R8N A;  4BY7 B;  3R8B A;  2Y0S B;  3VA5 A;  1CQF A;  1GUN A;  2BDO A;  2YU9 H;  4BBR B;  2UXD L;  1B44 D;  2DNE A;  1SAP A;  1TWF H;  2KUM A;  2MGS A;  1J9O A;  4DK0 A;  2K4K A;  4YIJ A;  5IYD H;  5FOB B;  4LF5 Q;  2VQE Q;  1N8R C;  4A3D H;  2AUJ D;  5T1I A;  3TZU A;  1JR0 D;  1OO9 B;  4ZQ3 A;  4RA8 A;  5IT9 c;  2RQX A;  3CQZ H;  4C3I H;  4K14 A;  1SRO A;  1NAP A;  3G7L A;  3M7G A;  1EYA A;  1SXT A;  3PUV A;  1QWY A;  2K6A A;  2L55 A;  3OPO A;  3J81 j;  1HNZ Q;  2CQA A;  4I7Z C;  4A3C H;  5H1S E;  1CHP D;  5CBE E;  2H5X A;  1UEA B;  1XMQ L;  4Q0F A;  1RTO A;  3OYY A;  3CPF A;  2F0V A;  2CVR A;  2A74 C;  2DUD A;  1NCV A;  2DY7 A;  5AJ3 L;  1L0W A;  5C0X G;  1ENA A;  4X3T A;  2J7Z A;  1ET9 A;  3MWY W;  3D3R A;  3H3V C;  3RN2 A;  3ND8 A;  3OSO A;  4JBM A;  3A5U A;  4LF4 Q;  4UHV A;  4MZ9 A;  1HZA A;  1BUV T;  4PZ8 A;  4HIO A;  1PYW D;  1Z6H A;  4PZ7 A;  4DXF A;  2VQF Q;  3BJU A;  3RNU A;  3J7A V;  1SMY D;  5FJ8 G;  2MNA A;  4FXG C;  1A8V A;  3DUZ A;  3DLL A;  3GV3 A;  3PQI A;  4MHE A;  1Q86 C;  2EYH A;  2XNA C;  1ENF A;  4LUZ A;  1OXT A;  2F0T A;  2B3G A;  2KA7 A;  3P1H A;  5GAH C;  4G4K A;  2JA5 B;  3BU2 A;  4DR7 Q;  3GTO B;  1KL9 A;  5IYD G;  2Q2T A;  4XQN A;  3GTM B;  2M2L A;  3UE0 A;  1LTR D;  1FR3 A;  2NVT H;  3BS1 A;  1IL8 A;  3SK6 A;  5KYI A;  1KNE A;  4JI6 Q;  4X3S A;  3ULL A;  1V8Q A;  2ZTE A;  5JJI A;  4A3I B;  1MBY A;  3GTL H;  1F2Z A;  2KCT A;  3J81 c;  2XTI A;  3E6Z X;  1GO3 E;  3NTI A;  4B3M Q;  4I65 A;  3Q8D A;  2K75 A;  4JI7 L;  2EJG C;  3CME A;  2WAQ E;  4YHH L;  1VQM A;  1CKM A;  2B2Y A;  3I91 A;  4JI3 Q;  2ATW A;  3MFY A;  2YV5 A;  2JJQ A;  2F0K A;  2RDH A;  1FNU A;  2IT1 A;  3HGB A;  4LUV A;  2TSS A;  5C5M A;  1K8M A;  3Q24 A;  4A3F H;  5C3E G;  3GTP H;  5M5Y H;  5COY A;  1TQO A;  4DR5 Q;  4OWT B;  4QIW E;  4AQY Q;  1IBK L;  2WB1 B;  1KNA A;  2V4D A;  3MEH A;  3PSI A;  4IPH A;  4B3T Q;  2Z9H A;  1HHV A;  4DV5 Q;  1EQR A;  1QIL A;  1RTN A;  1YNN D;  3I7F A;  3AYH B;  1VCI A;  1JOK A;  1K28 A;  3MXU A;  4GKJ L;  2F0P A;  4TVA B;  2Q8R E;  1AFP A;  1X3E A;  2R61 A;  3EA6 A;  3S17 H;  3AFQ A;  1BOS A;  3S16 B;  2DJF C;  3KJP A;  3TDQ A;  2EYJ A;  2PZU A;  2LXJ A;  5BN3 A;  1KD1 C;  4A3C G;  2Z4H A;  1IBM L;  1DD2 A;  2N8N A;  5IGE A;  3A54 A;  5E3F A;  3SK4 A;  1MIU A;  1PH8 A;  1LTL A;  1G91 A;  3MXN B;  2BA1 A;  1QUQ A;  1EEF D;  4DR6 L;  1EOT A;  1M4V A;  3SVM A;  1T5X D;  2X6L A;  3MVV A;  2Q2U A;  3S1R B;  4JBK A;  4J6H A;  5ELE A;  4ZKB B;  1N34 Q;  4LFB L;  3OW2 A;  2PMZ B;  4K0K L;  5CC4 A;  2PW7 A;  1S4Z A;  1WTQ A;  1PZI D;  2FHT A;  5ELC A;  3K5M A;  4GKJ Q;  1YNX A;  1SFO B;  2XRS D;  2XWB B;  3TS0 A;  4PZ6 A;  2EIF A;  3CRL C;  1BO0 A;  1JCK B;  3TQY A;  3HKS A;  2Z4I A;  1YNJ D;  3KF6 B;  2AKW B;  1CUK A;  2KQ3 A;  2IY5 B;  3E5S A;  3S14 H;  1BXT A;  5C4H A;  4GLV B;  1ZYR D;  2Z6K A;  1YHQ A;  5IGF A;  4BBS H;  2B39 A;  4DAM A;  2MUY A;  1IBL Q;  2NVX H;  4LFC Q;  1IZ6 A;  1EFI D;  3UDG A;  1G6Z A;  4KHZ A;  5FK9 C;  3NEN A;  1SJH D;  1XPR A;  3MHB A;  1GVP A;  4LF8 Q;  5CV5 A;  4QGU A;  1Q90 A;  1VQ8 A;  1SLJ A;  4UAI A;  2EY1 A;  2E5L L;  5EPL A;  4IUU A;  4BBS G;  1WOC A;  5I9O A;  5IGG A;  3BDL A;  5E1F A;  5FLX L;  2XIW A;  3NWS A;  4Y7N B;  1WD0 A;  3VYR A;  4KV6 A;  1VQJ A;  5ELF A;  1N36 L;  3H3V I;  3I3C A;  3DXJ C;  2IHE A;  4LFA L;  2GN5 A;  2PNH A;  4B3R L;  1R9T B;  3PIP A;  2FFK B;  4GZY C;  2K14 A;  4C3H H;  1TXY A;  4KTA A;  2K5Q A;  3L9A X;  4I7A A;  3B6Y A;  3CCM A;  5HY6 A;  1DM0 B;  2KEN A;  2ZJR A;  4HIK A;  1EOV A;  3C2P A;  2R92 H;  5EKI A;  3CCL A;  2X6G A;  5D3I B;  3WOF A;  1HZC A;  4DAY A;  1QCB D;  2SOB A;  4DV7 L;  2FJ2 A;  2OCE A;  3A8J E;  1YHA A;  2LMC B;  3IAY A;  4PMB A;  4DN4 M;  3R2T A;  4UP8 A;  1D1I A;  1IYJ B;  3F8T A;  3CCE A;  1YJ9 A;  4JI0 Q;  4LW1 A;  4XDX A;  3Q22 A;  1F9S A;  4IUN A;  3M85 A;  1XNR L;  4P75 A;  1AZP A;  1D6E C;  4B9W A;  4OX9 L;  2E75 C;  2E2D C;  2R92 B;  4JI4 Q;  1NMG A;  3D0F A;  4A3J H;  1Y1V H;  1E24 A;  3HOX H;  1QZH A;  4S3S A;  1BBX C;  1KAB A;  1XPU A;  2EDG A;  5A2Q L;  1RF2 D;  3UDI A;  1OTC A;  1N36 Q;  1D2B A;  1RHP A;  2Z6K C;  1KAW A;  4L63 B;  2L1B A;  1K8A C;  4Y7N H;  4OIK A;  4QUC A;  4OIJ A;  4JI5 L;  1D5X C;  1HQM C;  2RA4 A;  3DHQ A;  4RFB A;  4A3L H;  2RHS B;  1V1P B;  3GDE A;  2F0J A;  4KI0 A; 
#chains in the Genus database with same CATH homology
 5ISR A;  2I07 B;  4FXD A;  4DXG A;  3NQI A;  1TS4 A;  3BZD B;  2F0H A;  3J80 L;  5A35 A;  4WRD A;  4XQQ A;  2MJ8 A;  1EYD A;  4EQP A;  5C6A A;  1C4Q A;  5J22 A;  2IX0 A;  2OT2 A;  1STG A;  4FVM A;  3S14 B;  3TZD A;  4BBS B;  5DM7 3;  4ULL A;  4OO1 I;  2OEO A;  1B4O A;  4K6D A;  2F0F A;  5IGC A;  2O5I C;  5I2X A;  3G6J B;  1F9P A;  5CYU A;  1GUT A;  1GHK A;  1ZEQ X;  1EEI D;  3VR6 A;  2DY8 A;  3D4R A;  5JPM C;  2QEJ C;  1I4X A;  1I4Q A;  1JWM D;  4K5V A;  1STN A;  3DWP A;  2QKI C;  1LTS D;  5DNF A;  5C3W A;  2K1B A;  2NN6 H;  1GUS A;  3ONA B;  2OF1 A;  2QCP X;  3SDZ A;  5D65 A;  1I6H B;  2F0W A;  4TRD A;  4ZLT F;  4R8I A;  3J80 E;  4FO2 A;  1KLG D;  2TMP A;  3S2D B;  4ILW A;  2F3W A;  3I70 A;  4ME5 A;  1E0B A;  2YU9 B;  1IW7 C;  2B8G A;  3TME A;  1LT5 D;  2QDB A;  4C56 C;  5FO7 B;  1F9R A;  1S5B D;  3TP7 A;  5KIX A;  1SNC A;  1Y8P B;  5IOD A;  3KLS X;  3MXG A;  5I4D A;  1LV9 A;  1FGB D;  3IKJ A;  3IFD A;  4H44 C;  4PMC A;  4ZAI A;  2FMM A;  1LTB D;  5CV6 A;  3LWE A;  1C48 A;  3PUY A;  5NUC A;  2NWG A;  3VYS A;  2A6E C;  1FNW A;  3X3N A;  1EU3 A;  3S2H B;  1TVX A;  1LT6 D;  1KTK A;  2A6E D;  3A8K E;  3NXW A;  2EYF A;  4G7O C;  3PIP 3;  1E2V A;  5C4X B;  1I50 B;  5CR3 A;  2K5W A;  1PRT B;  1STE A;  1TY0 A;  1XWE A;  4QMG A;  1F2L A;  1HTP A;  2O2L D;  3H0G B;  3OWE B;  4KHV A;  1V1P A;  5JVH 3;  2DNC A;  1PFN A;  3NP8 A;  1SNO A;  2B2U C;  3D6W A;  5JPN C;  4ABN A;  4ZYS A;  3GTK B;  1A2T A;  2IWH A;  2AWO A;  2KEE A;  1G29 1;  3LX0 A;  2CHB D;  1U4L A;  3BVM A;  1IKL A;  1NR4 A;  4TQU S;  1ROD A;  2F3V A;  1H9S A;  3NTK A;  2WV6 D;  5LL6 S;  3HOU B;  5I2Y A;  1ZXT A;  3PV0 A;  2HCC A;  1SYC A;  4RAU C;  1TS3 A;  1KLU D;  2R93 B;  1DZ1 A;  2ENB A;  2F0U A;  2B2T C;  2WIN B;  2Q8I B;  5AFW A;  4IFD J;  1JIC A;  5IT9 E;  1SE4 A;  4IN3 A;  4TSS A;  3RMH A;  2LY7 A;  1I3Q B;  5M5Y B;  2CW0 C;  4RWS C;  1TWG B;  2AQ3 B;  2L11 A;  1B53 A;  5DM6 3;  4FF1 A;  3HRZ C;  4PNY A;  3VR4 A;  1NUC A;  3ITP A;  1QE6 A;  4DAP A;  2PZW A;  4HMJ A;  3T51 B;  5K5P A;  3GV6 A;  3I4L A;  4XYQ A;  4C3H G;  1MI2 A;  5I6Y A;  4CKE A;  4K5W A;  1HQR D;  1MGS A;  1AN8 A;  1H9M A;  4C3J B;  1TWA B;  4CJ0 B;  1LTA D;  1IYV A;  1ZKO A;  2RKS A;  3VYU A;  4KD4 A;  2F0S A;  4DK1 A;  1JE4 A;  4K2K A;  4RGM A;  1J8I A;  2C9O A;  2B2Y C;  5FO8 B;  2F0E A;  3T13 A;  4K5X A;  4M8A A;  5KEE A;  5IT9 L;  2YYZ A;  2RDF A;  2OXP A;  3DM1 A;  4WFN 3;  2A6H D;  3GTP B;  3KF8 A;  3OW7 A;  5M3F B;  3JAM L;  3GTG B;  2F0N A;  4KJN A;  2D62 A;  2D2C C;  4EQN A;  1PTO H;  4ZUJ A;  3NK9 A;  3NHH A;  2RSO A;  1XYI A;  2WKD A;  3S1M B;  2PZT A;  3A7A B;  4HN7 A;  1CI3 M;  1HXY D;  1SYE A;  3HOY B;  3C3L A;  3T4A C;  5JEA H;  1EIH A;  4CJ2 C;  3NPP A;  4L6T B;  4C1N I;  3NWT A;  1PDQ A;  3OHX C;  2J0T D;  5C0X I;  1TWF B;  2E2J B;  5LHY 1;  2VB3 X;  3NQT A;  1EY7 A;  3BVZ A;  2L9H A;  1JOR A;  2PW5 A;  3U9O A;  3CKI B;  4EGV A;  4EQO A;  3BDC A;  1RDP D;  1ILP A;  2IX1 A;  1PRT F;  3J7A F;  3Q6S A;  1EQV A;  4MIU A;  4RHS A;  4F7X A;  3BYT B;  3VYT A;  5C0X H;  1QJO A;  3T53 B;  2Z8L A;  4V19 0;  2AQ1 B;  3QO2 A;  2JA8 B;  3TP8 A;  3H6M A;  1G2T A;  1X3Q A;  3M7N A;  1X3P A;  1EWC A;  3H94 A;  4BWG B;  4CHT B;  4CGY B;  3K57 A;  1Y69 U;  2KCN A;  1HFN A;  1SYD A;  4RCO A;  5CBA E;  2ZT9 C;  2JEA I;  2HDL A;  2IL8 A;  3OMG A;  1NSN S;  1YNJ C;  5D14 A;  1S5F D;  2QF7 A;  3HP3 A;  4K8I A;  2IW3 A;  1EY8 A;  1I4P A;  4RKL A;  4X3U A;  3P75 A;  2L0C A;  3TBI B;  3VR5 A;  4XT3 B;  1A3V A;  5ELD A;  2SDF A;  5EPK A;  4K8J A;  1U4R A;  4JK1 C;  4KD3 A;  1GXD C;  2R3Z A;  1LTI D;  1G8Z D;  5CV4 A;  4C3I B;  3I73 A;  1JB3 A;  3K59 A;  1JWS D;  4DNT B;  1CT1 D;  4G7H C;  4N9P A;  4A3D B;  4F8M A;  3HOX B;  2BCO A;  3VR2 A;  4DU9 A;  1BCP B;  4HCE A;  1DOK A;  1PFM A;  2C5C A;  4K6L A;  1BCP F;  1RKN A;  1TWC B;  1L0Y B;  3R2I A;  4XIG S;  3HS0 C;  1CQV A;  1D5M C;  2NTS A;  5BN5 A;  2I46 A;  5CGK A;  1XTC D;  5C0X J;  2DN8 A;  1RCV D;  2WP8 J;  1AP0 A;  3K6O A;  4FF3 A;  1DCZ A;  1DOL A;  2KCC A;  4NMZ A;  3I4M B;  2LKV A;  4ZUI A;  1CTM A;  4KN4 C;  2NN6 I;  2F0O A;  1SEB D;  1I4G A;  4ZK9 B;  5DAU A;  4U67 3;  1F2Y A;  5FO9 B;  2B2V C;  1PXU A;  5G3L F;  3FRP B;  2RBM A;  2Q8T A;  2HDM A;  5EBC A;  3R3O A;  1SNM A;  3BYY B;  4FXK C;  2B2T A;  2E2H B;  2F4I A;  4QF4 A;  3BVG A;  1SSO A;  4L8J A;  3MXN A;  1Q3L A;  4BY1 B;  1I4H A;  5IGD A;  1SND A;  3S15 B;  5C5L A;  5E4W C;  3HOZ B;  3U9S A;  2EY6 A;  2EXZ A;  5BN4 A;  4C3I G;  4ODG A;  2G9D A;  2EJF C;  1LO5 D;  1PTO C;  1G2S A;  5KYL A;  3I72 A;  1EZ6 A;  4U68 A;  3HG9 A;  3OOC A;  1DON A;  4HAE A;  3K5N A;  1PRT C;  1DYQ A;  4QB4 A;  4O42 A;  3I8Z A;  3TSS A;  3N6R A;  3RZO B;  1UAP A;  3RUZ A;  2K01 A;  1TT2 A;  3K7A B;  3KBX A;  4H7B A;  1T5E A;  1GUO A;  1SYF A;  4TKO B;  2XRQ D;  3MZ5 A;  1RJT A;  1OXS C;  1B1Z A;  2EVB A;  1FYC A;  1QNU A;  2A69 C;  4OHJ A;  1H9S B;  3I90 A;  2PYK A;  2NB0 A;  5C44 B;  2M9V A;  1HPC A;  1HUM A;  2B2V A;  1Y8O B;  1KDA A;  2JSO A;  1MSG A;  5DEH A;  2VUM B;  3FKI B;  4FNF A;  3KLR A;  4A3F B;  3QOL A;  2EYO A;  5CV7 A;  3O13 A;  1STA A;  3VR3 A;  2H4O A;  5IIF A;  2JA7 B;  1SJE D;  4WOR A;  2HQE A;  2O5J C;  1S5C D;  1SYB A;  3ERO A;  1LAC A;  2AUK A;  1WTP A;  1XX8 A;  2D5D A;  1PZK D;  3LNN A;  4Q5V A;  4J8Q A;  3SE0 A;  1WTW A;  2D9U A;  3ERQ A;  2IPK D;  5T1G A;  1O80 A;  1VDZ A;  3OIP A;  2BE5 C;  1CK1 A;  1KDB A;  3S17 B;  1TKW B;  1I6V C;  4ZRZ A;  3R93 A;  4FF2 A;  4IFD G;  1OXU A;  1CA6 A;  3KLS A;  2E74 C;  3SK8 A;  1O78 A;  2Z1C A;  1FNV A;  4QIW B;  4QCL A;  4KY6 A;  2JEB I;  5A2Q E;  2K03 A;  1WTX A;  2MPM A;  1K8O A;  3TP6 A;  1EWH A;  1AEX A;  4RGO S;  3D6C A;  3L7Z C;  1JWU D;  3URY A;  2WAC A;  1VF5 C;  1LTT D;  2G9H D;  3OMC A;  4DNR B;  1LT3 D;  1WTR A;  4A3B B;  1EL0 A;  4CBV A;  3GTJ B;  3EVQ A;  4NP5 A;  1U9R A;  4OL7 A;  1PZJ D;  4LJZ C;  3NBI A;  3E0J A;  4IUV A;  5EPJ A;  4RCN A;  3K0Y A;  2K05 A;  2NVX B;  5KRU A;  2K33 A;  3CHB D;  3MAQ A;  2K04 A;  1LTG D;  1Z7T A;  3J7Y W;  2XSC A;  2E2I B;  1IYU A;  5KGU A;  3IFT A;  1IKM A;  2JXM B;  2NUC A;  2ICI A;  3W2D A;  3H09 A;  4NKL A;  4KKT A;  4HTH A;  1EY6 A;  5CV8 A;  5I6W A;  4EVO A;  1HTL D;  1CFM A;  2RSN A;  3NBH A;  4QUF A;  4MN3 A;  2R7Z B;  1L0X B;  3PUX A;  1D5Z C;  3PUZ A;  4BA1 I;  5C3X A;  2VXW A;  1ONL A;  1Y1V B;  5K36 H;  4A93 B;  1BR9 A;  2BOS A;  3A55 A;  2X69 A;  3MFG A;  3FPP A;  2H1E A;  3L3O C;  2F1M A;  4AYB B;  4O1N A;  1GJX A;  1KDC A;  1E2Z A;  2O4X A;  2A68 C;  2JA6 B;  2NVQ B;  5KNB A;  3FMC A;  3SXH A;  3HOW B;  2F0M A;  1QNK A;  3GTL B;  2NN6 G;  1W6K A;  5M3M B;  3V96 A;  4IFD H;  3DMU A;  3FVQ A;  5C4J B;  1WD1 A;  4PMW A;  5J39 A;  1HUN A;  1RD9 D;  2NVT B;  3JAM E;  2NBF A;  1GOZ A;  3QOJ A;  1H9R A;  4K2L A;  1A3T A;  3RZD B;  5EBD A;  4C3J G;  2B8F A;  1H9K A;  5IOC A;  1CHQ D;  5K36 G;  2EZV A;  1TS2 A;  4OGQ C;  3AMU A;  3AU7 A;  2F0G A;  4NW2 A;  1DOM A;  3K5O A;  1TS5 A;  3N52 A;  2ZXP A;  1M8A A;  3HKZ B;  1OXV A;  1U4P A;  2KHS A;  2B63 B;  4CKC A;  2EOT A;  3GTQ B;  2CW0 D;  3QJY A;  3SEB A;  1A2U A;  2EYL A;  4G57 A;  4DFA A;  1O7Y A;  3RLF A;  1PFB A;  1PTO F;  4DF7 A;  2EPB A;  1F2M A;  2L12 A;  3NSW A;  1UUP A;  4FP5 D;  1O7L A;  4A3K B;  4WJW A;  1A15 A;  1SE2 A;  2J4X A;  1AW7 A;  3VA7 A;  3H91 A;  4HR7 B;  2K7V A;  3NTH A;  1B3A A;  1O7Z A;  4HMI A;  1JOQ A;  4C2M B;  1WVL A;  2ID0 A;  1SBB B;  2FMC A;  3T56 B;  1EY9 A;  1MD2 D;  2ZXO A;  3LWU A;  3GP7 A;  1IW7 D;  2XVS A;  3S1Q B;  4BA2 I;  3S9W A;  3V2T A;  2BE5 D;  1STY A;  4KY7 A;  5KND A;  1LLR D;  1Z47 A;  2KJX A;  3D4W A;  1YNN C;  3MXP A;  1F9Q A;  4R9W A;  3A8I E;  4FF4 A;  1SNP A;  4FYD A;  1JC7 A;  2HCI A;  4N9T A;  4V0B A;  1JQY D;  2F03 A;  2PQE A;  2WII B;  2F0L A;  2FIN B;  1IHZ A;  5FKA C;  5CV9 A;  4XXE A;  1EYC A;  2F0Q A;  5M9O A;  2KEC A;  4ZKC B;  5JOB A;  3Q0A A;  5EGT A;  1CA5 A;  3DWA A;  3UI2 A;  4KY5 A;  1Q12 A;  2EYM A;  2A68 D;  1R4P B;  1WCM B;  1H9J A;  1FD7 D;  4IUT A;  5M5W B;  1TWH B;  3TN2 A;  1STB A;  4KKS A;  1Q8I A;  2HUG A;  1JOO A;  5CMD A;  3IL8 A;  2EY2 A;  3K5L A;  2F0I A;  3OIQ A;  2ZXR A;  1B9N A;  3I4N B;  1XXG A;  3X3M A;  1PTO B;  1EIG A;  1EY0 A;  1EZ8 A;  2B2W A;  2EY5 A;  2NTT A;  4XT1 B;  3C1F A;  1V43 A;  1Q1E A;  1EQT A;  4BS9 A;  4DAV A;  5E4X A;  3M4O B;  3KBG A;  1B50 A;  2SEB D;  1PTO D;  1HA5 A;  3DWQ A;  1NR2 A;  1W6J A;  1SE3 A;  1I4R A;  1QB5 D;  1ESF A;  3NE5 B;  1B2T A;  1SNQ A;  2WKC A;  5G3L D;  1PLF A;  1LT4 D;  1U4M A;  4A3M B;  3ZYY X;  4C3H B;  2BA0 A;  2KED A;  1OXX K;  3F2U A;  4E6I A;  1SDF A;  3KUP A;  1ICW A;  2LS0 1;  2EE1 A;  1HFG A;  3EFX D;  3PUW A;  2VB2 X;  3CU7 A;  4C1N K;  4F88 A;  5JEA G;  4CKB A;  3MTS A;  3TP5 A;  1A6X A;  4G7Z C;  1HA6 A;  5I9P A;  5JJZ A;  3QG1 A;  3RD4 A;  4XQJ A;  4RGN A;  3C46 A;  2QIL A;  4IUQ A;  5C4Z A;  4OO1 H;  1WTV A;  3QIA A;  3FEW X;  1PMR A;  4B08 A;  2GA4 B;  2JE6 I;  1BNZ A;  3EJI A;  2K5D A;  2NYZ D;  4JBW A;  1TII D;  2XN9 C;  1TR5 A;  4A3G B;  1V1O A;  4HSP A;  5D3D A;  1ENC A;  4HED A;  3PO2 B;  3SK5 A;  2NVY B;  1Y8N B;  2R6G A;  2MP1 A;  1TU2 B;  2PNR C;  1Q1B A;  2ICE C;  2KVM A;  1BCP C;  2RVL A;  4LK1 C;  3PMF A;  2PPB C;  4Z9C B;  3AB9 A;  3A7L A;  1VF7 A;  1QG7 A;  4P2C B;  1VMP A;  3HZX A;  3FDT A;  3CQZ B;  5EKK A;  2IX3 A;  2NZ1 D;  4M1U B;  1S5D D;  4KMU C;  2IJ0 A;  3D8G A;  4H0L C;  4CJ1 B;  4IUP A;  4LMQ D;  1KAA A;  1D1K A;  1BQQ T;  5C3E B;  3PO3 B;  3P7J A;  3WDN A;  5F2D A;  1VMC A;  1EY4 A;  5EJW A;  3HOV B;  5TSS A;  2A73 B;  5HGT A;  3D31 A;  5M5X B;  1AZQ A;  1ZYR C;  3T16 A;  4KJO A;  4IQZ A;  1DXM A;  4IUR A;  1QOH A;  3PIO 3;  4RHR A;  1F77 A;  1R4Q B;  4RH6 A;  4X3K A;  1CZW A;  1K83 B;  1GHJ A;  2MHV A;  3NUC A;  1S5E D;  2L4N A;  2EYP A;  2A6H C;  4HCS A;  4KN7 C;  4B9X A;  4A3J B;  4IFD I;  2KOL A;  3J81 E;  5LL6 X;  3EQL C;  3DEO A;  3A56 A;  1A3U A;  1PRT D;  1ET6 A;  3S1N B;  3DEP A;  3V05 A;  4RGT A;  3ND9 A;  4PV1 C;  4PQX A;  2VNU D;  5HUR A;  5EKL A;  1CZG A;  1GUW A;  4F87 A;  2XWJ B;  5IGB A;  4IAL A;  2WAQ B;  3CRK C;  1DJR D;  4KK7 A;  5J1Z A;  3C1E A;  1SYG A;  1HRJ A;  3QB3 A;  5COR A;  1SMY C;  3D4D A;  3MA2 B;  3M3Y B;  2L5T A;  3W3A A;  3WOE A;  2F0D A;  3GO5 A;  1BF4 A;  2N88 A;  4XTC S;  3Q23 A;  1BDO A;  4H13 C;  1B9M A;  2LFN A;  4LAA A;  5FLX E;  3GQB A;  2K32 A;  1X32 A;  2AQ2 B;  3OWF A;  2PCF B;  5JAV A;  1ML0 D;  1Y1W B;  2RDG A;  1GUG A;  3KK7 A;  4XYO A;  2BDN A;  1HCZ A;  2A5H A;  2M00 A;  1MSH A;  2SNS A;  4KKU A;  3SHL A;  2PO4 A;  3QWN A;  1EU4 A;  4J1M A;  5JVG 3;  2SNM A;  4DA2 A;  3M4Y A;  1UNS A;  5JEA J;  3P20 A;  4RKB A;  3K58 A;  2JYO A;  2E76 C;  1BCP D;  4HSV A;  4DGZ A;  1LAB A;  3FPU B;  3HEJ A;  4IZ8 A;  3BG3 A;  3J81 L;  2EJM A;  4ID6 A;  2A69 D;  2JP1 A;  1II3 A;  1EY5 A;  1E2W A;  2N55 A;  5KNC A;  1ESR A;  5EQ0 A;  3SR1 A;  4A3E B;  1STH A;  1ILQ A;  3BDO A;  4OO1 G;  1TY2 A;  1CM9 A;  4NDX A;  3GD7 A;  4UDU C;  2B2W C;  2AWN A;  2K28 A;  5ELB A;  1C8C A;  3MC0 B;  2B2U A;  1WTO A;  4BY7 B;  4R8N A;  3R8B A;  2Y0S B;  3VA5 A;  1CQF A;  1GUN A;  2BDO A;  4BBR B;  1B44 D;  2DNE A;  1SAP A;  2KUM A;  2MGS A;  1J9O A;  4DK0 A;  4YIJ A;  5FOB B;  2AUJ D;  5T1I A;  3TZU A;  1JR0 D;  1OO9 B;  4ZQ3 A;  4RA8 A;  2RQX A;  4K14 A;  1NAP A;  3G7L A;  3M7G A;  1EYA A;  1SXT A;  3PUV A;  1QWY A;  2K6A A;  2L55 A;  3OPO A;  2CQA A;  4I7Z C;  1CHP D;  5CBE E;  1UEA B;  4Q0F A;  1RTO A;  2F0V A;  2CVR A;  2A74 C;  1NCV A;  2DY7 A;  5C0X G;  1ENA A;  4X3T A;  2J7Z A;  1ET9 A;  3MWY W;  3D3R A;  3H3V C;  3ND8 A;  3OSO A;  1BUV T;  1PYW D;  1Z6H A;  4DXF A;  3J7A V;  1SMY D;  4FXG C;  3DUZ A;  3GV3 A;  4MHE A;  2EYH A;  2XNA C;  1ENF A;  1OXT A;  2F0T A;  2KA7 A;  3P1H A;  4G4K A;  2JA5 B;  3GTO B;  4XQN A;  3GTM B;  2M2L A;  1LTR D;  1FR3 A;  3BS1 A;  1IL8 A;  3SK6 A;  5KYI A;  1KNE A;  4X3S A;  1V8Q A;  4A3I B;  1MBY A;  1F2Z A;  3E6Z X;  3NTI A;  4I65 A;  2EJG C;  2B2Y A;  3I91 A;  3MFY A;  2RDH A;  2F0K A;  1FNU A;  2IT1 A;  3HGB A;  5C5M A;  2TSS A;  3Q24 A;  1K8M A;  5COY A;  1TQO A;  2WB1 B;  1KNA A;  2V4D A;  3MEH A;  1HHV A;  1RTN A;  1QIL A;  1YNN D;  1VCI A;  1JOK A;  3MXU A;  2F0P A;  2Q8R E;  1AFP A;  2R61 A;  3EA6 A;  1BOS A;  3S16 B;  3TDQ A;  2EYJ A;  2PZU A;  5BN3 A;  2Z4H A;  1DD2 A;  5IGE A;  3A54 A;  5E3F A;  3SK4 A;  1G91 A;  2BA1 A;  1EEF D;  1EOT A;  1M4V A;  3SVM A;  1T5X D;  2X6L A;  3MVV A;  3S1R B;  4J6H A;  5ELE A;  4ZKB B;  2PMZ B;  5CC4 A;  2PW7 A;  1S4Z A;  1WTQ A;  1PZI D;  2FHT A;  3K5M A;  1SFO B;  2XRS D;  2XWB B;  3CRL C;  1BO0 A;  1JCK B;  2Z4I A;  1YNJ D;  2KQ3 A;  3E5S A;  1BXT A;  5C4H A;  1ZYR D;  5IGF A;  2B39 A;  2MUY A;  1EFI D;  1G6Z A;  4KHZ A;  5FK9 C;  1SJH D;  3MHB A;  5CV5 A;  1Q90 A;  4UAI A;  2EY1 A;  5EPL A;  4IUU A;  5I9O A;  5IGG A;  3BDL A;  5E1F A;  5FLX L;  2XIW A;  3NWS A;  4Y7N B;  1WD0 A;  3VYR A;  4KV6 A;  5ELF A;  3I3C A;  3DXJ C;  1R9T B;  2FFK B;  4GZY C;  3L9A X;  2K5Q A;  4KTA A;  1DM0 B;  3C2P A;  5EKI A;  2X6G A;  5D3I B;  3WOF A;  4DAY A;  1QCB D;  2SOB A;  2FJ2 A;  3A8J E;  2LMC B;  3IAY A;  4PMB A;  4DN4 M;  3R2T A;  1D1I A;  4XDX A;  3Q22 A;  1F9S A;  4IUN A;  3M85 A;  1AZP A;  1D6E C;  4B9W A;  2E75 C;  2E2D C;  2R92 B;  4S3S A;  1BBX C;  1KAB A;  2EDG A;  5A2Q L;  1RF2 D;  1D2B A;  1RHP A;  4L63 B;  2L1B A;  4OIK A;  4QUC A;  4OIJ A;  1D5X C;  1HQM C;  2RA4 A;  3DHQ A;  4RFB A;  5ELC A;  1V1P B;  2F0J A;  4KI0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...