2Z1GA

Crystal structure of e.coli rnase hi surface charged mutant(q4r/t40e/q72h/q76k/q80e/t92k/q105k)
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
155
structure length
155
Chain Sequence
b'MLKRVEIFTDGSCLGNPGPGGYGAILRYRGREKTFSAGYERTTNNRMELMAAIVALEALKEHCEVILSTDSHYVRKGITEWIHNWKKRGWKKADKKPVKNVDLWKRLDAALGQHQIKWEWVKGHAGHPENERCDELARAAAMNPTLEDTGYQVEV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease HI
publication title Protein Thermostabilization Requires a Fine-tuned Placement of Surface-charged Residues
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 48
structure length 155
sequence length 155
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2007-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2z1gA00
2VG7A 4CFDA 4DQPA 1D9DA 4CK2A 3KTQA 3C95A 4CF9A 4DQSA 4B9MA 1FXXA 3DOKA 1RDCA 1HPZA 3VN5A 4E7LA 1WAFA 4Z4CA 3CYMA 4DTMA 1Q8IA 4ELTA 4ELUA 4OKEA 4JRPA 1J9AA 4FLWA 1UA0A 1NKBA 1Q9XA 1TAQA 4BWJA 2PZSA 2OPQA 4OPKA 1XWLA 3NE6A 4GW6A 1D5AA 4CEOA 2AJQA 1RT4A 2XO7A 4HUEA 2YV0X 3AA4A 3AVAA 3QNNA 3PX6A 1WLJA 2OPRA 4BACA 1NKCA 3IAYA 2B5JA 3DLBA 4CJ5A 4E1MA 3AVLA 4CJQA 1S6PA 2GV9A 1KLMA 3L2RA 1JLCA 4C8OA 4FZZA 4CIFA 1CZ9A 2Z1JA 1KVBA 1UOCA 4DTOA 3F9KA 4CJ4A 4Q0BA 4DTUA 3IRXA 3OYHA 4H4OA 3ITHA 2O4IA 5I3UA 1B9DA 5C25A 1L3VA 3SNNA 4E89A 3VQCA 4DFMA 3AA3A 1TL1A 1X9WA 4N56A 3DLEA 4M3ZA 4EP5A 1NJZA 5D3GA 5FRNA 2PY5A 1KRPA 4L8RB 4PWDA 1RT3A 3ZT2A 1NK7A 2DFFA 2OPPA 4CEBA 3PY8A 3KLIA 3SI6A 1BIZA 1GOCA 3S3NA 2P1JA 1BI4B 4LH4A 3PV8A 1JL2A 4HVJA 3DLKA 3LP2A 4FJXA 4B08A 2HHXA 3OY9A 4OLBA 4AHVA 4NYFA 4DFJA 2KZMA 1BL3A 4RW8A 3AO4A 3L3VA 4FM1A 3WNGA 3P1GA 4F2RA 4CF2A 1RILA 3OYBA 4DFPA 4FJJA 3ZSOA 2XHBA 1LV5A 1CXUA 4DTPA 2FBVA 1HYSA 3S3OA 3LP0A 3EY1A 1LW0A 4IBNA 3MEEA 3RMAA 2G8WA 1X1PA 2FBXA 2HHUA 3L2VA 4DTJA 3MXIA 4E7IA 1HQEA 2X6NA 4CK1A 3O4QA 3OYEA 3LZJA 5C24A 3RMBA 4DWIA 1VRUA 3AVFA 3ZSRA 3I0SA 2KQ2A 1VSEA 3PUFA 1WSFA 5J2QA 3KK1A 2XY7A 1W9HA 3TI0A 2EHGA 1RT7A 3DYAA 3G10A 5JS2A 5C42A 3SPYA 1JLFA 3K57A 3SQ1A 4M45A 3QIOA 4F8RA 3M8RA 4O4GA 3AV9A 3U3GA 4NCBA 2D5RA 2KFZA 3NDKA 3V9WA 4N41A 4FJHA 2IS3A 3HJFA 5JS1A 2WOMA 3P83D 4BDZA 1BI4A 3TABA 3OYMA 3OVNA 1NJWA 1KVAA 2YHAA 1HYZA 1Z25A 3D45A 1RT2A 3VQAA 3RRHA 3SUQA 4CGDA 4CHYA 3NH2A 3SUNA 1T03A 4J2DA 4CJKA 4IFVA 2OA8A 4FJ9A 2YKMA 1LWFA 3I8DA 3MEDA 4DSFA 1JL1A 4Z4GA 3AVKA 3PX0A 4O0IA 3RR8A 4QCLA 1RT1A 4NCGA 4DU1A 3TAGA 2RN2A 4FJIA 1X9SA 3K58A 3AVMA 1KTQA 4H8KA 4CEZA 4BDYA 4AHUA 4RW7A 3JYTA 3QNOA 4CEQA 2BANA 4IG3A 1TL3A 3DOLA 1F21A 1NK0A 3JSMA 1FK9A 1EETA 1HNIA 5FRMA 1A5XA 1RDAA 2VG6A 3HL8A 4E7KA 4N47A 3AA5X 4ELVA 3NF8A 4Y1DA 5FDLA 4JRQA 4FCYA 3TAMA 3DRSA 3L8BA 4CGGA 4E3SA 1TK0A 2P5GA 4JS4A 5I42A 1R0AA 2G8IA 2IGIA 2F8SA 1CXQA 1RNHA 2P51A 3QEWA 2DFHA 3HP6A 3TARA 3RMDA 4FLZA 4E19A 3KK2A 1HNVA 3T3FA 3AVJA 3HPGA 5FROA 3L3UA 3V9XA 3NF9A 1U49A 4AHCA 3HYFA 1NJXA 4J2BA 2FBYA 1TVRA 1T7PA 4I9QA 1HJRA 3VQEA 3OS1A 2YNHA 2ZD1A 3ZSZA 4CFBA 3RTVA 1SKRA 1DTTA 4DG1A 1C1AA 3SUPA 4BE2A 3HM9A 4ZTFA 4FLXA 3HPHA 3IG1A 4W5TA 4N5SA 3SUOA 4G1QA 3V1RA 3KKSA 2FBTA 3NF6A 3LP3A 4CJ3A 2YNGA 2G8FA 4CJPA 4F3OA 4KI4A 3WNHA 2YHBA 3TANA 1QS4A 2Z1GA 3NH0A 1D9FA 4FJMA 1TKXA 1ZBLA 2ETJA 5KI6A 1TGOA 3THVA 3QESA 1NK8A 3ALYA 1VSJA 1ASVA 1WSHA 4CJUA 3OYDA 1KSPA 1RT6A 4Z4EA 3MXJA 1WN7A 3ULDA 1C1BA 1I39A 4KI6A 4I2PA 3NAEA 2XY8A 4Z0UA 1A5VA 3SJJA 2D0BA 3OJSA 1BHLA 4FJNA 4CERA 3OYGA 4OJRA 4DLEA 1YT3A 4KO0A 3P5JA 3NHGA 4LY7A 1BCOA 4DSJA 1VSDA 4FLVA 4OGCA 4FK2A 4CJFA 1T05A 3CM6A 4CK3A 3DLHA 3VQBA 3VQQA 4CJWA 4FJLA 4CIGA 1C0TA 4I2QA 2HW3A 4B3OA 3QLHA 4KAZA 3A2FA 4CHQA 4AHSA 1NOYA 4B9LA 4FYDA 4W5NA 4JLHA 3OYFA 3KJVA 1K6YA 3FFIA 5SWMA 3KLHA 1U47A 2P5OA 1BGXT 1C0MA 3AO5A 1J53A 4TSXA 2HNDA 1WAJA 1LAWA 2KW4A 2ITGA 3LANA 2B4JA 4FJ7A 5HRPA 2RPIA 1HYVA 4DQIA 4KB1A 3TR8A 4FLUA 1VSKA 1YVUA 4FW1A 4DQQA 1JLBA 3S9HA 1EXQA 4DSEA 1S9EA 4FJ8A 4H4MA 3K59A 1FKOA 3B6OA 5HLFA 1RTDA 4KRFA 3KIOA 4B9NA 1ITGA 4OKKA 4IG0A 2KFNA 3L2UA 2GUIA 1QSYA 3OYIA 3O4NA 3OYLA 1QTMA 4K8ZA 4FZYA 1RDBA 3LDSA 3SCXA 2X6SA 4KHUA 2ATQA 2G8VA 5KTQA 1IKYA 1JLGA 2DFEA 2OPSA 3TAFA 3SQ2A 3AVCA 4B8AB 4CF1A 4HCCA 2O4GA 2WONA 2ZQBA 1BISA 3LP1A 3T1AA 4Z4HA 4ZTJA 4FJKA 5CYMA 3PO5A 3O3FA 3U3YA 2A1RA 3VA3A 1UWBA 4XIUA 1N5YA 3QEVA 2G8HA 4QOZB 2HNYA 1QHTA 1BCMA 1LWCA 4AILC 2B6AA 1B92A 4KKOA 2ZE2A 4O5BA 1VSMA 1JXBA 4C8NA 3CFRA 3TAEA 4F2SA 3V9ZA 4GVMA 3SV4A 2F8TA 2HHTA 3PO4A 4CHPA 2QKBA 4C8KA 2X78A 5CZ2A 3ZT4A 1L3UA 1BIUA 5DK5A 4W5QA 4B9TA 1BQMA 2DTUA 1O1WA 4CCHA 2OZSA 1RCHA 5HROA 3OYJA 3SPZA 4OLAA 4CF0A 3ZT0A 4EP4A 1KCFA 2D0CA 5HP1A 3M8PA 3RR7A 1RBSA 3AVIA 4C8MA 3K5OA 1SKWA 3KD5E 4CHZA 1S9GA 3WNFA 1C0UA 4CFCA 3TWHA 4LSLA 4DF4A 4PQUA 4LD0A 5K14A 4CEFA 3IS9A 4HTUA 4AHTA 1I3AA 1RDDA 1DLOA 1VSFA 3KLFA 4BE0A 2Z1HA 4FW2A 4DU4A 3C94A 2PYJA 4FXDA 1KFDA 3RWUA 3V1OA 1XI1A 3C6TA 3QEIA 3SQ4A 4CJEA 5KRTA 5HBMA 2R7YA 1IG9A 4HUFA 1B9FA 2D0AA 3NGYA 4Q5VA 1RBRA 4K8XA 4OGEA 1DTQA 4B9VA 1D8YA 4CGHA 2YNIA 3ZSWA 1S1UA 1U48A 4Z4IA 4I9LA 1REVA 3L2QA 2VWKA 1U04A 3HXMA 4CJTA 3KKRA 4I7FA 3SZ2A 1IKXA 1S1TA 4CEDA 3OJUA 3S3MA 2OYQA 4HUGA 4M3UA 3HO1A 2XY5A 2W42A 3DLGA 4HCBA 2HHSA 1RTIA 3AVHA 4RW4A 1XHZA 1N6QA 1J5OA 3TAPA 2HHQA 4FM0A 2F96A 3LAKA 3DRRA 3DMJA 1J54A 4E7JA 1S6QA 3ZCMA 1SL1A 4KPYA 4M3WA 2HHVA 3RRGA 4CGIA 3RMCA 2HNZA 2IAJA 3VQ7A 3LWLA 4DTNA 3LPUA 1L3SA 4PUOA 2IC3A 4OVLA 1VK0A 3AO3A 1RBTA 4KHWA 4O55A 3V9SA 2DY4A 4WE1A 4AHRA 2QK9A 4YNQA 3LWMA 3VA0A 3V9UA 1VRTA 4FZXC 3K5MA 4PA1A 4BE1A 5J2MA 2HVHA 4UQGA 5HRNA 4E7HA 4N76A 1X9MA 1RBVA 3ASMA 4MFBA 2RF2A 3HP9A 4KREA 1Z26A 4HHTA 4KTWA 3LALA 4BWMA 2VWJA 4KHSA 4RW9A 1NK9A 4IKFA 3BDPA 3DLRA 3M8SA 4O0JA 4LSNA 4FLYA 3SV3A 4CEEA 3CQ8A 1EKEA 3AVBA 1RT5A 3AA2A 5SZTA 1IO2A 1TKZA 4QAGA 2E6LA 3C6UA 3V1QA 3O3HA 4BDPA 4DLGA 4M3YA 3KLGA 4KHYA 3DI6A 3OYNA 3KLEA 3HVRA 3K5LA 3HK2A 4CJLA 5J1EA 2A1SA 4DMNA 1CZBA 2YKNA 3OS0A 4F4KA 4ID5A 4FJ5A 1UA1A 4PY5A 2PYLA 3NFAA 4NYNA 4NCAA 3ZT3A 2JGUA 3EYZA 4B8CA 5KRSA 1NKEA 1Y97A 3CFOA 3HSTB 4DFKA 4DF8A 2HMIA 4M41A 3KK3A 2BDPA 3QINA 3MECA 2IDOA 4B9SA 4DSIA 4M3XA 3DM2A 3ZSXA 1C1CA 3VQPA 4CJRA 4JS5A 4FJGA 4CECA 1IKWA 3I0RA 3QERA 1QSLA 2XY6A 3CM5A 3F73A 1W0HA 1VSHA 3OYCA 1ZBIA 3E01A 1L3TA 4AH9A 3D0PA 4IFYA 3VQDA 4W5OA 1SV5A 4GMJB 5DMRA 4DSKA 3O3GA 3QIPA 4KTZA 1ZBFA 3ZSYA 3HT3A 1U4BA 1NJYA 2KZZA 3AO2A 4YFUA 2KTQA 1LW2A 2E4LA 4J2EA 3UIQA 1QE1A 3PX4A 2I5JA 3G0ZA 5KGXA 1T8EA 3VQ4A 2HHWA 2FC0A 2NUBA 4CHNA 2XRIA 1VSIA 1NK6A 4CGJA 3TAQA 3VQ6A 3U6FA 5J2NA 4FLTA 3V81A 1EX4A 2QKKA 3WNEA 3V4IA 4J2AA 4KFBA 4O44A 2YNFA 4KTQA 1JXEA 2EX3A 3DRPA 1QSSA 4CF8A 1ZBUA 2VG5A 4F3TA 4DTSA 4ICLA 1XHXA 1G15A 4CESA 4DU3A 4KB0A 1NOZA 1CLQA 3AVNA 2Q3SA 1ZBHA 1ASUA 1UAXA 4FK0A 1HRHA 3VQ9A 2Z1IA 2LSNA 4EZ9A 1SL2A 1YTUA 1VSLA 2JLEA 3AO1A 4ID1A 4CE9A 4R5PA 2E6MA 5CZ1A 3OS2A 1RTJA 3SQ0A 2BE2A 1RBUA 4OKJA 3LAMA 5EU7A 2X74A 3KD1E 4Y1CA 1TAUA 4KV8A 3K2PA 1ASWA 4IDKA 1JLEA 1Q9YA 3NH1A 1NK4A 1LWEA 1JLAA 4B9UA 2QXFA 1U45A 4LH5A 4CGFA 3HPOA 4DQRA 1FKPA 1IKVA 3T19A 3QEXA 1S1WA 1ZYQA 1C6VA 3CFPA 3ISNC 3H08A 1KFSA 3VQ8A 2RKIA 4M3TA 4FK4A 1QQCA 4KHQA 3BGRA 1WSGA 4DS4A 4MQ3A 5T7BA 4DS5A 3QETA 1TKDA 4CFAA 1GOAA 4E1NA 4RW6A 1WSEA 3QO9A 1TV6A 4CEAA 1S1XA 5HRSA 3LZIA 2OZMA 4CHOA 1TKTA 4M3RA 3VQ5A 3ZSVA 4KHNA 5KGWA 2BGGA 1EP4A 1GOBA 2G8KA 3ZSQA 3NF7A 1BQNA 3QEPA 1SUQA 1S5JA 3ZT1A 3MAQA 4CJSA 4CJVA 3LPTA 3NGIA 1SL0A 1HMVA 4DSLA 1SKSA 4E0DA 4ZHRA 1JKHA 1XC9A 5E41A 3M8QA 4EZ6A 1S1VA 3L2WA 2Y1IA 4DTXA 1A5WA 3B6PA 3CG7A 5CY4A 3NCIA 1KLNA 4OPJA 3V6DA 3NBPA 4FVMA 3NGZA 1IH7A 1KVCA 1JLQA 4RG8A 3HVTA 4CIEA 5J2PA 3MXMA 2IOCA 4DTRA 1L5UA 1WNSA 1WSJA 3EZ5A 3MEGA 2G8UA 5HRRA 2HB5A 4FM2A 1HQUA 4Z4FA 4W5RA 3SYZA 1TK8A 3AVGA 3OYKA 1WSIA 5CYQA 1NK5A 1LAVA 1TK5A 1YTAA 4C8LA 2HVIA 3OYAA 1RTHA 3K5NA 4M42A 2GBZA 1MU2A 2Y1JA
chains in the Genus database with same CATH superfamily
4DV7K 4OO1J 3DOKA 2A5XA 1BG3A 1WAFA 5AQKA 5I9EB 4DTMA 1Q8IA 4ELTA 3AARA 1UA0A 3T69A 4BWJA 2OPQA 5AQPA 4OPKA 4GW6A 4LF8K 4XH5A 3PX6A 2E5LK 3FLCO 2QM1A 2GV9A 2H3GX 4C8OA 1WBDA 1KVBA 1UOCA 4Q0BA 5AQUA 1WB9A 5I3UA 5C25A 4E89A 3VQCA 1XQSC 5TKYA 3RVCA 4ILGB 4PWDA 1RT3A 3O9RA 1N8RO 3SI6A 4RCHA 3A5LC 5E26A 2HHXA 3OY9A 4AHVA 4FM1A 3VGKA 3THWB 1NLVA 3PSFA 4RTFD 1RILA 3MN9A 4FJJA 3ZLJA 4M63C 1CXUA 2FBVA 1X1PA 4FWSA 5BR8K 3MXIA 4CK1A 3O4QA 3AVFA 2QWLA 3I0SA 3PUFA 4H0XB 5J2QA 4ISFA 5GINA 2EHGA 1RT7A 3DYAA 2P9IA 4WFAL 4M45A 3M8RA 3AV9A 1NGIA 2KFZA 5M1OA 4FJHA 5AQWA 2FLOA 2WOMA 3TABA 3D45A 3VQAA 3SUQA 4CHYA 3NH2A 3TSUA 5AQZA 4IFVA 3G71N 2OA8A 2YKMA 3I8DA 4H0YB 4X66K 3RR8A 4GV6A 4BQZA 3TAGA 4DU1A 3HTVA 1X9SA 3K58A 4AHUA 3QNOA 5BRFA 5FRMA 5JVHL 1FK9A 1A5XA 3HL8A 5E84A 3VF2A 4BR9A 3NF8A 1IJJA 1IG8A 3JAMO 2P5GA 2YX6A 2F8SA 1CXQA 3IMXA 1RNHA 4BC4A 5JLHA 3TARA 3CCLN 3CCMN 3HSCA 1E4FT 1VQPN 3T3FA 3AVJA 3V9XA 1U49A 3NF9A 4AHCA 3EKUA 1Y64A 3OS1A 4CFBA 5M1NA 3E1YA 3SUPA 4FLXA 4W5TA 2ASMA 4N5SA 5LJWA 3C6AA 1K8KA 2YNGA 5ADXH 4F3OA 4KI4A 2YHBA 2KHOA 4FWPA 5C0YA 1NK8A 4M7YA 1ASVA 5M1PA 1RT6A 3MXJA 3CXCM 4BROA 1SQKA 4IOAL 1BHLA 4DLEA 3P5JA 3BY5A 4LY7A 3D2EA 4OGCA 1U6ZA 1X9JA 3DLHA 5LL6Z 4CJWA 5DM7L 4FJLA 4YDUA 3TTFA 4JKCA 5GAGP 4W5NA 4B9LA 1HUXA 4JLHA 5AQRA 2UYTA 1BGXT 3IKMA 3A5NC 1LAWA 2KW4A 3LANA 4KB1A 4FWMA 1YVUA 1WUAA 4BVPA 1EXQA 1XMOK 1RTDA 3DXKB 4IO8A 2GX9A 3VEWA 2KFNA 2OTJN 3LDOA 4DV2K 3O4NA 3OYLA 1QTMA 4FZYA 1BDGA 4AM6A 2ATQA 4JI2K 1JLGA 3TAFA 1YI2N 3T1AA 5GAHP 4EFHA 4GY2B 3O3FA 3OTOK 3GBTA 2A1RA 1N5YA 1QZ5A 4BR0A 1QHTA 1LWCA 1BO5O 4O5BA 4BRGA 2BH1A 3UKRB 4CI6A 3V9ZA 1NGBA 1Q86O 4C8KA 2IIRA 5CZ2A 4FWKA 3WXLA 4W5QA 3C7NA 1BQMA 4FWNA 1RCHA 3E66A 3EO3A 1OH7A 3ZT0A 4EP4A 3AVIA 3K5OA 1T6DA 5F1XA 3WNFA 2BTFA 4DKWA 2UUCK 3GG4A 3LDPA 2P9SB 1RDDA 4DU4A 4CBXA 2PYJA 2NRRA 3V1OA 1XI1A 4CZHA 5ELZA 3JXUA 3EKSA 3SQ4A 1IG9A 1GLAG 5KRTA 2R7YA 5FPMA 4JYAK 2D0AA 4Q5VA 1RBRA 1NG9A 3GDQA 4CGHA 3ZSWA 1S1UA 2GELA 3CJ7A 4WCEL 2QA4N 1U48A 1IBLK 1VQ8N 2HF3A 2UUBK 2VWKA 3HXMA 4CJTA 1IKXA 3E9LA 3S3MA 3T1HK 2OYQA 3GE1A 2HHSA 1RTIA 2A3ZA 4RW4A 4ISEA 4BGBA 1SL1A 4E7JA 3Q7CA 4IOXA 4CGIA 3RMCA 3LWLA 3VQ7A 3LPUA 4PUOA 4XEIA 1RBTA 2UXCK 3V9SA 5AQGA 4B3RK 3LWMA 4BE1A 4CZJA 1VQKN 2Q36A 4N76A 4LF4K 3MK6A 3MWPA 3HP9A 3LALA 3LDLA 4O5FA 4PKHA 4O0JA 4MO4A 4ISGA 4K25A 3CQ8A 4LF7K 1C0GA 3AA2A 5SZTA 2P9PA 1TKZA 4QAGA 3C6UA 3G6EN 4M3YA 4DR4K 3LL3A 4BR2A 3K5LA 4UY8O 4F4KA 4DMNA 1CZBA 2YKNA 4H5RA 4NYNA 3HSTB 4M41A 3MECA 1YF5L 4M3XA 3DM2A 2QWMA 4FJGA 4CECA 3I0RA 3QERA 1VQ7N 3E9OA 3HM8A 4B1YB 2XY6A 4BRLA 4IWVA 3O9SA 1ZBIA 2ZJQL 1XMQK 3HZ6A 3VQDA 4PKGA 4GMJB 4H5VA 2O8EB 2ASOA 1ATNA 4KTZA 1ZBFA 3HT3A 2NNWA 5AQLA 2HF4A 2KTQA 1LW2A 4FWOA 4EHTA 3PX4A 2HHWA 2XRIA 1VSIA 4BGAA 3VQ6A 5J2NA 3V81A 1EX4A 3V4IA 4KTQA 1JXEA 1QSSA 4O8KA 1EWRA 4ICLA 3M1FA 2AA4A 5GIPA 2Q3SA 1HRHA 5JMVA 1RGIA 2LSNA 2Z1IA 4PL8A 5F0XA 3GL1A 4CE9A 5CZ1A 3P38A 1RBUA 3H3OB 4B3SK 1LWEA 1JLAA 4CD3A 4B9UA 3T19A 4CZGA 1S1WA 3CFPA 3ISNC 1ILYA 4DR6K 3BGRA 3QETA 3MX5A 4E1NA 4GKJK 4OPAA 1WSEA 4I6MB 3QO9A 3MN7A 3QICA 5HRSA 1C0FA 2G8KA 1GOBA 3ZSQA 2F9TA 4JKEA 3NGIA 4DSLA 4ZHRA 1XC9A 3M8QA 1NGGA 4DTXA 1A5WA 3ENHA 3NCIA 3V6DA 3L4QA 3NBPA 1JLQA 4JV5K 5J2PA 1VQ4N 1R59O 2YHYA 2O8DB 3KK7A 3QBWA 1TK8A 3AVGA 5CYQA 1NK5A 1LAVA 2ASPA 3A8YA 1TK5A 3QDKA 2P9KA 1NBWA 2W40A 3QFPA 4CFDA 1D9DA 4LF6K 4RWTA 3DXMA 4B9MA 1FXXA 3VN5A 1HPZA 2KKZA 3CCRN 1VQ6N 4YORA 3UB5A 4OKEA 1J9AA 1NKBA 2E2PA 3ID8A 1Q9XA 2PZSA 3NE6A 4CEOA 1RT4A 2XO7A 3CJCA 4HUEA 2Q97A 3IAYA 1WLJA 2OPRA 1NKCA 3DLBA 5F2RA 5IWAK 4E1MA 4QS9A 4CJQA 1OKJA 4LFAK 3K9JA 4H03B 4IEIA 5AQVA 4FZZA 5AQHA 3FZMA 1CZ9A 1DGKN 4DTOA 3F9KA 5BRHA 3LDNA 1L3VA 3J7YP 1N33K 4DFMA 3AA3A 4N56A 2ZM6K 1NJZA 2PY5A 4CBWA 4L8RB 2DFFA 2OPPA 3ZX2A 1BIZA 2ZGYA 4X65K 1W7AA 1VQLN 5GIOA 3LP2A 1TYQB 4OLBA 4FOEA 4DFJA 1Q18A 4RW8A 3L3VA 3P1GA 3VESA 1QHAA 4JI6K 3ZSOA 1HYSA 1LV5A 2NRZA 4DTPA 1LW0A 4IBNA 3MEEA 3L2VA 4E7IA 3LZJA 3TPQA 4JD2B 2V7ZA 4DWIA 1VRUA 2KQ2A 4IEEA 3SPYA 3G10A 3PSIA 3THXA 3SQ1A 3U3GA 3FGUA 1NGAA 2W6LA 5JVGL 1VAZA 1QQOA 3UE5A 1S72N 3P83D 2HOEA 1BI4A 3OW2M 4L3QA 1Z25A 3RRHA 2ITMA 4CJKA 3CIPA 3MEDA 2GWJA 3I33A 4B9QA 3PX0A 4O0IA 4FJIA 4A57A 4OPHA 2E2NA 3D6RA 4IFEA 4DV4K 4CEZA 3RSEB 2BANA 4IG3A 1NK0A 1HNIA 1EETA 4DHYA 2YHWA 5FDLA 5JLFA 3DRSA 4V19S 3MX2A 1R0AA 2G8IA 2FF6A 4GVEA 3QEWA 3KZBA 3SMSA 1HNVA 3ATVA 3HYFA 2HBKA 4B1ZA 1NJXA 3FZLA 4J2BA 4IXCA 1V4SA 3RTVA 1P8ZA 2E88A 4DG1A 3FZHA 3J81O 4BE2A 4ZTFA 4NLBA 2FBTA 4DV1K 3LP3A 2G8FA 1QS4A 2Z1GA 3BZKA 2ETJA 1YHQN 1TGOA 4WQ4C 3THVA 1VSJA 4CJUA 1KSPA 4EHUA 1WN7A 2D4WA 1C1BA 3WEEA 1I39A 3P39A 2XY8A 3SJJA 2D0BA 2O8FB 4CERA 1YT3A 1OH8A 1BCOA 1U2VB 4CJFA 1T05A 3CM6A 4CK3A 4CIGA 2HW3A 4A5AA 3A2FA 4CHQA 4JK8A 5C10A 1U47A 1K6YA 5SWMA 2P5OA 3AO5A 5AZJA 5BR9A 5BRDA 4LFBK 2A42A 4J8FA 5GAEP 1VSKA 4FLUA 1JLBA 3S9HA 3R9PA 1GLBG 3J8AA 4H4MA 1FKOA 5HLFA 4BRAA 3KIOA 1ITGA 4OKKA 4IG0A 1QSYA 4FSVA 3OYIA 1GLCG 4JHDB 3LM2A 1RDBA 2X6SA 4DR2K 4KHUA 1P90A 1YVNA 5KTQA 4FPAA 2Q1NA 3AVCA 1KD1O 4ZTJA 3AY9A 1GLFO 1NJIO 2FSJA 4IJAA 4XIUA 3UKUA 1O13A 2P9LA 2CGKA 1GLLO 4AILC 1B92A 3CFRA 1JXBA 4C8NA 3C0BA 1DKGD 4DV5K 3IUCA 1W97L 3SV4A 1HX1A 4CHPA 3ZT4A 1KAXA 1BUPA 3VERA 3WQTA 2FSKA 1O1WA 1V4TA 3DLLL 1SZ2A 3OBYA 1NWKA 4CF0A 5HP1A 3M8PA 3RR7A 4HWIA 2QWRA 4FWQA 1S9GA 1Z05A 1C0UA 4CFCA 2O8CB 4PQUA 5BN8A 4HTUA 5AQSA 1VSFA 3O08A 4JI7K 3MWTA 1KFDA 3RWUA 3C6TA 3QEIA 3U8XA 4WQ5C 4IOCL 4HUFA 2VGNA 4MDAA 5AJ3K 4B9VA 1D8YA 2QEXN 2V51B 3L2QA 2QTDA 5HOOA 4I7FA 3CF5L 2NRWA 1S1TA 4CEDA 3CERA 4NXMK 4JI4K 5C2DA 3HO1A 2XY5A 5EVZA 2VGMA 1N6QA 2O8BB 1J5OA 2F96A 1MA9B 3DRRA 5C2FA 1XC3A 3EEQA 2HHVA 4KPYA 3RRGA 1Q81O 4DTNA 3AGRA 4YHHK 1NMNA 2OANA 1BA1A 4KHWA 2Q0RA 4O55A 2DY4A 4AHRA 2E8AA 1IBMK 4YNQA 3V9UA 3K5MA 4PA1A 1QVGM 2CH5A 3ASMA 2D0OA 4KREA 4HHTA 3VEOA 4KTWA 3HOSA 1NK9A 1HKGA 5MLCQ 3O80A 4CEEA 1EKEA 3V1QA 4DLGA 4IO9L 3KLGA 3DI6A 4GNIA 4MLEA 2OTLN 2NRHA 2PYLA 3NFAA 4YOVA 3ZT3A 4U7BA 3EYZA 4B8CA 2QW9A 1Y97A 3CFOA 4DF8A 1T6CA 3QINA 4B9SA 4DSIA 3ZSXA 3VQPA 3ZETA 4CJRA 4JS5A 4YOTA 3W0LA 2E2QA 1M90O 2P9NA 1QSLA 3F73A 1W0HA 3OYCA 2QWNA 4W5OA 1SV5A 5DMRA 5LJVA 4CZMA 3HRGA 5LY3A 2W6KA 2NRVA 4J2EA 2NLXA 2I5JA 2NUBA 2A41A 3SMPA 4JKFA 3ZEUA 2QKKA 3NVMA 4KFBA 3DRPA 2VG5A 1RFQA 4PL7A 1ZBHA 1UAXA 3VQ9A 1SL2A 3AO1A 4ID1A 2E6MA 2P9UA 4F9OA 2BE2A 3KD1E 5EU7A 4KH5A 5AQOA 3F5TA 3WXJA 5B8HA 1RDWX 5AQQA 1TUUA 3HPOA 4DQRA 1FKPA 1IKVA 2JWLA 3QEXA 4JK7A 4BC5A 2IVPA 1WBBA 4FK4A 1QQCA 2E1YA 4KHQA 4MQ3A 5T7BA 4JI8K 4CFAA 4WQ4A 1S1XA 1S3XA 3J7ZO 5AZIA 1EP4A 3L4IA 3M5RA 1BQNA 4R79A 3MAQA 4CJVA 3LPTA 1SL0A 1HKBA 4EZ6A 2Y1IA 3HOTA 3PLAA 2WBNA 3I8BA 5A2QO 1OH6A 4KH4A 1KVCA 2BUPA 1H1VA 3T1YK 3NVKA 4DTRA 3OBWA 2YHXA 3MEGA 2G8UA 1RDUA 3AGKA 4FM2A 3CC4N 3CCEN 3THYA 3IFRA 1WSIA 4JI3K 2HVIA 1HNXK 4DF4A 4BVOA 1N36K 2VG7A 3KTQA 3CPEA 4CK2A 4CF9A 4DQSA 1Q82O 4LF5K 4E7LA 3CJBA 3ULEA 3VEZA 3CYMA 3JS6A 4ELUA 3CCUN 4JI0K 4JRPA 4FLWA 3H46O 3AAPA 1XWLA 3BF1A 1D5AA 3R6MA 5IT9O 3AA4A 3AVAA 3QNNA 3AVLA 1S6PA 5KPRA 1KLMA 3K0SA 2VQEK 2Z1JA 3CMAN 3D2FA 2IVOA 3IRXA 2ZF5O 4G9ZA 2P9IB 1X9WA 3DLEA 4BRNA 4EP5A 2ZJRL 5FRNA 4A62A 3M6GA 1ATRA 4CEBA 1NK7A 3PY8A 4WFBL 3KLIA 3S3NA 2WTUA 3FFKB 4H0PA 3PV8A 2JWKA 1YXQA 4HVJA 4E1JA 4FJXA 4B08A 3B8AX 4NYFA 1BL3A 1K9MO 3WNGA 1KQSM 4WQ5A 4F2RA 4CF2A 3BF3A 3ENOA 4DFPA 2XHBA 2VYPA 2D0PA 2I7NA 2HHUA 4DTJA 4BREA 2CH6A 2X6NA 3OYEA 3J80O 2YJFA 3RMBA 3PIOL 2XY7A 1VSEA 3TI0A 5JS2A 1JLFA 4A2AA 3K57A 4CW7B 4A61A 4DR7K 3CETA 3QIOA 4F8RA 2FF3B 4FOIA 4O4GA 3TSPA 4NCBA 2D5RA 3WUHA 4QS7A 3NDKA 4BR5A 4N41A 2HHHK 4JKBA 3VGLA 2GTDA 4BDZA 3OYMA 2YHAA 3ID6A 4FJ9A 4J2DA 2A40A 4JKGB 1LWFA 4DSFA 1JL1A 4Z4GA 4DV3K 4JHDA 3THWA 3AVKA 4QCLA 1RT1A 4AF1A 2RN2A 1K8KB 3AVMA 4H8KA 3KHYA 4RW7A 2AP1A 1TL3A 3DOLA 1F21A 1Z6RA 1RDAA 4E7KA 4ELVA 1I94K 1MWMA 4JRQA 2HSTA 3TAMA 4E3SA 4CGGA 4FWLA 2IGIA 2NRTA 2F9WA 4YOYA 2NZTA 4B1VA 4FLZA 4E19A 1LCUA 2YCHA 5AQIA 3KK2A 3CCQN 3D2EB 4BQLA 1HKCA 4IZ9A 2FBYA 1FW6A 4GV9A 5M1FA 1T7PA 4I9QA 1HJRA 3CMEN 3ZSZA 3WT0A 1DTTA 3T7ZA 4B1XB 5C15A 3O8MA 3HPHA 4G1QA 2O8CA 4CJ3A 5EY4A 3WNHA 1HNWK 3TANA 4JKHA 5KQDA 4FJMA 1TKXA 1ZBLA 5KI6A 3ALYA 1EQYA 3ULDA 4DV6K 4KI6A 3R8EA 3OJSA 4BR4A 4FJNA 4CZLA 3NHGA 3H1QA 5BREA 4JN4A 4KAZA 3CJ9A 4AHSA 1NOYA 3CC2N 3OYFA 3FFIA 3KLHA 5KPTA 1C0MA 1J53A 4TSXA 4FVUA 2HNDA 1WAJA 2ITGA 4NLCA 2B4JA 2RPIA 4JKDA 4DQQA 4DSEA 4FJ8A 3K59A 4C1NI 3C7NB 2GUPA 3IDHA 3C65A 5CHIA 4MO5A 4H5WA 3SCXA 3WQUA 1J5EK 1W2BM 2G8VA 4LF9K 3SQ2A 1E3MA 1JCEA 2DPNA 4AM7A 4B8AB 2WONA 2ZQBA 4GV3A 4Z4HA 1VQ9N 4FJKA 1G99A 3VA3A 1UWBA 4H5TA 3G25A 3E9PA 2G8HA 4QOZB 5AR0A 2YI1A 1BCMA 4OX9K 4KKOA 1VSMA 1HR0K 1SAZA 4KH6A 3S41A 2F8TA 2HHTA 1LOTB 1BIUA 4B9TA 3DXKA 3BP8A 5TKWA 4CCHA 2OZSA 3ZX3A 4JI1K 3ATUA 4M7XA 4OLAA 3SPZA 3SAGA 1KCFA 4C8MA 5AFUA 3CCVN 1SKWA 3TWHA 4LSLA 3WXMB 4DB3A 5K14A 3IS9A 3KLFA 4FXDA 3C94A 1IV0A 1CZAN 3L6QA 1T44A 2UXDK 3O1WA 5LMUK 2W41A 5HBMA 1YJWN 1B9FA 3QFUA 3BUZB 4OGEA 3UKRA 2YNIA 4Z4IA 4I9LA 1U04A 1OH5A 3SZ2A 4K41A 3OJUA 2VCPA 2P9PB 4HUGA 4M3UA 1HNZK 2W42A 2CGLA 3AVHA 1XHZA 3FZKA 3TAPA 4JKAA 3LAKA 1NNEA 1S6QA 3ZCMA 3DAWA 3NMUA 3G4SN 2HNZA 2IAJA 1ZXOA 2PFUA 3LM9A 1L3SA 4OVLA 1N34K 2P9SA 1VK0A 3VETA 3AO3A 4BRCA 1T3VA 3H1VX 4WE1A 5AQNA 4CZEA 4YY3K 1GLEG 1VRTA 4BC2A 4FZXC 4CJ7A 3EE9A 3VEVA 4UQGA 1XUPO 1RBVA 2RF2A 4B1UB 4BWMA 2VWJA 3O5BA 4IKFA 3CHWA 3M8SA 1NGFA 4LSNA 4FLYA 4H0TB 4HTLA 1RT5A 3HVRA 4LC9B 4CJLA 5J1EA 1YAGA 4PY5A 3QMLA 4NCAA 2V7YA 2CGJA 5KRSA 1NKEA 3CCSN 4DFKA 2BDPA 3KK3A 1J6ZA 2IDOA 3EZWA 1C1CA 3I56N 1IKWA 4FWRA 3CM5A 1BWFO 1VSHA 3AAQA 4X62K 1L3TA 3D0PA 4IFYA 3H3NO 3P4IA 1EWQA 4DSKA 4A59A 3O3GA 3QIPA 1NJYA 1U4BA 3SAFA 3AO2A 2HBLA 3UIQA 1QE1A 3O1BA 3G0ZA 1NGEA 3DJCA 2QI2A 3TAQA 4BRFA 5LMNK 3WNEA 1NU0A 4O44A 2YNFA 4B3MK 4DTSA 4DU3A 1NOZA 4BRHA 5M1QA 4JNEA 1ASUA 4FK0A 4EZ9A 1YTUA 1VSLA 2JLEA 3P31A 5CE3A 4ILHA 3SQ0A 1TAUA 2E2OA 2YJEA 1ASWA 1DEJA 4IDKA 4JK9A 4DQ8A 1NK4A 1Q9YA 2O8EA 2A6AA 4YOXA 5AQTA 4BRPA 2QXFA 1U45A 4FPBA 4LH5A 4CGFA 3R1XA 3CQYA 1C6VA 3H08A 2RKIA 4M3TA 1WSGA 4DS4A 4X64K 4DS5A 2P9KB 3O9TA 4CEAA 3LZIA 2OZMA 1TKTA 4M3RA 4B1WB 1YUWA 4C23A 1HPMA 3DXMB 3NF7A 3QEPA 1S5JA 3ZT1A 4BRDA 1HMVA 1SKSA 4XH1A 3L0QA 5E41A 3L2WA 3B6PA 3F2KA 3CG7A 5CY4A 1KLNA 5M1KA 4OPJA 4FVMA 3U9ZA 3HI0A 4RG8A 4A5BA 3HVTA 1L5UA 1WNSA 3EZ5A 3MN5A 5HRRA 1HJOA 2HB5A 2E20A 5BPNA 1HQUA 4Z4FA 3J7AP 4W5RA 3OYKA 4Z94A 3OYAA 4JKGA 3K5NA 4I6MA 4MDBA 1MU2A 4DQPA 2NRXA 3C95A 1RDCA 4WFNL 4Z4CA 3Q7BA 2F4VK 5FLXO 1TAQA 4BR7A 2VWBA 2AJQA 2YV0X 4BACA 5JICA 2B5JA 1JCGA 4CJ5A 2WUSA 3L2RA 1JCFA 1JLCA 3KVGA 4CIFA 5FPDA 2O8DA 1NGJA 4CJ4A 4DTUA 3OYHA 4H4OA 3ITHA 2O4IA 1B9DA 3THXB 3SNNA 1TL1A 3D7EO 1JJ2M 1KAZA 4M3ZA 5D3GA 2RHKA 4BY9C 1KRPA 1VQ5N 3ZT2A 5KPZA 3ZYYX 1GOCA 2QWPA 2P1JA 1BI4B 4LH4A 2Q0UA 1JL2A 3VEYA 3DLKA 3O6WA 2GWKA 3W3DA 2KZMA 3CPWM 4NXNK 3AO4A 3WXKA 3OYBA 5EXWA 3SK3A 3S3OA 3LP0A 3EY1A 3RMAA 2PBDA 2G8WA 2FBXA 4K42A 5KQ8A 3O4WA 1HQEA 3F9MA 5C24A 4K0KK 3ZSRA 4DUZK 1WSFA 3KK1A 1W9HA 5C42A 1KAYA 4JEPA 1M1KO 1YIJN 3FR0A 4CBUA 4DV0K 3V9WA 3KWIA 2IS3A 3HJFA 5JS1A 4IJNA 1NGCA 3OVNA 1NJWA 1KVAA 3M3ZA 1HYZA 5I42A 1RT2A 5HL7L 4CGDA 3SJHA 3SUNA 1T03A 1TYQA 3CC7N 3PIPL 1DT9A 2OCEA 1ZBSA 4NCGA 3MCAB 1KTQA 4BDYA 3JYTA 3K9KA 1GLDG 2RE2A 2UXBK 4CEQA 3JSMA 5BPLA 2HMPA 2VG6A 4JD2A 3H6EA 4N47A 3AA5X 4Y1DA 4FCYA 3R3LA 3L8BA 2I7PA 1TK0A 3WEEB 4JS4A 2P51A 1WOQA 4MLHA 2DFHA 3HP6A 1YITN 3RMDA 2EWSA 5AQYA 4CZFA 3MMVA 3HPGA 5FROA 3L3UA 1TVRA 3VQEA 1SKRA 2YNHA 2ZD1A 4DR1K 3VF6A 1C1AA 3HM9A 3IG1A 1VQON 5AZJB 3SUOA 3V1RA 3KKSA 1MWKA 3NF6A 1K8AO 5EOYA 4CJPA 2J4RA 3RSEA 3NH0A 4C1NK 1D9FA 4KBOA 3EE8A 4H5NA 3QESA 4WYBA 1WSHA 3VENA 3OYDA 2FSNA 1NGDA 4Z4EA 1FJGK 3KWGA 4I2PA 5AQFA 3NAEA 4Z0UA 1A5VA 4BRKA 3EN9A 3OYGA 4OJRA 3MDQA 4KO0A 4DSJA 1VSDA 3BEXA 3O9QA 1TUYA 4FLVA 5AFUH 4FK2A 4BC3A 3MN6A 3VQBA 3VQQA 1C0TA 4I2QA 4B3OA 3QLHA 3UKUB 4CD1A 2P9LB 4FYDA 5AQXA 3KJVA 1QVFM 1IBKK 4FJ7A 5HRPA 4DQIA 1HYVA 3TR8A 4FW1A 5DM6L 4BRQA 3VPZA 1S9EA 3VEXA 1S22A 4EIAA 3CJ1A 3B6OA 4DCHA 4KRFA 4B9NA 3L2UA 2GUIA 2ZGZA 4NO7A 3CCJN 4K8ZA 4FO0A 3LDSA 2VQFK 2O8FA 1XNRK 1IKYA 3TTDA 2DFEA 2OPSA 4KHPK 4CF1A 4HCCA 3VMFB 4CZKA 2O4GA 3LP1A 1BISA 2HBJA 1U2VA 5CYMA 3PO5A 1VHXA 4DR5K 3U3YA 1QZ6A 3QEVA 1EO1A 4B3TK 2HNYA 2UU9K 2GEMA 5ADXA 2B6AA 3CJAA 3N4QA 2ZE2A 3TAEA 4F2SA 4GVMA 3PO4A 2QKBA 5AQJA 4YOUA 2X78A 1YJ9N 1L3UA 5DK5A 1X3MA 3DWLA 3N4PA 2V52B 2DTUA 3FE1A 3SLCA 5HROA 3OYJA 2D0CA 1RBSA 1BU6O 3KD5E 4CHZA 3TSQA 4LD0A 1OVQA 3U9DA 4CEFA 4AHTA 1K73O 1I3AA 1DLOA 4BE0A 2Z1HA 3BZCA 4FW2A 5FPNA 2FXUA 4CJEA 3VF4A 3NGYA 4ILJA 4K8XA 3CI5A 2QWQA 1DTQA 5BN9A 1E4GT 1REVA 3KKRA 1BOTO 4BG9A 1ZC6A 4HCBA 3DLGA 1OVYA 2HHQA 4FM0A 3DMJA 1J54A 5AQMA 4M3WA 5C12A 2WFBA 2ZJPL 5BPMA 2IC3A 4JI5K 3H45C 3ZETB 2ZWHA 2QK9A 4DUYK 4Y0WA 2P9NB 3QBXA 4WF9L 3VA0A 1YJNN 2HVHA 4FL9A 5J2MA 3MCPA 5HRNA 3OA9A 5H1SQ 4E7HA 1X9MA 4MFBA 1NMDA 1Z26A 4KHSA 4RW9A 3BDPA 4PKIA 3DLRA 4QS8A 3SV3A 3A5OC 4IDHA 3AVBA 1IO2A 2IVNA 3O3HA 2E6LA 4BG8A 4BDPA 3VGMA 4KHYA 3OYNA 3KLEA 1XNQK 3HK2A 1N32K 2O8BA 4FJ5A 3CD6N 2A1SA 3ZX0A 4GKKK 3OS0A 4ID5A 1UA1A 1NM1A 5FPEA 3ZEUB 2JGUA 2KLAA 2HMIA 5EX5A 3WXIA 3SAHA 4NB4A 1GLJO 3A5MC 2P9UB 3VTHA 1ESVA 3E01A 4AH9A 1Q7YO 4LFCK 1SS6A 1X3NA 4JAXA 4DR3K 3LDQA 3O9UA 3TU5A 3HBTA 3ZSYA 2KZZA 4YFUA 2E4LA 4BRMA 3EL2A 1T8EA 5KGXA 3VQ4A 2FC0A 4PHTX 4CHNA 1NK6A 4CGJA 2E1ZA 5GADP 3U6FA 1MDUB 2PAVA 4FLTA 2QXLA 4J2AA 2QWOA 2Q31A 2EX3A 5AZIB 4CF8A 1ZBUA 4F3TA 1XHXA 1G15A 4CESA 4KB0A 1CLQA 3AVNA 4YDUC 3FZFA 2Q2RA 1D4XA 3A0IX 3SBGA 4H0OA 4R5PA 2D1KA 3OS2A 1VQMN 1RTJA 1ATSA 4OKJA 3LAMA 4XH4A 2X74A 4Y1CA 4H0VB 3K2PA 4KV8A 1QQNA 3CQXA 3QB0A 1JLEA 3NH1A 1QQMA 3I55N 3OHRA 1ZYQA 4U67L 4CZIA 4AQYK 3THYB 3VQ8A 4EAHD 1KFSA 3GOIA 1TKDA 1NGHA 1GOAA 3SBTA 4RW6A 1KC8O 1TV6A 5CR4A 3U4LA 4YOWA 4CHOA 2WC9A 3VQ5A 3ZSVA 4KHNA 4CVNE 5KGWA 2BGGA 2HBMA 3ULEB 1BA0A 1SUQA 1KXPA 4CJSA 4E0DA 3C6HA 1JKHA 2UUAK 4O8UA 3ENBA 1S1VA 3VTIA 3NGZA 1IH7A 3VOVA 4CIEA 3MXMA 2IOCA 1VQNN 1WSJA 3SYZA 3D2FB 4K43A 3TTCA 4BRIA 4C8LA 1YTAA 4A2BA 1HLUA 1RTHA 4M42A 2F7TA 2GBZA 2Y1JA
chains in the Genus database with same CATH topology
2VG7A 4CFDA 4DQPA 1D9DA 4CK2A 3KTQA 3C95A 4CF9A 4DQSA 4B9MA 1FXXA 3DOKA 1RDCA 1HPZA 3VN5A 4E7LA 1WAFA 4Z4CA 3CYMA 4DTMA 1Q8IA 4ELTA 4ELUA 4OKEA 4JRPA 1J9AA 4FLWA 1UA0A 1NKBA 1Q9XA 1TAQA 4BWJA 2PZSA 2OPQA 4OPKA 1XWLA 3NE6A 4GW6A 1D5AA 4CEOA 2AJQA 1RT4A 2XO7A 4HUEA 2YV0X 3AA4A 3AVAA 3QNNA 3PX6A 1WLJA 2OPRA 4BACA 1NKCA 3IAYA 2B5JA 3DLBA 4CJ5A 4E1MA 3AVLA 4CJQA 1S6PA 2GV9A 1KLMA 3L2RA 1JLCA 4C8OA 4FZZA 4CIFA 1CZ9A 2Z1JA 1KVBA 1UOCA 4DTOA 3F9KA 4CJ4A 4Q0BA 4DTUA 3IRXA 3OYHA 4H4OA 3ITHA 2O4IA 5I3UA 1B9DA 5C25A 1L3VA 3SNNA 4E89A 3VQCA 4DFMA 3AA3A 1TL1A 1X9WA 4N56A 3DLEA 4M3ZA 4EP5A 1NJZA 5D3GA 5FRNA 2PY5A 1KRPA 4L8RB 4PWDA 1RT3A 3ZT2A 1NK7A 2DFFA 2OPPA 4CEBA 3PY8A 3KLIA 3SI6A 1BIZA 1GOCA 3S3NA 2P1JA 1BI4B 4LH4A 3PV8A 1JL2A 4HVJA 3DLKA 3LP2A 4FJXA 4B08A 2HHXA 3OY9A 4OLBA 4AHVA 4NYFA 4DFJA 2KZMA 1BL3A 4RW8A 3AO4A 3L3VA 4FM1A 3WNGA 3P1GA 4F2RA 4CF2A 1RILA 3OYBA 4DFPA 4FJJA 3ZSOA 2XHBA 1LV5A 1CXUA 4DTPA 2FBVA 1HYSA 3S3OA 3LP0A 3EY1A 1LW0A 4IBNA 3MEEA 3RMAA 2G8WA 1X1PA 2FBXA 2HHUA 3L2VA 4DTJA 3MXIA 4E7IA 1HQEA 2X6NA 4CK1A 3O4QA 3OYEA 3LZJA 5C24A 3RMBA 4DWIA 1VRUA 3AVFA 3ZSRA 3I0SA 2KQ2A 1VSEA 3PUFA 1WSFA 5J2QA 3KK1A 2XY7A 1W9HA 3TI0A 2EHGA 1RT7A 3DYAA 3G10A 5JS2A 5C42A 3SPYA 1JLFA 3K57A 3SQ1A 4M45A 3QIOA 4F8RA 3M8RA 4O4GA 3AV9A 3U3GA 4NCBA 2D5RA 2KFZA 3NDKA 3V9WA 4N41A 4FJHA 2IS3A 3HJFA 5JS1A 2WOMA 3P83D 4BDZA 1BI4A 3TABA 3OYMA 3OVNA 1NJWA 1KVAA 2YHAA 1HYZA 1Z25A 3D45A 1RT2A 3VQAA 3RRHA 3SUQA 4CGDA 4CHYA 3NH2A 3SUNA 1T03A 4J2DA 4CJKA 4IFVA 2OA8A 4FJ9A 2YKMA 1LWFA 3I8DA 3MEDA 4DSFA 1JL1A 4Z4GA 3AVKA 3PX0A 4O0IA 3RR8A 4QCLA 1RT1A 4NCGA 4DU1A 3TAGA 2RN2A 4FJIA 1X9SA 3K58A 3AVMA 1KTQA 4H8KA 4CEZA 4BDYA 4AHUA 4RW7A 3JYTA 3QNOA 4CEQA 2BANA 4IG3A 1TL3A 3DOLA 1F21A 1NK0A 3JSMA 1FK9A 1EETA 1HNIA 5FRMA 1A5XA 1RDAA 2VG6A 3HL8A 4E7KA 4N47A 3AA5X 4ELVA 3NF8A 4Y1DA 5FDLA 4JRQA 4FCYA 3TAMA 3DRSA 3L8BA 4CGGA 4E3SA 1TK0A 2P5GA 4JS4A 5I42A 1R0AA 2G8IA 2IGIA 2F8SA 1CXQA 1RNHA 2P51A 3QEWA 2DFHA 3HP6A 3TARA 3RMDA 4FLZA 4E19A 3KK2A 1HNVA 3T3FA 3AVJA 3HPGA 5FROA 3L3UA 3V9XA 3NF9A 1U49A 4AHCA 3HYFA 1NJXA 4J2BA 2FBYA 1TVRA 1T7PA 4I9QA 1HJRA 3VQEA 3OS1A 2YNHA 2ZD1A 3ZSZA 4CFBA 3RTVA 1SKRA 1DTTA 4DG1A 1C1AA 3SUPA 4BE2A 3HM9A 4ZTFA 4FLXA 3HPHA 3IG1A 4W5TA 4N5SA 3SUOA 4G1QA 3V1RA 3KKSA 2FBTA 3NF6A 3LP3A 4CJ3A 2YNGA 2G8FA 4CJPA 4F3OA 4KI4A 3WNHA 2YHBA 3TANA 1QS4A 2Z1GA 3NH0A 1D9FA 4FJMA 1TKXA 1ZBLA 2ETJA 5KI6A 1TGOA 3THVA 3QESA 1NK8A 3ALYA 1VSJA 1ASVA 1WSHA 4CJUA 3OYDA 1KSPA 1RT6A 4Z4EA 3MXJA 1WN7A 3ULDA 1C1BA 1I39A 4KI6A 4I2PA 3NAEA 2XY8A 4Z0UA 1A5VA 3SJJA 2D0BA 3OJSA 1BHLA 4FJNA 4CERA 3OYGA 4OJRA 4DLEA 1YT3A 4KO0A 3P5JA 3NHGA 4LY7A 1BCOA 4DSJA 1VSDA 4FLVA 4OGCA 4FK2A 4CJFA 1T05A 3CM6A 4CK3A 3DLHA 3VQBA 3VQQA 4CJWA 4FJLA 4CIGA 1C0TA 4I2QA 2HW3A 4B3OA 3QLHA 4KAZA 3A2FA 4CHQA 4AHSA 1NOYA 4B9LA 4FYDA 4W5NA 4JLHA 3OYFA 3KJVA 1K6YA 3FFIA 5SWMA 3KLHA 1U47A 2P5OA 1BGXT 1C0MA 3AO5A 1J53A 4TSXA 2HNDA 1WAJA 1LAWA 2KW4A 2ITGA 3LANA 2B4JA 4FJ7A 5HRPA 2RPIA 1HYVA 4DQIA 4KB1A 3TR8A 4FLUA 1VSKA 1YVUA 4FW1A 4DQQA 1JLBA 3S9HA 1EXQA 4DSEA 1S9EA 4FJ8A 4H4MA 3K59A 1FKOA 3B6OA 5HLFA 1RTDA 4KRFA 3KIOA 4B9NA 1ITGA 4OKKA 4IG0A 2KFNA 3L2UA 2GUIA 1QSYA 3OYIA 3O4NA 3OYLA 1QTMA 4K8ZA 4FZYA 1RDBA 3LDSA 3SCXA 2X6SA 4KHUA 2ATQA 2G8VA 5KTQA 1IKYA 1JLGA 2DFEA 2OPSA 3TAFA 3SQ2A 3AVCA 4B8AB 4CF1A 4HCCA 2O4GA 2WONA 2ZQBA 1BISA 3LP1A 3T1AA 4Z4HA 4ZTJA 4FJKA 5CYMA 3PO5A 3O3FA 3U3YA 2A1RA 3VA3A 1UWBA 4XIUA 1N5YA 3QEVA 2G8HA 4QOZB 2HNYA 1QHTA 1BCMA 1LWCA 4AILC 2B6AA 1B92A 4KKOA 2ZE2A 4O5BA 1VSMA 1JXBA 4C8NA 3CFRA 3TAEA 4F2SA 3V9ZA 4GVMA 3SV4A 2F8TA 2HHTA 3PO4A 4CHPA 2QKBA 4C8KA 2X78A 5CZ2A 3ZT4A 1L3UA 1BIUA 5DK5A 4W5QA 4B9TA 1BQMA 2DTUA 1O1WA 4CCHA 2OZSA 1RCHA 5HROA 3OYJA 3SPZA 4OLAA 4CF0A 3ZT0A 4EP4A 1KCFA 2D0CA 5HP1A 3M8PA 3RR7A 1RBSA 3AVIA 4C8MA 3K5OA 1SKWA 3KD5E 4CHZA 1S9GA 3WNFA 1C0UA 4CFCA 3TWHA 4LSLA 4DF4A 4PQUA 4LD0A 5K14A 4CEFA 3IS9A 4HTUA 4AHTA 1I3AA 1RDDA 1DLOA 1VSFA 3KLFA 4BE0A 2Z1HA 4FW2A 4DU4A 3C94A 2PYJA 4FXDA 1KFDA 3RWUA 3V1OA 1XI1A 3C6TA 3QEIA 3SQ4A 4CJEA 5KRTA 5HBMA 2R7YA 1IG9A 4HUFA 1B9FA 2D0AA 3NGYA 4Q5VA 1RBRA 4K8XA 4OGEA 1DTQA 4B9VA 1D8YA 4CGHA 2YNIA 3ZSWA 1S1UA 1U48A 4Z4IA 4I9LA 1REVA 3L2QA 2VWKA 1U04A 3HXMA 4CJTA 3KKRA 4I7FA 3SZ2A 1IKXA 1S1TA 4CEDA 3OJUA 3S3MA 2OYQA 4HUGA 4M3UA 3HO1A 2XY5A 2W42A 3DLGA 4HCBA 2HHSA 1RTIA 3AVHA 4RW4A 1XHZA 1N6QA 1J5OA 3TAPA 2HHQA 4FM0A 2F96A 3LAKA 3DRRA 3DMJA 1J54A 4E7JA 1S6QA 3ZCMA 1SL1A 4KPYA 4M3WA 2HHVA 3RRGA 4CGIA 3RMCA 2HNZA 2IAJA 3VQ7A 3LWLA 4DTNA 3LPUA 1L3SA 4PUOA 2IC3A 4OVLA 1VK0A 3AO3A 1RBTA 4KHWA 4O55A 3V9SA 2DY4A 4WE1A 4AHRA 2QK9A 4YNQA 3LWMA 3VA0A 3V9UA 1VRTA 4FZXC 3K5MA 4PA1A 4BE1A 5J2MA 2HVHA 4UQGA 5HRNA 4E7HA 4N76A 1X9MA 1RBVA 3ASMA 4MFBA 2RF2A 3HP9A 4KREA 1Z26A 4HHTA 4KTWA 3LALA 4BWMA 2VWJA 4KHSA 4RW9A 1NK9A 4IKFA 3BDPA 3DLRA 3M8SA 4O0JA 4LSNA 4FLYA 3SV3A 4CEEA 3CQ8A 1EKEA 3AVBA 1RT5A 3AA2A 5SZTA 1IO2A 1TKZA 4QAGA 2E6LA 3C6UA 3V1QA 3O3HA 4BDPA 4DLGA 4M3YA 3KLGA 4KHYA 3DI6A 3OYNA 3KLEA 3HVRA 3K5LA 3HK2A 4CJLA 5J1EA 2A1SA 4DMNA 1CZBA 2YKNA 3OS0A 4F4KA 4ID5A 4FJ5A 1UA1A 4PY5A 2PYLA 3NFAA 4NYNA 4NCAA 3ZT3A 2JGUA 3EYZA 4B8CA 5KRSA 1NKEA 1Y97A 3CFOA 3HSTB 4DFKA 4DF8A 2HMIA 4M41A 3KK3A 2BDPA 3QINA 3MECA 2IDOA 4B9SA 4DSIA 4M3XA 3DM2A 3ZSXA 1C1CA 3VQPA 4CJRA 4JS5A 4FJGA 4CECA 1IKWA 3I0RA 3QERA 1QSLA 2XY6A 3CM5A 3F73A 1W0HA 1VSHA 3OYCA 1ZBIA 3E01A 1L3TA 4AH9A 3D0PA 4IFYA 3VQDA 4W5OA 1SV5A 4GMJB 5DMRA 4DSKA 3O3GA 3QIPA 4KTZA 1ZBFA 3ZSYA 3HT3A 1U4BA 1NJYA 2KZZA 3AO2A 4YFUA 2KTQA 1LW2A 2E4LA 4J2EA 3UIQA 1QE1A 3PX4A 2I5JA 3G0ZA 5KGXA 1T8EA 3VQ4A 2HHWA 2FC0A 2NUBA 4CHNA 2XRIA 1VSIA 1NK6A 4CGJA 3TAQA 3VQ6A 3U6FA 5J2NA 4FLTA 3V81A 1EX4A 2QKKA 3WNEA 3V4IA 4J2AA 4KFBA 4O44A 2YNFA 4KTQA 1JXEA 2EX3A 3DRPA 1QSSA 4CF8A 1ZBUA 2VG5A 4F3TA 4DTSA 4ICLA 1XHXA 1G15A 4CESA 4DU3A 4KB0A 1NOZA 1CLQA 3AVNA 2Q3SA 1ZBHA 1ASUA 1UAXA 4FK0A 1HRHA 3VQ9A 2Z1IA 2LSNA 4EZ9A 1SL2A 1YTUA 1VSLA 2JLEA 3AO1A 4ID1A 4CE9A 4R5PA 2E6MA 5CZ1A 3OS2A 1RTJA 3SQ0A 2BE2A 1RBUA 4OKJA 3LAMA 5EU7A 2X74A 3KD1E 4Y1CA 1TAUA 4KV8A 3K2PA 1ASWA 4IDKA 1JLEA 1Q9YA 3NH1A 1NK4A 1LWEA 1JLAA 4B9UA 2QXFA 1U45A 4LH5A 4CGFA 3HPOA 4DQRA 1FKPA 1IKVA 3T19A 3QEXA 1S1WA 1ZYQA 1C6VA 3CFPA 3ISNC 3H08A 1KFSA 3VQ8A 2RKIA 4M3TA 4FK4A 1QQCA 4KHQA 3BGRA 1WSGA 4DS4A 4MQ3A 5T7BA 4DS5A 3QETA 1TKDA 4CFAA 1GOAA 4E1NA 4RW6A 1WSEA 3QO9A 1TV6A 4CEAA 1S1XA 5HRSA 3LZIA 2OZMA 4CHOA 1TKTA 4M3RA 3VQ5A 3ZSVA 4KHNA 5KGWA 2BGGA 1EP4A 1GOBA 2G8KA 3ZSQA 3NF7A 1BQNA 3QEPA 1SUQA 1S5JA 3ZT1A 3MAQA 4CJSA 4CJVA 3LPTA 3NGIA 1SL0A 1HMVA 4DSLA 1SKSA 4E0DA 4ZHRA 1JKHA 1XC9A 5E41A 3M8QA 4EZ6A 1S1VA 3L2WA 2Y1IA 4DTXA 1A5WA 3B6PA 3CG7A 5CY4A 3NCIA 1KLNA 4OPJA 3V6DA 3NBPA 4FVMA 3NGZA 1IH7A 1KVCA 1JLQA 4RG8A 3HVTA 4CIEA 5J2PA 3MXMA 2IOCA 4DTRA 1L5UA 1WNSA 1WSJA 3EZ5A 3MEGA 2G8UA 5HRRA 2HB5A 4FM2A 1HQUA 4Z4FA 4W5RA 3SYZA 1TK8A 3AVGA 3OYKA 1WSIA 5CYQA 1NK5A 1LAVA 1TK5A 1YTAA 4C8LA 2HVIA 3OYAA 1RTHA 3K5NA 4M42A 2GBZA 1MU2A 2Y1JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VG7 A;  4CFD A;  4DQP A;  1D9D A;  4CK2 A;  3KTQ A;  3C95 A;  4CF9 A;  4DQS A;  4B9M A;  1FXX A;  3DOK A;  1RDC A;  1HPZ A;  3VN5 A;  4E7L A;  1WAF A;  4Z4C A;  3CYM A;  4DTM A;  1Q8I A;  4ELT A;  4ELU A;  4OKE A;  4JRP A;  1J9A A;  4FLW A;  1UA0 A;  1NKB A;  1Q9X A;  1TAQ A;  4BWJ A;  2PZS A;  2OPQ A;  4OPK A;  1XWL A;  3NE6 A;  4GW6 A;  1D5A A;  4CEO A;  2AJQ A;  1RT4 A;  2XO7 A;  4HUE A;  2YV0 X;  3AA4 A;  3AVA A;  3QNN A;  3PX6 A;  1WLJ A;  2OPR A;  4BAC A;  1NKC A;  3IAY A;  2B5J A;  3DLB A;  4CJ5 A;  4E1M A;  3AVL A;  4CJQ A;  1S6P A;  2GV9 A;  1KLM A;  3L2R A;  1JLC A;  4C8O A;  4FZZ A;  4CIF A;  1CZ9 A;  2Z1J A;  1KVB A;  1UOC A;  4DTO A;  3F9K A;  4CJ4 A;  4Q0B A;  4DTU A;  3IRX A;  3OYH A;  4H4O A;  3ITH A;  2O4I A;  5I3U A;  1B9D A;  5C25 A;  1L3V A;  3SNN A;  4E89 A;  3VQC A;  4DFM A;  3AA3 A;  1TL1 A;  1X9W A;  4N56 A;  3DLE A;  4M3Z A;  4EP5 A;  1NJZ A;  5D3G A;  5FRN A;  2PY5 A;  1KRP A;  4L8R B;  4PWD A;  1RT3 A;  3ZT2 A;  1NK7 A;  2DFF A;  2OPP A;  4CEB A;  3PY8 A;  3KLI A;  3SI6 A;  1BIZ A;  1GOC A;  3S3N A;  2P1J A;  1BI4 B;  4LH4 A;  3PV8 A;  1JL2 A;  4HVJ A;  3DLK A;  3LP2 A;  4FJX A;  4B08 A;  2HHX A;  3OY9 A;  4OLB A;  4AHV A;  4NYF A;  4DFJ A;  2KZM A;  1BL3 A;  4RW8 A;  3AO4 A;  3L3V A;  4FM1 A;  3WNG A;  3P1G A;  4F2R A;  4CF2 A;  1RIL A;  3OYB A;  4DFP A;  4FJJ A;  3ZSO A;  2XHB A;  1LV5 A;  1CXU A;  4DTP A;  2FBV A;  1HYS A;  3S3O A;  3LP0 A;  3EY1 A;  1LW0 A;  4IBN A;  3MEE A;  3RMA A;  2G8W A;  1X1P A;  2FBX A;  2HHU A;  3L2V A;  4DTJ A;  3MXI A;  4E7I A;  1HQE A;  2X6N A;  4CK1 A;  3O4Q A;  3OYE A;  3LZJ A;  5C24 A;  3RMB A;  4DWI A;  1VRU A;  3AVF A;  3ZSR A;  3I0S A;  2KQ2 A;  1VSE A;  3PUF A;  1WSF A;  5J2Q A;  3KK1 A;  2XY7 A;  1W9H A;  3TI0 A;  2EHG A;  1RT7 A;  3DYA A;  3G10 A;  5JS2 A;  5C42 A;  3SPY A;  1JLF A;  3K57 A;  3SQ1 A;  4M45 A;  3QIO A;  4F8R A;  3M8R A;  4O4G A;  3AV9 A;  3U3G A;  4NCB A;  2D5R A;  2KFZ A;  3NDK A;  3V9W A;  4N41 A;  4FJH A;  2IS3 A;  3HJF A;  5JS1 A;  2WOM A;  3P83 D;  4BDZ A;  1BI4 A;  3TAB A;  3OYM A;  3OVN A;  1NJW A;  1KVA A;  2YHA A;  1HYZ A;  1Z25 A;  3D45 A;  1RT2 A;  3VQA A;  3RRH A;  3SUQ A;  4CGD A;  4CHY A;  3NH2 A;  3SUN A;  1T03 A;  4J2D A;  4CJK A;  4IFV A;  2OA8 A;  4FJ9 A;  2YKM A;  1LWF A;  3I8D A;  3MED A;  4DSF A;  1JL1 A;  4Z4G A;  3AVK A;  3PX0 A;  4O0I A;  3RR8 A;  4QCL A;  1RT1 A;  4NCG A;  4DU1 A;  3TAG A;  2RN2 A;  4FJI A;  1X9S A;  3K58 A;  3AVM A;  1KTQ A;  4H8K A;  4CEZ A;  4BDY A;  4AHU A;  4RW7 A;  3JYT A;  3QNO A;  4CEQ A;  2BAN A;  4IG3 A;  1TL3 A;  3DOL A;  1F21 A;  1NK0 A;  3JSM A;  1FK9 A;  1EET A;  1HNI A;  5FRM A;  1A5X A;  1RDA A;  2VG6 A;  3HL8 A;  4E7K A;  4N47 A;  3AA5 X;  4ELV A;  3NF8 A;  4Y1D A;  5FDL A;  4JRQ A;  4FCY A;  3TAM A;  3DRS A;  3L8B A;  4CGG A;  4E3S A;  1TK0 A;  2P5G A;  4JS4 A;  5I42 A;  1R0A A;  2G8I A;  2IGI A;  2F8S A;  1CXQ A;  1RNH A;  2P51 A;  3QEW A;  2DFH A;  3HP6 A;  3TAR A;  3RMD A;  4FLZ A;  4E19 A;  3KK2 A;  1HNV A;  3T3F A;  3AVJ A;  3HPG A;  5FRO A;  3L3U A;  3V9X A;  3NF9 A;  1U49 A;  4AHC A;  3HYF A;  1NJX A;  4J2B A;  2FBY A;  1TVR A;  1T7P A;  4I9Q A;  1HJR A;  3VQE A;  3OS1 A;  2YNH A;  2ZD1 A;  3ZSZ A;  4CFB A;  3RTV A;  1SKR A;  1DTT A;  4DG1 A;  1C1A A;  3SUP A;  4BE2 A;  3HM9 A;  4ZTF A;  4FLX A;  3HPH A;  3IG1 A;  4W5T A;  4N5S A;  3SUO A;  4G1Q A;  3V1R A;  3KKS A;  2FBT A;  3NF6 A;  3LP3 A;  4CJ3 A;  2YNG A;  2G8F A;  4CJP A;  4F3O A;  4KI4 A;  3WNH A;  2YHB A;  3TAN A;  1QS4 A;  2Z1G A;  3NH0 A;  1D9F A;  4FJM A;  1TKX A;  1ZBL A;  2ETJ A;  5KI6 A;  1TGO A;  3THV A;  3QES A;  1NK8 A;  3ALY A;  1VSJ A;  1ASV A;  1WSH A;  4CJU A;  3OYD A;  1KSP A;  1RT6 A;  4Z4E A;  3MXJ A;  1WN7 A;  3ULD A;  1C1B A;  1I39 A;  4KI6 A;  4I2P A;  3NAE A;  2XY8 A;  4Z0U A;  1A5V A;  3SJJ A;  2D0B A;  3OJS A;  1BHL A;  4FJN A;  4CER A;  3OYG A;  4OJR A;  4DLE A;  1YT3 A;  4KO0 A;  3P5J A;  3NHG A;  4LY7 A;  1BCO A;  4DSJ A;  1VSD A;  4FLV A;  4OGC A;  4FK2 A;  4CJF A;  1T05 A;  3CM6 A;  4CK3 A;  3DLH A;  3VQB A;  3VQQ A;  4CJW A;  4FJL A;  4CIG A;  1C0T A;  4I2Q A;  2HW3 A;  4B3O A;  3QLH A;  4KAZ A;  3A2F A;  4CHQ A;  4AHS A;  1NOY A;  4B9L A;  4FYD A;  4W5N A;  4JLH A;  3OYF A;  3KJV A;  1K6Y A;  3FFI A;  5SWM A;  3KLH A;  1U47 A;  2P5O A;  1BGX T;  1C0M A;  3AO5 A;  1J53 A;  4TSX A;  2HND A;  1WAJ A;  1LAW A;  2KW4 A;  2ITG A;  3LAN A;  2B4J A;  4FJ7 A;  5HRP A;  2RPI A;  1HYV A;  4DQI A;  4KB1 A;  3TR8 A;  4FLU A;  1VSK A;  1YVU A;  4FW1 A;  4DQQ A;  1JLB A;  3S9H A;  1EXQ A;  4DSE A;  1S9E A;  4FJ8 A;  4H4M A;  3K59 A;  1FKO A;  3B6O A;  5HLF A;  1RTD A;  4KRF A;  3KIO A;  4B9N A;  1ITG A;  4OKK A;  4IG0 A;  2KFN A;  3L2U A;  2GUI A;  1QSY A;  3OYI A;  3O4N A;  3OYL A;  1QTM A;  4K8Z A;  4FZY A;  1RDB A;  3LDS A;  3SCX A;  2X6S A;  4KHU A;  2ATQ A;  2G8V A;  5KTQ A;  1IKY A;  1JLG A;  2DFE A;  2OPS A;  3TAF A;  3SQ2 A;  3AVC A;  4B8A B;  4CF1 A;  4HCC A;  2O4G A;  2WON A;  2ZQB A;  1BIS A;  3LP1 A;  3T1A A;  4Z4H A;  4ZTJ A;  4FJK A;  5CYM A;  3PO5 A;  3O3F A;  3U3Y A;  2A1R A;  3VA3 A;  1UWB A;  4XIU A;  1N5Y A;  3QEV A;  2G8H A;  4QOZ B;  2HNY A;  1QHT A;  1BCM A;  1LWC A;  4AIL C;  2B6A A;  1B92 A;  4KKO A;  2ZE2 A;  4O5B A;  1VSM A;  1JXB A;  4C8N A;  3CFR A;  3TAE A;  4F2S A;  3V9Z A;  4GVM A;  3SV4 A;  2F8T A;  2HHT A;  3PO4 A;  4CHP A;  2QKB A;  4C8K A;  2X78 A;  5CZ2 A;  3ZT4 A;  1L3U A;  1BIU A;  5DK5 A;  4W5Q A;  4B9T A;  1BQM A;  2DTU A;  1O1W A;  4CCH A;  2OZS A;  1RCH A;  5HRO A;  3OYJ A;  3SPZ A;  4OLA A;  4CF0 A;  3ZT0 A;  4EP4 A;  1KCF A;  2D0C A;  5HP1 A;  3M8P A;  3RR7 A;  1RBS A;  3AVI A;  4C8M A;  3K5O A;  1SKW A;  3KD5 E;  4CHZ A;  1S9G A;  3WNF A;  1C0U A;  4CFC A;  3TWH A;  4LSL A;  4DF4 A;  4PQU A;  4LD0 A;  5K14 A;  4CEF A;  3IS9 A;  4HTU A;  4AHT A;  1I3A A;  1RDD A;  1DLO A;  1VSF A;  3KLF A;  4BE0 A;  2Z1H A;  4FW2 A;  4DU4 A;  3C94 A;  2PYJ A;  4FXD A;  1KFD A;  3RWU A;  3V1O A;  1XI1 A;  3C6T A;  3QEI A;  3SQ4 A;  4CJE A;  5KRT A;  5HBM A;  2R7Y A;  1IG9 A;  4HUF A;  1B9F A;  2D0A A;  3NGY A;  4Q5V A;  1RBR A;  4K8X A;  4OGE A;  1DTQ A;  4B9V A;  1D8Y A;  4CGH A;  2YNI A;  3ZSW A;  1S1U A;  1U48 A;  4Z4I A;  4I9L A;  1REV A;  3L2Q A;  2VWK A;  1U04 A;  3HXM A;  4CJT A;  3KKR A;  4I7F A;  3SZ2 A;  1IKX A;  1S1T A;  4CED A;  3OJU A;  3S3M A;  2OYQ A;  4HUG A;  4M3U A;  3HO1 A;  2XY5 A;  2W42 A;  3DLG A;  4HCB A;  2HHS A;  1RTI A;  3AVH A;  4RW4 A;  1XHZ A;  1N6Q A;  1J5O A;  3TAP A;  2HHQ A;  4FM0 A;  2F96 A;  3LAK A;  3DRR A;  3DMJ A;  1J54 A;  4E7J A;  1S6Q A;  3ZCM A;  1SL1 A;  4KPY A;  4M3W A;  2HHV A;  3RRG A;  4CGI A;  3RMC A;  2HNZ A;  2IAJ A;  3VQ7 A;  3LWL A;  4DTN A;  3LPU A;  1L3S A;  4PUO A;  2IC3 A;  4OVL A;  1VK0 A;  3AO3 A;  1RBT A;  4KHW A;  4O55 A;  3V9S A;  2DY4 A;  4WE1 A;  4AHR A;  2QK9 A;  4YNQ A;  3LWM A;  3VA0 A;  3V9U A;  1VRT A;  4FZX C;  3K5M A;  4PA1 A;  4BE1 A;  5J2M A;  2HVH A;  4UQG A;  5HRN A;  4E7H A;  4N76 A;  1X9M A;  1RBV A;  3ASM A;  4MFB A;  2RF2 A;  3HP9 A;  4KRE A;  1Z26 A;  4HHT A;  4KTW A;  3LAL A;  4BWM A;  2VWJ A;  4KHS A;  4RW9 A;  1NK9 A;  4IKF A;  3BDP A;  3DLR A;  3M8S A;  4O0J A;  4LSN A;  4FLY A;  3SV3 A;  4CEE A;  3CQ8 A;  1EKE A;  3AVB A;  1RT5 A;  3AA2 A;  5SZT A;  1IO2 A;  1TKZ A;  4QAG A;  2E6L A;  3C6U A;  3V1Q A;  3O3H A;  4BDP A;  4DLG A;  4M3Y A;  3KLG A;  4KHY A;  3DI6 A;  3OYN A;  3KLE A;  3HVR A;  3K5L A;  3HK2 A;  4CJL A;  5J1E A;  2A1S A;  4DMN A;  1CZB A;  2YKN A;  3OS0 A;  4F4K A;  4ID5 A;  4FJ5 A;  1UA1 A;  4PY5 A;  2PYL A;  3NFA A;  4NYN A;  4NCA A;  3ZT3 A;  2JGU A;  3EYZ A;  4B8C A;  5KRS A;  1NKE A;  1Y97 A;  3CFO A;  3HST B;  4DFK A;  4DF8 A;  2HMI A;  4M41 A;  3KK3 A;  2BDP A;  3QIN A;  3MEC A;  2IDO A;  4B9S A;  4DSI A;  4M3X A;  3DM2 A;  3ZSX A;  1C1C A;  3VQP A;  4CJR A;  4JS5 A;  4FJG A;  4CEC A;  1IKW A;  3I0R A;  3QER A;  1QSL A;  2XY6 A;  3CM5 A;  3F73 A;  1W0H A;  1VSH A;  3OYC A;  1ZBI A;  3E01 A;  1L3T A;  4AH9 A;  3D0P A;  4IFY A;  3VQD A;  4W5O A;  1SV5 A;  4GMJ B;  5DMR A;  4DSK A;  3O3G A;  3QIP A;  4KTZ A;  1ZBF A;  3ZSY A;  3HT3 A;  1U4B A;  1NJY A;  2KZZ A;  3AO2 A;  4YFU A;  2KTQ A;  1LW2 A;  2E4L A;  4J2E A;  3UIQ A;  1QE1 A;  3PX4 A;  2I5J A;  3G0Z A;  5KGX A;  1T8E A;  3VQ4 A;  2HHW A;  2FC0 A;  2NUB A;  4CHN A;  2XRI A;  1VSI A;  1NK6 A;  4CGJ A;  3TAQ A;  3VQ6 A;  3U6F A;  5J2N A;  4FLT A;  3V81 A;  1EX4 A;  2QKK A;  3WNE A;  3V4I A;  4J2A A;  4KFB A;  4O44 A;  2YNF A;  4KTQ A;  1JXE A;  2EX3 A;  3DRP A;  1QSS A;  4CF8 A;  1ZBU A;  2VG5 A;  4F3T A;  4DTS A;  4ICL A;  1XHX A;  1G15 A;  4CES A;  4DU3 A;  4KB0 A;  1NOZ A;  1CLQ A;  3AVN A;  2Q3S A;  1ZBH A;  1ASU A;  1UAX A;  4FK0 A;  1HRH A;  3VQ9 A;  2Z1I A;  2LSN A;  4EZ9 A;  1SL2 A;  1YTU A;  1VSL A;  2JLE A;  3AO1 A;  4ID1 A;  4CE9 A;  4R5P A;  2E6M A;  5CZ1 A;  3OS2 A;  1RTJ A;  3SQ0 A;  2BE2 A;  1RBU A;  4OKJ A;  3LAM A;  5EU7 A;  2X74 A;  3KD1 E;  4Y1C A;  1TAU A;  4KV8 A;  3K2P A;  1ASW A;  4IDK A;  1JLE A;  1Q9Y A;  3NH1 A;  1NK4 A;  1LWE A;  1JLA A;  4B9U A;  2QXF A;  1U45 A;  4LH5 A;  4CGF A;  3HPO A;  4DQR A;  1FKP A;  1IKV A;  3T19 A;  3QEX A;  1S1W A;  1ZYQ A;  1C6V A;  3CFP A;  3ISN C;  3H08 A;  1KFS A;  3VQ8 A;  2RKI A;  4M3T A;  4FK4 A;  1QQC A;  4KHQ A;  3BGR A;  1WSG A;  4DS4 A;  4MQ3 A;  5T7B A;  4DS5 A;  3QET A;  1TKD A;  4CFA A;  1GOA A;  4E1N A;  4RW6 A;  1WSE A;  3QO9 A;  1TV6 A;  4CEA A;  1S1X A;  5HRS A;  3LZI A;  2OZM A;  4CHO A;  1TKT A;  4M3R A;  3VQ5 A;  3ZSV A;  4KHN A;  5KGW A;  2BGG A;  1EP4 A;  1GOB A;  2G8K A;  3ZSQ A;  3NF7 A;  1BQN A;  3QEP A;  1SUQ A;  1S5J A;  3ZT1 A;  3MAQ A;  4CJS A;  4CJV A;  3LPT A;  3NGI A;  1SL0 A;  1HMV A;  4DSL A;  1SKS A;  4E0D A;  4ZHR A;  1JKH A;  1XC9 A;  5E41 A;  3M8Q A;  4EZ6 A;  1S1V A;  3L2W A;  2Y1I A;  4DTX A;  1A5W A;  3B6P A;  3CG7 A;  5CY4 A;  3NCI A;  1KLN A;  4OPJ A;  3V6D A;  3NBP A;  4FVM A;  3NGZ A;  1IH7 A;  1KVC A;  1JLQ A;  4RG8 A;  3HVT A;  4CIE A;  5J2P A;  3MXM A;  2IOC A;  4DTR A;  1L5U A;  1WNS A;  1WSJ A;  3EZ5 A;  3MEG A;  2G8U A;  5HRR A;  2HB5 A;  4FM2 A;  1HQU A;  4Z4F A;  4W5R A;  3SYZ A;  1TK8 A;  3AVG A;  3OYK A;  1WSI A;  5CYQ A;  1NK5 A;  1LAV A;  1TK5 A;  1YTA A;  4C8L A;  2HVI A;  3OYA A;  1RTH A;  3K5N A;  4M42 A;  2GBZ A;  1MU2 A;  2Y1J A; 
#chains in the Genus database with same CATH topology
 4DV7 K;  4OO1 J;  3DOK A;  2A5X A;  1BG3 A;  1WAF A;  5AQK A;  5I9E B;  4DTM A;  1Q8I A;  4ELT A;  3AAR A;  1UA0 A;  3T69 A;  4BWJ A;  2OPQ A;  5AQP A;  4OPK A;  4GW6 A;  4LF8 K;  4XH5 A;  3PX6 A;  2E5L K;  3FLC O;  2QM1 A;  2GV9 A;  2H3G X;  4C8O A;  1WBD A;  1KVB A;  1UOC A;  4Q0B A;  5AQU A;  1WB9 A;  5I3U A;  5C25 A;  4E89 A;  3VQC A;  1XQS C;  5TKY A;  3RVC A;  4ILG B;  4PWD A;  1RT3 A;  3O9R A;  1N8R O;  3SI6 A;  4RCH A;  3A5L C;  5E26 A;  2HHX A;  3OY9 A;  4AHV A;  4FM1 A;  3VGK A;  3THW B;  1NLV A;  3PSF A;  4RTF D;  1RIL A;  3MN9 A;  4FJJ A;  3ZLJ A;  4M63 C;  1CXU A;  2FBV A;  1X1P A;  4FWS A;  5BR8 K;  3MXI A;  4CK1 A;  3O4Q A;  3AVF A;  2QWL A;  3I0S A;  3PUF A;  4H0X B;  5J2Q A;  4ISF A;  5GIN A;  2EHG A;  1RT7 A;  3DYA A;  2P9I A;  4WFA L;  4M45 A;  3M8R A;  3AV9 A;  1NGI A;  2KFZ A;  5M1O A;  4FJH A;  5AQW A;  2FLO A;  2WOM A;  3TAB A;  3D45 A;  3VQA A;  3SUQ A;  4CHY A;  3NH2 A;  3TSU A;  5AQZ A;  4IFV A;  3G71 N;  2OA8 A;  2YKM A;  3I8D A;  4H0Y B;  4X66 K;  3RR8 A;  4GV6 A;  4BQZ A;  3TAG A;  4DU1 A;  3HTV A;  1X9S A;  3K58 A;  4AHU A;  3QNO A;  5BRF A;  5FRM A;  5JVH L;  1FK9 A;  1A5X A;  3HL8 A;  5E84 A;  3VF2 A;  4BR9 A;  3NF8 A;  1IJJ A;  1IG8 A;  3JAM O;  2P5G A;  2YX6 A;  2F8S A;  1CXQ A;  3IMX A;  1RNH A;  4BC4 A;  5JLH A;  3TAR A;  3CCL N;  3CCM N;  3HSC A;  1E4F T;  1VQP N;  3T3F A;  3AVJ A;  3V9X A;  1U49 A;  3NF9 A;  4AHC A;  3EKU A;  1Y64 A;  3OS1 A;  4CFB A;  5M1N A;  3E1Y A;  3SUP A;  4FLX A;  4W5T A;  2ASM A;  4N5S A;  5LJW A;  3C6A A;  1K8K A;  2YNG A;  5ADX H;  4F3O A;  4KI4 A;  2YHB A;  2KHO A;  4FWP A;  5C0Y A;  1NK8 A;  4M7Y A;  1ASV A;  5M1P A;  1RT6 A;  3MXJ A;  3CXC M;  4BRO A;  1SQK A;  4IOA L;  1BHL A;  4DLE A;  3P5J A;  3BY5 A;  4LY7 A;  3D2E A;  4OGC A;  1U6Z A;  1X9J A;  3DLH A;  5LL6 Z;  4CJW A;  5DM7 L;  4FJL A;  4YDU A;  3TTF A;  4JKC A;  5GAG P;  4W5N A;  4B9L A;  1HUX A;  4JLH A;  5AQR A;  2UYT A;  1BGX T;  3IKM A;  3A5N C;  1LAW A;  2KW4 A;  3LAN A;  4KB1 A;  4FWM A;  1YVU A;  1WUA A;  4BVP A;  1EXQ A;  1XMO K;  1RTD A;  3DXK B;  4IO8 A;  2GX9 A;  3VEW A;  2KFN A;  2OTJ N;  3LDO A;  4DV2 K;  3O4N A;  3OYL A;  1QTM A;  4FZY A;  1BDG A;  4AM6 A;  2ATQ A;  4JI2 K;  1JLG A;  3TAF A;  1YI2 N;  3T1A A;  5GAH P;  4EFH A;  4GY2 B;  3O3F A;  3OTO K;  3GBT A;  2A1R A;  1N5Y A;  1QZ5 A;  4BR0 A;  1QHT A;  1LWC A;  1BO5 O;  4O5B A;  4BRG A;  2BH1 A;  3UKR B;  4CI6 A;  3V9Z A;  1NGB A;  1Q86 O;  4C8K A;  2IIR A;  5CZ2 A;  4FWK A;  3WXL A;  4W5Q A;  3C7N A;  1BQM A;  4FWN A;  1RCH A;  3E66 A;  3EO3 A;  1OH7 A;  3ZT0 A;  4EP4 A;  3AVI A;  3K5O A;  1T6D A;  5F1X A;  3WNF A;  2BTF A;  4DKW A;  2UUC K;  3GG4 A;  3LDP A;  2P9S B;  1RDD A;  4DU4 A;  4CBX A;  2PYJ A;  2NRR A;  3V1O A;  1XI1 A;  4CZH A;  5ELZ A;  3JXU A;  3EKS A;  3SQ4 A;  1IG9 A;  1GLA G;  5KRT A;  2R7Y A;  5FPM A;  4JYA K;  2D0A A;  4Q5V A;  1RBR A;  1NG9 A;  3GDQ A;  4CGH A;  3ZSW A;  1S1U A;  2GEL A;  3CJ7 A;  4WCE L;  2QA4 N;  1U48 A;  1IBL K;  1VQ8 N;  2HF3 A;  2UUB K;  2VWK A;  3HXM A;  4CJT A;  1IKX A;  3E9L A;  3S3M A;  3T1H K;  2OYQ A;  3GE1 A;  2HHS A;  1RTI A;  2A3Z A;  4RW4 A;  4ISE A;  4BGB A;  1SL1 A;  4E7J A;  3Q7C A;  4IOX A;  4CGI A;  3RMC A;  3LWL A;  3VQ7 A;  3LPU A;  4PUO A;  4XEI A;  1RBT A;  2UXC K;  3V9S A;  5AQG A;  4B3R K;  3LWM A;  4BE1 A;  4CZJ A;  1VQK N;  2Q36 A;  4N76 A;  4LF4 K;  3MK6 A;  3MWP A;  3HP9 A;  3LAL A;  3LDL A;  4O5F A;  4PKH A;  4O0J A;  4MO4 A;  4ISG A;  4K25 A;  3CQ8 A;  4LF7 K;  1C0G A;  3AA2 A;  5SZT A;  2P9P A;  1TKZ A;  4QAG A;  3C6U A;  3G6E N;  4M3Y A;  4DR4 K;  3LL3 A;  4BR2 A;  3K5L A;  4UY8 O;  4F4K A;  4DMN A;  1CZB A;  2YKN A;  4H5R A;  4NYN A;  3HST B;  4M41 A;  3MEC A;  1YF5 L;  4M3X A;  3DM2 A;  2QWM A;  4FJG A;  4CEC A;  3I0R A;  3QER A;  1VQ7 N;  3E9O A;  3HM8 A;  4B1Y B;  2XY6 A;  4BRL A;  4IWV A;  3O9S A;  1ZBI A;  2ZJQ L;  1XMQ K;  3HZ6 A;  3VQD A;  4PKG A;  4GMJ B;  4H5V A;  2O8E B;  2ASO A;  1ATN A;  4KTZ A;  1ZBF A;  3HT3 A;  2NNW A;  5AQL A;  2HF4 A;  2KTQ A;  1LW2 A;  4FWO A;  4EHT A;  3PX4 A;  2HHW A;  2XRI A;  1VSI A;  4BGA A;  3VQ6 A;  5J2N A;  3V81 A;  1EX4 A;  3V4I A;  4KTQ A;  1JXE A;  1QSS A;  4O8K A;  1EWR A;  4ICL A;  3M1F A;  2AA4 A;  5GIP A;  2Q3S A;  1HRH A;  5JMV A;  1RGI A;  2LSN A;  2Z1I A;  4PL8 A;  5F0X A;  3GL1 A;  4CE9 A;  5CZ1 A;  3P38 A;  1RBU A;  3H3O B;  4B3S K;  1LWE A;  1JLA A;  4CD3 A;  4B9U A;  3T19 A;  4CZG A;  1S1W A;  3CFP A;  3ISN C;  1ILY A;  4DR6 K;  3BGR A;  3QET A;  3MX5 A;  4E1N A;  4GKJ K;  4OPA A;  1WSE A;  4I6M B;  3QO9 A;  3MN7 A;  3QIC A;  5HRS A;  1C0F A;  2G8K A;  1GOB A;  3ZSQ A;  2F9T A;  4JKE A;  3NGI A;  4DSL A;  4ZHR A;  1XC9 A;  3M8Q A;  1NGG A;  4DTX A;  1A5W A;  3ENH A;  3NCI A;  3V6D A;  3L4Q A;  3NBP A;  1JLQ A;  4JV5 K;  5J2P A;  1VQ4 N;  1R59 O;  2YHY A;  2O8D B;  3KK7 A;  3QBW A;  1TK8 A;  3AVG A;  5CYQ A;  1NK5 A;  1LAV A;  2ASP A;  3A8Y A;  1TK5 A;  3QDK A;  2P9K A;  1NBW A;  2W40 A;  3QFP A;  4CFD A;  1D9D A;  4LF6 K;  4RWT A;  3DXM A;  4B9M A;  1FXX A;  3VN5 A;  1HPZ A;  2KKZ A;  3CCR N;  1VQ6 N;  4YOR A;  3UB5 A;  4OKE A;  1J9A A;  1NKB A;  2E2P A;  3ID8 A;  1Q9X A;  2PZS A;  3NE6 A;  4CEO A;  1RT4 A;  2XO7 A;  3CJC A;  4HUE A;  2Q97 A;  3IAY A;  1WLJ A;  2OPR A;  1NKC A;  3DLB A;  5F2R A;  5IWA K;  4E1M A;  4QS9 A;  4CJQ A;  1OKJ A;  4LFA K;  3K9J A;  4H03 B;  4IEI A;  5AQV A;  4FZZ A;  5AQH A;  3FZM A;  1CZ9 A;  1DGK N;  4DTO A;  3F9K A;  5BRH A;  3LDN A;  1L3V A;  3J7Y P;  1N33 K;  4DFM A;  3AA3 A;  4N56 A;  2ZM6 K;  1NJZ A;  2PY5 A;  4CBW A;  4L8R B;  2DFF A;  2OPP A;  3ZX2 A;  1BIZ A;  2ZGY A;  4X65 K;  1W7A A;  1VQL N;  5GIO A;  3LP2 A;  1TYQ B;  4OLB A;  4FOE A;  4DFJ A;  1Q18 A;  4RW8 A;  3L3V A;  3P1G A;  3VES A;  1QHA A;  4JI6 K;  3ZSO A;  1HYS A;  1LV5 A;  2NRZ A;  4DTP A;  1LW0 A;  4IBN A;  3MEE A;  3L2V A;  4E7I A;  3LZJ A;  3TPQ A;  4JD2 B;  2V7Z A;  4DWI A;  1VRU A;  2KQ2 A;  4IEE A;  3SPY A;  3G10 A;  3PSI A;  3THX A;  3SQ1 A;  3U3G A;  3FGU A;  1NGA A;  2W6L A;  5JVG L;  1VAZ A;  1QQO A;  3UE5 A;  1S72 N;  3P83 D;  2HOE A;  1BI4 A;  3OW2 M;  4L3Q A;  1Z25 A;  3RRH A;  2ITM A;  4CJK A;  3CIP A;  3MED A;  2GWJ A;  3I33 A;  4B9Q A;  3PX0 A;  4O0I A;  4FJI A;  4A57 A;  4OPH A;  2E2N A;  3D6R A;  4IFE A;  4DV4 K;  4CEZ A;  3RSE B;  2BAN A;  4IG3 A;  1NK0 A;  1HNI A;  1EET A;  4DHY A;  2YHW A;  5FDL A;  5JLF A;  3DRS A;  4V19 S;  3MX2 A;  1R0A A;  2G8I A;  2FF6 A;  4GVE A;  3QEW A;  3KZB A;  3SMS A;  1HNV A;  3ATV A;  3HYF A;  2HBK A;  4B1Z A;  1NJX A;  3FZL A;  4J2B A;  4IXC A;  1V4S A;  3RTV A;  1P8Z A;  2E88 A;  4DG1 A;  3FZH A;  3J81 O;  4BE2 A;  4ZTF A;  4NLB A;  2FBT A;  4DV1 K;  3LP3 A;  2G8F A;  1QS4 A;  2Z1G A;  3BZK A;  2ETJ A;  1YHQ N;  1TGO A;  4WQ4 C;  3THV A;  1VSJ A;  4CJU A;  1KSP A;  4EHU A;  1WN7 A;  2D4W A;  1C1B A;  3WEE A;  1I39 A;  3P39 A;  2XY8 A;  3SJJ A;  2D0B A;  2O8F B;  4CER A;  1YT3 A;  1OH8 A;  1BCO A;  1U2V B;  4CJF A;  1T05 A;  3CM6 A;  4CK3 A;  4CIG A;  2HW3 A;  4A5A A;  3A2F A;  4CHQ A;  4JK8 A;  5C10 A;  1U47 A;  1K6Y A;  5SWM A;  2P5O A;  3AO5 A;  5AZJ A;  5BR9 A;  5BRD A;  4LFB K;  2A42 A;  4J8F A;  5GAE P;  1VSK A;  4FLU A;  1JLB A;  3S9H A;  3R9P A;  1GLB G;  3J8A A;  4H4M A;  1FKO A;  5HLF A;  4BRA A;  3KIO A;  1ITG A;  4OKK A;  4IG0 A;  1QSY A;  4FSV A;  3OYI A;  1GLC G;  4JHD B;  3LM2 A;  1RDB A;  2X6S A;  4DR2 K;  4KHU A;  1P90 A;  1YVN A;  5KTQ A;  4FPA A;  2Q1N A;  3AVC A;  1KD1 O;  4ZTJ A;  3AY9 A;  1GLF O;  1NJI O;  2FSJ A;  4IJA A;  4XIU A;  3UKU A;  1O13 A;  2P9L A;  2CGK A;  1GLL O;  4AIL C;  1B92 A;  3CFR A;  1JXB A;  4C8N A;  3C0B A;  1DKG D;  4DV5 K;  3IUC A;  1W97 L;  3SV4 A;  1HX1 A;  4CHP A;  3ZT4 A;  1KAX A;  1BUP A;  3VER A;  3WQT A;  2FSK A;  1O1W A;  1V4T A;  3DLL L;  1SZ2 A;  3OBY A;  1NWK A;  4CF0 A;  5HP1 A;  3M8P A;  3RR7 A;  4HWI A;  2QWR A;  4FWQ A;  1S9G A;  1Z05 A;  1C0U A;  4CFC A;  2O8C B;  4PQU A;  5BN8 A;  4HTU A;  5AQS A;  1VSF A;  3O08 A;  4JI7 K;  3MWT A;  1KFD A;  3RWU A;  3C6T A;  3QEI A;  3U8X A;  4WQ5 C;  4IOC L;  4HUF A;  2VGN A;  4MDA A;  5AJ3 K;  4B9V A;  1D8Y A;  2QEX N;  2V51 B;  3L2Q A;  2QTD A;  5HOO A;  4I7F A;  3CF5 L;  2NRW A;  1S1T A;  4CED A;  3CER A;  4NXM K;  4JI4 K;  5C2D A;  3HO1 A;  2XY5 A;  5EVZ A;  2VGM A;  1N6Q A;  2O8B B;  1J5O A;  2F96 A;  1MA9 B;  3DRR A;  5C2F A;  1XC3 A;  3EEQ A;  2HHV A;  4KPY A;  3RRG A;  1Q81 O;  4DTN A;  3AGR A;  4YHH K;  1NMN A;  2OAN A;  1BA1 A;  4KHW A;  2Q0R A;  4O55 A;  2DY4 A;  4AHR A;  2E8A A;  1IBM K;  4YNQ A;  3V9U A;  3K5M A;  4PA1 A;  1QVG M;  2CH5 A;  3ASM A;  2D0O A;  4KRE A;  4HHT A;  3VEO A;  4KTW A;  3HOS A;  1NK9 A;  1HKG A;  5MLC Q;  3O80 A;  4CEE A;  1EKE A;  3V1Q A;  4DLG A;  4IO9 L;  3KLG A;  3DI6 A;  4GNI A;  4MLE A;  2OTL N;  2NRH A;  2PYL A;  3NFA A;  4YOV A;  3ZT3 A;  4U7B A;  3EYZ A;  4B8C A;  2QW9 A;  1Y97 A;  3CFO A;  4DF8 A;  1T6C A;  3QIN A;  4B9S A;  4DSI A;  3ZSX A;  3VQP A;  3ZET A;  4CJR A;  4JS5 A;  4YOT A;  3W0L A;  2E2Q A;  1M90 O;  2P9N A;  1QSL A;  3F73 A;  1W0H A;  3OYC A;  2QWN A;  4W5O A;  1SV5 A;  5DMR A;  5LJV A;  4CZM A;  3HRG A;  5LY3 A;  2W6K A;  2NRV A;  4J2E A;  2NLX A;  2I5J A;  2NUB A;  2A41 A;  3SMP A;  4JKF A;  3ZEU A;  2QKK A;  3NVM A;  4KFB A;  3DRP A;  2VG5 A;  1RFQ A;  4PL7 A;  1ZBH A;  1UAX A;  3VQ9 A;  1SL2 A;  3AO1 A;  4ID1 A;  2E6M A;  2P9U A;  4F9O A;  2BE2 A;  3KD1 E;  5EU7 A;  4KH5 A;  5AQO A;  3F5T A;  3WXJ A;  5B8H A;  1RDW X;  5AQQ A;  1TUU A;  3HPO A;  4DQR A;  1FKP A;  1IKV A;  2JWL A;  3QEX A;  4JK7 A;  4BC5 A;  2IVP A;  1WBB A;  4FK4 A;  1QQC A;  2E1Y A;  4KHQ A;  4MQ3 A;  5T7B A;  4JI8 K;  4CFA A;  4WQ4 A;  1S1X A;  1S3X A;  3J7Z O;  5AZI A;  1EP4 A;  3L4I A;  3M5R A;  1BQN A;  4R79 A;  3MAQ A;  4CJV A;  3LPT A;  1SL0 A;  1HKB A;  4EZ6 A;  2Y1I A;  3HOT A;  3PLA A;  2WBN A;  3I8B A;  5A2Q O;  1OH6 A;  4KH4 A;  1KVC A;  2BUP A;  1H1V A;  3T1Y K;  3NVK A;  4DTR A;  3OBW A;  2YHX A;  3MEG A;  2G8U A;  1RDU A;  3AGK A;  4FM2 A;  3CC4 N;  3CCE N;  3THY A;  3IFR A;  1WSI A;  4JI3 K;  2HVI A;  1HNX K;  4DF4 A;  4BVO A;  1N36 K;  2VG7 A;  3KTQ A;  3CPE A;  4CK2 A;  4CF9 A;  4DQS A;  1Q82 O;  4LF5 K;  4E7L A;  3CJB A;  3ULE A;  3VEZ A;  3CYM A;  3JS6 A;  4ELU A;  3CCU N;  4JI0 K;  4JRP A;  4FLW A;  3H46 O;  3AAP A;  1XWL A;  3BF1 A;  1D5A A;  3R6M A;  5IT9 O;  3AA4 A;  3AVA A;  3QNN A;  3AVL A;  1S6P A;  5KPR A;  1KLM A;  3K0S A;  2VQE K;  2Z1J A;  3CMA N;  3D2F A;  2IVO A;  3IRX A;  2ZF5 O;  4G9Z A;  2P9I B;  1X9W A;  3DLE A;  4BRN A;  4EP5 A;  2ZJR L;  5FRN A;  4A62 A;  3M6G A;  1ATR A;  4CEB A;  1NK7 A;  3PY8 A;  4WFB L;  3KLI A;  3S3N A;  2WTU A;  3FFK B;  4H0P A;  3PV8 A;  2JWK A;  1YXQ A;  4HVJ A;  4E1J A;  4FJX A;  4B08 A;  3B8A X;  4NYF A;  1BL3 A;  1K9M O;  3WNG A;  1KQS M;  4WQ5 A;  4F2R A;  4CF2 A;  3BF3 A;  3ENO A;  4DFP A;  2XHB A;  2VYP A;  2D0P A;  2I7N A;  2HHU A;  4DTJ A;  4BRE A;  2CH6 A;  2X6N A;  3OYE A;  3J80 O;  2YJF A;  3RMB A;  3PIO L;  2XY7 A;  1VSE A;  3TI0 A;  5JS2 A;  1JLF A;  4A2A A;  3K57 A;  4CW7 B;  4A61 A;  4DR7 K;  3CET A;  3QIO A;  4F8R A;  2FF3 B;  4FOI A;  4O4G A;  3TSP A;  4NCB A;  2D5R A;  3WUH A;  4QS7 A;  3NDK A;  4BR5 A;  4N41 A;  2HHH K;  4JKB A;  3VGL A;  2GTD A;  4BDZ A;  3OYM A;  2YHA A;  3ID6 A;  4FJ9 A;  4J2D A;  2A40 A;  4JKG B;  1LWF A;  4DSF A;  1JL1 A;  4Z4G A;  4DV3 K;  4JHD A;  3THW A;  3AVK A;  4QCL A;  1RT1 A;  4AF1 A;  2RN2 A;  1K8K B;  3AVM A;  4H8K A;  3KHY A;  4RW7 A;  2AP1 A;  1TL3 A;  3DOL A;  1F21 A;  1Z6R A;  1RDA A;  4E7K A;  4ELV A;  1I94 K;  1MWM A;  4JRQ A;  2HST A;  3TAM A;  4E3S A;  4CGG A;  4FWL A;  2IGI A;  2NRT A;  2F9W A;  4YOY A;  2NZT A;  4B1V A;  4FLZ A;  4E19 A;  1LCU A;  2YCH A;  5AQI A;  3KK2 A;  3CCQ N;  3D2E B;  4BQL A;  1HKC A;  4IZ9 A;  2FBY A;  1FW6 A;  4GV9 A;  5M1F A;  1T7P A;  4I9Q A;  1HJR A;  3CME N;  3ZSZ A;  3WT0 A;  1DTT A;  3T7Z A;  4B1X B;  5C15 A;  3O8M A;  3HPH A;  4G1Q A;  2O8C A;  4CJ3 A;  5EY4 A;  3WNH A;  1HNW K;  3TAN A;  4JKH A;  5KQD A;  4FJM A;  1TKX A;  1ZBL A;  5KI6 A;  3ALY A;  1EQY A;  3ULD A;  4DV6 K;  4KI6 A;  3R8E A;  3OJS A;  4BR4 A;  4FJN A;  4CZL A;  3NHG A;  3H1Q A;  5BRE A;  4JN4 A;  4KAZ A;  3CJ9 A;  4AHS A;  1NOY A;  3CC2 N;  3OYF A;  3FFI A;  3KLH A;  5KPT A;  1C0M A;  1J53 A;  4TSX A;  4FVU A;  2HND A;  1WAJ A;  2ITG A;  4NLC A;  2B4J A;  2RPI A;  4JKD A;  4DQQ A;  4DSE A;  4FJ8 A;  3K59 A;  4C1N I;  3C7N B;  2GUP A;  3IDH A;  3C65 A;  5CHI A;  4MO5 A;  4H5W A;  3SCX A;  3WQU A;  1J5E K;  1W2B M;  2G8V A;  4LF9 K;  3SQ2 A;  1E3M A;  1JCE A;  2DPN A;  4AM7 A;  4B8A B;  2WON A;  2ZQB A;  4GV3 A;  4Z4H A;  1VQ9 N;  4FJK A;  1G99 A;  3VA3 A;  1UWB A;  4H5T A;  3G25 A;  3E9P A;  2G8H A;  4QOZ B;  5AR0 A;  2YI1 A;  1BCM A;  4OX9 K;  4KKO A;  1VSM A;  1HR0 K;  1SAZ A;  4KH6 A;  3S41 A;  2F8T A;  2HHT A;  1LOT B;  1BIU A;  4B9T A;  3DXK A;  3BP8 A;  5TKW A;  4CCH A;  2OZS A;  3ZX3 A;  4JI1 K;  3ATU A;  4M7X A;  4OLA A;  3SPZ A;  3SAG A;  1KCF A;  4C8M A;  5AFU A;  3CCV N;  1SKW A;  3TWH A;  4LSL A;  3WXM B;  4DB3 A;  5K14 A;  3IS9 A;  3KLF A;  4FXD A;  3C94 A;  1IV0 A;  1CZA N;  3L6Q A;  1T44 A;  2UXD K;  3O1W A;  5LMU K;  2W41 A;  5HBM A;  1YJW N;  1B9F A;  3QFU A;  3BUZ B;  4OGE A;  3UKR A;  2YNI A;  4Z4I A;  4I9L A;  1U04 A;  1OH5 A;  3SZ2 A;  4K41 A;  3OJU A;  2VCP A;  2P9P B;  4HUG A;  4M3U A;  1HNZ K;  2W42 A;  2CGL A;  3AVH A;  1XHZ A;  3FZK A;  3TAP A;  4JKA A;  3LAK A;  1NNE A;  1S6Q A;  3ZCM A;  3DAW A;  3NMU A;  3G4S N;  2HNZ A;  2IAJ A;  1ZXO A;  2PFU A;  3LM9 A;  1L3S A;  4OVL A;  1N34 K;  2P9S A;  1VK0 A;  3VET A;  3AO3 A;  4BRC A;  1T3V A;  3H1V X;  4WE1 A;  5AQN A;  4CZE A;  4YY3 K;  1GLE G;  1VRT A;  4BC2 A;  4FZX C;  4CJ7 A;  3EE9 A;  3VEV A;  4UQG A;  1XUP O;  1RBV A;  2RF2 A;  4B1U B;  4BWM A;  2VWJ A;  3O5B A;  4IKF A;  3CHW A;  3M8S A;  1NGF A;  4LSN A;  4FLY A;  4H0T B;  4HTL A;  1RT5 A;  3HVR A;  4LC9 B;  4CJL A;  5J1E A;  1YAG A;  4PY5 A;  3QML A;  4NCA A;  2V7Y A;  2CGJ A;  5KRS A;  1NKE A;  3CCS N;  4DFK A;  2BDP A;  3KK3 A;  1J6Z A;  2IDO A;  3EZW A;  1C1C A;  3I56 N;  1IKW A;  4FWR A;  3CM5 A;  1BWF O;  1VSH A;  3AAQ A;  4X62 K;  1L3T A;  3D0P A;  4IFY A;  3H3N O;  3P4I A;  1EWQ A;  4DSK A;  4A59 A;  3O3G A;  3QIP A;  1NJY A;  1U4B A;  3SAF A;  3AO2 A;  2HBL A;  3UIQ A;  1QE1 A;  3O1B A;  3G0Z A;  1NGE A;  3DJC A;  2QI2 A;  3TAQ A;  4BRF A;  5LMN K;  3WNE A;  1NU0 A;  4O44 A;  2YNF A;  4B3M K;  4DTS A;  4DU3 A;  1NOZ A;  4BRH A;  5M1Q A;  4JNE A;  1ASU A;  4FK0 A;  4EZ9 A;  1YTU A;  1VSL A;  2JLE A;  3P31 A;  5CE3 A;  4ILH A;  3SQ0 A;  1TAU A;  2E2O A;  2YJE A;  1ASW A;  1DEJ A;  4IDK A;  4JK9 A;  4DQ8 A;  1NK4 A;  1Q9Y A;  2O8E A;  2A6A A;  4YOX A;  5AQT A;  4BRP A;  2QXF A;  1U45 A;  4FPB A;  4LH5 A;  4CGF A;  3R1X A;  3CQY A;  1C6V A;  3H08 A;  2RKI A;  4M3T A;  1WSG A;  4DS4 A;  4X64 K;  4DS5 A;  2P9K B;  3O9T A;  4CEA A;  3LZI A;  2OZM A;  1TKT A;  4M3R A;  4B1W B;  1YUW A;  4C23 A;  1HPM A;  3DXM B;  3NF7 A;  3QEP A;  1S5J A;  3ZT1 A;  4BRD A;  1HMV A;  1SKS A;  4XH1 A;  3L0Q A;  5E41 A;  3L2W A;  3B6P A;  3F2K A;  3CG7 A;  5CY4 A;  1KLN A;  5M1K A;  4OPJ A;  4FVM A;  3U9Z A;  3HI0 A;  4RG8 A;  4A5B A;  3HVT A;  1L5U A;  1WNS A;  3EZ5 A;  3MN5 A;  5HRR A;  1HJO A;  2HB5 A;  2E20 A;  5BPN A;  1HQU A;  4Z4F A;  3J7A P;  4W5R A;  3OYK A;  4Z94 A;  3OYA A;  4JKG A;  3K5N A;  4I6M A;  4MDB A;  1MU2 A;  4DQP A;  2NRX A;  3C95 A;  1RDC A;  4WFN L;  4Z4C A;  3Q7B A;  2F4V K;  5FLX O;  1TAQ A;  4BR7 A;  2VWB A;  2AJQ A;  2YV0 X;  4BAC A;  5JIC A;  2B5J A;  1JCG A;  4CJ5 A;  2WUS A;  3L2R A;  1JCF A;  1JLC A;  3KVG A;  4CIF A;  5FPD A;  2O8D A;  1NGJ A;  4CJ4 A;  4DTU A;  3OYH A;  4H4O A;  3ITH A;  2O4I A;  1B9D A;  3THX B;  3SNN A;  1TL1 A;  3D7E O;  1JJ2 M;  1KAZ A;  4M3Z A;  5D3G A;  2RHK A;  4BY9 C;  1KRP A;  1VQ5 N;  3ZT2 A;  5KPZ A;  3ZYY X;  1GOC A;  2QWP A;  2P1J A;  1BI4 B;  4LH4 A;  2Q0U A;  1JL2 A;  3VEY A;  3DLK A;  3O6W A;  2GWK A;  3W3D A;  2KZM A;  3CPW M;  4NXN K;  3AO4 A;  3WXK A;  3OYB A;  5EXW A;  3SK3 A;  3S3O A;  3LP0 A;  3EY1 A;  3RMA A;  2PBD A;  2G8W A;  2FBX A;  4K42 A;  5KQ8 A;  3O4W A;  1HQE A;  3F9M A;  5C24 A;  4K0K K;  3ZSR A;  4DUZ K;  1WSF A;  3KK1 A;  1W9H A;  5C42 A;  1KAY A;  4JEP A;  1M1K O;  1YIJ N;  3FR0 A;  4CBU A;  4DV0 K;  3V9W A;  3KWI A;  2IS3 A;  3HJF A;  5JS1 A;  4IJN A;  1NGC A;  3OVN A;  1NJW A;  1KVA A;  3M3Z A;  1HYZ A;  5I42 A;  1RT2 A;  5HL7 L;  4CGD A;  3SJH A;  3SUN A;  1T03 A;  1TYQ A;  3CC7 N;  3PIP L;  1DT9 A;  2OCE A;  1ZBS A;  4NCG A;  3MCA B;  1KTQ A;  4BDY A;  3JYT A;  3K9K A;  1GLD G;  2RE2 A;  2UXB K;  4CEQ A;  3JSM A;  5BPL A;  2HMP A;  2VG6 A;  4JD2 A;  3H6E A;  4N47 A;  3AA5 X;  4Y1D A;  4FCY A;  3R3L A;  3L8B A;  2I7P A;  1TK0 A;  3WEE B;  4JS4 A;  2P51 A;  1WOQ A;  4MLH A;  2DFH A;  3HP6 A;  1YIT N;  3RMD A;  2EWS A;  5AQY A;  4CZF A;  3MMV A;  3HPG A;  5FRO A;  3L3U A;  1TVR A;  3VQE A;  1SKR A;  2YNH A;  2ZD1 A;  4DR1 K;  3VF6 A;  1C1A A;  3HM9 A;  3IG1 A;  1VQO N;  5AZJ B;  3SUO A;  3V1R A;  3KKS A;  1MWK A;  3NF6 A;  1K8A O;  5EOY A;  4CJP A;  2J4R A;  3RSE A;  3NH0 A;  4C1N K;  1D9F A;  4KBO A;  3EE8 A;  4H5N A;  3QES A;  4WYB A;  1WSH A;  3VEN A;  3OYD A;  2FSN A;  1NGD A;  4Z4E A;  1FJG K;  3KWG A;  4I2P A;  5AQF A;  3NAE A;  4Z0U A;  1A5V A;  4BRK A;  3EN9 A;  3OYG A;  4OJR A;  3MDQ A;  4KO0 A;  4DSJ A;  1VSD A;  3BEX A;  3O9Q A;  1TUY A;  4FLV A;  5AFU H;  4FK2 A;  4BC3 A;  3MN6 A;  3VQB A;  3VQQ A;  1C0T A;  4I2Q A;  4B3O A;  3QLH A;  3UKU B;  4CD1 A;  2P9L B;  4FYD A;  5AQX A;  3KJV A;  1QVF M;  1IBK K;  4FJ7 A;  5HRP A;  4DQI A;  1HYV A;  3TR8 A;  4FW1 A;  5DM6 L;  4BRQ A;  3VPZ A;  1S9E A;  3VEX A;  1S22 A;  4EIA A;  3CJ1 A;  3B6O A;  4DCH A;  4KRF A;  4B9N A;  3L2U A;  2GUI A;  2ZGZ A;  4NO7 A;  3CCJ N;  4K8Z A;  4FO0 A;  3LDS A;  2VQF K;  2O8F A;  1XNR K;  1IKY A;  3TTD A;  2DFE A;  2OPS A;  4KHP K;  4CF1 A;  4HCC A;  3VMF B;  4CZK A;  2O4G A;  3LP1 A;  1BIS A;  2HBJ A;  1U2V A;  5CYM A;  3PO5 A;  1VHX A;  4DR5 K;  3U3Y A;  1QZ6 A;  3QEV A;  1EO1 A;  4B3T K;  2HNY A;  2UU9 K;  2GEM A;  5ADX A;  2B6A A;  3CJA A;  3N4Q A;  2ZE2 A;  3TAE A;  4F2S A;  4GVM A;  3PO4 A;  2QKB A;  5AQJ A;  4YOU A;  2X78 A;  1YJ9 N;  1L3U A;  5DK5 A;  1X3M A;  3DWL A;  3N4P A;  2V52 B;  2DTU A;  3FE1 A;  3SLC A;  5HRO A;  3OYJ A;  2D0C A;  1RBS A;  1BU6 O;  3KD5 E;  4CHZ A;  3TSQ A;  4LD0 A;  1OVQ A;  3U9D A;  4CEF A;  4AHT A;  1K73 O;  1I3A A;  1DLO A;  4BE0 A;  2Z1H A;  3BZC A;  4FW2 A;  5FPN A;  2FXU A;  4CJE A;  3VF4 A;  3NGY A;  4ILJ A;  4K8X A;  3CI5 A;  2QWQ A;  1DTQ A;  5BN9 A;  1E4G T;  1REV A;  3KKR A;  1BOT O;  4BG9 A;  1ZC6 A;  4HCB A;  3DLG A;  1OVY A;  2HHQ A;  4FM0 A;  3DMJ A;  1J54 A;  5AQM A;  4M3W A;  5C12 A;  2WFB A;  2ZJP L;  5BPM A;  2IC3 A;  4JI5 K;  3H45 C;  3ZET B;  2ZWH A;  2QK9 A;  4DUY K;  4Y0W A;  2P9N B;  3QBX A;  4WF9 L;  3VA0 A;  1YJN N;  2HVH A;  4FL9 A;  5J2M A;  3MCP A;  5HRN A;  3OA9 A;  5H1S Q;  4E7H A;  1X9M A;  4MFB A;  1NMD A;  1Z26 A;  4KHS A;  4RW9 A;  3BDP A;  4PKI A;  3DLR A;  4QS8 A;  3SV3 A;  3A5O C;  4IDH A;  3AVB A;  1IO2 A;  2IVN A;  3O3H A;  2E6L A;  4BG8 A;  4BDP A;  3VGM A;  4KHY A;  3OYN A;  3KLE A;  1XNQ K;  3HK2 A;  1N32 K;  2O8B A;  4FJ5 A;  3CD6 N;  2A1S A;  3ZX0 A;  4GKK K;  3OS0 A;  4ID5 A;  1UA1 A;  1NM1 A;  5FPE A;  3ZEU B;  2JGU A;  2KLA A;  2HMI A;  5EX5 A;  3WXI A;  3SAH A;  4NB4 A;  1GLJ O;  3A5M C;  2P9U B;  3VTH A;  1ESV A;  3E01 A;  4AH9 A;  1Q7Y O;  4LFC K;  1SS6 A;  1X3N A;  4JAX A;  4DR3 K;  3LDQ A;  3O9U A;  3TU5 A;  3HBT A;  3ZSY A;  2KZZ A;  4YFU A;  2E4L A;  4BRM A;  3EL2 A;  1T8E A;  5KGX A;  3VQ4 A;  2FC0 A;  4PHT X;  4CHN A;  1NK6 A;  4CGJ A;  2E1Z A;  5GAD P;  3U6F A;  1MDU B;  2PAV A;  4FLT A;  2QXL A;  4J2A A;  2QWO A;  2Q31 A;  2EX3 A;  5AZI B;  4CF8 A;  1ZBU A;  4F3T A;  1XHX A;  1G15 A;  4CES A;  4KB0 A;  1CLQ A;  3AVN A;  4YDU C;  3FZF A;  2Q2R A;  1D4X A;  3A0I X;  3SBG A;  4H0O A;  4R5P A;  2D1K A;  3OS2 A;  1VQM N;  1RTJ A;  1ATS A;  4OKJ A;  3LAM A;  4XH4 A;  2X74 A;  4Y1C A;  4H0V B;  3K2P A;  4KV8 A;  1QQN A;  3CQX A;  3QB0 A;  1JLE A;  3NH1 A;  1QQM A;  3I55 N;  3OHR A;  1ZYQ A;  4U67 L;  4CZI A;  4AQY K;  3THY B;  3VQ8 A;  4EAH D;  1KFS A;  3GOI A;  1TKD A;  1NGH A;  1GOA A;  3SBT A;  4RW6 A;  1KC8 O;  1TV6 A;  5CR4 A;  3U4L A;  4YOW A;  4CHO A;  2WC9 A;  3VQ5 A;  3ZSV A;  4KHN A;  4CVN E;  5KGW A;  2BGG A;  2HBM A;  3ULE B;  1BA0 A;  1SUQ A;  1KXP A;  4CJS A;  4E0D A;  3C6H A;  1JKH A;  2UUA K;  4O8U A;  3ENB A;  1S1V A;  3VTI A;  3NGZ A;  1IH7 A;  3VOV A;  4CIE A;  3MXM A;  2IOC A;  1VQN N;  1WSJ A;  3SYZ A;  3D2F B;  4K43 A;  3TTC A;  4BRI A;  4C8L A;  1YTA A;  4A2B A;  1HLU A;  1RTH A;  4M42 A;  2F7T A;  2GBZ A;  2Y1J A; 
#chains in the Genus database with same CATH homology
 2VG7 A;  4CFD A;  4DQP A;  1D9D A;  4CK2 A;  3KTQ A;  3C95 A;  4CF9 A;  4DQS A;  4B9M A;  1FXX A;  3DOK A;  1RDC A;  1HPZ A;  3VN5 A;  4E7L A;  1WAF A;  4Z4C A;  3CYM A;  4DTM A;  1Q8I A;  4ELT A;  4ELU A;  4OKE A;  4JRP A;  1J9A A;  4FLW A;  1UA0 A;  1NKB A;  1Q9X A;  1TAQ A;  4BWJ A;  2PZS A;  2OPQ A;  4OPK A;  1XWL A;  3NE6 A;  4GW6 A;  1D5A A;  4CEO A;  2AJQ A;  1RT4 A;  2XO7 A;  4HUE A;  2YV0 X;  3AA4 A;  3AVA A;  3QNN A;  3PX6 A;  1WLJ A;  2OPR A;  4BAC A;  1NKC A;  3IAY A;  2B5J A;  3DLB A;  4CJ5 A;  4E1M A;  3AVL A;  4CJQ A;  1S6P A;  2GV9 A;  1KLM A;  3L2R A;  1JLC A;  4C8O A;  4FZZ A;  4CIF A;  1CZ9 A;  2Z1J A;  1KVB A;  1UOC A;  4DTO A;  3F9K A;  4CJ4 A;  4Q0B A;  4DTU A;  3IRX A;  3OYH A;  4H4O A;  3ITH A;  2O4I A;  5I3U A;  1B9D A;  5C25 A;  1L3V A;  3SNN A;  4E89 A;  3VQC A;  4DFM A;  3AA3 A;  1TL1 A;  1X9W A;  4N56 A;  3DLE A;  4M3Z A;  4EP5 A;  1NJZ A;  5D3G A;  5FRN A;  2PY5 A;  1KRP A;  4L8R B;  4PWD A;  1RT3 A;  3ZT2 A;  1NK7 A;  2DFF A;  2OPP A;  4CEB A;  3PY8 A;  3KLI A;  3SI6 A;  1BIZ A;  1GOC A;  3S3N A;  2P1J A;  1BI4 B;  4LH4 A;  3PV8 A;  1JL2 A;  4HVJ A;  3DLK A;  3LP2 A;  4FJX A;  4B08 A;  2HHX A;  3OY9 A;  4OLB A;  4AHV A;  4NYF A;  4DFJ A;  2KZM A;  1BL3 A;  4RW8 A;  3AO4 A;  3L3V A;  4FM1 A;  3WNG A;  3P1G A;  4F2R A;  4CF2 A;  1RIL A;  3OYB A;  4DFP A;  4FJJ A;  3ZSO A;  2XHB A;  1LV5 A;  1CXU A;  4DTP A;  2FBV A;  1HYS A;  3S3O A;  3LP0 A;  3EY1 A;  1LW0 A;  4IBN A;  3MEE A;  3RMA A;  2G8W A;  1X1P A;  2FBX A;  2HHU A;  3L2V A;  4DTJ A;  3MXI A;  4E7I A;  1HQE A;  2X6N A;  4CK1 A;  3O4Q A;  3OYE A;  3LZJ A;  5C24 A;  3RMB A;  4DWI A;  1VRU A;  3AVF A;  3ZSR A;  3I0S A;  2KQ2 A;  1VSE A;  3PUF A;  1WSF A;  5J2Q A;  3KK1 A;  2XY7 A;  1W9H A;  3TI0 A;  2EHG A;  1RT7 A;  3DYA A;  3G10 A;  5JS2 A;  5C42 A;  3SPY A;  1JLF A;  3K57 A;  3SQ1 A;  4M45 A;  3QIO A;  4F8R A;  3M8R A;  4O4G A;  3AV9 A;  3U3G A;  4NCB A;  2D5R A;  2KFZ A;  3NDK A;  3V9W A;  4N41 A;  4FJH A;  2IS3 A;  3HJF A;  5JS1 A;  2WOM A;  3P83 D;  4BDZ A;  1BI4 A;  3TAB A;  3OYM A;  3OVN A;  1NJW A;  1KVA A;  2YHA A;  1HYZ A;  1Z25 A;  3D45 A;  1RT2 A;  3VQA A;  3RRH A;  3SUQ A;  4CGD A;  4CHY A;  3NH2 A;  3SUN A;  1T03 A;  4J2D A;  4CJK A;  4IFV A;  2OA8 A;  4FJ9 A;  2YKM A;  1LWF A;  3I8D A;  3MED A;  4DSF A;  1JL1 A;  4Z4G A;  3AVK A;  3PX0 A;  4O0I A;  3RR8 A;  4QCL A;  1RT1 A;  4NCG A;  4DU1 A;  3TAG A;  2RN2 A;  4FJI A;  1X9S A;  3K58 A;  3AVM A;  1KTQ A;  4H8K A;  4CEZ A;  4BDY A;  4AHU A;  4RW7 A;  3JYT A;  3QNO A;  4CEQ A;  2BAN A;  4IG3 A;  1TL3 A;  3DOL A;  1F21 A;  1NK0 A;  3JSM A;  1FK9 A;  1EET A;  1HNI A;  5FRM A;  1A5X A;  1RDA A;  2VG6 A;  3HL8 A;  4E7K A;  4N47 A;  3AA5 X;  4ELV A;  3NF8 A;  4Y1D A;  5FDL A;  4JRQ A;  4FCY A;  3TAM A;  3DRS A;  3L8B A;  4CGG A;  4E3S A;  1TK0 A;  2P5G A;  4JS4 A;  5I42 A;  1R0A A;  2G8I A;  2IGI A;  2F8S A;  1CXQ A;  1RNH A;  2P51 A;  3QEW A;  2DFH A;  3HP6 A;  3TAR A;  3RMD A;  4FLZ A;  4E19 A;  3KK2 A;  1HNV A;  3T3F A;  3AVJ A;  3HPG A;  5FRO A;  3L3U A;  3V9X A;  3NF9 A;  1U49 A;  4AHC A;  3HYF A;  1NJX A;  4J2B A;  2FBY A;  1TVR A;  1T7P A;  4I9Q A;  1HJR A;  3VQE A;  3OS1 A;  2YNH A;  2ZD1 A;  3ZSZ A;  4CFB A;  3RTV A;  1SKR A;  1DTT A;  4DG1 A;  1C1A A;  3SUP A;  4BE2 A;  3HM9 A;  4ZTF A;  4FLX A;  3HPH A;  3IG1 A;  4W5T A;  4N5S A;  3SUO A;  4G1Q A;  3V1R A;  3KKS A;  2FBT A;  3NF6 A;  3LP3 A;  4CJ3 A;  2YNG A;  2G8F A;  4CJP A;  4F3O A;  4KI4 A;  3WNH A;  2YHB A;  3TAN A;  1QS4 A;  2Z1G A;  3NH0 A;  1D9F A;  4FJM A;  1TKX A;  1ZBL A;  2ETJ A;  5KI6 A;  1TGO A;  3THV A;  3QES A;  1NK8 A;  3ALY A;  1VSJ A;  1ASV A;  1WSH A;  4CJU A;  3OYD A;  1KSP A;  1RT6 A;  4Z4E A;  3MXJ A;  1WN7 A;  3ULD A;  1C1B A;  1I39 A;  4KI6 A;  4I2P A;  3NAE A;  2XY8 A;  4Z0U A;  1A5V A;  3SJJ A;  2D0B A;  3OJS A;  1BHL A;  4FJN A;  4CER A;  3OYG A;  4OJR A;  4DLE A;  1YT3 A;  4KO0 A;  3P5J A;  3NHG A;  4LY7 A;  1BCO A;  4DSJ A;  1VSD A;  4FLV A;  4OGC A;  4FK2 A;  4CJF A;  1T05 A;  3CM6 A;  4CK3 A;  3DLH A;  3VQB A;  3VQQ A;  4CJW A;  4FJL A;  4CIG A;  1C0T A;  4I2Q A;  2HW3 A;  4B3O A;  3QLH A;  4KAZ A;  3A2F A;  4CHQ A;  4AHS A;  1NOY A;  4B9L A;  4FYD A;  4W5N A;  4JLH A;  3OYF A;  3KJV A;  1K6Y A;  3FFI A;  5SWM A;  3KLH A;  1U47 A;  2P5O A;  1BGX T;  1C0M A;  3AO5 A;  1J53 A;  4TSX A;  2HND A;  1WAJ A;  1LAW A;  2KW4 A;  2ITG A;  3LAN A;  2B4J A;  4FJ7 A;  5HRP A;  2RPI A;  1HYV A;  4DQI A;  4KB1 A;  3TR8 A;  4FLU A;  1VSK A;  1YVU A;  4FW1 A;  4DQQ A;  1JLB A;  3S9H A;  1EXQ A;  4DSE A;  1S9E A;  4FJ8 A;  4H4M A;  3K59 A;  1FKO A;  3B6O A;  5HLF A;  1RTD A;  4KRF A;  3KIO A;  4B9N A;  1ITG A;  4OKK A;  4IG0 A;  2KFN A;  3L2U A;  2GUI A;  1QSY A;  3OYI A;  3O4N A;  3OYL A;  1QTM A;  4K8Z A;  4FZY A;  1RDB A;  3LDS A;  3SCX A;  2X6S A;  4KHU A;  2ATQ A;  2G8V A;  5KTQ A;  1IKY A;  1JLG A;  2DFE A;  2OPS A;  3TAF A;  3SQ2 A;  3AVC A;  4B8A B;  4CF1 A;  4HCC A;  2O4G A;  2WON A;  2ZQB A;  1BIS A;  3LP1 A;  3T1A A;  4Z4H A;  4ZTJ A;  4FJK A;  5CYM A;  3PO5 A;  3O3F A;  3U3Y A;  2A1R A;  3VA3 A;  1UWB A;  4XIU A;  1N5Y A;  3QEV A;  2G8H A;  4QOZ B;  2HNY A;  1QHT A;  1BCM A;  1LWC A;  4AIL C;  2B6A A;  1B92 A;  4KKO A;  2ZE2 A;  4O5B A;  1VSM A;  1JXB A;  4C8N A;  3CFR A;  3TAE A;  4F2S A;  3V9Z A;  4GVM A;  3SV4 A;  2F8T A;  2HHT A;  3PO4 A;  4CHP A;  2QKB A;  4C8K A;  2X78 A;  5CZ2 A;  3ZT4 A;  1L3U A;  1BIU A;  5DK5 A;  4W5Q A;  4B9T A;  1BQM A;  2DTU A;  1O1W A;  4CCH A;  2OZS A;  1RCH A;  5HRO A;  3OYJ A;  3SPZ A;  4OLA A;  4CF0 A;  3ZT0 A;  4EP4 A;  1KCF A;  2D0C A;  5HP1 A;  3M8P A;  3RR7 A;  1RBS A;  3AVI A;  4C8M A;  3K5O A;  1SKW A;  3KD5 E;  4CHZ A;  1S9G A;  3WNF A;  1C0U A;  4CFC A;  3TWH A;  4LSL A;  4DF4 A;  4PQU A;  4LD0 A;  5K14 A;  4CEF A;  3IS9 A;  4HTU A;  4AHT A;  1I3A A;  1RDD A;  1DLO A;  1VSF A;  3KLF A;  4BE0 A;  2Z1H A;  4FW2 A;  4DU4 A;  3C94 A;  2PYJ A;  4FXD A;  1KFD A;  3RWU A;  3V1O A;  1XI1 A;  3C6T A;  3QEI A;  3SQ4 A;  4CJE A;  5KRT A;  5HBM A;  2R7Y A;  1IG9 A;  4HUF A;  1B9F A;  2D0A A;  3NGY A;  4Q5V A;  1RBR A;  4K8X A;  4OGE A;  1DTQ A;  4B9V A;  1D8Y A;  4CGH A;  2YNI A;  3ZSW A;  1S1U A;  1U48 A;  4Z4I A;  4I9L A;  1REV A;  3L2Q A;  2VWK A;  1U04 A;  3HXM A;  4CJT A;  3KKR A;  4I7F A;  3SZ2 A;  1IKX A;  1S1T A;  4CED A;  3OJU A;  3S3M A;  2OYQ A;  4HUG A;  4M3U A;  3HO1 A;  2XY5 A;  2W42 A;  3DLG A;  4HCB A;  2HHS A;  1RTI A;  3AVH A;  4RW4 A;  1XHZ A;  1N6Q A;  1J5O A;  3TAP A;  2HHQ A;  4FM0 A;  2F96 A;  3LAK A;  3DRR A;  3DMJ A;  1J54 A;  4E7J A;  1S6Q A;  3ZCM A;  1SL1 A;  4KPY A;  4M3W A;  2HHV A;  3RRG A;  4CGI A;  3RMC A;  2HNZ A;  2IAJ A;  3VQ7 A;  3LWL A;  4DTN A;  3LPU A;  1L3S A;  4PUO A;  2IC3 A;  4OVL A;  1VK0 A;  3AO3 A;  1RBT A;  4KHW A;  4O55 A;  3V9S A;  2DY4 A;  4WE1 A;  4AHR A;  2QK9 A;  4YNQ A;  3LWM A;  3VA0 A;  3V9U A;  1VRT A;  4FZX C;  3K5M A;  4PA1 A;  4BE1 A;  5J2M A;  2HVH A;  4UQG A;  5HRN A;  4E7H A;  4N76 A;  1X9M A;  1RBV A;  3ASM A;  4MFB A;  2RF2 A;  3HP9 A;  4KRE A;  1Z26 A;  4HHT A;  4KTW A;  3LAL A;  4BWM A;  2VWJ A;  4KHS A;  4RW9 A;  1NK9 A;  4IKF A;  3BDP A;  3DLR A;  3M8S A;  4O0J A;  4LSN A;  4FLY A;  3SV3 A;  4CEE A;  3CQ8 A;  1EKE A;  3AVB A;  1RT5 A;  3AA2 A;  5SZT A;  1IO2 A;  1TKZ A;  4QAG A;  2E6L A;  3C6U A;  3V1Q A;  3O3H A;  4BDP A;  4DLG A;  4M3Y A;  3KLG A;  4KHY A;  3DI6 A;  3OYN A;  3KLE A;  3HVR A;  3K5L A;  3HK2 A;  4CJL A;  5J1E A;  2A1S A;  4DMN A;  1CZB A;  2YKN A;  3OS0 A;  4F4K A;  4ID5 A;  4FJ5 A;  1UA1 A;  4PY5 A;  2PYL A;  3NFA A;  4NYN A;  4NCA A;  3ZT3 A;  2JGU A;  3EYZ A;  4B8C A;  5KRS A;  1NKE A;  1Y97 A;  3CFO A;  3HST B;  4DFK A;  4DF8 A;  2HMI A;  4M41 A;  3KK3 A;  2BDP A;  3QIN A;  3MEC A;  2IDO A;  4B9S A;  4DSI A;  4M3X A;  3DM2 A;  3ZSX A;  1C1C A;  3VQP A;  4CJR A;  4JS5 A;  4FJG A;  4CEC A;  1IKW A;  3I0R A;  3QER A;  1QSL A;  2XY6 A;  3CM5 A;  3F73 A;  1W0H A;  1VSH A;  3OYC A;  1ZBI A;  3E01 A;  1L3T A;  4AH9 A;  3D0P A;  4IFY A;  3VQD A;  4W5O A;  1SV5 A;  4GMJ B;  5DMR A;  4DSK A;  3O3G A;  3QIP A;  4KTZ A;  1ZBF A;  3ZSY A;  3HT3 A;  1U4B A;  1NJY A;  2KZZ A;  3AO2 A;  4YFU A;  2KTQ A;  1LW2 A;  2E4L A;  4J2E A;  3UIQ A;  1QE1 A;  3PX4 A;  2I5J A;  3G0Z A;  5KGX A;  1T8E A;  3VQ4 A;  2HHW A;  2FC0 A;  2NUB A;  4CHN A;  2XRI A;  1VSI A;  1NK6 A;  4CGJ A;  3TAQ A;  3VQ6 A;  3U6F A;  5J2N A;  4FLT A;  3V81 A;  1EX4 A;  2QKK A;  3WNE A;  3V4I A;  4J2A A;  4KFB A;  4O44 A;  2YNF A;  4KTQ A;  1JXE A;  2EX3 A;  3DRP A;  1QSS A;  4CF8 A;  1ZBU A;  2VG5 A;  4F3T A;  4DTS A;  4ICL A;  1XHX A;  1G15 A;  4CES A;  4DU3 A;  4KB0 A;  1NOZ A;  1CLQ A;  3AVN A;  2Q3S A;  1ZBH A;  1ASU A;  1UAX A;  4FK0 A;  1HRH A;  3VQ9 A;  2Z1I A;  2LSN A;  4EZ9 A;  1SL2 A;  1YTU A;  1VSL A;  2JLE A;  3AO1 A;  4ID1 A;  4CE9 A;  4R5P A;  2E6M A;  5CZ1 A;  3OS2 A;  1RTJ A;  3SQ0 A;  2BE2 A;  1RBU A;  4OKJ A;  3LAM A;  5EU7 A;  2X74 A;  3KD1 E;  4Y1C A;  1TAU A;  4KV8 A;  3K2P A;  1ASW A;  4IDK A;  1JLE A;  1Q9Y A;  3NH1 A;  1NK4 A;  1LWE A;  1JLA A;  4B9U A;  2QXF A;  1U45 A;  4LH5 A;  4CGF A;  3HPO A;  4DQR A;  1FKP A;  1IKV A;  3T19 A;  3QEX A;  1S1W A;  1ZYQ A;  1C6V A;  3CFP A;  3ISN C;  3H08 A;  1KFS A;  3VQ8 A;  2RKI A;  4M3T A;  4FK4 A;  1QQC A;  4KHQ A;  3BGR A;  1WSG A;  4DS4 A;  4MQ3 A;  5T7B A;  4DS5 A;  3QET A;  1TKD A;  4CFA A;  1GOA A;  4E1N A;  4RW6 A;  1WSE A;  3QO9 A;  1TV6 A;  4CEA A;  1S1X A;  5HRS A;  3LZI A;  2OZM A;  4CHO A;  1TKT A;  4M3R A;  3VQ5 A;  3ZSV A;  4KHN A;  5KGW A;  2BGG A;  1EP4 A;  1GOB A;  2G8K A;  3ZSQ A;  3NF7 A;  1BQN A;  3QEP A;  1SUQ A;  1S5J A;  3ZT1 A;  3MAQ A;  4CJS A;  4CJV A;  3LPT A;  3NGI A;  1SL0 A;  1HMV A;  4DSL A;  1SKS A;  4E0D A;  4ZHR A;  1JKH A;  1XC9 A;  5E41 A;  3M8Q A;  4EZ6 A;  1S1V A;  3L2W A;  2Y1I A;  4DTX A;  1A5W A;  3B6P A;  3CG7 A;  5CY4 A;  3NCI A;  1KLN A;  4OPJ A;  3V6D A;  3NBP A;  4FVM A;  3NGZ A;  1IH7 A;  1KVC A;  1JLQ A;  4RG8 A;  3HVT A;  4CIE A;  5J2P A;  3MXM A;  2IOC A;  4DTR A;  1L5U A;  1WNS A;  1WSJ A;  3EZ5 A;  3MEG A;  2G8U A;  5HRR A;  2HB5 A;  4FM2 A;  1HQU A;  4Z4F A;  4W5R A;  3SYZ A;  1TK8 A;  3AVG A;  3OYK A;  1WSI A;  5CYQ A;  1NK5 A;  1LAV A;  1TK5 A;  1YTA A;  4C8L A;  2HVI A;  3OYA A;  1RTH A;  3K5N A;  4M42 A;  2GBZ A;  1MU2 A;  2Y1J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...