2Z1GA

Crystal structure of e.coli rnase hi surface charged mutant(q4r/t40e/q72h/q76k/q80e/t92k/q105k)
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
155
structure length
155
Chain Sequence
MLKRVEIFTDGSCLGNPGPGGYGAILRYRGREKTFSAGYERTTNNRMELMAAIVALEALKEHCEVILSTDSHYVRKGITEWIHNWKKRGWKKADKKPVKNVDLWKRLDAALGQHQIKWEWVKGHAGHPENERCDELARAAAMNPTLEDTGYQVEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Protein Thermostabilization Requires a Fine-tuned Placement of Surface-charged Residues
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Ribonuclease HI
total genus 48
structure length 155
sequence length 155
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2007-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2z1gA00
4NCAA 1BI4A 4MQ3A 2YKMA 4M3ZA 1RBTA 4EZ6A 3HP6A 4ELTA 3QEWA 4FJJA 4RW9A 3VQ6A 3VQAA 1CLQA 1L3SA 4DFMA 3KLFA 4IDKA 2YNHA 2P1JA 1RT2A 1X9MA 3ZSWA 1D5AA 4ZTJA 3V9XA 4IFYA 3MXIA 1S1VA 3B6PA 3LZJA 3S3OA 4E7IA 2FBVA 3NF7A 4F4KA 2P51A 2F96A 4CEQA 4W5OA 4HTUA 5HP1A 3DLBA 1NOZA 2HHVA 4HUEA 3DI6A 1LAWA 3I0RA 3VQ7A 3AVFA 3NF6A 4M3TA 1BIZA 5JS2A 4DS4A 1S5JA 1EX4A 1TKXA 4LH4A 4RW4A 4HUGA 4KHYA 4W5QA 4E7KA 3THVA 2B5JA 3AO1A 4Q0BA 5HBMA 2XY8A 1HQEA 3ZSYA 4BE1A 4CFDA 3SNNA 1C6VA 1RT4A 3L2WA 3IAYA 4B9UA 2OYQA 3DM2A 5D3GA 3QETA 1C0TA 3HL8A 3U3GA 4XIUA 3TAFA 1RTDA 1B9DA 4PY5A 1C0UA 4CFCA 4N47A 3IG1A 4Z4CA 3V1OA 3NGZA 4FJKA 1L3TA 5CY4A 2EHGA 4QCLA 1EKEA 4Z4EA 1B92A 3AVBA 3DLHA 4H4OA 3V4IA 3M8PA 3D45A 4DTOA 1TKZA 5FDLA 1HYZA 4DFKA 3LPUA 1U45A 3KD1E 3AA3A 2DFEA 3SUQA 5I42A 4RW8A 3OYCA 1TL3A 4EP5A 3SYZA 3CFRA 3OJUA 4M3RA 3U3YA 2Y1JA 4FK0A 3SUOA 1VK0A 4C8MA 3AVGA 4CF2A 1JLBA 1WNSA 3NGIA 2LSNA 4CK3A 3VQDA 1U4BA 3OYKA 4HUFA 4F2RA 3ZSOA 2KW4A 1S6QA 3B6OA 5J2NA 4KTZA 4KHNA 2HVIA 1BHLA 3ZSXA 2DFFA 1U04A 1RDAA 5KI6A 2BE2A 3ZSZA 3O3GA 3EZ5A 1SL0A 3A2FA 5J1EA 3CFPA 1C1BA 3IRXA 3TAPA 4HVJA 3OYMA 1RT3A 2D0BA 1N5YA 3LALA 1LW0A 3QIPA 4OPJA 4JS5A 3QEVA 1ZBIA 2KZZA 1RT5A 4DTPA 3M8SA 3K5NA 3KK1A 4Z4FA 2PYLA 1RBUA 4C8NA 4CHPA 4B9SA 1BGXT 3HYFA 1FKPA 1WSEA 2P5OA 4KI4A 5CZ2A 3PV8A 3KLHA 3AV9A 4J2DA 3IS9A 4Y1CA 4E1MA 4JRPA 1JLEA 4KAZA 3SI6A 3NH2A 4DTSA 3KKSA 4M42A 4B3OA 3KTQA 4DSLA 4CF9A 3SV4A 4CJ3A 2XY5A 2HMIA 3NHGA 1I3AA 4YFUA 4ELUA 4CJUA 1X1PA 5SWMA 4W5RA 3V1RA 3LDSA 3I0SA 4FLXA 1RTIA 3CQ8A 4CGGA 3CG7A 1RDBA 2D5RA 3KK3A 1RILA 3PX6A 4KTQA 4CF0A 4KHSA 3NFAA 2HB5A 1WAFA 4CF8A 1IKVA 2YNGA 4FM2A 3S3NA 1HQUA 3SUNA 4IG0A 1T05A 3CFOA 3AO2A 4B9NA 2JLEA 5DMRA 1IKXA 3AVNA 4OKJA 3NE6A 1BIUA 3MXMA 1QSLA 2D0CA 4DTXA 1Q8IA 5HRSA 3SQ4A 1DTQA 2OA8A 4CEAA 1QSSA 1HMVA 5KTQA 1SKSA 3RRGA 2XY6A 1EXQA 4CGJA 1NK5A 2HHTA 1Z25A 2W42A 4AHUA 4FM0A 4FJ8A 2YHAA 2Z1IA 3OVNA 1BCMA 1KLMA 4Q5VA 2NUBA 3V9SA 3VA3A 1WSJA 3ZT0A 4AILC 4CFBA 3L2QA 3I8DA 4FLTA 1C1CA 3VQQA 4CJKA 3MEDA 4O0IA 1CZ9A 1VSMA 3TR8A 3QINA 4K8XA 5J2MA 4FJXA 3OY9A 3JSMA 2HHXA 1XHZA 1NJXA 4PA1A 3OS1A 4KO0A 1J9AA 5I3UA 1Z26A 1TKTA 1X9SA 3NH0A 3QNNA 3QESA 4GVMA 1VSKA 1WLJA 3K2PA 3ZSVA 1D8YA 1ASWA 3TWHA 1WSHA 3NCIA 4AHRA 4J2BA 4CESA 3OYIA 4AH9A 2YKNA 3KKRA 4CHYA 1BQNA 4ELVA 2HVHA 4CE9A 5JS1A 3VQ5A 4G1QA 4UQGA 2KFNA 3RR8A 4Z4IA 3F9KA 4LSNA 4Z4HA 3SPYA 2G8KA 3OYNA 4H8KA 5T7BA 3TANA 1TK8A 5HLFA 1RT6A 5HRNA 1KSPA 1REVA 3ISNC 2F8TA 3C95A 1NK0A 1SKRA 4C8OA 3MAQA 4KRFA 3VQ4A 4LY7A 2HHQA 3VN5A 3DRPA 1ASVA 4CJEA 4DLEA 4NYFA 5CYQA 4O5BA 4CJ4A 1J5OA 4W5NA 4ID5A 2KZMA 3JYTA 1KTQA 4FCYA 3SQ0A 3ULDA 3LAKA 5EU7A 3AVAA 4EZ9A 4PWDA 3LPTA 4CJ5A 3MXJA 3SUPA 1KVAA 1NKBA 1FKOA 2O4GA 1NJWA 1TAUA 2WONA 1HRHA 3OYHA 3DMJA 3LP1A 3NF8A 4FJHA 2HW3A 4QAGA 1LWEA 1TKDA 1ZBFA 4JRQA 2VG5A 1YTAA 3QERA 3NDKA 4RG8A 1S1UA 5KGWA 4B8CA 4CGHA 1S6PA 4DQRA 3QEIA 1TL1A 1ZBUA 3O3HA 4M41A 3RMAA 3PX0A 4IBNA 1RT7A 3OYBA 1VSFA 4KTWA 4JLHA 1A5VA 3HK2A 4DFPA 3KK2A 1CZBA 4E19A 1N6QA 3T3FA 1XC9A 3RMCA 3K5OA 4IFVA 1VRTA 1C0MA 3HPGA 3SPZA 4QOZB 1ITGA 4E3SA 3HPHA 4FJMA 2IC3A 3M8RA 2G8HA 4Z4GA 2VG6A 1ZBHA 1CXQA 5FRNA 3LANA 3CYMA 4FLWA 4LH5A 1RDCA 2R7YA 2HHUA 3HSTB 1HNIA 2BANA 3DLKA 3TAEA 4M3YA 2QK9A 3KD5E 4FZXC 3EYZA 4FZYA 4I9LA 1O1WA 3L8BA 2P5GA 2FBXA 1IKWA 2FC0A 1IKYA 3VQ9A 4DQPA 4MFBA 1RNHA 3OYJA 3QEPA 3OYEA 1D9DA 2E6LA 1UWBA 1IO2A 4EP4A 3TAMA 1ZBLA 2OZMA 3LP2A 3HXMA 1UAXA 1WSGA 3VQBA 2DTUA 4E1NA 2KTQA 1D9FA 1HYSA 4CEFA 4LSLA 4CF1A 3RWUA 4CGDA 3AA5X 3MEEA 3DOKA 3OS0A 3AVLA 1JL2A 1QQCA 1SUQA 1S1WA 1JXBA 3WNEA 2ATQA 2YNFA 3LZIA 1NK9A 2Z1JA 4DF8A 1BI4B 1HPZA 4CEEA 5HRRA 3WNGA 1Q9YA 1X9WA 4BWJA 4DTNA 4BWMA 4CIGA 4CEZA 3DYAA 4DSJA 1KRPA 3LP0A 4I2PA 4AHVA 2HHSA 4FJ7A 4F2SA 3K58A 1HNVA 3VA0A 2JGUA 3QNOA 3ZT4A 1T8EA 1JLFA 3VQPA 2QKKA 3SV3A 1JLQA 4ICLA 4O0JA 4F3OA 4FLVA 2Z1HA 4DMNA 4B8AB 2ETJA 2RN2A 1LW2A 4CERA 4KI6A 3KJVA 4FW1A 3RR7A 3DRRA 4DWIA 4DLGA 4F8RA 4BDYA 3KIOA 1JL1A 3AO3A 3QIOA 4CJFA 3QLHA 3OYFA 3QEXA 3E01A 3DLRA 3ZT2A 2ZD1A 4CIFA 5CYMA 1KFSA 4M3UA 5J2QA 1W0HA 1BL3A 2Q3SA 3WNHA 2VG7A 2Z1GA 4OGCA 3OYDA 3G0ZA 4E0DA 4KKOA 1NK8A 1LV5A 3PX4A 4KHWA 1BQMA 4FJLA 4CEOA 4F3TA 1W9HA 4FZZA 3V9UA 5SZTA 3KLGA 3HM9A 1J54A 4J2AA 4M3XA 3C6UA 2ITGA 4W5TA 3T1AA 3L2VA 4CGFA 1LWFA 3SJJA 5DK5A 2D0AA 4IG3A 5HROA 4RW7A 2ZQBA 3O3FA 2DY4A 3F73A 4N5SA 1KLNA 2HHWA 1L5UA 2KFZA 2X78A 1KVCA 2IAJA 3AVCA 4NYNA 1WSFA 2HNZA 4ZTFA 1ASUA 4CIEA 1L3VA 2G8UA 1TVRA 3AVIA 3V9ZA 3TABA 4N56A 4AHTA 1NK7A 4DSKA 4FYDA 4H4MA 2X74A 1CXUA 4FJ5A 2A1RA 3MECA 4I2QA 2QXFA 4KB0A 3AO4A 3ZSRA 4FXDA 1QS4A 1VSEA 4DF4A 1WSIA 4J2EA 3TI0A 2G8FA 4OJRA 1JLGA 4JS4A 3PO4A 1MU2A 4CJTA 3HP9A 2OPQA 1TV6A 3ZT1A 3FFIA 4K8ZA 2EX3A 4PUOA 1VSDA 3VQCA 4DSEA 4KHQA 2IGIA 3SZ2A 4N41A 1B9FA 4BE2A 3L2UA 2RF2A 1VSHA 1K6YA 1QSYA 5HRPA 1FXXA 3L3UA 2HNYA 2IS3A 4OVLA 5KRSA 3TAGA 4CGIA 3ZSQA 4CJQA 2IDOA 1Q9XA 3T19A 4PQUA 4HCBA 4KPYA 3L3VA 3K59A 4CJWA 1QTMA 4CEDA 2G8WA 4B08A 3OYLA 2RPIA 4DTRA 4B9TA 4HCCA 3OJSA 4FLYA 3SCXA 4DTUA 1YTUA 3P83D 5C24A 4FJNA 1S1TA 1HYVA 3G10A 4NCGA 3ALYA 1ZYQA 3NBPA 2GUIA 3PO5A 1DLOA 3LAMA 4YNQA 1QHTA 2X6SA 3PUFA 3VQ8A 1NKEA 2DFHA 2XO7A 4ID1A 1JLCA 1RTHA 4OPKA 4E7HA 4FJIA 1A5WA 3D0PA 1S9EA 4CHOA 3HVTA 1TK0A 4KHUA 4CK1A 1WAJA 2PZSA 4CK2A 3TARA 5FROA 4C8LA 3K5MA 3AA2A 3ZT3A 1TK5A 3HVRA 1XHXA 4CECA 2OPSA 3SQ1A 4ZHRA 4FVMA 4WE1A 1U47A 3MEGA 4DQSA 3DLEA 2FBTA 4HHTA 1NK6A 3RRHA 4FJ9A 1YT3A 2ZE2A 1JKHA 2Y1IA 3BDPA 5J2PA 2G8VA 3OYGA 3OS2A 4DTJA 2IOCA 4CJLA 4E7LA 1LWCA 1DTTA 1TAQA 2YHBA 4I7FA 3NH1A 3P1GA 3HPOA 5KGXA 2YV0X 1HJRA 3P5JA 4BACA 1IH7A 1VSJA 4AHCA 4CHZA 4CJRA 1RT1A 4GW6A 1R0AA 3VQEA 1G15A 2RKIA 3AVMA 5C42A 4DFJA 3CM6A 3EY1A 4CCHA 3UIQA 1RTJA 3OYAA 1T03A 4FLUA 2X6NA 5CZ1A 3U6FA 2GBZA 3V6DA 3O4QA 3S9HA 1NJYA 4BDPA 1GOBA 2XRIA 1NOYA 4DQIA 3V1QA 1A5XA 3NGYA 3AVHA 4CFAA 4FLZA 1KVBA 3L2RA 1TGOA 4B9LA 4O44A 1U48A 4M3WA 2BDPA 3ITHA 4IKFA 1S9GA 1GOCA 1RBRA 3AO5A 4FW2A 4E89A 1NKCA 4KB1A 4N76A 3RTVA 3RMBA 4KFBA 4DSIA 3QO9A 2FBYA 4Z0UA 3C6TA 3DLGA 3NF9A 2OPPA 3V81A 3DOLA 3LP3A 1UA0A 4OLBA 2QKBA 2YNIA 4DSFA 2O4IA 4OGEA 4LD0A 4L8RB 1EETA 2XHBA 3AA4A 1BCOA 1UOCA 4DU3A 4CJVA 1GOAA 4OLAA 1RBSA 1VSLA 3K57A 2HNDA 1XI1A 5FRMA 4I9QA 1RBVA 5C25A 1F21A 1I39A 2WOMA 3LWLA 2KQ2A 3C94A 1JXEA 4R5PA 4NCBA 4CHNA 4CEBA 1SV5A 4KV8A 4DG1A 3WNFA 4B9MA 3M8QA 4OKEA 2VWJA 1L3UA 4CHQA 4CJPA 2F8SA 4O55A 4BDZA 4FJGA 4RW6A 1QE1A 4FK4A 3KLEA 3KLIA 4C8KA 4DQQA 1KFDA 5KRTA 1UA1A 4DTMA 4BE0A 1SKWA 4GMJB 4Y1DA 1SL1A 1XWLA 2OPRA 3AVJA 4DU4A 1VSIA 3S3MA 3BGRA 1LAVA 3DRSA 4B9VA 1KCFA 3NAEA 2BGGA 1YVUA 4O4GA 3HJFA 3RMDA 2B6AA 1NK4A 2XY7A 1Y97A 3PY8A 1T7PA 2OZSA 1FK9A 3ZCMA 3O4NA 5E41A 2PY5A 3CM5A 2E6MA 2I5JA 3TAQA 3SQ2A 1IG9A 1JLAA 1RCHA 4DU1A 4FK2A 3ASMA 4TSXA 4AHSA 3V9WA 4FM1A 1NJZA 1SL2A 3HO1A 2VWKA 1U49A 2GV9A 4KREA 2G8IA 1BISA 3K5LA 2AJQA 4M45A 4DS5A 3LWMA 1RDDA 4CJSA 3H08A 1WN7A 2A1SA 1EP4A 1S1XA 1VRUA 2E4LA 3AVKA 4OKKA 4E7JA 2PYJA 1J53A 3HT3A 2B4JA 5K14A 1C1AA
chains in the Genus database with same CATH superfamily
1YAGA 3GOIA 2NRTA 1YJWN 4FVUA 1RBTA 1BA1A 5M1PA 4RW9A 3DWLA 4NXMK 4IOCL 4B1WB 4IOXA 4FWPA 2YX6A 1X9MA 3EE9A 3V9XA 1S1VA 2WC9A 3S3OA 4E7IA 2FBVA 2P51A 1K8AO 1QZ6A 3NF6A 3C7NA 3GBTA 1BIZA 3EEQA 5EX5A 1EX4A 4KHYA 2ZWHA 4E7KA 4Q0BA 1HQEA 3BP8A 2RHKA 4B9UA 5D3GA 4XIUA 1OVQA 2QXLA 4O8KA 1C0UA 1TUUA 4CFCA 4N47A 2AA4A 4FJKA 5CY4A 1YITN 4H5RA 5E26A 3HI0A 1C0FA 5AQRA 4BR4A 4U7BA 5AQTA 2E20A 1HYZA 3LPUA 3WXIA 3MN7A 1LCUA 5I42A 2KKZA 4EP5A 3U3YA 4M3RA 2Y1JA 4FK0A 4C8MA 1WNSA 4FO0A 3TTFA 4H0PA 3VQDA 4HUFA 3UKUB 1XC3A 4KTZA 3EZ5A 1SL0A 3O3GA 3E66A 3OYMA 1GLCG 4YOTA 4OPJA 1N33K 1ZBIA 4DTPA 1N32K 4IFEA 3KK1A 1W2BM 4ISGA 4GV3A 2PYLA 1RBUA 3ZETA 4CHPA 3J80O 1MDUB 3DXKB 1FKPA 3VEOA 3PV8A 3SMSA 4Y1CA 1IV0A 4E1MA 4JRPA 3J7YP 4EIAA 5AQQA 4M42A 4XH1A 4DSLA 1K8KA 3NHGA 1I3AA 3O4WA 4CJUA 3EKSA 2D4WA 4FLXA 1RTIA 1QQOA 1QHAA 3PX6A 2UU9K 4KTQA 4FWSA 3O9SA 4JKEA 2YNGA 1HQUA 3SUNA 4IG0A 2PFUA 4B9NA 1IKXA 2P9PB 4DTXA 1NGBA 1Q8IA 1NNEA 1HMVA 2NLXA 4J8FA 4FM0A 4DV5K 4BG9A 2Z1IA 3OVNA 1KLMA 2NUBA 4AILC 1WSJA 1NWKA 2GWJA 4CFBA 1C1CA 4CJKA 4FJXA 4PL8A 3OS1A 1J9AA 1Z26A 1Q18A 3QESA 4GVMA 3K2PA 3IFRA 2VYPA 3TWHA 3TSUA 4JI1K 4CHYA 1HKCA 1YJNN 2G8KA 3R1XA 1MWMA 5T7BA 1TK8A 5HLFA 3F9MA 4H0VB 1REVA 3ISNC 2UUBK 2VQFK 1T6CA 1VQ8N 3CJ9A 4OX9K 3BF1A 3O9QA 3VN5A 1EQYA 4DB3A 4NYFA 3NVMA 1TYQA 2YHXA 1J5OA 2KZMA 4WFNL 4H0XB 1IBKK 3ULDA 3JAMO 1T44A 3CD6N 1RFQA 1TAUA 1NKBA 5BPLA 3OYHA 3LP1A 2F7TA 4B3SK 2HOEA 4QAGA 1ZBFA 3SMPA 1BG3A 1Q81O 4RG8A 1S1UA 4BRPA 1S6PA 4V19S 1TL1A 1I94K 1VSFA 4JLHA 3O08A 4IFVA 2QA4N 4QOZB 1ATSA 1RGIA 4E3SA 2IC3A 3THWA 3KK7A 1ZBHA 3LANA 4FLWA 1RDCA 3HSTB 1HNIA 1V4SA 2BANA 3DLKA 5AQZA 3TAEA 4BC3A 3EYZA 4IXCA 5LJWA 2P5GA 1IKWA 1IKYA 4R79A 1UWBA 1S22A 4EP4A 3ENBA 3HXMA 3L6QA 2ASMA 2UXCK 3VQBA 2E88A 2DTUA 2KTQA 1HNWK 4CEFA 3CERA 3RWUA 3DOKA 3FZMA 3CCLN 1S1WA 2ATQA 3LZIA 4B1ZA 5HRRA 3WNGA 4BWJA 4DTNA 4DSJA 1KRPA 4I2PA 1NM1A 4AHVA 4F2SA 3O6WA 3QNOA 1JLFA 3C6AA 4F3OA 1SQKA 2Z1HA 1BWFO 4BGBA 5AQNA 3OYFA 3QLHA 3QEXA 3E01A 3CPEA 3DLRA 3ZT2A 1GLJO 3J8AA 4M3UA 2VG7A 3E1YA 4DHYA 3SAFA 3PLAA 4KH5A 4BQZA 4F3TA 1W9HA 1X3MA 4CZIA 3KLGA 1QVFM 3C6UA 2ITGA 3SJJA 5HROA 2ZQBA 2NRRA 3FE1A 1L5UA 2X78A 4LF8K 1TVRA 4AHTA 4FYDA 4K43A 2A1RA 4I2QA 1BU6O 1QS4A 1VSEA 1WSIA 4OJRA 1JLGA 2P9UB 3PO4A 2ZGYA 3ZT1A 2OPQA 3FFIA 4K8ZA 3I33A 2QWNA 1XNRK 5EXWA 3SZ2A 4N41A 1B9FA 3O9TA 3L3UA 4FL9A 4DV2K 3TAGA 5FPDA 2Q0UA 2UUAK 3KWGA 4DV7K 5IT9O 3H6EA 1KD1O 2W6KA 4A62A 4FWMA 4CEDA 3SLCA 1WBDA 3SCXA 2QWMA 4FLYA 4DTUA 3VF4A 5KQDA 4CJ7A 4CZEA 3PO5A 3LAMA 1QHTA 4JI6K 3VQ8A 1NKEA 3GE1A 3O5BA 2XO7A 1RTHA 4MDBA 1A5WA 1MWKA 5AJ3K 4RWTA 3ZX3A 3TARA 3WEEA 3K5MA 1WOQA 3THYB 2OPSA 4XEIA 2FBTA 1NK6A 4A2AA 4IWVA 4X65K 1BOTO 2ZE2A 2P9IA 1JKHA 3TTDA 2Y1IA 4NXNK 3O8MA 1LWCA 3IKMA 1P90A 4PHTX 3AGKA 1HJRA 4BACA 2ZJRL 1VSJA 4AHCA 3B8AX 3VQEA 1G15A 1R59O 2ZGZA 3UIQA 2X6NA 2GBZA 3WQTA 5A2QO 3MN5A 3NGYA 3L2RA 1U48A 5AQIA 3QFPA 3ITHA 5GAGP 1RBRA 2Q31A 4KFBA 4DSIA 4Z0UA 3NF9A 1YF5L 2V7YA 1UA0A 2YI1A 2QKBA 2YNIA 4BRDA 4DSFA 4GNIA 4QS7A 5F1XA 1EETA 4L8RB 1C0GA 3AA4A 3WUHA 3SAGA 1BCOA 1UOCA 4A57A 4CJVA 3K57A 2HBJA 4GY2B 3BF3A 1RDUA 5C25A 4MLHA 1F21A 4BRGA 1JXEA 4B9MA 3A5NC 4CJPA 4O55A 4LF9K 4BDZA 4FJGA 2UXBK 1QE1A 2E2NA 2Q2RA 5AQKA 5KRTA 3CF5L 4DQQA 3WEEB 1XWLA 1VSIA 4B9VA 1NG9A 5I9EB 4JI8K 3AAQA 1YXQA 2OZSA 4JI5K 2P9NB 4E1JA 3ZCMA 5ADXH 3SQ2A 4FM1A 4JD2A 2GV9A 4JKDA 2DPNA 2WBNA 1VRUA 4OKKA 1YI2N 2PYJA 5FLXO 2GUPA 2B4JA 1C1AA 4BC4A 4YOXA 4DQ8A 2YKMA 3BEXA 4M3ZA 3AAPA 3D6RA 4EZ6A 4ELTA 3VQ6A 1CLQA 1L3SA 2E2QA 3J7ZO 4DFMA 4FWRA 2IVOA 4DUZK 1J5EK 4ZTJA 3MXIA 4BR9A 1VQLN 4BC2A 4BRQA 2P9LA 2F96A 4CEQA 2HHVA 3EO3A 2OCEA 4HTUA 3H45C 1VQNN 3I0RA 4EFHA 3G4SN 2CGKA 3HM8A 2F9WA 4DS4A 3O1BA 2NRZA 1NMNA 3SJHA 3K0SA 3AO1A 5HBMA 4GKKK 2XY8A 4BE1A 3OW2M 4CFDA 1RT4A 1NJIO 5EVZA 3M6GA 5M1KA 3HL8A 3TAFA 2BTFA 2D0PA 4Z4CA 3NGZA 1L3TA 3CI5A 4Z4EA 1QQNA 3K9JA 3AVBA 3V4IA 3M8PA 4DTOA 1HPMA 1VQKN 1TKZA 5BR9A 3CCJN 3KD1E 3WT0A 1GLFO 5BRHA 3SUQA 2A5XA 3SYZA 3SUOA 3MK6A 3AVGA 1JLBA 3NGIA 2LSNA 1U4BA 4YDUC 3CJ7A 4C1NI 4F2RA 1BA0A 1BHLA 1TK5A 2BE2A 3TAPA 1RT3A 2OTLN 2D0BA 2ZF5O 3LALA 1NGIA 3M8SA 3R8EA 4M63C 4C8NA 1W97L 1BGXT 3HYFA 4KI4A 2P9SB 4BVOA 3KLHA 4LC9B 4FWQA 2HHHK 4KAZA 3SI6A 3WQUA 4CF9A 2P9KB 5AZJB 2XY5A 2A42A 4K42A 3THXA 1HX1A 3RVCA 2OTJN 3I0SA 2FF6A 3CG7A 2I7PA 4CGGA 1RILA 4NB4A 1NGAA 3ENOA 2HB5A 4FM2A 1ILYA 3CFOA 3AO2A 5DMRA 4BRIA 5E84A 3R3LA 3CCMN 3U9DA 5AQVA 3SQ4A 3T69A 1QSSA 1U6ZA 3RRGA 1HNZK 4CGJA 1NK5A 2HHTA 3H3NO 2W42A 3GDQA 2YHAA 4DV4K 4Q5VA 3V9SA 3VA3A 3MX2A 3I8DA 4O0IA 4K8XA 1VSMA 4JK9A 3QINA 5J2MA 1N36K 1XHZA 4KO0A 5I3UA 2HMPA 1TKTA 5JICA 3WXKA 1VSKA 1WLJA 3ZSVA 1ASWA 2WUSA 3NCIA 4AHRA 2O8EB 4CESA 4AH9A 1HUXA 2YKNA 4ELVA 4CE9A 3CJAA 5JS1A 4UQGA 2KFNA 3RR8A 4Z4IA 3F9KA 4H8KA 2FLOA 1KSPA 1GLAG 3AY9A 1NK0A 1SKRA 5GAEP 2HHQA 1SZ2A 2NZTA 3THXB 1W7AA 4O5BA 4NO7A 5FPEA 4A2BA 1KTQA 4FCYA 3SQ0A 2CGLA 1Y64A 3LM2A 1KAXA 4LF4K 2UYTA 5LY3A 3LPTA 3SUPA 2WONA 3VEVA 5GAHP 3DMJA 4FJHA 2HW3A 1VQMN 1LWEA 4K0KK 4JRQA 5KGWA 4BR2A 4DQRA 3LDOA 3PX0A 3UKRA 5TKWA 1A5VA 1CZBA 4YDUA 4AM7A 1XC9A 3RMCA 1VRTA 4JV5K 1C0MA 3HPGA 4MO4A 3VEZA 3PIOL 2W6LA 3O9RA 2G8HA 5FRNA 4CZFA 1NLVA 4LH5A 4NLBA 2HHUA 3FLCO 4FZXC 1WUAA 5KPTA 4I9LA 3VOVA 5AQLA 4YOWA 1HJOA 4B1VA 4DQPA 1IO2A 4IDHA 2OZMA 2Q36A 3LP2A 1WSGA 5AFUA 4FWLA 1D9FA 1HYSA 4B1XB 3AA5X 4YY3K 3AVLA 4FPAA 4LFCK 2Z1JA 1BI4B 2WTUA 1Q9YA 3VGMA 4CIGA 2EWSA 5JMVA 3EN9A 3E9OA 3LP0A 4B1YB 2JGUA 1T8EA 3VQPA 2QKKA 4ICLA 4FLVA 1HKGA 4DMNA 4B8AB 4CERA 4KI6A 2P9KA 2E5LK 2O8CA 1JL1A 4IOAL 1BO5O 1KFSA 5ELZA 2Q3SA 2Z1GA 5AFUH 2FSKA 1NMDA 4E0DA 4KKOA 2O8FA 5AZIA 4LF6K 4B1UB 3V9UA 3ID8A 3HM9A 3FFKB 2YHYA 5DK5A 2D0AA 3L0QA 4FOEA 4IG3A 4RW7A 3L4IA 2HF3A 3CETA 1KXPA 4JN4A 1L3VA 3OBWA 3V9ZA 3AVIA 4K25A 3TABA 1NK7A 2X74A 1CXUA 4FJ5A 4PKIA 5BPNA 4B3MK 2QXFA 3L4QA 1H1VA 3ZSRA 5JVGL 4DF4A 3KHYA 2QW9A 2G8FA 4JS4A 1N34K 3VTIA 4BR5A 4JEPA 4PUOA 4BR0A 4BGAA 4DSEA 5BR8K 4BRMA 4QS8A 4A5AA 2D0OA 1VSHA 1VQ4N 1FXXA 3MN9A 1XUPO 5KRSA 4CJQA 2IDOA 3SAHA 3BZKA 4PQUA 4KPYA 3D2EA 3U4LA 3L3VA 4IZ9A 5DM6L 1QTMA 4HCCA 2RPIA 4DTRA 4B9TA 1Q82O 2GUIA 4YNQA 1NGHA 2QWRA 4ID1A 4OPKA 4FJIA 3CJCA 4E7HA 3D0PA 1S9EA 4K41A 3HVTA 3WXJA 2VWBA 5AR0A 2O8EA 1WAJA 4YHHK 2PZSA 4C8LA 3AA2A 4BRKA 3SQ1A 1QZ5A 1QVGM 4WE1A 3MEGA 4DQSA 2UXDK 3RRHA 3BDPA 4JKBA 4E7LA 4I7FA 3NH1A 4U67L 2YV0X 3P5JA 2JWKA 4PKGA 1IH7A 4FWOA 4Z94A 5CHIA 4JYAK 3HSCA 4CHZA 1R0AA 4FPBA 2QI2A 2RKIA 3CM6A 3EY1A 1RTJA 4FSVA 1VQ7N 4FLUA 3S9HA 3V6DA 1GOBA 1NOYA 2V51B 1HLUA 3V1QA 4FLZA 3UB5A 4GKJK 1KVBA 4O44A 2BDPA 4BVPA 4IKFA 2D1KA 5AQSA 4E89A 1JCGA 3V81A 4OLBA 2OPPA 2O4IA 3VENA 2GEMA 1VSLA 5FRMA 1XI1A 4B3TK 1J6ZA 3QMLA 1Q86O 4OO1J 3LWLA 3WXLA 2E8AA 5AQWA 3I56N 1IBMK 2I7NA 4MDAA 4DG1A 4OKEA 1L3UA 5GINA 1ZXOA 2F8SA 1EO1A 4JI4K 2GWKA 3KLIA 4C8KA 1UA1A 1NGFA 1SKWA 5KPZA 3AVJA 3DJCA 5AZIB 3BGRA 1LAVA 1K8KB 3QBWA 2P9NA 1NK4A 2RE2A 1Y97A 1NGEA 1FK9A 1IG9A 3H1VX 3QICA 5IWAK 3V9WA 1NJZA 1BDGA 3TPQA 4KREA 2AJQA 3A0IX 4DS5A 4ILGB 3KZBA 3R6MA 2E1ZA 3AVKA 4E7JA 1J53A 2W40A 3HT3A 1BI4A 4MQ3A 2P9SA 4EAHD 4RTFD 5LMUK 3QEWA 4DR1K 1GLBG 4DR6K 2CH6A 3KLFA 3CCSN 5FPNA 2YNHA 4CVNE 1KQSM 5C12A 2P1JA 3ZSWA 1D5AA 4BROA 3BUZB 4BREA 2HF4A 3B6PA 1YTUA 5HP1A 4HUEA 1LAWA 3VTHA 1XMQK 4M3TA 4PL7A 5JS2A 4JI7K 3HZ6A 4RW4A 1TKXA 4W5QA 2B5JA 3QB0A 2YHWA 1C6VA 3VESA 4C1NK 3L2WA 4ILHA 1QQMA 1C0TA 1HNXK 3S41A 5C10A 1B9DA 1S72N 3IG1A 4JI0K 4DUYK 2O8FB 1EKEA 1B92A 4LFAK 3DLHA 4PKHA 4H4OA 2CGJA 4LF7K 1U45A 3AA3A 3M3ZA 2Q97A 3OJUA 1VK0A 4CF2A 1U2VA 2E2PA 4F9OA 2KW4A 1S6QA 3B6OA 5J2NA 4KHNA 2HVIA 4FJ7A 2DFFA 1U04A 2FSNA 3UKUA 5GADP 4C23A 3CFPA 3IRXA 4HVJA 3OTOK 1N5YA 1LW0A 4BRNA 1TUYA 2WFBA 1RT5A 3EZWA 3K5NA 3MCAB 4DR7K 4B9SA 1NGDA 1DKGD 4JHDB 1WSEA 1NGGA 3VERA 4J2DA 3IS9A 3N4PA 1JLEA 3FGUA 4DTSA 4B3OA 3KTQA 1TYQB 2HMIA 4YFUA 3I55N 1X1PA 3TSPA 3TU5A 1RDBA 3KK3A 4FWKA 3NFAA 4H0TB 4GVEA 5BPMA 4OKJA 3UKRB 1JJ2M 5MLCQ 1SS6A 2D0CA 5HRSA 1DTQA 2PAVA 3D2FA 3CQYA 2XY6A 3VGKA 1BCMA 3ZT0A 4FWNA 2ZM6K 3L2QA 2NRHA 4FLTA 4AF1A 3VQQA 1CZ9A 2NNWA 3OY9A 2HBLA 3JSMA 2HHXA 1NJXA 1E3MA 1D8YA 1WSHA 3OYIA 3KKRA 1BQNA 3J81O 2HBKA 4Z4HA 2KLAA 3C6HA 3TANA 3MDQA 3FZFA 1RT6A 5HRNA 4C8OA 3MAQA 3FZLA 4LY7A 4CI6A 1ASVA 4CJEA 1XMOK 4DLEA 2UUCK 1NGJA 4CJ4A 5FPMA 3JYTA 4OPAA 5TKYA 4IEEA 3LAKA 5EU7A 4EZ9A 3BZCA 3ULEB 2GTDA 2NRVA 1FKOA 2O4GA 3ENHA 4WFAL 1HRHA 4DV1K 3NF8A 2VG5A 3QERA 3CC2N 3ATVA 5F0XA 5DM7L 4M41A 3RMAA 4IBNA 1RT7A 5AQJA 3HK2A 4E19A 1E4GT 3T3FA 3K5OA 4DV0K 3SPZA 5AQXA 3VF6A 4FJMA 4EHUA 5GIOA 3M8RA 3IMXA 3QDKA 2R7YA 4M3YA 3A5OC 1O1WA 4CD1A 5LL6Z 2FC0A 3QEPA 3OYEA 1D9DA 4YOUA 1Z05A 1UAXA 3IUCA 3FR0A 4CF1A 4CGDA 3CC4N 3EKUA 5M1NA 3SBTA 4YOYA 3MEEA 1SUQA 1JXBA 3WNEA 2YNFA 4X66K 1P8ZA 3A8YA 1NK9A 4WQ5A 1HPZA 3EL2A 1X9WA 4CEZA 4ISEA 2HHSA 2GELA 1VQ6N 1HNVA 3VA0A 2VGMA 3ZT4A 3LM9A 4ILJA 1JLQA 3ULEA 1LW2A 3PSFA 4FW1A 5M1OA 3KJVA 4DR2K 4DLGA 3T7ZA 4BDYA 4DSKA 3QIOA 4CJFA 3VEWA 3MXMA 2ZD1A 4CW7B 5GIPA 5J2QA 5JVHL 1BL3A 4OGCA 3OYDA 3G0ZA 1NK8A 4KHWA 3CXCM 4FJLA 4CEOA 3M1FA 5M1FA 4FZZA 5AZJA 4J2AA 1J54A 1D4XA 2NRXA 4W5TA 3T1AA 4CGFA 4DR3K 3O3FA 3CJBA 1ATNA 1KLNA 2KFZA 3OA9A 1JCFA 4NYNA 1WSFA 2HNZA 1VQON 1ASUA 3CCEN 5EY4A 4AM6A 4H4MA 3CPWM 1ZBSA 4GV9A 3MECA 4KB0A 2ZJPL 3AO4A 4FXDA 5KPRA 3VEXA 2QEXN 3D2FB 4CJTA 1TV6A 2EX3A 2W41A 1DGKN 1VSDA 3QBXA 2IGIA 1K6YA 2QM1A 2HNYA 2IS3A 1OH5A 2AP1A 4CGIA 5JLFA 3ZSQA 1NBWA 3O1WA 1K73O 3K59A 2KHOA 2ASPA 2G8WA 3OJSA 3P83D 5C24A 2PBDA 1HYVA 1X9JA 3G10A 1KAZA 3ALYA 3D2EB 1DLOA 2JWLA 3TSQA 1JLCA 1TK0A 4CHOA 3DAWA 2H3GX 3D7EO 4KHUA 4CK1A 4CK2A 4O8UA 5CE3A 3HVRA 1XHXA 4AQYK 4CECA 1U47A 5BREA 1YHQN 1NU0A 4CJLA 3MX5A 3UE5A 1WB9A 3VPZA 4H0YB 4IJAA 3VF2A 2ZJQL 1YIJN 4BY9C 3O9UA 3AVMA 4JKFA 4QS9A 4CCHA 2A6AA 5HL7L 5CZ1A 3U6FA 1NJYA 3O4QA 3CHWA 4DQIA 5C2FA 4MO5A 3IDHA 1TGOA 1S9GA 1GOCA 3AO5A 4FW2A 1NKCA 4KB1A 4N76A 3RTVA 3RMBA 4O5FA 3HOSA 2FBYA 4BQLA 2XHBA 2NRWA 3DXKA 4DR4K 1GOAA 4OLAA 1I39A 2WOMA 1T3VA 3CCRN 2P9IB 2KQ2A 3C94A 4NCBA 4CHNA 2QWQA 3ZX0A 4YOVA 3M8QA 2J4RA 4CHQA 1ESVA 4RW6A 3TTCA 5M1QA 3M5RA 3KLEA 4FK4A 4IO8A 3THYA 4BE0A 4GMJB 3HOTA 4Y1DA 2O8DB 3P39A 2OPRA 2YJFA 1HKBA 3S3MA 3DRSA 2ITMA 2BGGA 4B3RK 4O4GA 4DR5K 3RMDA 2IIRA 5EOYA 3DXMA 2XY7A 3PY8A 5C2DA 4GV6A 1SAZA 3ZX2A 4X64K 1HR0K 3FZHA 1M90O 2PY5A 2E6MA 2I5JA 3TAQA 1RCHA 4DU1A 4FK2A 4XH4A 4JK7A 3HO1A 4JI3K 3H3OB 1U49A 2G8IA 3K5LA 3KWIA 3ATUA 4M45A 1RDDA 4CJSA 4BG8A 1WN7A 1EP4A 2E4LA 4OPHA 3OHRA 4NCAA 2YCHA 3C7NB 3HP6A 1OH7A 4FJJA 3VQAA 4XH5A 1LOTB 2E2OA 4IDKA 1CZAN 1RT2A 3U9ZA 4IFYA 3LZJA 4F4KA 3NF7A 4W5OA 3DLBA 1NOZA 3SK3A 4H5WA 3DI6A 3VQ7A 3AVFA 1GLEG 4H0OA 3CMAN 4IO9L 1S5JA 4LH4A 5CR4A 4HUGA 3MWPA 3THVA 3C0BA 3K9KA 3ZSYA 3SNNA 5BN8A 3IAYA 2OYQA 3DM2A 3QETA 3U3GA 1YUWA 1RTDA 3ID6A 4PY5A 4BRFA 3V1OA 3LL3A 2EHGA 4QCLA 3W3DA 3D45A 5FDLA 3JXUA 4DFKA 3F2KA 2DFEA 4JKGB 4RW8A 3OYCA 1TL3A 3CFRA 4CZKA 1XQSC 4EHTA 2QTDA 4M7YA 4CK3A 3OYKA 4WFBL 3F5TA 3CCQN 3ZSOA 4CD3A 2Q1NA 3OBYA 3ZSXA 4A5BA 5KI6A 1RDAA 3ZSZA 4JKHA 5JLHA 3A2FA 5J1EA 1C1BA 3DLLL 3QIPA 2KZZA 4JS5A 3QEVA 4CZHA 4Z4FA 2GX9A 5BRFA 4YORA 2P5OA 3VGLA 1ATRA 5CZ2A 3AV9A 3ZEUA 3FZKA 3LDLA 3RSEA 3NH2A 3KKSA 4JAXA 4WYBA 3SV4A 4CJ3A 4ELUA 1MA9B 3MWTA 5SWMA 4W5RA 3V1RA 1OVYA 3LDSA 3CQ8A 2D5RA 4KHSA 4CF0A 1WAFA 4CF8A 1YVNA 1IKVA 4CZGA 3S3NA 4I6MA 3RSEB 1T05A 3A5MC 2F4VK 2JLEA 3AVNA 3NE6A 3SBGA 1BIUA 1QSLA 3LDNA 2P9PA 2OA8A 5AQYA 4CEAA 5KTQA 1SKSA 5KQ8A 4KH4A 1EXQA 2QWOA 1Z25A 4AHUA 4FJ8A 5BN9A 1S3XA 3ZLJA 4CBUA 3MCPA 3MEDA 1M1KO 3TR8A 3CIPA 2Q0RA 4PA1A 1X9SA 3NH0A 3G6EN 3QNNA 4WQ4C 4KH6A 3U8XA 4J2BA 3BY5A 2HVHA 3P4IA 4BR7A 3E9LA 3VQ5A 4G1QA 4LSNA 1EWQA 3SPYA 3OYNA 3ZETB 3CCUN 5LMNK 3R9PA 4JK8A 3I8BA 2F8TA 5AQMA 3C95A 1RDWX 3E9PA 4KRFA 1DEJA 3VQ4A 4WCEL 1VQ5N 1BUPA 4JNEA 3DRPA 5CYQA 1X3NA 3THWB 3T1HK 1Q7YO 2QWLA 1T6DA 2O8BA 4W5NA 3JS6A 4ID5A 3CQXA 3H1QA 4ISFA 3AVAA 4PWDA 1IBLK 2P9LB 4CJ5A 3MXJA 1KVAA 3ZEUB 1NJWA 4BRCA 2BUPA 1TKDA 4WQ4A 1YTAA 3NDKA 4CGHA 4B8CA 3QEIA 3LDQA 1ZBUA 3O3HA 2FXUA 3CJ1A 3HRGA 3MN6A 3OYBA 4KTWA 5HOOA 4DFPA 5AQOA 3KK2A 1N6QA 4DV6K 1ITGA 3HPHA 1VAZA 1EWRA 4Z4GA 2VG6A 1CXQA 4JD2B 3CYMA 1O13A 2QK9A 3KD5E 4FZYA 4RCHA 3L8BA 3O80A 2FBXA 3VQ9A 4MFBA 1RNHA 3OYJA 2E6LA 3N4QA 1V4TA 1ZBLA 3TAMA 3NVKA 4H03B 2HBMA 1E4FT 3AARA 3W0LA 4DCHA 4E1NA 4CZJA 3P31A 4LSLA 3EE8A 2F9TA 5AQFA 3OS0A 1JL2A 1QQCA 1OKJA 3LDPA 4H5VA 1FJGK 4KHPK 4KBOA 4DF8A 4BRAA 4MLEA 4CEEA 4BWMA 4H5NA 3KVGA 4FOIA 3DYAA 3K58A 3GG4A 4DV3K 3T1YK 2V7ZA 3SV3A 4O0JA 5AQPA 2ETJA 2RN2A 4JKAA 1YJ9N 3RR7A 3DRRA 4DWIA 4F8RA 3KIOA 3AO3A 4CIFA 3NMUA 1VQ9N 5CYMA 1W0HA 1ZC6A 3WNHA 5C0YA 3PSIA 1LV5A 3PX4A 3P38A 1BQMA 5AQHA 5SZTA 4M3XA 4HTLA 3L2VA 1LWFA 2DY4A 3F73A 4N5SA 4A59A 4IEIA 2HHWA 1N8RO 1OH6A 1KVCA 2IAJA 3AVCA 2G8UA 4ZTFA 4CIEA 4N56A 2FF3B 3CCVN 2IVPA 3CC7N 4J2EA 4JHDA 4BRHA 3TI0A 2O8DA 1MU2A 3HP9A 2OANA 5C15A 3C65A 3VQCA 4KHQA 4BE2A 3L2UA 2RF2A 1QSYA 5HRPA 4JKCA 4OVLA 2O8BB 1Q9XA 3T19A 4HCBA 1OH8A 1NGCA 1U2VB 3GL1A 1DT9A 4CJWA 4X62K 4B08A 3OYLA 1XNQK 2E1YA 1S1TA 4FJNA 4NCGA 1ZYQA 5H1SQ 3NBPA 3CMEN 1Z6RA 2X6SA 3PUFA 2DFHA 4Y0WA 2VCPA 4LFBK 3QFUA 2A40A 5BRDA 5FROA 1JCEA 3ZT3A 1FW6A 3WXMB 4ZHRA 4FVMA 4IJNA 3DLEA 2P9UA 4HHTA 4G9ZA 1G99A 4FJ9A 1YT3A 1K9MO 5J2PA 2G8VA 3OYGA 1GLDG 3OS2A 4DTJA 2IOCA 1DTTA 1TAQA 2YHBA 3VMFB 1KAYA 4JKGA 3P1GA 3HPOA 2QWPA 5KGXA 4WQ5C 4JI2K 4CJRA 1RT1A 2VGNA 4GW6A 4CBXA 2CH5A 4DFJA 1WBBA 5AQGA 5C42A 1IG8A 3PIPL 3OYAA 1T03A 4I6MB 3AGRA 3G71N 4DKWA 4BDPA 2XRIA 1A5XA 1IJJA 2FSJA 3H46O 3AVHA 4CFAA 2A41A 4B9LA 4M3WA 3VEYA 2V52B 1KC8O 4L3QA 1GLLO 2VQEK 2A3ZA 3QO9A 4H5TA 3C6TA 3DLGA 4M7XA 3DOLA 3LP3A 4OGEA 4LD0A 4DU3A 3G25A 4WF9L 1RBSA 5LJVA 2HNDA 3Q7BA 4I9QA 1RBVA 3HTVA 3A5LC 4CZLA 4CZMA 2IVNA 4A61A 4R5PA 4CEBA 1SV5A 4KV8A 3WNFA 2VWJA 5ADXA 4LF5K 2YJEA 1KFDA 4DTMA 1VHXA 4BRLA 1SL1A 4DU4A 2HSTA 1KCFA 4NLCA 3NAEA 1YVUA 3HJFA 2B6AA 3MMVA 1T7PA 3DXMB 3Q7CA 2ASOA 3HBTA 3VETA 3O4NA 4BC5A 5E41A 2BH1A 3CM5A 5B8HA 1JLAA 3ASMA 4TSXA 4AHSA 1SL2A 2VWKA 1BISA 5AQUA 4CBWA 4B9QA 2O8CB 3LWMA 3ZYYX 3H08A 1VQPN 2A1SA 4HWIA 1S1XA 4UY8O 5K14A 5F2RA 3J7AP
chains in the Genus database with same CATH topology
4NCAA 1BI4A 4MQ3A 2YKMA 4M3ZA 1RBTA 4EZ6A 3HP6A 4ELTA 3QEWA 4FJJA 4RW9A 3VQ6A 3VQAA 1CLQA 1L3SA 4DFMA 3KLFA 4IDKA 2YNHA 2P1JA 1RT2A 1X9MA 3ZSWA 1D5AA 4ZTJA 3V9XA 4IFYA 3MXIA 1S1VA 3B6PA 3LZJA 3S3OA 4E7IA 2FBVA 3NF7A 4F4KA 2P51A 2F96A 4CEQA 4W5OA 4HTUA 5HP1A 3DLBA 1NOZA 2HHVA 4HUEA 3DI6A 1LAWA 3I0RA 3VQ7A 3AVFA 3NF6A 4M3TA 1BIZA 5JS2A 4DS4A 1S5JA 1EX4A 1TKXA 4LH4A 4RW4A 4HUGA 4KHYA 4W5QA 4E7KA 3THVA 2B5JA 3AO1A 4Q0BA 5HBMA 2XY8A 1HQEA 3ZSYA 4BE1A 4CFDA 3SNNA 1C6VA 1RT4A 3L2WA 3IAYA 4B9UA 2OYQA 3DM2A 5D3GA 3QETA 1C0TA 3HL8A 3U3GA 4XIUA 3TAFA 1RTDA 1B9DA 4PY5A 1C0UA 4CFCA 4N47A 3IG1A 4Z4CA 3V1OA 3NGZA 4FJKA 1L3TA 5CY4A 2EHGA 4QCLA 1EKEA 4Z4EA 1B92A 3AVBA 3DLHA 4H4OA 3V4IA 3M8PA 3D45A 4DTOA 1TKZA 5FDLA 1HYZA 4DFKA 3LPUA 1U45A 3KD1E 3AA3A 2DFEA 3SUQA 5I42A 4RW8A 3OYCA 1TL3A 4EP5A 3SYZA 3CFRA 3OJUA 4M3RA 3U3YA 2Y1JA 4FK0A 3SUOA 1VK0A 4C8MA 3AVGA 4CF2A 1JLBA 1WNSA 3NGIA 2LSNA 4CK3A 3VQDA 1U4BA 3OYKA 4HUFA 4F2RA 3ZSOA 2KW4A 1S6QA 3B6OA 5J2NA 4KTZA 4KHNA 2HVIA 1BHLA 3ZSXA 2DFFA 1U04A 1RDAA 5KI6A 2BE2A 3ZSZA 3O3GA 3EZ5A 1SL0A 3A2FA 5J1EA 3CFPA 1C1BA 3IRXA 3TAPA 4HVJA 3OYMA 1RT3A 2D0BA 1N5YA 3LALA 1LW0A 3QIPA 4OPJA 4JS5A 3QEVA 1ZBIA 2KZZA 1RT5A 4DTPA 3M8SA 3K5NA 3KK1A 4Z4FA 2PYLA 1RBUA 4C8NA 4CHPA 4B9SA 1BGXT 3HYFA 1FKPA 1WSEA 2P5OA 4KI4A 5CZ2A 3PV8A 3KLHA 3AV9A 4J2DA 3IS9A 4Y1CA 4E1MA 4JRPA 1JLEA 4KAZA 3SI6A 3NH2A 4DTSA 3KKSA 4M42A 4B3OA 3KTQA 4DSLA 4CF9A 3SV4A 4CJ3A 2XY5A 2HMIA 3NHGA 1I3AA 4YFUA 4ELUA 4CJUA 1X1PA 5SWMA 4W5RA 3V1RA 3LDSA 3I0SA 4FLXA 1RTIA 3CQ8A 4CGGA 3CG7A 1RDBA 2D5RA 3KK3A 1RILA 3PX6A 4KTQA 4CF0A 4KHSA 3NFAA 2HB5A 1WAFA 4CF8A 1IKVA 2YNGA 4FM2A 3S3NA 1HQUA 3SUNA 4IG0A 1T05A 3CFOA 3AO2A 4B9NA 2JLEA 5DMRA 1IKXA 3AVNA 4OKJA 3NE6A 1BIUA 3MXMA 1QSLA 2D0CA 4DTXA 1Q8IA 5HRSA 3SQ4A 1DTQA 2OA8A 4CEAA 1QSSA 1HMVA 5KTQA 1SKSA 3RRGA 2XY6A 1EXQA 4CGJA 1NK5A 2HHTA 1Z25A 2W42A 4AHUA 4FM0A 4FJ8A 2YHAA 2Z1IA 3OVNA 1BCMA 1KLMA 4Q5VA 2NUBA 3V9SA 3VA3A 1WSJA 3ZT0A 4AILC 4CFBA 3L2QA 3I8DA 4FLTA 1C1CA 3VQQA 4CJKA 3MEDA 4O0IA 1CZ9A 1VSMA 3TR8A 3QINA 4K8XA 5J2MA 4FJXA 3OY9A 3JSMA 2HHXA 1XHZA 1NJXA 4PA1A 3OS1A 4KO0A 1J9AA 5I3UA 1Z26A 1TKTA 1X9SA 3NH0A 3QNNA 3QESA 4GVMA 1VSKA 1WLJA 3K2PA 3ZSVA 1D8YA 1ASWA 3TWHA 1WSHA 3NCIA 4AHRA 4J2BA 4CESA 3OYIA 4AH9A 2YKNA 3KKRA 4CHYA 1BQNA 4ELVA 2HVHA 4CE9A 5JS1A 3VQ5A 4G1QA 4UQGA 2KFNA 3RR8A 4Z4IA 3F9KA 4LSNA 4Z4HA 3SPYA 2G8KA 3OYNA 4H8KA 5T7BA 3TANA 1TK8A 5HLFA 1RT6A 5HRNA 1KSPA 1REVA 3ISNC 2F8TA 3C95A 1NK0A 1SKRA 4C8OA 3MAQA 4KRFA 3VQ4A 4LY7A 2HHQA 3VN5A 3DRPA 1ASVA 4CJEA 4DLEA 4NYFA 5CYQA 4O5BA 4CJ4A 1J5OA 4W5NA 4ID5A 2KZMA 3JYTA 1KTQA 4FCYA 3SQ0A 3ULDA 3LAKA 5EU7A 3AVAA 4EZ9A 4PWDA 3LPTA 4CJ5A 3MXJA 3SUPA 1KVAA 1NKBA 1FKOA 2O4GA 1NJWA 1TAUA 2WONA 1HRHA 3OYHA 3DMJA 3LP1A 3NF8A 4FJHA 2HW3A 4QAGA 1LWEA 1TKDA 1ZBFA 4JRQA 2VG5A 1YTAA 3QERA 3NDKA 4RG8A 1S1UA 5KGWA 4B8CA 4CGHA 1S6PA 4DQRA 3QEIA 1TL1A 1ZBUA 3O3HA 4M41A 3RMAA 3PX0A 4IBNA 1RT7A 3OYBA 1VSFA 4KTWA 4JLHA 1A5VA 3HK2A 4DFPA 3KK2A 1CZBA 4E19A 1N6QA 3T3FA 1XC9A 3RMCA 3K5OA 4IFVA 1VRTA 1C0MA 3HPGA 3SPZA 4QOZB 1ITGA 4E3SA 3HPHA 4FJMA 2IC3A 3M8RA 2G8HA 4Z4GA 2VG6A 1ZBHA 1CXQA 5FRNA 3LANA 3CYMA 4FLWA 4LH5A 1RDCA 2R7YA 2HHUA 3HSTB 1HNIA 2BANA 3DLKA 3TAEA 4M3YA 2QK9A 3KD5E 4FZXC 3EYZA 4FZYA 4I9LA 1O1WA 3L8BA 2P5GA 2FBXA 1IKWA 2FC0A 1IKYA 3VQ9A 4DQPA 4MFBA 1RNHA 3OYJA 3QEPA 3OYEA 1D9DA 2E6LA 1UWBA 1IO2A 4EP4A 3TAMA 1ZBLA 2OZMA 3LP2A 3HXMA 1UAXA 1WSGA 3VQBA 2DTUA 4E1NA 2KTQA 1D9FA 1HYSA 4CEFA 4LSLA 4CF1A 3RWUA 4CGDA 3AA5X 3MEEA 3DOKA 3OS0A 3AVLA 1JL2A 1QQCA 1SUQA 1S1WA 1JXBA 3WNEA 2ATQA 2YNFA 3LZIA 1NK9A 2Z1JA 4DF8A 1BI4B 1HPZA 4CEEA 5HRRA 3WNGA 1Q9YA 1X9WA 4BWJA 4DTNA 4BWMA 4CIGA 4CEZA 3DYAA 4DSJA 1KRPA 3LP0A 4I2PA 4AHVA 2HHSA 4FJ7A 4F2SA 3K58A 1HNVA 3VA0A 2JGUA 3QNOA 3ZT4A 1T8EA 1JLFA 3VQPA 2QKKA 3SV3A 1JLQA 4ICLA 4O0JA 4F3OA 4FLVA 2Z1HA 4DMNA 4B8AB 2ETJA 2RN2A 1LW2A 4CERA 4KI6A 3KJVA 4FW1A 3RR7A 3DRRA 4DWIA 4DLGA 4F8RA 4BDYA 3KIOA 1JL1A 3AO3A 3QIOA 4CJFA 3QLHA 3OYFA 3QEXA 3E01A 3DLRA 3ZT2A 2ZD1A 4CIFA 5CYMA 1KFSA 4M3UA 5J2QA 1W0HA 1BL3A 2Q3SA 3WNHA 2VG7A 2Z1GA 4OGCA 3OYDA 3G0ZA 4E0DA 4KKOA 1NK8A 1LV5A 3PX4A 4KHWA 1BQMA 4FJLA 4CEOA 4F3TA 1W9HA 4FZZA 3V9UA 5SZTA 3KLGA 3HM9A 1J54A 4J2AA 4M3XA 3C6UA 2ITGA 4W5TA 3T1AA 3L2VA 4CGFA 1LWFA 3SJJA 5DK5A 2D0AA 4IG3A 5HROA 4RW7A 2ZQBA 3O3FA 2DY4A 3F73A 4N5SA 1KLNA 2HHWA 1L5UA 2KFZA 2X78A 1KVCA 2IAJA 3AVCA 4NYNA 1WSFA 2HNZA 4ZTFA 1ASUA 4CIEA 1L3VA 2G8UA 1TVRA 3AVIA 3V9ZA 3TABA 4N56A 4AHTA 1NK7A 4DSKA 4FYDA 4H4MA 2X74A 1CXUA 4FJ5A 2A1RA 3MECA 4I2QA 2QXFA 4KB0A 3AO4A 3ZSRA 4FXDA 1QS4A 1VSEA 4DF4A 1WSIA 4J2EA 3TI0A 2G8FA 4OJRA 1JLGA 4JS4A 3PO4A 1MU2A 4CJTA 3HP9A 2OPQA 1TV6A 3ZT1A 3FFIA 4K8ZA 2EX3A 4PUOA 1VSDA 3VQCA 4DSEA 4KHQA 2IGIA 3SZ2A 4N41A 1B9FA 4BE2A 3L2UA 2RF2A 1VSHA 1K6YA 1QSYA 5HRPA 1FXXA 3L3UA 2HNYA 2IS3A 4OVLA 5KRSA 3TAGA 4CGIA 3ZSQA 4CJQA 2IDOA 1Q9XA 3T19A 4PQUA 4HCBA 4KPYA 3L3VA 3K59A 4CJWA 1QTMA 4CEDA 2G8WA 4B08A 3OYLA 2RPIA 4DTRA 4B9TA 4HCCA 3OJSA 4FLYA 3SCXA 4DTUA 1YTUA 3P83D 5C24A 4FJNA 1S1TA 1HYVA 3G10A 4NCGA 3ALYA 1ZYQA 3NBPA 2GUIA 3PO5A 1DLOA 3LAMA 4YNQA 1QHTA 2X6SA 3PUFA 3VQ8A 1NKEA 2DFHA 2XO7A 4ID1A 1JLCA 1RTHA 4OPKA 4E7HA 4FJIA 1A5WA 3D0PA 1S9EA 4CHOA 3HVTA 1TK0A 4KHUA 4CK1A 1WAJA 2PZSA 4CK2A 3TARA 5FROA 4C8LA 3K5MA 3AA2A 3ZT3A 1TK5A 3HVRA 1XHXA 4CECA 2OPSA 3SQ1A 4ZHRA 4FVMA 4WE1A 1U47A 3MEGA 4DQSA 3DLEA 2FBTA 4HHTA 1NK6A 3RRHA 4FJ9A 1YT3A 2ZE2A 1JKHA 2Y1IA 3BDPA 5J2PA 2G8VA 3OYGA 3OS2A 4DTJA 2IOCA 4CJLA 4E7LA 1LWCA 1DTTA 1TAQA 2YHBA 4I7FA 3NH1A 3P1GA 3HPOA 5KGXA 2YV0X 1HJRA 3P5JA 4BACA 1IH7A 1VSJA 4AHCA 4CHZA 4CJRA 1RT1A 4GW6A 1R0AA 3VQEA 1G15A 2RKIA 3AVMA 5C42A 4DFJA 3CM6A 3EY1A 4CCHA 3UIQA 1RTJA 3OYAA 1T03A 4FLUA 2X6NA 5CZ1A 3U6FA 2GBZA 3V6DA 3O4QA 3S9HA 1NJYA 4BDPA 1GOBA 2XRIA 1NOYA 4DQIA 3V1QA 1A5XA 3NGYA 3AVHA 4CFAA 4FLZA 1KVBA 3L2RA 1TGOA 4B9LA 4O44A 1U48A 4M3WA 2BDPA 3ITHA 4IKFA 1S9GA 1GOCA 1RBRA 3AO5A 4FW2A 4E89A 1NKCA 4KB1A 4N76A 3RTVA 3RMBA 4KFBA 4DSIA 3QO9A 2FBYA 4Z0UA 3C6TA 3DLGA 3NF9A 2OPPA 3V81A 3DOLA 3LP3A 1UA0A 4OLBA 2QKBA 2YNIA 4DSFA 2O4IA 4OGEA 4LD0A 4L8RB 1EETA 2XHBA 3AA4A 1BCOA 1UOCA 4DU3A 4CJVA 1GOAA 4OLAA 1RBSA 1VSLA 3K57A 2HNDA 1XI1A 5FRMA 4I9QA 1RBVA 5C25A 1F21A 1I39A 2WOMA 3LWLA 2KQ2A 3C94A 1JXEA 4R5PA 4NCBA 4CHNA 4CEBA 1SV5A 4KV8A 4DG1A 3WNFA 4B9MA 3M8QA 4OKEA 2VWJA 1L3UA 4CHQA 4CJPA 2F8SA 4O55A 4BDZA 4FJGA 4RW6A 1QE1A 4FK4A 3KLEA 3KLIA 4C8KA 4DQQA 1KFDA 5KRTA 1UA1A 4DTMA 4BE0A 1SKWA 4GMJB 4Y1DA 1SL1A 1XWLA 2OPRA 3AVJA 4DU4A 1VSIA 3S3MA 3BGRA 1LAVA 3DRSA 4B9VA 1KCFA 3NAEA 2BGGA 1YVUA 4O4GA 3HJFA 3RMDA 2B6AA 1NK4A 2XY7A 1Y97A 3PY8A 1T7PA 2OZSA 1FK9A 3ZCMA 3O4NA 5E41A 2PY5A 3CM5A 2E6MA 2I5JA 3TAQA 3SQ2A 1IG9A 1JLAA 1RCHA 4DU1A 4FK2A 3ASMA 4TSXA 4AHSA 3V9WA 4FM1A 1NJZA 1SL2A 3HO1A 2VWKA 1U49A 2GV9A 4KREA 2G8IA 1BISA 3K5LA 2AJQA 4M45A 4DS5A 3LWMA 1RDDA 4CJSA 3H08A 1WN7A 2A1SA 1EP4A 1S1XA 1VRUA 2E4LA 3AVKA 4OKKA 4E7JA 2PYJA 1J53A 3HT3A 2B4JA 5K14A 1C1AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NCA A;  1BI4 A;  4MQ3 A;  2YKM A;  4M3Z A;  1RBT A;  4EZ6 A;  3HP6 A;  4ELT A;  3QEW A;  4FJJ A;  4RW9 A;  3VQ6 A;  3VQA A;  1CLQ A;  1L3S A;  4DFM A;  3KLF A;  4IDK A;  2YNH A;  2P1J A;  1RT2 A;  1X9M A;  3ZSW A;  1D5A A;  4ZTJ A;  3V9X A;  4IFY A;  3MXI A;  1S1V A;  3B6P A;  3LZJ A;  3S3O A;  4E7I A;  2FBV A;  3NF7 A;  4F4K A;  2P51 A;  2F96 A;  4CEQ A;  4W5O A;  4HTU A;  5HP1 A;  3DLB A;  1NOZ A;  2HHV A;  4HUE A;  3DI6 A;  1LAW A;  3I0R A;  3VQ7 A;  3AVF A;  3NF6 A;  4M3T A;  1BIZ A;  5JS2 A;  4DS4 A;  1S5J A;  1EX4 A;  1TKX A;  4LH4 A;  4RW4 A;  4HUG A;  4KHY A;  4W5Q A;  4E7K A;  3THV A;  2B5J A;  3AO1 A;  4Q0B A;  5HBM A;  2XY8 A;  1HQE A;  3ZSY A;  4BE1 A;  4CFD A;  3SNN A;  1C6V A;  1RT4 A;  3L2W A;  3IAY A;  4B9U A;  2OYQ A;  3DM2 A;  5D3G A;  3QET A;  1C0T A;  3HL8 A;  3U3G A;  4XIU A;  3TAF A;  1RTD A;  1B9D A;  4PY5 A;  1C0U A;  4CFC A;  4N47 A;  3IG1 A;  4Z4C A;  3V1O A;  3NGZ A;  4FJK A;  1L3T A;  5CY4 A;  2EHG A;  4QCL A;  1EKE A;  4Z4E A;  1B92 A;  3AVB A;  3DLH A;  4H4O A;  3V4I A;  3M8P A;  3D45 A;  4DTO A;  1TKZ A;  5FDL A;  1HYZ A;  4DFK A;  3LPU A;  1U45 A;  3KD1 E;  3AA3 A;  2DFE A;  3SUQ A;  5I42 A;  4RW8 A;  3OYC A;  1TL3 A;  4EP5 A;  3SYZ A;  3CFR A;  3OJU A;  4M3R A;  3U3Y A;  2Y1J A;  4FK0 A;  3SUO A;  1VK0 A;  4C8M A;  3AVG A;  4CF2 A;  1JLB A;  1WNS A;  3NGI A;  2LSN A;  4CK3 A;  3VQD A;  1U4B A;  3OYK A;  4HUF A;  4F2R A;  3ZSO A;  2KW4 A;  1S6Q A;  3B6O A;  5J2N A;  4KTZ A;  4KHN A;  2HVI A;  1BHL A;  3ZSX A;  2DFF A;  1U04 A;  1RDA A;  5KI6 A;  2BE2 A;  3ZSZ A;  3O3G A;  3EZ5 A;  1SL0 A;  3A2F A;  5J1E A;  3CFP A;  1C1B A;  3IRX A;  3TAP A;  4HVJ A;  3OYM A;  1RT3 A;  2D0B A;  1N5Y A;  3LAL A;  1LW0 A;  3QIP A;  4OPJ A;  4JS5 A;  3QEV A;  1ZBI A;  2KZZ A;  1RT5 A;  4DTP A;  3M8S A;  3K5N A;  3KK1 A;  4Z4F A;  2PYL A;  1RBU A;  4C8N A;  4CHP A;  4B9S A;  1BGX T;  3HYF A;  1FKP A;  1WSE A;  2P5O A;  4KI4 A;  5CZ2 A;  3PV8 A;  3KLH A;  3AV9 A;  4J2D A;  3IS9 A;  4Y1C A;  4E1M A;  4JRP A;  1JLE A;  4KAZ A;  3SI6 A;  3NH2 A;  4DTS A;  3KKS A;  4M42 A;  4B3O A;  3KTQ A;  4DSL A;  4CF9 A;  3SV4 A;  4CJ3 A;  2XY5 A;  2HMI A;  3NHG A;  1I3A A;  4YFU A;  4ELU A;  4CJU A;  1X1P A;  5SWM A;  4W5R A;  3V1R A;  3LDS A;  3I0S A;  4FLX A;  1RTI A;  3CQ8 A;  4CGG A;  3CG7 A;  1RDB A;  2D5R A;  3KK3 A;  1RIL A;  3PX6 A;  4KTQ A;  4CF0 A;  4KHS A;  3NFA A;  2HB5 A;  1WAF A;  4CF8 A;  1IKV A;  2YNG A;  4FM2 A;  3S3N A;  1HQU A;  3SUN A;  4IG0 A;  1T05 A;  3CFO A;  3AO2 A;  4B9N A;  2JLE A;  5DMR A;  1IKX A;  3AVN A;  4OKJ A;  3NE6 A;  1BIU A;  3MXM A;  1QSL A;  2D0C A;  4DTX A;  1Q8I A;  5HRS A;  3SQ4 A;  1DTQ A;  2OA8 A;  4CEA A;  1QSS A;  1HMV A;  5KTQ A;  1SKS A;  3RRG A;  2XY6 A;  1EXQ A;  4CGJ A;  1NK5 A;  2HHT A;  1Z25 A;  2W42 A;  4AHU A;  4FM0 A;  4FJ8 A;  2YHA A;  2Z1I A;  3OVN A;  1BCM A;  1KLM A;  4Q5V A;  2NUB A;  3V9S A;  3VA3 A;  1WSJ A;  3ZT0 A;  4AIL C;  4CFB A;  3L2Q A;  3I8D A;  4FLT A;  1C1C A;  3VQQ A;  4CJK A;  3MED A;  4O0I A;  1CZ9 A;  1VSM A;  3TR8 A;  3QIN A;  4K8X A;  5J2M A;  4FJX A;  3OY9 A;  3JSM A;  2HHX A;  1XHZ A;  1NJX A;  4PA1 A;  3OS1 A;  4KO0 A;  1J9A A;  5I3U A;  1Z26 A;  1TKT A;  1X9S A;  3NH0 A;  3QNN A;  3QES A;  4GVM A;  1VSK A;  1WLJ A;  3K2P A;  3ZSV A;  1D8Y A;  1ASW A;  3TWH A;  1WSH A;  3NCI A;  4AHR A;  4J2B A;  4CES A;  3OYI A;  4AH9 A;  2YKN A;  3KKR A;  4CHY A;  1BQN A;  4ELV A;  2HVH A;  4CE9 A;  5JS1 A;  3VQ5 A;  4G1Q A;  4UQG A;  2KFN A;  3RR8 A;  4Z4I A;  3F9K A;  4LSN A;  4Z4H A;  3SPY A;  2G8K A;  3OYN A;  4H8K A;  5T7B A;  3TAN A;  1TK8 A;  5HLF A;  1RT6 A;  5HRN A;  1KSP A;  1REV A;  3ISN C;  2F8T A;  3C95 A;  1NK0 A;  1SKR A;  4C8O A;  3MAQ A;  4KRF A;  3VQ4 A;  4LY7 A;  2HHQ A;  3VN5 A;  3DRP A;  1ASV A;  4CJE A;  4DLE A;  4NYF A;  5CYQ A;  4O5B A;  4CJ4 A;  1J5O A;  4W5N A;  4ID5 A;  2KZM A;  3JYT A;  1KTQ A;  4FCY A;  3SQ0 A;  3ULD A;  3LAK A;  5EU7 A;  3AVA A;  4EZ9 A;  4PWD A;  3LPT A;  4CJ5 A;  3MXJ A;  3SUP A;  1KVA A;  1NKB A;  1FKO A;  2O4G A;  1NJW A;  1TAU A;  2WON A;  1HRH A;  3OYH A;  3DMJ A;  3LP1 A;  3NF8 A;  4FJH A;  2HW3 A;  4QAG A;  1LWE A;  1TKD A;  1ZBF A;  4JRQ A;  2VG5 A;  1YTA A;  3QER A;  3NDK A;  4RG8 A;  1S1U A;  5KGW A;  4B8C A;  4CGH A;  1S6P A;  4DQR A;  3QEI A;  1TL1 A;  1ZBU A;  3O3H A;  4M41 A;  3RMA A;  3PX0 A;  4IBN A;  1RT7 A;  3OYB A;  1VSF A;  4KTW A;  4JLH A;  1A5V A;  3HK2 A;  4DFP A;  3KK2 A;  1CZB A;  4E19 A;  1N6Q A;  3T3F A;  1XC9 A;  3RMC A;  3K5O A;  4IFV A;  1VRT A;  1C0M A;  3HPG A;  3SPZ A;  4QOZ B;  1ITG A;  4E3S A;  3HPH A;  4FJM A;  2IC3 A;  3M8R A;  2G8H A;  4Z4G A;  2VG6 A;  1ZBH A;  1CXQ A;  5FRN A;  3LAN A;  3CYM A;  4FLW A;  4LH5 A;  1RDC A;  2R7Y A;  2HHU A;  3HST B;  1HNI A;  2BAN A;  3DLK A;  3TAE A;  4M3Y A;  2QK9 A;  3KD5 E;  4FZX C;  3EYZ A;  4FZY A;  4I9L A;  1O1W A;  3L8B A;  2P5G A;  2FBX A;  1IKW A;  2FC0 A;  1IKY A;  3VQ9 A;  4DQP A;  4MFB A;  1RNH A;  3OYJ A;  3QEP A;  3OYE A;  1D9D A;  2E6L A;  1UWB A;  1IO2 A;  4EP4 A;  3TAM A;  1ZBL A;  2OZM A;  3LP2 A;  3HXM A;  1UAX A;  1WSG A;  3VQB A;  2DTU A;  4E1N A;  2KTQ A;  1D9F A;  1HYS A;  4CEF A;  4LSL A;  4CF1 A;  3RWU A;  4CGD A;  3AA5 X;  3MEE A;  3DOK A;  3OS0 A;  3AVL A;  1JL2 A;  1QQC A;  1SUQ A;  1S1W A;  1JXB A;  3WNE A;  2ATQ A;  2YNF A;  3LZI A;  1NK9 A;  2Z1J A;  4DF8 A;  1BI4 B;  1HPZ A;  4CEE A;  5HRR A;  3WNG A;  1Q9Y A;  1X9W A;  4BWJ A;  4DTN A;  4BWM A;  4CIG A;  4CEZ A;  3DYA A;  4DSJ A;  1KRP A;  3LP0 A;  4I2P A;  4AHV A;  2HHS A;  4FJ7 A;  4F2S A;  3K58 A;  1HNV A;  3VA0 A;  2JGU A;  3QNO A;  3ZT4 A;  1T8E A;  1JLF A;  3VQP A;  2QKK A;  3SV3 A;  1JLQ A;  4ICL A;  4O0J A;  4F3O A;  4FLV A;  2Z1H A;  4DMN A;  4B8A B;  2ETJ A;  2RN2 A;  1LW2 A;  4CER A;  4KI6 A;  3KJV A;  4FW1 A;  3RR7 A;  3DRR A;  4DWI A;  4DLG A;  4F8R A;  4BDY A;  3KIO A;  1JL1 A;  3AO3 A;  3QIO A;  4CJF A;  3QLH A;  3OYF A;  3QEX A;  3E01 A;  3DLR A;  3ZT2 A;  2ZD1 A;  4CIF A;  5CYM A;  1KFS A;  4M3U A;  5J2Q A;  1W0H A;  1BL3 A;  2Q3S A;  3WNH A;  2VG7 A;  2Z1G A;  4OGC A;  3OYD A;  3G0Z A;  4E0D A;  4KKO A;  1NK8 A;  1LV5 A;  3PX4 A;  4KHW A;  1BQM A;  4FJL A;  4CEO A;  4F3T A;  1W9H A;  4FZZ A;  3V9U A;  5SZT A;  3KLG A;  3HM9 A;  1J54 A;  4J2A A;  4M3X A;  3C6U A;  2ITG A;  4W5T A;  3T1A A;  3L2V A;  4CGF A;  1LWF A;  3SJJ A;  5DK5 A;  2D0A A;  4IG3 A;  5HRO A;  4RW7 A;  2ZQB A;  3O3F A;  2DY4 A;  3F73 A;  4N5S A;  1KLN A;  2HHW A;  1L5U A;  2KFZ A;  2X78 A;  1KVC A;  2IAJ A;  3AVC A;  4NYN A;  1WSF A;  2HNZ A;  4ZTF A;  1ASU A;  4CIE A;  1L3V A;  2G8U A;  1TVR A;  3AVI A;  3V9Z A;  3TAB A;  4N56 A;  4AHT A;  1NK7 A;  4DSK A;  4FYD A;  4H4M A;  2X74 A;  1CXU A;  4FJ5 A;  2A1R A;  3MEC A;  4I2Q A;  2QXF A;  4KB0 A;  3AO4 A;  3ZSR A;  4FXD A;  1QS4 A;  1VSE A;  4DF4 A;  1WSI A;  4J2E A;  3TI0 A;  2G8F A;  4OJR A;  1JLG A;  4JS4 A;  3PO4 A;  1MU2 A;  4CJT A;  3HP9 A;  2OPQ A;  1TV6 A;  3ZT1 A;  3FFI A;  4K8Z A;  2EX3 A;  4PUO A;  1VSD A;  3VQC A;  4DSE A;  4KHQ A;  2IGI A;  3SZ2 A;  4N41 A;  1B9F A;  4BE2 A;  3L2U A;  2RF2 A;  1VSH A;  1K6Y A;  1QSY A;  5HRP A;  1FXX A;  3L3U A;  2HNY A;  2IS3 A;  4OVL A;  5KRS A;  3TAG A;  4CGI A;  3ZSQ A;  4CJQ A;  2IDO A;  1Q9X A;  3T19 A;  4PQU A;  4HCB A;  4KPY A;  3L3V A;  3K59 A;  4CJW A;  1QTM A;  4CED A;  2G8W A;  4B08 A;  3OYL A;  2RPI A;  4DTR A;  4B9T A;  4HCC A;  3OJS A;  4FLY A;  3SCX A;  4DTU A;  1YTU A;  3P83 D;  5C24 A;  4FJN A;  1S1T A;  1HYV A;  3G10 A;  4NCG A;  3ALY A;  1ZYQ A;  3NBP A;  2GUI A;  3PO5 A;  1DLO A;  3LAM A;  4YNQ A;  1QHT A;  2X6S A;  3PUF A;  3VQ8 A;  1NKE A;  2DFH A;  2XO7 A;  4ID1 A;  1JLC A;  1RTH A;  4OPK A;  4E7H A;  4FJI A;  1A5W A;  3D0P A;  1S9E A;  4CHO A;  3HVT A;  1TK0 A;  4KHU A;  4CK1 A;  1WAJ A;  2PZS A;  4CK2 A;  3TAR A;  5FRO A;  4C8L A;  3K5M A;  3AA2 A;  3ZT3 A;  1TK5 A;  3HVR A;  1XHX A;  4CEC A;  2OPS A;  3SQ1 A;  4ZHR A;  4FVM A;  4WE1 A;  1U47 A;  3MEG A;  4DQS A;  3DLE A;  2FBT A;  4HHT A;  1NK6 A;  3RRH A;  4FJ9 A;  1YT3 A;  2ZE2 A;  1JKH A;  2Y1I A;  3BDP A;  5J2P A;  2G8V A;  3OYG A;  3OS2 A;  4DTJ A;  2IOC A;  4CJL A;  4E7L A;  1LWC A;  1DTT A;  1TAQ A;  2YHB A;  4I7F A;  3NH1 A;  3P1G A;  3HPO A;  5KGX A;  2YV0 X;  1HJR A;  3P5J A;  4BAC A;  1IH7 A;  1VSJ A;  4AHC A;  4CHZ A;  4CJR A;  1RT1 A;  4GW6 A;  1R0A A;  3VQE A;  1G15 A;  2RKI A;  3AVM A;  5C42 A;  4DFJ A;  3CM6 A;  3EY1 A;  4CCH A;  3UIQ A;  1RTJ A;  3OYA A;  1T03 A;  4FLU A;  2X6N A;  5CZ1 A;  3U6F A;  2GBZ A;  3V6D A;  3O4Q A;  3S9H A;  1NJY A;  4BDP A;  1GOB A;  2XRI A;  1NOY A;  4DQI A;  3V1Q A;  1A5X A;  3NGY A;  3AVH A;  4CFA A;  4FLZ A;  1KVB A;  3L2R A;  1TGO A;  4B9L A;  4O44 A;  1U48 A;  4M3W A;  2BDP A;  3ITH A;  4IKF A;  1S9G A;  1GOC A;  1RBR A;  3AO5 A;  4FW2 A;  4E89 A;  1NKC A;  4KB1 A;  4N76 A;  3RTV A;  3RMB A;  4KFB A;  4DSI A;  3QO9 A;  2FBY A;  4Z0U A;  3C6T A;  3DLG A;  3NF9 A;  2OPP A;  3V81 A;  3DOL A;  3LP3 A;  1UA0 A;  4OLB A;  2QKB A;  2YNI A;  4DSF A;  2O4I A;  4OGE A;  4LD0 A;  4L8R B;  1EET A;  2XHB A;  3AA4 A;  1BCO A;  1UOC A;  4DU3 A;  4CJV A;  1GOA A;  4OLA A;  1RBS A;  1VSL A;  3K57 A;  2HND A;  1XI1 A;  5FRM A;  4I9Q A;  1RBV A;  5C25 A;  1F21 A;  1I39 A;  2WOM A;  3LWL A;  2KQ2 A;  3C94 A;  1JXE A;  4R5P A;  4NCB A;  4CHN A;  4CEB A;  1SV5 A;  4KV8 A;  4DG1 A;  3WNF A;  4B9M A;  3M8Q A;  4OKE A;  2VWJ A;  1L3U A;  4CHQ A;  4CJP A;  2F8S A;  4O55 A;  4BDZ A;  4FJG A;  4RW6 A;  1QE1 A;  4FK4 A;  3KLE A;  3KLI A;  4C8K A;  4DQQ A;  1KFD A;  5KRT A;  1UA1 A;  4DTM A;  4BE0 A;  1SKW A;  4GMJ B;  4Y1D A;  1SL1 A;  1XWL A;  2OPR A;  3AVJ A;  4DU4 A;  1VSI A;  3S3M A;  3BGR A;  1LAV A;  3DRS A;  4B9V A;  1KCF A;  3NAE A;  2BGG A;  1YVU A;  4O4G A;  3HJF A;  3RMD A;  2B6A A;  1NK4 A;  2XY7 A;  1Y97 A;  3PY8 A;  1T7P A;  2OZS A;  1FK9 A;  3ZCM A;  3O4N A;  5E41 A;  2PY5 A;  3CM5 A;  2E6M A;  2I5J A;  3TAQ A;  3SQ2 A;  1IG9 A;  1JLA A;  1RCH A;  4DU1 A;  4FK2 A;  3ASM A;  4TSX A;  4AHS A;  3V9W A;  4FM1 A;  1NJZ A;  1SL2 A;  3HO1 A;  2VWK A;  1U49 A;  2GV9 A;  4KRE A;  2G8I A;  1BIS A;  3K5L A;  2AJQ A;  4M45 A;  4DS5 A;  3LWM A;  1RDD A;  4CJS A;  3H08 A;  1WN7 A;  2A1S A;  1EP4 A;  1S1X A;  1VRU A;  2E4L A;  3AVK A;  4OKK A;  4E7J A;  2PYJ A;  1J53 A;  3HT3 A;  2B4J A;  5K14 A;  1C1A A; 
#chains in the Genus database with same CATH topology
 1YAG A;  3GOI A;  2NRT A;  1YJW N;  4FVU A;  1RBT A;  1BA1 A;  5M1P A;  4RW9 A;  3DWL A;  4NXM K;  4IOC L;  4B1W B;  4IOX A;  4FWP A;  2YX6 A;  1X9M A;  3EE9 A;  3V9X A;  1S1V A;  2WC9 A;  3S3O A;  4E7I A;  2FBV A;  2P51 A;  1K8A O;  1QZ6 A;  3NF6 A;  3C7N A;  3GBT A;  1BIZ A;  3EEQ A;  5EX5 A;  1EX4 A;  4KHY A;  2ZWH A;  4E7K A;  4Q0B A;  1HQE A;  3BP8 A;  2RHK A;  4B9U A;  5D3G A;  4XIU A;  1OVQ A;  2QXL A;  4O8K A;  1C0U A;  1TUU A;  4CFC A;  4N47 A;  2AA4 A;  4FJK A;  5CY4 A;  1YIT N;  4H5R A;  5E26 A;  3HI0 A;  1C0F A;  5AQR A;  4BR4 A;  4U7B A;  5AQT A;  2E20 A;  1HYZ A;  3LPU A;  3WXI A;  3MN7 A;  1LCU A;  5I42 A;  2KKZ A;  4EP5 A;  3U3Y A;  4M3R A;  2Y1J A;  4FK0 A;  4C8M A;  1WNS A;  4FO0 A;  3TTF A;  4H0P A;  3VQD A;  4HUF A;  3UKU B;  1XC3 A;  4KTZ A;  3EZ5 A;  1SL0 A;  3O3G A;  3E66 A;  3OYM A;  1GLC G;  4YOT A;  4OPJ A;  1N33 K;  1ZBI A;  4DTP A;  1N32 K;  4IFE A;  3KK1 A;  1W2B M;  4ISG A;  4GV3 A;  2PYL A;  1RBU A;  3ZET A;  4CHP A;  3J80 O;  1MDU B;  3DXK B;  1FKP A;  3VEO A;  3PV8 A;  3SMS A;  4Y1C A;  1IV0 A;  4E1M A;  4JRP A;  3J7Y P;  4EIA A;  5AQQ A;  4M42 A;  4XH1 A;  4DSL A;  1K8K A;  3NHG A;  1I3A A;  3O4W A;  4CJU A;  3EKS A;  2D4W A;  4FLX A;  1RTI A;  1QQO A;  1QHA A;  3PX6 A;  2UU9 K;  4KTQ A;  4FWS A;  3O9S A;  4JKE A;  2YNG A;  1HQU A;  3SUN A;  4IG0 A;  2PFU A;  4B9N A;  1IKX A;  2P9P B;  4DTX A;  1NGB A;  1Q8I A;  1NNE A;  1HMV A;  2NLX A;  4J8F A;  4FM0 A;  4DV5 K;  4BG9 A;  2Z1I A;  3OVN A;  1KLM A;  2NUB A;  4AIL C;  1WSJ A;  1NWK A;  2GWJ A;  4CFB A;  1C1C A;  4CJK A;  4FJX A;  4PL8 A;  3OS1 A;  1J9A A;  1Z26 A;  1Q18 A;  3QES A;  4GVM A;  3K2P A;  3IFR A;  2VYP A;  3TWH A;  3TSU A;  4JI1 K;  4CHY A;  1HKC A;  1YJN N;  2G8K A;  3R1X A;  1MWM A;  5T7B A;  1TK8 A;  5HLF A;  3F9M A;  4H0V B;  1REV A;  3ISN C;  2UUB K;  2VQF K;  1T6C A;  1VQ8 N;  3CJ9 A;  4OX9 K;  3BF1 A;  3O9Q A;  3VN5 A;  1EQY A;  4DB3 A;  4NYF A;  3NVM A;  1TYQ A;  2YHX A;  1J5O A;  2KZM A;  4WFN L;  4H0X B;  1IBK K;  3ULD A;  3JAM O;  1T44 A;  3CD6 N;  1RFQ A;  1TAU A;  1NKB A;  5BPL A;  3OYH A;  3LP1 A;  2F7T A;  4B3S K;  2HOE A;  4QAG A;  1ZBF A;  3SMP A;  1BG3 A;  1Q81 O;  4RG8 A;  1S1U A;  4BRP A;  1S6P A;  4V19 S;  1TL1 A;  1I94 K;  1VSF A;  4JLH A;  3O08 A;  4IFV A;  2QA4 N;  4QOZ B;  1ATS A;  1RGI A;  4E3S A;  2IC3 A;  3THW A;  3KK7 A;  1ZBH A;  3LAN A;  4FLW A;  1RDC A;  3HST B;  1HNI A;  1V4S A;  2BAN A;  3DLK A;  5AQZ A;  3TAE A;  4BC3 A;  3EYZ A;  4IXC A;  5LJW A;  2P5G A;  1IKW A;  1IKY A;  4R79 A;  1UWB A;  1S22 A;  4EP4 A;  3ENB A;  3HXM A;  3L6Q A;  2ASM A;  2UXC K;  3VQB A;  2E88 A;  2DTU A;  2KTQ A;  1HNW K;  4CEF A;  3CER A;  3RWU A;  3DOK A;  3FZM A;  3CCL N;  1S1W A;  2ATQ A;  3LZI A;  4B1Z A;  5HRR A;  3WNG A;  4BWJ A;  4DTN A;  4DSJ A;  1KRP A;  4I2P A;  1NM1 A;  4AHV A;  4F2S A;  3O6W A;  3QNO A;  1JLF A;  3C6A A;  4F3O A;  1SQK A;  2Z1H A;  1BWF O;  4BGB A;  5AQN A;  3OYF A;  3QLH A;  3QEX A;  3E01 A;  3CPE A;  3DLR A;  3ZT2 A;  1GLJ O;  3J8A A;  4M3U A;  2VG7 A;  3E1Y A;  4DHY A;  3SAF A;  3PLA A;  4KH5 A;  4BQZ A;  4F3T A;  1W9H A;  1X3M A;  4CZI A;  3KLG A;  1QVF M;  3C6U A;  2ITG A;  3SJJ A;  5HRO A;  2ZQB A;  2NRR A;  3FE1 A;  1L5U A;  2X78 A;  4LF8 K;  1TVR A;  4AHT A;  4FYD A;  4K43 A;  2A1R A;  4I2Q A;  1BU6 O;  1QS4 A;  1VSE A;  1WSI A;  4OJR A;  1JLG A;  2P9U B;  3PO4 A;  2ZGY A;  3ZT1 A;  2OPQ A;  3FFI A;  4K8Z A;  3I33 A;  2QWN A;  1XNR K;  5EXW A;  3SZ2 A;  4N41 A;  1B9F A;  3O9T A;  3L3U A;  4FL9 A;  4DV2 K;  3TAG A;  5FPD A;  2Q0U A;  2UUA K;  3KWG A;  4DV7 K;  5IT9 O;  3H6E A;  1KD1 O;  2W6K A;  4A62 A;  4FWM A;  4CED A;  3SLC A;  1WBD A;  3SCX A;  2QWM A;  4FLY A;  4DTU A;  3VF4 A;  5KQD A;  4CJ7 A;  4CZE A;  3PO5 A;  3LAM A;  1QHT A;  4JI6 K;  3VQ8 A;  1NKE A;  3GE1 A;  3O5B A;  2XO7 A;  1RTH A;  4MDB A;  1A5W A;  1MWK A;  5AJ3 K;  4RWT A;  3ZX3 A;  3TAR A;  3WEE A;  3K5M A;  1WOQ A;  3THY B;  2OPS A;  4XEI A;  2FBT A;  1NK6 A;  4A2A A;  4IWV A;  4X65 K;  1BOT O;  2ZE2 A;  2P9I A;  1JKH A;  3TTD A;  2Y1I A;  4NXN K;  3O8M A;  1LWC A;  3IKM A;  1P90 A;  4PHT X;  3AGK A;  1HJR A;  4BAC A;  2ZJR L;  1VSJ A;  4AHC A;  3B8A X;  3VQE A;  1G15 A;  1R59 O;  2ZGZ A;  3UIQ A;  2X6N A;  2GBZ A;  3WQT A;  5A2Q O;  3MN5 A;  3NGY A;  3L2R A;  1U48 A;  5AQI A;  3QFP A;  3ITH A;  5GAG P;  1RBR A;  2Q31 A;  4KFB A;  4DSI A;  4Z0U A;  3NF9 A;  1YF5 L;  2V7Y A;  1UA0 A;  2YI1 A;  2QKB A;  2YNI A;  4BRD A;  4DSF A;  4GNI A;  4QS7 A;  5F1X A;  1EET A;  4L8R B;  1C0G A;  3AA4 A;  3WUH A;  3SAG A;  1BCO A;  1UOC A;  4A57 A;  4CJV A;  3K57 A;  2HBJ A;  4GY2 B;  3BF3 A;  1RDU A;  5C25 A;  4MLH A;  1F21 A;  4BRG A;  1JXE A;  4B9M A;  3A5N C;  4CJP A;  4O55 A;  4LF9 K;  4BDZ A;  4FJG A;  2UXB K;  1QE1 A;  2E2N A;  2Q2R A;  5AQK A;  5KRT A;  3CF5 L;  4DQQ A;  3WEE B;  1XWL A;  1VSI A;  4B9V A;  1NG9 A;  5I9E B;  4JI8 K;  3AAQ A;  1YXQ A;  2OZS A;  4JI5 K;  2P9N B;  4E1J A;  3ZCM A;  5ADX H;  3SQ2 A;  4FM1 A;  4JD2 A;  2GV9 A;  4JKD A;  2DPN A;  2WBN A;  1VRU A;  4OKK A;  1YI2 N;  2PYJ A;  5FLX O;  2GUP A;  2B4J A;  1C1A A;  4BC4 A;  4YOX A;  4DQ8 A;  2YKM A;  3BEX A;  4M3Z A;  3AAP A;  3D6R A;  4EZ6 A;  4ELT A;  3VQ6 A;  1CLQ A;  1L3S A;  2E2Q A;  3J7Z O;  4DFM A;  4FWR A;  2IVO A;  4DUZ K;  1J5E K;  4ZTJ A;  3MXI A;  4BR9 A;  1VQL N;  4BC2 A;  4BRQ A;  2P9L A;  2F96 A;  4CEQ A;  2HHV A;  3EO3 A;  2OCE A;  4HTU A;  3H45 C;  1VQN N;  3I0R A;  4EFH A;  3G4S N;  2CGK A;  3HM8 A;  2F9W A;  4DS4 A;  3O1B A;  2NRZ A;  1NMN A;  3SJH A;  3K0S A;  3AO1 A;  5HBM A;  4GKK K;  2XY8 A;  4BE1 A;  3OW2 M;  4CFD A;  1RT4 A;  1NJI O;  5EVZ A;  3M6G A;  5M1K A;  3HL8 A;  3TAF A;  2BTF A;  2D0P A;  4Z4C A;  3NGZ A;  1L3T A;  3CI5 A;  4Z4E A;  1QQN A;  3K9J A;  3AVB A;  3V4I A;  3M8P A;  4DTO A;  1HPM A;  1VQK N;  1TKZ A;  5BR9 A;  3CCJ N;  3KD1 E;  3WT0 A;  1GLF O;  5BRH A;  3SUQ A;  2A5X A;  3SYZ A;  3SUO A;  3MK6 A;  3AVG A;  1JLB A;  3NGI A;  2LSN A;  1U4B A;  4YDU C;  3CJ7 A;  4C1N I;  4F2R A;  1BA0 A;  1BHL A;  1TK5 A;  2BE2 A;  3TAP A;  1RT3 A;  2OTL N;  2D0B A;  2ZF5 O;  3LAL A;  1NGI A;  3M8S A;  3R8E A;  4M63 C;  4C8N A;  1W97 L;  1BGX T;  3HYF A;  4KI4 A;  2P9S B;  4BVO A;  3KLH A;  4LC9 B;  4FWQ A;  2HHH K;  4KAZ A;  3SI6 A;  3WQU A;  4CF9 A;  2P9K B;  5AZJ B;  2XY5 A;  2A42 A;  4K42 A;  3THX A;  1HX1 A;  3RVC A;  2OTJ N;  3I0S A;  2FF6 A;  3CG7 A;  2I7P A;  4CGG A;  1RIL A;  4NB4 A;  1NGA A;  3ENO A;  2HB5 A;  4FM2 A;  1ILY A;  3CFO A;  3AO2 A;  5DMR A;  4BRI A;  5E84 A;  3R3L A;  3CCM N;  3U9D A;  5AQV A;  3SQ4 A;  3T69 A;  1QSS A;  1U6Z A;  3RRG A;  1HNZ K;  4CGJ A;  1NK5 A;  2HHT A;  3H3N O;  2W42 A;  3GDQ A;  2YHA A;  4DV4 K;  4Q5V A;  3V9S A;  3VA3 A;  3MX2 A;  3I8D A;  4O0I A;  4K8X A;  1VSM A;  4JK9 A;  3QIN A;  5J2M A;  1N36 K;  1XHZ A;  4KO0 A;  5I3U A;  2HMP A;  1TKT A;  5JIC A;  3WXK A;  1VSK A;  1WLJ A;  3ZSV A;  1ASW A;  2WUS A;  3NCI A;  4AHR A;  2O8E B;  4CES A;  4AH9 A;  1HUX A;  2YKN A;  4ELV A;  4CE9 A;  3CJA A;  5JS1 A;  4UQG A;  2KFN A;  3RR8 A;  4Z4I A;  3F9K A;  4H8K A;  2FLO A;  1KSP A;  1GLA G;  3AY9 A;  1NK0 A;  1SKR A;  5GAE P;  2HHQ A;  1SZ2 A;  2NZT A;  3THX B;  1W7A A;  4O5B A;  4NO7 A;  5FPE A;  4A2B A;  1KTQ A;  4FCY A;  3SQ0 A;  2CGL A;  1Y64 A;  3LM2 A;  1KAX A;  4LF4 K;  2UYT A;  5LY3 A;  3LPT A;  3SUP A;  2WON A;  3VEV A;  5GAH P;  3DMJ A;  4FJH A;  2HW3 A;  1VQM N;  1LWE A;  4K0K K;  4JRQ A;  5KGW A;  4BR2 A;  4DQR A;  3LDO A;  3PX0 A;  3UKR A;  5TKW A;  1A5V A;  1CZB A;  4YDU A;  4AM7 A;  1XC9 A;  3RMC A;  1VRT A;  4JV5 K;  1C0M A;  3HPG A;  4MO4 A;  3VEZ A;  3PIO L;  2W6L A;  3O9R A;  2G8H A;  5FRN A;  4CZF A;  1NLV A;  4LH5 A;  4NLB A;  2HHU A;  3FLC O;  4FZX C;  1WUA A;  5KPT A;  4I9L A;  3VOV A;  5AQL A;  4YOW A;  1HJO A;  4B1V A;  4DQP A;  1IO2 A;  4IDH A;  2OZM A;  2Q36 A;  3LP2 A;  1WSG A;  5AFU A;  4FWL A;  1D9F A;  1HYS A;  4B1X B;  3AA5 X;  4YY3 K;  3AVL A;  4FPA A;  4LFC K;  2Z1J A;  1BI4 B;  2WTU A;  1Q9Y A;  3VGM A;  4CIG A;  2EWS A;  5JMV A;  3EN9 A;  3E9O A;  3LP0 A;  4B1Y B;  2JGU A;  1T8E A;  3VQP A;  2QKK A;  4ICL A;  4FLV A;  1HKG A;  4DMN A;  4B8A B;  4CER A;  4KI6 A;  2P9K A;  2E5L K;  2O8C A;  1JL1 A;  4IOA L;  1BO5 O;  1KFS A;  5ELZ A;  2Q3S A;  2Z1G A;  5AFU H;  2FSK A;  1NMD A;  4E0D A;  4KKO A;  2O8F A;  5AZI A;  4LF6 K;  4B1U B;  3V9U A;  3ID8 A;  3HM9 A;  3FFK B;  2YHY A;  5DK5 A;  2D0A A;  3L0Q A;  4FOE A;  4IG3 A;  4RW7 A;  3L4I A;  2HF3 A;  3CET A;  1KXP A;  4JN4 A;  1L3V A;  3OBW A;  3V9Z A;  3AVI A;  4K25 A;  3TAB A;  1NK7 A;  2X74 A;  1CXU A;  4FJ5 A;  4PKI A;  5BPN A;  4B3M K;  2QXF A;  3L4Q A;  1H1V A;  3ZSR A;  5JVG L;  4DF4 A;  3KHY A;  2QW9 A;  2G8F A;  4JS4 A;  1N34 K;  3VTI A;  4BR5 A;  4JEP A;  4PUO A;  4BR0 A;  4BGA A;  4DSE A;  5BR8 K;  4BRM A;  4QS8 A;  4A5A A;  2D0O A;  1VSH A;  1VQ4 N;  1FXX A;  3MN9 A;  1XUP O;  5KRS A;  4CJQ A;  2IDO A;  3SAH A;  3BZK A;  4PQU A;  4KPY A;  3D2E A;  3U4L A;  3L3V A;  4IZ9 A;  5DM6 L;  1QTM A;  4HCC A;  2RPI A;  4DTR A;  4B9T A;  1Q82 O;  2GUI A;  4YNQ A;  1NGH A;  2QWR A;  4ID1 A;  4OPK A;  4FJI A;  3CJC A;  4E7H A;  3D0P A;  1S9E A;  4K41 A;  3HVT A;  3WXJ A;  2VWB A;  5AR0 A;  2O8E A;  1WAJ A;  4YHH K;  2PZS A;  4C8L A;  3AA2 A;  4BRK A;  3SQ1 A;  1QZ5 A;  1QVG M;  4WE1 A;  3MEG A;  4DQS A;  2UXD K;  3RRH A;  3BDP A;  4JKB A;  4E7L A;  4I7F A;  3NH1 A;  4U67 L;  2YV0 X;  3P5J A;  2JWK A;  4PKG A;  1IH7 A;  4FWO A;  4Z94 A;  5CHI A;  4JYA K;  3HSC A;  4CHZ A;  1R0A A;  4FPB A;  2QI2 A;  2RKI A;  3CM6 A;  3EY1 A;  1RTJ A;  4FSV A;  1VQ7 N;  4FLU A;  3S9H A;  3V6D A;  1GOB A;  1NOY A;  2V51 B;  1HLU A;  3V1Q A;  4FLZ A;  3UB5 A;  4GKJ K;  1KVB A;  4O44 A;  2BDP A;  4BVP A;  4IKF A;  2D1K A;  5AQS A;  4E89 A;  1JCG A;  3V81 A;  4OLB A;  2OPP A;  2O4I A;  3VEN A;  2GEM A;  1VSL A;  5FRM A;  1XI1 A;  4B3T K;  1J6Z A;  3QML A;  1Q86 O;  4OO1 J;  3LWL A;  3WXL A;  2E8A A;  5AQW A;  3I56 N;  1IBM K;  2I7N A;  4MDA A;  4DG1 A;  4OKE A;  1L3U A;  5GIN A;  1ZXO A;  2F8S A;  1EO1 A;  4JI4 K;  2GWK A;  3KLI A;  4C8K A;  1UA1 A;  1NGF A;  1SKW A;  5KPZ A;  3AVJ A;  3DJC A;  5AZI B;  3BGR A;  1LAV A;  1K8K B;  3QBW A;  2P9N A;  1NK4 A;  2RE2 A;  1Y97 A;  1NGE A;  1FK9 A;  1IG9 A;  3H1V X;  3QIC A;  5IWA K;  3V9W A;  1NJZ A;  1BDG A;  3TPQ A;  4KRE A;  2AJQ A;  3A0I X;  4DS5 A;  4ILG B;  3KZB A;  3R6M A;  2E1Z A;  3AVK A;  4E7J A;  1J53 A;  2W40 A;  3HT3 A;  1BI4 A;  4MQ3 A;  2P9S A;  4EAH D;  4RTF D;  5LMU K;  3QEW A;  4DR1 K;  1GLB G;  4DR6 K;  2CH6 A;  3KLF A;  3CCS N;  5FPN A;  2YNH A;  4CVN E;  1KQS M;  5C12 A;  2P1J A;  3ZSW A;  1D5A A;  4BRO A;  3BUZ B;  4BRE A;  2HF4 A;  3B6P A;  1YTU A;  5HP1 A;  4HUE A;  1LAW A;  3VTH A;  1XMQ K;  4M3T A;  4PL7 A;  5JS2 A;  4JI7 K;  3HZ6 A;  4RW4 A;  1TKX A;  4W5Q A;  2B5J A;  3QB0 A;  2YHW A;  1C6V A;  3VES A;  4C1N K;  3L2W A;  4ILH A;  1QQM A;  1C0T A;  1HNX K;  3S41 A;  5C10 A;  1B9D A;  1S72 N;  3IG1 A;  4JI0 K;  4DUY K;  2O8F B;  1EKE A;  1B92 A;  4LFA K;  3DLH A;  4PKH A;  4H4O A;  2CGJ A;  4LF7 K;  1U45 A;  3AA3 A;  3M3Z A;  2Q97 A;  3OJU A;  1VK0 A;  4CF2 A;  1U2V A;  2E2P A;  4F9O A;  2KW4 A;  1S6Q A;  3B6O A;  5J2N A;  4KHN A;  2HVI A;  4FJ7 A;  2DFF A;  1U04 A;  2FSN A;  3UKU A;  5GAD P;  4C23 A;  3CFP A;  3IRX A;  4HVJ A;  3OTO K;  1N5Y A;  1LW0 A;  4BRN A;  1TUY A;  2WFB A;  1RT5 A;  3EZW A;  3K5N A;  3MCA B;  4DR7 K;  4B9S A;  1NGD A;  1DKG D;  4JHD B;  1WSE A;  1NGG A;  3VER A;  4J2D A;  3IS9 A;  3N4P A;  1JLE A;  3FGU A;  4DTS A;  4B3O A;  3KTQ A;  1TYQ B;  2HMI A;  4YFU A;  3I55 N;  1X1P A;  3TSP A;  3TU5 A;  1RDB A;  3KK3 A;  4FWK A;  3NFA A;  4H0T B;  4GVE A;  5BPM A;  4OKJ A;  3UKR B;  1JJ2 M;  5MLC Q;  1SS6 A;  2D0C A;  5HRS A;  1DTQ A;  2PAV A;  3D2F A;  3CQY A;  2XY6 A;  3VGK A;  1BCM A;  3ZT0 A;  4FWN A;  2ZM6 K;  3L2Q A;  2NRH A;  4FLT A;  4AF1 A;  3VQQ A;  1CZ9 A;  2NNW A;  3OY9 A;  2HBL A;  3JSM A;  2HHX A;  1NJX A;  1E3M A;  1D8Y A;  1WSH A;  3OYI A;  3KKR A;  1BQN A;  3J81 O;  2HBK A;  4Z4H A;  2KLA A;  3C6H A;  3TAN A;  3MDQ A;  3FZF A;  1RT6 A;  5HRN A;  4C8O A;  3MAQ A;  3FZL A;  4LY7 A;  4CI6 A;  1ASV A;  4CJE A;  1XMO K;  4DLE A;  2UUC K;  1NGJ A;  4CJ4 A;  5FPM A;  3JYT A;  4OPA A;  5TKY A;  4IEE A;  3LAK A;  5EU7 A;  4EZ9 A;  3BZC A;  3ULE B;  2GTD A;  2NRV A;  1FKO A;  2O4G A;  3ENH A;  4WFA L;  1HRH A;  4DV1 K;  3NF8 A;  2VG5 A;  3QER A;  3CC2 N;  3ATV A;  5F0X A;  5DM7 L;  4M41 A;  3RMA A;  4IBN A;  1RT7 A;  5AQJ A;  3HK2 A;  4E19 A;  1E4G T;  3T3F A;  3K5O A;  4DV0 K;  3SPZ A;  5AQX A;  3VF6 A;  4FJM A;  4EHU A;  5GIO A;  3M8R A;  3IMX A;  3QDK A;  2R7Y A;  4M3Y A;  3A5O C;  1O1W A;  4CD1 A;  5LL6 Z;  2FC0 A;  3QEP A;  3OYE A;  1D9D A;  4YOU A;  1Z05 A;  1UAX A;  3IUC A;  3FR0 A;  4CF1 A;  4CGD A;  3CC4 N;  3EKU A;  5M1N A;  3SBT A;  4YOY A;  3MEE A;  1SUQ A;  1JXB A;  3WNE A;  2YNF A;  4X66 K;  1P8Z A;  3A8Y A;  1NK9 A;  4WQ5 A;  1HPZ A;  3EL2 A;  1X9W A;  4CEZ A;  4ISE A;  2HHS A;  2GEL A;  1VQ6 N;  1HNV A;  3VA0 A;  2VGM A;  3ZT4 A;  3LM9 A;  4ILJ A;  1JLQ A;  3ULE A;  1LW2 A;  3PSF A;  4FW1 A;  5M1O A;  3KJV A;  4DR2 K;  4DLG A;  3T7Z A;  4BDY A;  4DSK A;  3QIO A;  4CJF A;  3VEW A;  3MXM A;  2ZD1 A;  4CW7 B;  5GIP A;  5J2Q A;  5JVH L;  1BL3 A;  4OGC A;  3OYD A;  3G0Z A;  1NK8 A;  4KHW A;  3CXC M;  4FJL A;  4CEO A;  3M1F A;  5M1F A;  4FZZ A;  5AZJ A;  4J2A A;  1J54 A;  1D4X A;  2NRX A;  4W5T A;  3T1A A;  4CGF A;  4DR3 K;  3O3F A;  3CJB A;  1ATN A;  1KLN A;  2KFZ A;  3OA9 A;  1JCF A;  4NYN A;  1WSF A;  2HNZ A;  1VQO N;  1ASU A;  3CCE N;  5EY4 A;  4AM6 A;  4H4M A;  3CPW M;  1ZBS A;  4GV9 A;  3MEC A;  4KB0 A;  2ZJP L;  3AO4 A;  4FXD A;  5KPR A;  3VEX A;  2QEX N;  3D2F B;  4CJT A;  1TV6 A;  2EX3 A;  2W41 A;  1DGK N;  1VSD A;  3QBX A;  2IGI A;  1K6Y A;  2QM1 A;  2HNY A;  2IS3 A;  1OH5 A;  2AP1 A;  4CGI A;  5JLF A;  3ZSQ A;  1NBW A;  3O1W A;  1K73 O;  3K59 A;  2KHO A;  2ASP A;  2G8W A;  3OJS A;  3P83 D;  5C24 A;  2PBD A;  1HYV A;  1X9J A;  3G10 A;  1KAZ A;  3ALY A;  3D2E B;  1DLO A;  2JWL A;  3TSQ A;  1JLC A;  1TK0 A;  4CHO A;  3DAW A;  2H3G X;  3D7E O;  4KHU A;  4CK1 A;  4CK2 A;  4O8U A;  5CE3 A;  3HVR A;  1XHX A;  4AQY K;  4CEC A;  1U47 A;  5BRE A;  1YHQ N;  1NU0 A;  4CJL A;  3MX5 A;  3UE5 A;  1WB9 A;  3VPZ A;  4H0Y B;  4IJA A;  3VF2 A;  2ZJQ L;  1YIJ N;  4BY9 C;  3O9U A;  3AVM A;  4JKF A;  4QS9 A;  4CCH A;  2A6A A;  5HL7 L;  5CZ1 A;  3U6F A;  1NJY A;  3O4Q A;  3CHW A;  4DQI A;  5C2F A;  4MO5 A;  3IDH A;  1TGO A;  1S9G A;  1GOC A;  3AO5 A;  4FW2 A;  1NKC A;  4KB1 A;  4N76 A;  3RTV A;  3RMB A;  4O5F A;  3HOS A;  2FBY A;  4BQL A;  2XHB A;  2NRW A;  3DXK A;  4DR4 K;  1GOA A;  4OLA A;  1I39 A;  2WOM A;  1T3V A;  3CCR N;  2P9I B;  2KQ2 A;  3C94 A;  4NCB A;  4CHN A;  2QWQ A;  3ZX0 A;  4YOV A;  3M8Q A;  2J4R A;  4CHQ A;  1ESV A;  4RW6 A;  3TTC A;  5M1Q A;  3M5R A;  3KLE A;  4FK4 A;  4IO8 A;  3THY A;  4BE0 A;  4GMJ B;  3HOT A;  4Y1D A;  2O8D B;  3P39 A;  2OPR A;  2YJF A;  1HKB A;  3S3M A;  3DRS A;  2ITM A;  2BGG A;  4B3R K;  4O4G A;  4DR5 K;  3RMD A;  2IIR A;  5EOY A;  3DXM A;  2XY7 A;  3PY8 A;  5C2D A;  4GV6 A;  1SAZ A;  3ZX2 A;  4X64 K;  1HR0 K;  3FZH A;  1M90 O;  2PY5 A;  2E6M A;  2I5J A;  3TAQ A;  1RCH A;  4DU1 A;  4FK2 A;  4XH4 A;  4JK7 A;  3HO1 A;  4JI3 K;  3H3O B;  1U49 A;  2G8I A;  3K5L A;  3KWI A;  3ATU A;  4M45 A;  1RDD A;  4CJS A;  4BG8 A;  1WN7 A;  1EP4 A;  2E4L A;  4OPH A;  3OHR A;  4NCA A;  2YCH A;  3C7N B;  3HP6 A;  1OH7 A;  4FJJ A;  3VQA A;  4XH5 A;  1LOT B;  2E2O A;  4IDK A;  1CZA N;  1RT2 A;  3U9Z A;  4IFY A;  3LZJ A;  4F4K A;  3NF7 A;  4W5O A;  3DLB A;  1NOZ A;  3SK3 A;  4H5W A;  3DI6 A;  3VQ7 A;  3AVF A;  1GLE G;  4H0O A;  3CMA N;  4IO9 L;  1S5J A;  4LH4 A;  5CR4 A;  4HUG A;  3MWP A;  3THV A;  3C0B A;  3K9K A;  3ZSY A;  3SNN A;  5BN8 A;  3IAY A;  2OYQ A;  3DM2 A;  3QET A;  3U3G A;  1YUW A;  1RTD A;  3ID6 A;  4PY5 A;  4BRF A;  3V1O A;  3LL3 A;  2EHG A;  4QCL A;  3W3D A;  3D45 A;  5FDL A;  3JXU A;  4DFK A;  3F2K A;  2DFE A;  4JKG B;  4RW8 A;  3OYC A;  1TL3 A;  3CFR A;  4CZK A;  1XQS C;  4EHT A;  2QTD A;  4M7Y A;  4CK3 A;  3OYK A;  4WFB L;  3F5T A;  3CCQ N;  3ZSO A;  4CD3 A;  2Q1N A;  3OBY A;  3ZSX A;  4A5B A;  5KI6 A;  1RDA A;  3ZSZ A;  4JKH A;  5JLH A;  3A2F A;  5J1E A;  1C1B A;  3DLL L;  3QIP A;  2KZZ A;  4JS5 A;  3QEV A;  4CZH A;  4Z4F A;  2GX9 A;  5BRF A;  4YOR A;  2P5O A;  3VGL A;  1ATR A;  5CZ2 A;  3AV9 A;  3ZEU A;  3FZK A;  3LDL A;  3RSE A;  3NH2 A;  3KKS A;  4JAX A;  4WYB A;  3SV4 A;  4CJ3 A;  4ELU A;  1MA9 B;  3MWT A;  5SWM A;  4W5R A;  3V1R A;  1OVY A;  3LDS A;  3CQ8 A;  2D5R A;  4KHS A;  4CF0 A;  1WAF A;  4CF8 A;  1YVN A;  1IKV A;  4CZG A;  3S3N A;  4I6M A;  3RSE B;  1T05 A;  3A5M C;  2F4V K;  2JLE A;  3AVN A;  3NE6 A;  3SBG A;  1BIU A;  1QSL A;  3LDN A;  2P9P A;  2OA8 A;  5AQY A;  4CEA A;  5KTQ A;  1SKS A;  5KQ8 A;  4KH4 A;  1EXQ A;  2QWO A;  1Z25 A;  4AHU A;  4FJ8 A;  5BN9 A;  1S3X A;  3ZLJ A;  4CBU A;  3MCP A;  3MED A;  1M1K O;  3TR8 A;  3CIP A;  2Q0R A;  4PA1 A;  1X9S A;  3NH0 A;  3G6E N;  3QNN A;  4WQ4 C;  4KH6 A;  3U8X A;  4J2B A;  3BY5 A;  2HVH A;  3P4I A;  4BR7 A;  3E9L A;  3VQ5 A;  4G1Q A;  4LSN A;  1EWQ A;  3SPY A;  3OYN A;  3ZET B;  3CCU N;  5LMN K;  3R9P A;  4JK8 A;  3I8B A;  2F8T A;  5AQM A;  3C95 A;  1RDW X;  3E9P A;  4KRF A;  1DEJ A;  3VQ4 A;  4WCE L;  1VQ5 N;  1BUP A;  4JNE A;  3DRP A;  5CYQ A;  1X3N A;  3THW B;  3T1H K;  1Q7Y O;  2QWL A;  1T6D A;  2O8B A;  4W5N A;  3JS6 A;  4ID5 A;  3CQX A;  3H1Q A;  4ISF A;  3AVA A;  4PWD A;  1IBL K;  2P9L B;  4CJ5 A;  3MXJ A;  1KVA A;  3ZEU B;  1NJW A;  4BRC A;  2BUP A;  1TKD A;  4WQ4 A;  1YTA A;  3NDK A;  4CGH A;  4B8C A;  3QEI A;  3LDQ A;  1ZBU A;  3O3H A;  2FXU A;  3CJ1 A;  3HRG A;  3MN6 A;  3OYB A;  4KTW A;  5HOO A;  4DFP A;  5AQO A;  3KK2 A;  1N6Q A;  4DV6 K;  1ITG A;  3HPH A;  1VAZ A;  1EWR A;  4Z4G A;  2VG6 A;  1CXQ A;  4JD2 B;  3CYM A;  1O13 A;  2QK9 A;  3KD5 E;  4FZY A;  4RCH A;  3L8B A;  3O80 A;  2FBX A;  3VQ9 A;  4MFB A;  1RNH A;  3OYJ A;  2E6L A;  3N4Q A;  1V4T A;  1ZBL A;  3TAM A;  3NVK A;  4H03 B;  2HBM A;  1E4F T;  3AAR A;  3W0L A;  4DCH A;  4E1N A;  4CZJ A;  3P31 A;  4LSL A;  3EE8 A;  2F9T A;  5AQF A;  3OS0 A;  1JL2 A;  1QQC A;  1OKJ A;  3LDP A;  4H5V A;  1FJG K;  4KHP K;  4KBO A;  4DF8 A;  4BRA A;  4MLE A;  4CEE A;  4BWM A;  4H5N A;  3KVG A;  4FOI A;  3DYA A;  3K58 A;  3GG4 A;  4DV3 K;  3T1Y K;  2V7Z A;  3SV3 A;  4O0J A;  5AQP A;  2ETJ A;  2RN2 A;  4JKA A;  1YJ9 N;  3RR7 A;  3DRR A;  4DWI A;  4F8R A;  3KIO A;  3AO3 A;  4CIF A;  3NMU A;  1VQ9 N;  5CYM A;  1W0H A;  1ZC6 A;  3WNH A;  5C0Y A;  3PSI A;  1LV5 A;  3PX4 A;  3P38 A;  1BQM A;  5AQH A;  5SZT A;  4M3X A;  4HTL A;  3L2V A;  1LWF A;  2DY4 A;  3F73 A;  4N5S A;  4A59 A;  4IEI A;  2HHW A;  1N8R O;  1OH6 A;  1KVC A;  2IAJ A;  3AVC A;  2G8U A;  4ZTF A;  4CIE A;  4N56 A;  2FF3 B;  3CCV N;  2IVP A;  3CC7 N;  4J2E A;  4JHD A;  4BRH A;  3TI0 A;  2O8D A;  1MU2 A;  3HP9 A;  2OAN A;  5C15 A;  3C65 A;  3VQC A;  4KHQ A;  4BE2 A;  3L2U A;  2RF2 A;  1QSY A;  5HRP A;  4JKC A;  4OVL A;  2O8B B;  1Q9X A;  3T19 A;  4HCB A;  1OH8 A;  1NGC A;  1U2V B;  3GL1 A;  1DT9 A;  4CJW A;  4X62 K;  4B08 A;  3OYL A;  1XNQ K;  2E1Y A;  1S1T A;  4FJN A;  4NCG A;  1ZYQ A;  5H1S Q;  3NBP A;  3CME N;  1Z6R A;  2X6S A;  3PUF A;  2DFH A;  4Y0W A;  2VCP A;  4LFB K;  3QFU A;  2A40 A;  5BRD A;  5FRO A;  1JCE A;  3ZT3 A;  1FW6 A;  3WXM B;  4ZHR A;  4FVM A;  4IJN A;  3DLE A;  2P9U A;  4HHT A;  4G9Z A;  1G99 A;  4FJ9 A;  1YT3 A;  1K9M O;  5J2P A;  2G8V A;  3OYG A;  1GLD G;  3OS2 A;  4DTJ A;  2IOC A;  1DTT A;  1TAQ A;  2YHB A;  3VMF B;  1KAY A;  4JKG A;  3P1G A;  3HPO A;  2QWP A;  5KGX A;  4WQ5 C;  4JI2 K;  4CJR A;  1RT1 A;  2VGN A;  4GW6 A;  4CBX A;  2CH5 A;  4DFJ A;  1WBB A;  5AQG A;  5C42 A;  1IG8 A;  3PIP L;  3OYA A;  1T03 A;  4I6M B;  3AGR A;  3G71 N;  4DKW A;  4BDP A;  2XRI A;  1A5X A;  1IJJ A;  2FSJ A;  3H46 O;  3AVH A;  4CFA A;  2A41 A;  4B9L A;  4M3W A;  3VEY A;  2V52 B;  1KC8 O;  4L3Q A;  1GLL O;  2VQE K;  2A3Z A;  3QO9 A;  4H5T A;  3C6T A;  3DLG A;  4M7X A;  3DOL A;  3LP3 A;  4OGE A;  4LD0 A;  4DU3 A;  3G25 A;  4WF9 L;  1RBS A;  5LJV A;  2HND A;  3Q7B A;  4I9Q A;  1RBV A;  3HTV A;  3A5L C;  4CZL A;  4CZM A;  2IVN A;  4A61 A;  4R5P A;  4CEB A;  1SV5 A;  4KV8 A;  3WNF A;  2VWJ A;  5ADX A;  4LF5 K;  2YJE A;  1KFD A;  4DTM A;  1VHX A;  4BRL A;  1SL1 A;  4DU4 A;  2HST A;  1KCF A;  4NLC A;  3NAE A;  1YVU A;  3HJF A;  2B6A A;  3MMV A;  1T7P A;  3DXM B;  3Q7C A;  2ASO A;  3HBT A;  3VET A;  3O4N A;  4BC5 A;  5E41 A;  2BH1 A;  3CM5 A;  5B8H A;  1JLA A;  3ASM A;  4TSX A;  4AHS A;  1SL2 A;  2VWK A;  1BIS A;  5AQU A;  4CBW A;  4B9Q A;  2O8C B;  3LWM A;  3ZYY X;  3H08 A;  1VQP N;  2A1S A;  4HWI A;  1S1X A;  4UY8 O;  5K14 A;  5F2R A;  3J7A P; 
#chains in the Genus database with same CATH homology
 4NCA A;  1BI4 A;  4MQ3 A;  2YKM A;  4M3Z A;  1RBT A;  4EZ6 A;  3HP6 A;  4ELT A;  3QEW A;  4FJJ A;  4RW9 A;  3VQ6 A;  3VQA A;  1CLQ A;  1L3S A;  4DFM A;  3KLF A;  4IDK A;  2YNH A;  2P1J A;  1RT2 A;  1X9M A;  3ZSW A;  1D5A A;  4ZTJ A;  3V9X A;  4IFY A;  3MXI A;  1S1V A;  3B6P A;  3LZJ A;  3S3O A;  4E7I A;  2FBV A;  3NF7 A;  4F4K A;  2P51 A;  2F96 A;  4CEQ A;  4W5O A;  4HTU A;  5HP1 A;  3DLB A;  1NOZ A;  2HHV A;  4HUE A;  3DI6 A;  1LAW A;  3I0R A;  3VQ7 A;  3AVF A;  3NF6 A;  4M3T A;  1BIZ A;  5JS2 A;  4DS4 A;  1S5J A;  1EX4 A;  1TKX A;  4LH4 A;  4RW4 A;  4HUG A;  4KHY A;  4W5Q A;  4E7K A;  3THV A;  2B5J A;  3AO1 A;  4Q0B A;  5HBM A;  2XY8 A;  1HQE A;  3ZSY A;  4BE1 A;  4CFD A;  3SNN A;  1C6V A;  1RT4 A;  3L2W A;  3IAY A;  4B9U A;  2OYQ A;  3DM2 A;  5D3G A;  3QET A;  1C0T A;  3HL8 A;  3U3G A;  4XIU A;  3TAF A;  1RTD A;  1B9D A;  4PY5 A;  1C0U A;  4CFC A;  4N47 A;  3IG1 A;  4Z4C A;  3V1O A;  3NGZ A;  4FJK A;  1L3T A;  5CY4 A;  2EHG A;  4QCL A;  1EKE A;  4Z4E A;  1B92 A;  3AVB A;  3DLH A;  4H4O A;  3V4I A;  3M8P A;  3D45 A;  4DTO A;  1TKZ A;  5FDL A;  1HYZ A;  4DFK A;  3LPU A;  1U45 A;  3KD1 E;  3AA3 A;  2DFE A;  3SUQ A;  5I42 A;  4RW8 A;  3OYC A;  1TL3 A;  4EP5 A;  3SYZ A;  3CFR A;  3OJU A;  4M3R A;  3U3Y A;  2Y1J A;  4FK0 A;  3SUO A;  1VK0 A;  4C8M A;  3AVG A;  4CF2 A;  1JLB A;  1WNS A;  3NGI A;  2LSN A;  4CK3 A;  3VQD A;  1U4B A;  3OYK A;  4HUF A;  4F2R A;  3ZSO A;  2KW4 A;  1S6Q A;  3B6O A;  5J2N A;  4KTZ A;  4KHN A;  2HVI A;  1BHL A;  3ZSX A;  2DFF A;  1U04 A;  1RDA A;  5KI6 A;  2BE2 A;  3ZSZ A;  3O3G A;  3EZ5 A;  1SL0 A;  3A2F A;  5J1E A;  3CFP A;  1C1B A;  3IRX A;  3TAP A;  4HVJ A;  3OYM A;  1RT3 A;  2D0B A;  1N5Y A;  3LAL A;  1LW0 A;  3QIP A;  4OPJ A;  4JS5 A;  3QEV A;  1ZBI A;  2KZZ A;  1RT5 A;  4DTP A;  3M8S A;  3K5N A;  3KK1 A;  4Z4F A;  2PYL A;  1RBU A;  4C8N A;  4CHP A;  4B9S A;  1BGX T;  3HYF A;  1FKP A;  1WSE A;  2P5O A;  4KI4 A;  5CZ2 A;  3PV8 A;  3KLH A;  3AV9 A;  4J2D A;  3IS9 A;  4Y1C A;  4E1M A;  4JRP A;  1JLE A;  4KAZ A;  3SI6 A;  3NH2 A;  4DTS A;  3KKS A;  4M42 A;  4B3O A;  3KTQ A;  4DSL A;  4CF9 A;  3SV4 A;  4CJ3 A;  2XY5 A;  2HMI A;  3NHG A;  1I3A A;  4YFU A;  4ELU A;  4CJU A;  1X1P A;  5SWM A;  4W5R A;  3V1R A;  3LDS A;  3I0S A;  4FLX A;  1RTI A;  3CQ8 A;  4CGG A;  3CG7 A;  1RDB A;  2D5R A;  3KK3 A;  1RIL A;  3PX6 A;  4KTQ A;  4CF0 A;  4KHS A;  3NFA A;  2HB5 A;  1WAF A;  4CF8 A;  1IKV A;  2YNG A;  4FM2 A;  3S3N A;  1HQU A;  3SUN A;  4IG0 A;  1T05 A;  3CFO A;  3AO2 A;  4B9N A;  2JLE A;  5DMR A;  1IKX A;  3AVN A;  4OKJ A;  3NE6 A;  1BIU A;  3MXM A;  1QSL A;  2D0C A;  4DTX A;  1Q8I A;  5HRS A;  3SQ4 A;  1DTQ A;  2OA8 A;  4CEA A;  1QSS A;  1HMV A;  5KTQ A;  1SKS A;  3RRG A;  2XY6 A;  1EXQ A;  4CGJ A;  1NK5 A;  2HHT A;  1Z25 A;  2W42 A;  4AHU A;  4FM0 A;  4FJ8 A;  2YHA A;  2Z1I A;  3OVN A;  1BCM A;  1KLM A;  4Q5V A;  2NUB A;  3V9S A;  3VA3 A;  1WSJ A;  3ZT0 A;  4AIL C;  4CFB A;  3L2Q A;  3I8D A;  4FLT A;  1C1C A;  3VQQ A;  4CJK A;  3MED A;  4O0I A;  1CZ9 A;  1VSM A;  3TR8 A;  3QIN A;  4K8X A;  5J2M A;  4FJX A;  3OY9 A;  3JSM A;  2HHX A;  1XHZ A;  1NJX A;  4PA1 A;  3OS1 A;  4KO0 A;  1J9A A;  5I3U A;  1Z26 A;  1TKT A;  1X9S A;  3NH0 A;  3QNN A;  3QES A;  4GVM A;  1VSK A;  1WLJ A;  3K2P A;  3ZSV A;  1D8Y A;  1ASW A;  3TWH A;  1WSH A;  3NCI A;  4AHR A;  4J2B A;  4CES A;  3OYI A;  4AH9 A;  2YKN A;  3KKR A;  4CHY A;  1BQN A;  4ELV A;  2HVH A;  4CE9 A;  5JS1 A;  3VQ5 A;  4G1Q A;  4UQG A;  2KFN A;  3RR8 A;  4Z4I A;  3F9K A;  4LSN A;  4Z4H A;  3SPY A;  2G8K A;  3OYN A;  4H8K A;  5T7B A;  3TAN A;  1TK8 A;  5HLF A;  1RT6 A;  5HRN A;  1KSP A;  1REV A;  3ISN C;  2F8T A;  3C95 A;  1NK0 A;  1SKR A;  4C8O A;  3MAQ A;  4KRF A;  3VQ4 A;  4LY7 A;  2HHQ A;  3VN5 A;  3DRP A;  1ASV A;  4CJE A;  4DLE A;  4NYF A;  5CYQ A;  4O5B A;  4CJ4 A;  1J5O A;  4W5N A;  4ID5 A;  2KZM A;  3JYT A;  1KTQ A;  4FCY A;  3SQ0 A;  3ULD A;  3LAK A;  5EU7 A;  3AVA A;  4EZ9 A;  4PWD A;  3LPT A;  4CJ5 A;  3MXJ A;  3SUP A;  1KVA A;  1NKB A;  1FKO A;  2O4G A;  1NJW A;  1TAU A;  2WON A;  1HRH A;  3OYH A;  3DMJ A;  3LP1 A;  3NF8 A;  4FJH A;  2HW3 A;  4QAG A;  1LWE A;  1TKD A;  1ZBF A;  4JRQ A;  2VG5 A;  1YTA A;  3QER A;  3NDK A;  4RG8 A;  1S1U A;  5KGW A;  4B8C A;  4CGH A;  1S6P A;  4DQR A;  3QEI A;  1TL1 A;  1ZBU A;  3O3H A;  4M41 A;  3RMA A;  3PX0 A;  4IBN A;  1RT7 A;  3OYB A;  1VSF A;  4KTW A;  4JLH A;  1A5V A;  3HK2 A;  4DFP A;  3KK2 A;  1CZB A;  4E19 A;  1N6Q A;  3T3F A;  1XC9 A;  3RMC A;  3K5O A;  4IFV A;  1VRT A;  1C0M A;  3HPG A;  3SPZ A;  4QOZ B;  1ITG A;  4E3S A;  3HPH A;  4FJM A;  2IC3 A;  3M8R A;  2G8H A;  4Z4G A;  2VG6 A;  1ZBH A;  1CXQ A;  5FRN A;  3LAN A;  3CYM A;  4FLW A;  4LH5 A;  1RDC A;  2R7Y A;  2HHU A;  3HST B;  1HNI A;  2BAN A;  3DLK A;  3TAE A;  4M3Y A;  2QK9 A;  3KD5 E;  4FZX C;  3EYZ A;  4FZY A;  4I9L A;  1O1W A;  3L8B A;  2P5G A;  2FBX A;  1IKW A;  2FC0 A;  1IKY A;  3VQ9 A;  4DQP A;  4MFB A;  1RNH A;  3OYJ A;  3QEP A;  3OYE A;  1D9D A;  2E6L A;  1UWB A;  1IO2 A;  4EP4 A;  3TAM A;  1ZBL A;  2OZM A;  3LP2 A;  3HXM A;  1UAX A;  1WSG A;  3VQB A;  2DTU A;  4E1N A;  2KTQ A;  1D9F A;  1HYS A;  4CEF A;  4LSL A;  4CF1 A;  3RWU A;  4CGD A;  3AA5 X;  3MEE A;  3DOK A;  3OS0 A;  3AVL A;  1JL2 A;  1QQC A;  1SUQ A;  1S1W A;  1JXB A;  3WNE A;  2ATQ A;  2YNF A;  3LZI A;  1NK9 A;  2Z1J A;  4DF8 A;  1BI4 B;  1HPZ A;  4CEE A;  5HRR A;  3WNG A;  1Q9Y A;  1X9W A;  4BWJ A;  4DTN A;  4BWM A;  4CIG A;  4CEZ A;  3DYA A;  4DSJ A;  1KRP A;  3LP0 A;  4I2P A;  4AHV A;  2HHS A;  4FJ7 A;  4F2S A;  3K58 A;  1HNV A;  3VA0 A;  2JGU A;  3QNO A;  3ZT4 A;  1T8E A;  1JLF A;  3VQP A;  2QKK A;  3SV3 A;  1JLQ A;  4ICL A;  4O0J A;  4F3O A;  4FLV A;  2Z1H A;  4DMN A;  4B8A B;  2ETJ A;  2RN2 A;  1LW2 A;  4CER A;  4KI6 A;  3KJV A;  4FW1 A;  3RR7 A;  3DRR A;  4DWI A;  4DLG A;  4F8R A;  4BDY A;  3KIO A;  1JL1 A;  3AO3 A;  3QIO A;  4CJF A;  3QLH A;  3OYF A;  3QEX A;  3E01 A;  3DLR A;  3ZT2 A;  2ZD1 A;  4CIF A;  5CYM A;  1KFS A;  4M3U A;  5J2Q A;  1W0H A;  1BL3 A;  2Q3S A;  3WNH A;  2VG7 A;  2Z1G A;  4OGC A;  3OYD A;  3G0Z A;  4E0D A;  4KKO A;  1NK8 A;  1LV5 A;  3PX4 A;  4KHW A;  1BQM A;  4FJL A;  4CEO A;  4F3T A;  1W9H A;  4FZZ A;  3V9U A;  5SZT A;  3KLG A;  3HM9 A;  1J54 A;  4J2A A;  4M3X A;  3C6U A;  2ITG A;  4W5T A;  3T1A A;  3L2V A;  4CGF A;  1LWF A;  3SJJ A;  5DK5 A;  2D0A A;  4IG3 A;  5HRO A;  4RW7 A;  2ZQB A;  3O3F A;  2DY4 A;  3F73 A;  4N5S A;  1KLN A;  2HHW A;  1L5U A;  2KFZ A;  2X78 A;  1KVC A;  2IAJ A;  3AVC A;  4NYN A;  1WSF A;  2HNZ A;  4ZTF A;  1ASU A;  4CIE A;  1L3V A;  2G8U A;  1TVR A;  3AVI A;  3V9Z A;  3TAB A;  4N56 A;  4AHT A;  1NK7 A;  4DSK A;  4FYD A;  4H4M A;  2X74 A;  1CXU A;  4FJ5 A;  2A1R A;  3MEC A;  4I2Q A;  2QXF A;  4KB0 A;  3AO4 A;  3ZSR A;  4FXD A;  1QS4 A;  1VSE A;  4DF4 A;  1WSI A;  4J2E A;  3TI0 A;  2G8F A;  4OJR A;  1JLG A;  4JS4 A;  3PO4 A;  1MU2 A;  4CJT A;  3HP9 A;  2OPQ A;  1TV6 A;  3ZT1 A;  3FFI A;  4K8Z A;  2EX3 A;  4PUO A;  1VSD A;  3VQC A;  4DSE A;  4KHQ A;  2IGI A;  3SZ2 A;  4N41 A;  1B9F A;  4BE2 A;  3L2U A;  2RF2 A;  1VSH A;  1K6Y A;  1QSY A;  5HRP A;  1FXX A;  3L3U A;  2HNY A;  2IS3 A;  4OVL A;  5KRS A;  3TAG A;  4CGI A;  3ZSQ A;  4CJQ A;  2IDO A;  1Q9X A;  3T19 A;  4PQU A;  4HCB A;  4KPY A;  3L3V A;  3K59 A;  4CJW A;  1QTM A;  4CED A;  2G8W A;  4B08 A;  3OYL A;  2RPI A;  4DTR A;  4B9T A;  4HCC A;  3OJS A;  4FLY A;  3SCX A;  4DTU A;  1YTU A;  3P83 D;  5C24 A;  4FJN A;  1S1T A;  1HYV A;  3G10 A;  4NCG A;  3ALY A;  1ZYQ A;  3NBP A;  2GUI A;  3PO5 A;  1DLO A;  3LAM A;  4YNQ A;  1QHT A;  2X6S A;  3PUF A;  3VQ8 A;  1NKE A;  2DFH A;  2XO7 A;  4ID1 A;  1JLC A;  1RTH A;  4OPK A;  4E7H A;  4FJI A;  1A5W A;  3D0P A;  1S9E A;  4CHO A;  3HVT A;  1TK0 A;  4KHU A;  4CK1 A;  1WAJ A;  2PZS A;  4CK2 A;  3TAR A;  5FRO A;  4C8L A;  3K5M A;  3AA2 A;  3ZT3 A;  1TK5 A;  3HVR A;  1XHX A;  4CEC A;  2OPS A;  3SQ1 A;  4ZHR A;  4FVM A;  4WE1 A;  1U47 A;  3MEG A;  4DQS A;  3DLE A;  2FBT A;  4HHT A;  1NK6 A;  3RRH A;  4FJ9 A;  1YT3 A;  2ZE2 A;  1JKH A;  2Y1I A;  3BDP A;  5J2P A;  2G8V A;  3OYG A;  3OS2 A;  4DTJ A;  2IOC A;  4CJL A;  4E7L A;  1LWC A;  1DTT A;  1TAQ A;  2YHB A;  4I7F A;  3NH1 A;  3P1G A;  3HPO A;  5KGX A;  2YV0 X;  1HJR A;  3P5J A;  4BAC A;  1IH7 A;  1VSJ A;  4AHC A;  4CHZ A;  4CJR A;  1RT1 A;  4GW6 A;  1R0A A;  3VQE A;  1G15 A;  2RKI A;  3AVM A;  5C42 A;  4DFJ A;  3CM6 A;  3EY1 A;  4CCH A;  3UIQ A;  1RTJ A;  3OYA A;  1T03 A;  4FLU A;  2X6N A;  5CZ1 A;  3U6F A;  2GBZ A;  3V6D A;  3O4Q A;  3S9H A;  1NJY A;  4BDP A;  1GOB A;  2XRI A;  1NOY A;  4DQI A;  3V1Q A;  1A5X A;  3NGY A;  3AVH A;  4CFA A;  4FLZ A;  1KVB A;  3L2R A;  1TGO A;  4B9L A;  4O44 A;  1U48 A;  4M3W A;  2BDP A;  3ITH A;  4IKF A;  1S9G A;  1GOC A;  1RBR A;  3AO5 A;  4FW2 A;  4E89 A;  1NKC A;  4KB1 A;  4N76 A;  3RTV A;  3RMB A;  4KFB A;  4DSI A;  3QO9 A;  2FBY A;  4Z0U A;  3C6T A;  3DLG A;  3NF9 A;  2OPP A;  3V81 A;  3DOL A;  3LP3 A;  1UA0 A;  4OLB A;  2QKB A;  2YNI A;  4DSF A;  2O4I A;  4OGE A;  4LD0 A;  4L8R B;  1EET A;  2XHB A;  3AA4 A;  1BCO A;  1UOC A;  4DU3 A;  4CJV A;  1GOA A;  4OLA A;  1RBS A;  1VSL A;  3K57 A;  2HND A;  1XI1 A;  5FRM A;  4I9Q A;  1RBV A;  5C25 A;  1F21 A;  1I39 A;  2WOM A;  3LWL A;  2KQ2 A;  3C94 A;  1JXE A;  4R5P A;  4NCB A;  4CHN A;  4CEB A;  1SV5 A;  4KV8 A;  4DG1 A;  3WNF A;  4B9M A;  3M8Q A;  4OKE A;  2VWJ A;  1L3U A;  4CHQ A;  4CJP A;  2F8S A;  4O55 A;  4BDZ A;  4FJG A;  4RW6 A;  1QE1 A;  4FK4 A;  3KLE A;  3KLI A;  4C8K A;  4DQQ A;  1KFD A;  5KRT A;  1UA1 A;  4DTM A;  4BE0 A;  1SKW A;  4GMJ B;  4Y1D A;  1SL1 A;  1XWL A;  2OPR A;  3AVJ A;  4DU4 A;  1VSI A;  3S3M A;  3BGR A;  1LAV A;  3DRS A;  4B9V A;  1KCF A;  3NAE A;  2BGG A;  1YVU A;  4O4G A;  3HJF A;  3RMD A;  2B6A A;  1NK4 A;  2XY7 A;  1Y97 A;  3PY8 A;  1T7P A;  2OZS A;  1FK9 A;  3ZCM A;  3O4N A;  5E41 A;  2PY5 A;  3CM5 A;  2E6M A;  2I5J A;  3TAQ A;  3SQ2 A;  1IG9 A;  1JLA A;  1RCH A;  4DU1 A;  4FK2 A;  3ASM A;  4TSX A;  4AHS A;  3V9W A;  4FM1 A;  1NJZ A;  1SL2 A;  3HO1 A;  2VWK A;  1U49 A;  2GV9 A;  4KRE A;  2G8I A;  1BIS A;  3K5L A;  2AJQ A;  4M45 A;  4DS5 A;  3LWM A;  1RDD A;  4CJS A;  3H08 A;  1WN7 A;  2A1S A;  1EP4 A;  1S1X A;  1VRU A;  2E4L A;  3AVK A;  4OKK A;  4E7J A;  2PYJ A;  1J53 A;  3HT3 A;  2B4J A;  5K14 A;  1C1A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...