2Z1GA

Crystal structure of e.coli rnase hi surface charged mutant(q4r/t40e/q72h/q76k/q80e/t92k/q105k)
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
155
structure length
155
Chain Sequence
MLKRVEIFTDGSCLGNPGPGGYGAILRYRGREKTFSAGYERTTNNRMELMAAIVALEALKEHCEVILSTDSHYVRKGITEWIHNWKKRGWKKADKKPVKNVDLWKRLDAALGQHQIKWEWVKGHAGHPENERCDELARAAAMNPTLEDTGYQVEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease HI
publication title Protein Thermostabilization Requires a Fine-tuned Placement of Surface-charged Residues
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 48
structure length 155
sequence length 155
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2007-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2z1gA00
4XIUA 4M3UA 4O4GA 2HW3A 2GV9A 2RN2A 4CJ5A 3TANA 3PO5A 4DWIA 1HMVA 1JXBA 1WAFA 4CFBA 4ZTJA 4B9VA 4HCBA 4CIEA 2D0BA 3QIOA 4FJ7A 4CJFA 1T05A 4KI4A 5FRMA 2YNFA 3SPZA 3WNGA 4CK1A 3RMCA 4HHTA 1NJXA 5J2MA 4DU4A 3S3OA 4BWMA 2HB5A 4DQIA 2O4GA 1B9FA 3NGZA 3RRGA 3V6DA 1JLEA 4CF9A 1UWBA 1WNSA 5CZ1A 4E19A 4IKFA 4PQUA 3L3UA 4CFAA 3NAEA 2KW4A 2Y1JA 2PY5A 1VSEA 4CIFA 3E01A 3QLHA 2XHBA 1BGXT 3MEGA 4DS4A 4M3TA 1IKYA 5K14A 3DOKA 1LWEA 2YKMA 5KI6A 4I9QA 4CEEA 4C8OA 4DTJA 4CGFA 4FCYA 1JL2A 1RBTA 2ITGA 1LAWA 3ALYA 1KVAA 4BE1A 1ZBLA 1YTUA 1SKWA 3L2VA 5FRNA 5DK5A 4CJWA 4CEFA 4DFKA 3DMJA 3KLIA 3PY8A 3FFIA 4CF1A 4F2SA 3NBPA 4E0DA 4YNQA 2HHSA 4AH9A 3VQ5A 4DTXA 1QE1A 3QEVA 4HUGA 3QEPA 1NKBA 4DF4A 3NHGA 3ZSXA 4C8MA 3T19A 3ZSYA 4CJ4A 4BE0A 4E3SA 3TR8A 4KHSA 4O0JA 3OYJA 4EP5A 3SV3A 3QESA 2QK9A 1HQUA 4UQGA 4CHYA 3AVNA 3VQ6A 3OYBA 5J2QA 5HLFA 1ITGA 5HRSA 3SQ0A 1EXQA 3ISNC 2DFFA 3IRXA 1RBSA 3I0SA 4CJPA 3AVAA 2PYJA 2OYQA 3DI6A 5HBMA 1NK4A 3IAYA 4FYDA 1RTJA 3V9ZA 4DQRA 1HQEA 1RDAA 1C1CA 3LZJA 4CESA 4YFUA 4BACA 2KQ2A 2IS3A 1SKSA 1TKDA 3TAQA 2KZMA 2AJQA 4K8ZA 4CHNA 3K5NA 3P1GA 1RTDA 2HHWA 3U3YA 3ULDA 4CHPA 1HYZA 2YNIA 4CEAA 3CYMA 3G0ZA 3O3GA 3LDSA 3AO3A 3DLGA 4E7IA 2E6LA 1VRUA 3VQBA 2E6MA 1U48A 4F3OA 4BWJA 3RWUA 4M3YA 4QCLA 1J54A 2DFEA 3HP9A 1Q8IA 2XO7A 1WSHA 3ZCMA 2KFZA 2KZZA 2FBYA 3V81A 3O4QA 3TAGA 4MFBA 4JRPA 1EP4A 2ZD1A 5JS2A 3DRSA 1L5UA 1KLNA 4JS5A 3L2WA 4B9MA 4O0IA 1TK8A 4FVMA 3MAQA 3OYMA 3OYFA 2WOMA 2A1SA 3LP2A 3QIPA 1RT6A 4RW6A 4KHUA 1X1PA 3WNEA 4CJ3A 4DLEA 4CFDA 3TARA 1IO2A 3PX4A 2DFHA 1QTMA 1TAQA 3UIQA 3PUFA 4IDKA 3LP0A 3AA2A 4E1NA 4FM1A 3SPYA 4FZXC 2X78A 1ZBIA 4B9TA 3HPOA 2G8KA 4ELTA 4BDZA 3S3MA 5HRRA 1YT3A 1KTQA 4DSLA 2QKBA 5T7BA 1ZBUA 3AVCA 1S1TA 3P83D 3LP1A 3WNFA 1Y97A 4FK4A 2HHTA 4Z4CA 4RW9A 3HL8A 3NDKA 1XI1A 1JLCA 3DRRA 3K2PA 3V9XA 2OPPA 3LAKA 3F73A 3LPTA 4GW6A 4LSNA 4CGGA 4W5OA 3KIOA 3JYTA 2B6AA 3QETA 1HPZA 1LW2A 2EHGA 2QXFA 3AVFA 4F8RA 2WONA 3OYGA 1GOBA 1HJRA 4OVLA 3U6FA 2G8WA 2HNZA 2G8VA 2OZSA 1C0TA 4PY5A 3SJJA 4DSIA 3AVJA 4IFYA 4FZZA 2X6SA 5DMRA 4OPJA 3NGYA 1BIZA 4ZTFA 3H08A 4KTQA 1EX4A 2BDPA 3HP6A 5I42A 1REVA 4KHWA 1L3UA 4DTOA 4N41A 3TWHA 4CEOA 2OPSA 3L2QA 5D3GA 4IG0A 4OKJA 1BCMA 4Z4IA 2BANA 3ZSQA 3T3FA 2XY7A 4KPYA 1CXUA 4M41A 4EZ6A 3HVRA 4J2BA 3I8DA 4M3ZA 3HPHA 3TAEA 1NK7A 4BDPA 3SUOA 1I39A 3OVNA 2IDOA 4JLHA 4LD0A 4FJKA 4Z4HA 2PZSA 2JLEA 2P5OA 3SQ2A 3SV4A 3NF8A 4EP4A 4LSLA 4KAZA 3L3VA 3SCXA 1IKXA 4EZ9A 3P5JA 1I3AA 2BGGA 4N5SA 2DY4A 2OPRA 3WNHA 2HHQA 4DTUA 2F8TA 4DTSA 3LAMA 1ASUA 1WSIA 2VG6A 4PUOA 3HK2A 3AO4A 4O55A 3OYEA 3SQ1A 3OS2A 3NF6A 4NCBA 1LW0A 2YKNA 3NF9A 2Z1HA 3LWMA 3LZIA 1QSYA 3PX0A 3AO5A 1Z26A 2YNHA 4AHTA 4CEDA 3K5LA 4DS5A 3ZSOA 1LV5A 1A5WA 2BE2A 3VQEA 4DMNA 1C0UA 1WN7A 3DOLA 2KTQA 1RTIA 3LPUA 3LANA 3VA0A 1VSMA 4FLXA 3PO4A 4Q5VA 3T1AA 2G8HA 4G1QA 4Y1DA 3QEIA 1X9WA 1L3VA 3DLBA 2YNGA 2LSNA 4CJVA 3HT3A 1XHZA 2Y1IA 1HYVA 1JLBA 3ZT1A 4CEBA 2G8FA 3THVA 4M42A 3VA3A 4KHYA 3V4IA 4AHSA 4ZHRA 4NCGA 1NOZA 1XHXA 4FM2A 2KFNA 4CJSA 2XY5A 1FKPA 3C6TA 4OGCA 4OJRA 3RTVA 3ZT2A 1X9MA 4I9LA 4HVJA 1WSGA 1U47A 3K57A 4FJIA 2EX3A 4ID1A 4J2DA 1IKWA 2F96A 3O3FA 2OPQA 2YHBA 3V1RA 4F2RA 4FJMA 2A1RA 1VSDA 1S6QA 2VWKA 2ZQBA 5KGWA 1S9EA 2O4IA 4JS4A 4DF8A 1U49A 1WSJA 4KKOA 3K59A 4E7LA 4FJJA 4PWDA 1JXEA 3RR8A 2D0AA 2FC0A 4C8KA 3O4NA 3AVBA 4RW7A 4CF0A 4B8AB 3BGRA 3QO9A 5I3UA 5KRSA 1QQCA 3MEDA 1S1UA 3C95A 1RT3A 3CFRA 4E1MA 4KHNA 1D9FA 4O44A 4JRQA 1GOCA 5HP1A 3M8QA 2VWJA 4C8NA 1MU2A 3KLGA 3L2UA 4M3XA 2HNYA 3I0RA 4KB0A 4M3WA 3MECA 4K8XA 2FBTA 4H4OA 1T7PA 1W0HA 4KFBA 2P5GA 1VSLA 3KLFA 3KLHA 3AVKA 5HROA 1ASWA 1XWLA 4QOZB 2IGIA 4IFVA 4CJEA 3G10A 4Y1CA 3V1QA 4E89A 4CK3A 3ZT3A 4DLGA 4DFMA 1N6QA 3F9KA 1WSEA 3QEWA 4M3RA 2X6NA 1T8EA 3AO1A 3OYIA 1RT1A 2XY6A 1BI4B 4OLBA 1SKRA 1G15A 1CZBA 1DTTA 1NKCA 4N76A 3KK3A 1WAJA 1FK9A 1VSKA 4Z4EA 2D5RA 4CHQA 4FJ5A 1Q9YA 4MQ3A 2VG7A 4KI6A 1KVCA 1U04A 2FBVA 3PV8A 4F4KA 1O1WA 4W5QA 4E7KA 3CG7A 3DLHA 3LWLA 3TAMA 4CJLA 1RCHA 2RKIA 1FKOA 3ZSWA 3OYHA 3L2RA 1WSFA 1F21A 3VQ7A 3IS9A 3NF7A 1TK0A 3NH2A 4KREA 4W5NA 4IG3A 3HVTA 1UAXA 4DFJA 3PX6A 3QNOA 1JLFA 4ELVA 3ZT0A 4FK0A 4KHQA 4FLWA 4KO0A 3CFPA 1UOCA 4CECA 4CJQA 3OYCA 2B4JA 2R7YA 1BQNA 3TABA 1XC9A 1RDCA 4FJXA 3SI6A 1A5VA 1QSLA 1KFDA 2ZE2A 3MEEA 1NOYA 1EKEA 3QEXA 4DTNA 3KD1E 4F3TA 3SUNA 3D0PA 1JL1A 3AVHA 1ZBFA 1IH7A 4CF2A 4FJLA 4CHZA 1T03A 4CCHA 1X9SA 4FXDA 3OJSA 3KK1A 4DFPA 3EYZA 4KV8A 4KTZA 5HRNA 4AHUA 4CJKA 3AVMA 3A2FA 3KKSA 1SL2A 1LWFA 3TAPA 3V9WA 1L3TA 1W9HA 1VSIA 1NKEA 1HNVA 4IBNA 4FJGA 4FK2A 1YVUA 2FBXA 4PA1A 4CJTA 3ITHA 5KGXA 4ICLA 1D5AA 3V1OA 4GVMA 4BE2A 1JLQA 3AVGA 3MXMA 1NJZA 4J2AA 3LALA 3NGIA 1RT5A 1UA0A 3V9SA 1L3SA 1DTQA 4CJUA 4L8RB 1Z25A 1NK6A 4Z4GA 4FLTA 1BCOA 1FXXA 1VK0A 1S6PA 4CEZA 5C42A 4OPKA 3K58A 4FM0A 4ID5A 1C1BA 3DM2A 4LH5A 3NH0A 1BL3A 1VSJA 1JLGA 3L8BA 2Z1IA 4DG1A 1EETA 3CQ8A 4FJ9A 4M45A 5HRPA 3MXIA 3HYFA 4CGJA 4FW1A 3B6PA 4FLUA 1ZYQA 4C8LA 4DSJA 4Z4FA 5CY4A 4AHRA 1S1XA 4I2QA 1B9DA 1QSSA 4HCCA 3NE6A 2HVIA 2XRIA 3ZSVA 1SL1A 1RBRA 4ELUA 1KSPA 3BDPA 3ZSRA 1C6VA 5FROA 1VSHA 1Q9XA 1RDBA 2ETJA 1IG9A 2NUBA 4I2PA 3VQ9A 2RF2A 4B9SA 3VQ8A 3KLEA 3NH1A 3OYDA 1TKTA 4NYFA 3OJUA 3TAFA 1D8YA 3AO2A 4N56A 3O3HA 1TKXA 4E7JA 2E4LA 1NK9A 1TL3A 1J53A 1A5XA 1BQMA 1JLAA 2D0CA 3ZT4A 4DU3A 1DLOA 3ASMA 3AVLA 2G8IA 3RRHA 1BISA 1NK0A 5CYMA 4HUFA 3QINA 4DSEA 4OLAA 3C6UA 3OS0A 1SV5A 4FJNA 4Z0UA 3OYLA 5EU7A 4CJRA 5E41A 4DQPA 5KRTA 2IAJA 4FJHA 3HXMA 1NJWA 3V9UA 2PYLA 4CFCA 1S1WA 3K5MA 1HRHA 2P1JA 4DQQA 3OS1A 5J1EA 1RBUA 2Z1JA 1JKHA 3U3GA 4CK2A 4DQSA 1UA1A 3HO1A 1CZ9A 4R5PA 1QS4A 1CLQA 3JSMA 4Q0BA 3AV9A 1J5OA 3K5OA 4OKKA 4DSFA 4DTRA 5CZ2A 1KRPA 3KTQA 2GUIA 4KRFA 1BI4A 1RDDA 4W5TA 4NYNA 1B92A 1HNIA 1S9GA 4WE1A 4CHOA 2YHAA 2Z1GA 5C24A 3EY1A 1SL0A 3M8SA 3NFAA 3HJFA 1TGOA 3VQPA 3M8RA 3AA5X 4B8CA 5C25A 4KTWA 4N47A 4BDYA 3DRPA 3RMDA 2B5JA 1LAVA 2HNDA 3HPGA 4B9LA 1NJYA 1RT4A 3VQCA 4O5BA 5JS1A 5SWMA 3QNNA 3DYAA 4FLZA 4TSXA 4FJ8A 1C0MA 4CE9A 3AA4A 1KVBA 1GOAA 1S1VA 3DLEA 4HUEA 1LWCA 1RT2A 1NK5A 4DTMA 3VQDA 1U4BA 3KD5E 3RMBA 1U45A 3C94A 1KLMA 1RTHA 4FLVA 4DTPA 3M8PA 4CGHA 4FLYA 1TAUA 3AA3A 3AVIA 1QHTA 4CGDA 1CXQA 4E7HA 3S3NA 3RR7A 3VQAA 2ATQA 1NK8A 4AHVA 1ZBHA 2DTUA 2I5JA 5FDLA 4HTUA 1TKZA 4CGIA 4I7FA 3SUQA 1KFSA 1KCFA 3EZ5A 2IOCA 5J2NA 3KJVA 4KB1A 1BHLA 4OGEA 2HHVA 4LY7A 3SZ2A 3OYNA 2OA8A 3HM9A 2JGUA 1N5YA 1RBVA 1SUQA 1VSFA 3KKRA 4RG8A 5KTQA 3OYAA 2YV0X 3RMAA 2RPIA 1HYSA 1J9AA 4CF8A 1K6YA 3D45A 4B08A 3VN5A 4B9UA 1WLJA 3VQQA 3OYKA 3OY9A 1VRTA 1YTAA 3NCIA 4B9NA 4FZYA 4B3OA 4AHCA 4GMJB 1RT7A 2Q3SA 5SZTA 3CM5A 3HSTB 1TL1A 2F8SA 3DLKA 1BIUA 4FW2A 1RILA 3QERA 3CM6A 2X74A 2G8UA 3B6OA 2XY8A 4J2EA 1C1AA 3CFOA 4RW4A 2OZMA 1ASVA 1IKVA 2QKKA 4H4MA 1R0AA 3SYZA 2HMIA 2HHXA 3LP3A 4AILC 1RNHA 5CYQA 3VQ4A 2GBZA 4LH4A 3ZSZA 3SQ4A 4DSKA 3MXJA 2P51A 4NCAA 4CEQA 4W5RA 2HHUA 2W42A 3SUPA 3S9HA 2VG5A 4H8KA 3TI0A 5J2PA 3SNNA 4CERA 3KK2A 3DLRA 4DU1A 3IG1A 2IC3A 1TK5A 1TV6A 1TVRA 4CIGA 4QAGA 4OKEA 2HVHA 1S5JA 1D9DA 4RW8A
chains in the Genus database with same CATH superfamily
4I6MA 2HW3A 1G99A 1NU0A 3TANA 1HMVA 4ZTJA 2GWJA 4CFBA 4HCBA 3BZKA 4H0XB 4KI4A 4CJFA 3SPZA 3WNGA 4CK1A 3RMCA 5J2MA 4BWMA 4AQYK 3NGZA 3GE1A 1UWBA 4E19A 2FSKA 4IKFA 3NAEA 4H5TA 3VEYA 1VSEA 3K9KA 4DR5K 3C7NA 1RBTA 3LM9A 1YTUA 1S72N 3BY5A 3FFIA 4F2SA 4EFHA 3NBPA 4E0DA 4DTXA 4WFBL 4DF4A 4BE0A 3ID8A 3OYJA 4EP5A 3VGKA 4LF4K 4BR5A 2QK9A 4BY9C 3AVNA 3O6WA 5AQZA 2OCEA 4G9ZA 3QBXA 4JI8K 4CZMA 3CERA 2PYJA 5GADP 4FYDA 3TTFA 4BACA 4YFUA 1TKDA 3H1VX 1RTDA 5C2FA 4BRKA 3I33A 4E7IA 3LDSA 1VRUA 4F3OA 4M3YA 5JVGL 3ZCMA 3OBYA 4MFBA 5C15A 1EP4A 5JS2A 1KLNA 4FVMA 3QIPA 4LC9B 3MWTA 4FM1A 4IDKA 4B9TA 2VQFK 4MLHA 3S3MA 5T7BA 1ZBUA 1S1TA 4L3QA 3DWLA 4CBUA 4Z4CA 4RW9A 1NJIO 3NDKA 3THWB 3LAKA 3LPTA 4CGGA 4W5OA 3KIOA 3JYTA 1NLVA 1HPZA 2IVNA 2QXFA 3QDKA 5M1NA 4F8RA 1GOBA 3U6FA 1C0TA 4BRFA 1ATNA 3SJJA 4FZZA 3CJBA 3WQTA 4ZTFA 3H08A 3SAFA 2P9KA 5M1PA 1QZ6A 2UXDK 1ZBSA 5I42A 1REVA 1L3UA 5AFUA 4JK8A 4H0VB 3VOVA 3O08A 2YX6A 1S3XA 4XEIA 4CEOA 5KPTA 2OPSA 3CCVN 5E84A 4OKJA 1VQON 4Z4IA 3D2FB 4JV5K 5KQDA 2NRTA 4M41A 2F9TA 3HZ6A 2JLEA 4JI4K 3B8AX 3NF8A 4KAZA 3L3VA 3SCXA 2A40A 3P5JA 1I3AA 4N5SA 1NGFA 3FE1A 3R1XA 1OVQA 4DTSA 3LAMA 4O5FA 1ASUA 4WQ4A 3OS2A 3LL3A 2FF3B 1H1VA 2HBLA 4DS5A 2YNHA 4CEDA 4GNIA 4JKGB 3A5NC 1C0UA 2KTQA 1RTIA 3LANA 3VA0A 1VQNN 3TSQA 2V7YA 4G1QA 4Y1DA 2ZJQL 3THYA 2HHHK 2Y1IA 4CEBA 3RSEA 2Q1NA 4AHSA 4NCGA 2KFNA 3A5OC 4OGCA 1BU6O 3ZT2A 2VWBA 2FF6A 4HVJA 4FJIA 2FSNA 4J2DA 4F2RA 2ZQBA 4JS4A 4IOXA 1HJOA 1WSJA 4KKOA 4B3SK 2QWLA 3O9SA 3AVBA 5I3UA 2ITMA 5KRSA 2BUPA 1BO5O 3C95A 4WCEL 1N8RO 4KHNA 3QFPA 4O44A 2HSTA 4YOYA 3PIPL 3KLGA 3L2UA 2P9PB 3I0RA 2YCHA 4KB0A 4EIAA 4K8XA 4BQZA 4WYBA 1W0HA 3AVKA 1ASWA 1XWLA 2IGIA 4DB3A 4IFVA 1T3VA 3G10A 3VEOA 3V1QA 4E89A 4CK3A 1NGHA 3O1WA 3CQXA 1BI4B 1NKCA 4Z4EA 2VQEK 3FZMA 4KI6A 2VG7A 5FPDA 4JI7K 4F4KA 3QB0A 4DCHA 2GWKA 3ZX3A 2P9SB 3L2RA 1WSFA 1F21A 5F2RA 3EO3A 3ULEB 4FOEA 3FZKA 4ELVA 3ZT0A 4KHQA 2CGJA 4KO0A 4YOUA 4CECA 3CFPA 4FLWA 2G8KA 2B4JA 3TABA 3SI6A 2ZE2A 3SMPA 4F3TA 1IH7A 4CJKA 3AVMA 1VQ8N 1VSIA 4IBNA 5KGXA 2GUPA 2NRVA 4JEPA 3V1OA 4GVMA 4BE2A 3AVGA 4YORA 3ATUA 3V9SA 4L8RB 4FLTA 1BCOA 3M6GA 1VK0A 3FZHA 4FM0A 2GELA 3L8BA 2GEMA 4DG1A 4Z4FA 2P9UB 4YOVA 2HVIA 1TYQA 1VQ5N 3GDQA 5F1XA 1RBRA 3ZSRA 4BVPA 1IG9A 3PSIA 4NYFA 1TKXA 1NK9A 4FJ5A 1J53A 4JKEA 1BQMA 1JLAA 5BRFA 3AVLA 4H0YB 1VQ9N 4V19S 4DSEA 4X65K 3THXA 4CJRA 5KRTA 3WEEB 1OH6A 4FJHA 3HXMA 4BRHA 4MDBA 4BR0A 4CBXA 1HRHA 4WQ5A 5J1EA 1RBUA 4DQSA 4AM6A 1NMDA 1U2VB 4YDUA 4LF7K 1J5OA 3P39A 5BPLA 1HNIA 5AR0A 3C7NB 3CJ1A 4RCHA 3M1FA 4CHOA 3THWA 1SL0A 3NFAA 3MX5A 4WQ4C 4PKIA 2JWLA 5A2QO 1LAVA 2HNDA 3HPGA 1NJYA 1RT4A 3EL2A 5SWMA 3QNNA 4CE9A 3AA4A 3QFUA 2W6LA 1R59O 3KD5E 1RT2A 3VQDA 4C1NI 4CGHA 1TAUA 3AA3A 1ESVA 3RR7A 5AQKA 1NK8A 4AHVA 1ZBHA 4JI3K 4B1VA 1KXPA 2RHKA 4I7FA 3PIOL 1WBBA 1SAZA 2Q0UA 1VQPN 1N36K 4BRIA 4BRGA 3G4SN 3DXKB 3EEQA 3WXIA 3HM9A 1RBVA 3VERA 1SUQA 4ILGB 2O8EA 1K6YA 3D45A 2E1YA 3CCEN 1WLJA 1D4XA 1YTAA 3OY9A 4AHCA 5SZTA 4A57A 1EWQA 1KAXA 3HSTB 5M1FA 3VEZA 2HF3A 3CFOA 5AJ3K 1HUXA 1NMNA 2Q2RA 5BPNA 2O8FB 2P51A 5DM7L 4CEQA 1P8ZA 5EX5A 3SNNA 4CERA 2O8CA 3H1QA 4X62K 3M5RA 1NGIA 1W2BM 4KH6A 4NXNK 4M3UA 4CJ5A 1BOTO 2RN2A 4GVEA 4KH4A 1JXBA 4B9VA 2D0BA 5FRMA 1XNRK 1BA0A 1IBKK 4HHTA 3E9PA 3S3OA 2O4GA 1B9FA 5TKYA 2QI2A 3V6DA 1JLEA 2WC9A 4CFAA 2O8DB 2PY5A 2FLOA 1IKYA 3DOKA 3BZCA 1JL2A 2A5XA 1KVAA 3ALYA 2A42A 3VF4A 2NLXA 4B1UB 4GV6A 5FRNA 3MN6A 2KHOA 4DFKA 3DMJA 3KLIA 3PY8A 4DR1K 1QQOA 4K41A 3VQ5A 4AH9A 1T6DA 3QEVA 5AQXA 4HUGA 3QEPA 1GLBG 3ZSXA 4C8MA 3IUCA 4UY8O 1NWKA 4A5AA 4H5RA 1KAZA 3L6QA 3SQ0A 4LFCK 4CJPA 1N34K 5CE3A 2OYQA 1E3MA 3PLAA 2W6KA 1RTJA 5JMVA 1RDAA 2P9SA 4CESA 1SKSA 2KQ2A 2IS3A 2UUBK 2E2NA 3OA9A 2UYTA 3U3YA 4LFBK 3ULDA 2YNIA 3CYMA 2E6LA 1U48A 2E6MA 4BWJA 2HF4A 3HP9A 3JXUA 3UKRB 2XO7A 2KFZA 4LF9K 3V81A 3TAGA 4JRPA 1TK8A 3OYFA 2Q0RA 4FWQA 2A1SA 4MO4A 1NGJA 1Z05A 3WNEA 4CJ3A 3PX4A 3DAWA 3PUFA 3AA2A 4FZXC 2IVPA 2AA4A 4BC2A 4CZHA 4WQ5C 1QVFM 4DSLA 1BUPA 1YJWN 3WNFA 4YDUC 3A5MC 2HHTA 4NB4A 3V9XA 1EWRA 3MCPA 3F73A 2HMPA 1ATSA 2EHGA 3AVFA 2OTLN 4DR7K 4OVLA 1JCFA 2OZSA 4PY5A 4DSIA 5BN8A 2P9UA 3T69A 1GLEG 3NGYA 1Q18A 3HP6A 4DTOA 4XH4A 3P4IA 4N41A 3TWHA 3G6EN 3S41A 5D3GA 1BCMA 2XY7A 4KPYA 1CXUA 4H0OA 3HPHA 3TAEA 3SUOA 3OVNA 2IDOA 4LD0A 2PBDA 3WEEA 4LSLA 4FWRA 3TTCA 5KQ8A 2HHQA 4DQ8A 1U2VA 1O13A 1NBWA 2VG6A 3AO4A 4IFEA 2OANA 4H0PA 4NCBA 1LW0A 4ILJA 1ZC6A 3EZWA 3VQEA 3O9RA 1VSMA 4H5NA 1K9MO 4Q5VA 3QEIA 1L3VA 2YNGA 3HT3A 1XHZA 1HYVA 3ZT1A 4AF1A 4M42A 1VQKN 4JKCA 4KHYA 3A5LC 1XHXA 4NLCA 3RTVA 1U47A 3K57A 4O8KA 2EX3A 4OPAA 1IKWA 2YHBA 2NRWA 1TYQB 1VSDA 4XH1A 1S6QA 4PL7A 4IOAL 5KGWA 2E2QA 2P9LB 3FGUA 3NVMA 1U49A 3K59A 4FJJA 1JXEA 3DXKA 4C8KA 3HOSA 3VMFB 3LM2A 3OBWA 3RVCA 2ZM6K 3CFRA 3M8QA 2VWJA 4C8NA 1MU2A 4M3XA 2HNYA 3K9JA 3THXB 3HTVA 4KFBA 2UU9K 5AQQA 2QWNA 4FWMA 3M3ZA 1YI2N 4BR2A 2PAVA 3U9DA 4U7BA 3GBTA 4FWOA 4DLGA 4DFMA 3CCQN 1KD1O 2O8FA 3NMUA 4M3RA 2X6NA 3OYIA 4OLBA 3WT0A 4PKHA 1DTTA 4YOTA 4N76A 1WAJA 4C1NK 4MQ3A 4BR9A 1U04A 2FBVA 4JNEA 3PV8A 5HOOA 2RKIA 4WFAL 3U8XA 3IS9A 4A2BA 4W5NA 4DFJA 3PX6A 4IEIA 1UOCA 4CJQA 1X9JA 2R7YA 1BQNA 1RDCA 1QSLA 4BQLA 5JICA 4DV1K 3QEXA 4DTNA 1BG3A 4LFAK 4GKJK 1JL1A 2O8DA 1SQKA 1RGIA 4CHZA 5AZIA 1T03A 4CCHA 4FXDA 5BPMA 5AFUH 4KTZA 5HRNA 2OTJN 1LWFA 5B8HA 3V9WA 4H5WA 1NKEA 3TPQA 5AQYA 1YVUA 4PA1A 3SBGA 3ITHA 4AM7A 2KKZA 1D5AA 2Q31A 1NJZA 4J2AA 1IG8A 2O8EB 3CJAA 3GL1A 1UA0A 4CZJA 4LF5K 1L3SA 1DTQA 4BR4A 1NGCA 2WUSA 1NK6A 4EHUA 3J7YP 2Q36A 1FXXA 4CEZA 3K58A 4ID5A 1C1BA 3DM2A 5BRHA 1JLGA 3E66A 3CQ8A 4M45A 4CGJA 4FW1A 4AHRA 2W41A 1QSSA 5HL7L 5H1SQ 3ZSVA 1DKGD 4ELUA 3TTDA 4EAHD 1QVGM 5AQNA 3VQ9A 3VQ8A 3KLEA 3AO2A 2O8CB 3L0QA 3CI5A 4E7JA 3ZT4A 3OHRA 2WTUA 1DLOA 3ASMA 3RRHA 1BISA 5CYMA 3UKRA 1K8AO 2QWQA 4OLAA 2GTDA 3OS0A 5AQMA 1SV5A 4FJNA 3OYLA 4DV0K 3E9LA 1NJWA 3K5MA 1MA9B 2Z1JA 3U3GA 3VGLA 1CZ9A 1QS4A 1FJGK 4R79A 4B1WB 2E1ZA 4JI0K 1OH5A 4DSFA 5CZ2A 3MN9A 4QS9A 5FPNA 1S9GA 4WE1A 5AQSA 3EY1A 5AQRA 3HJFA 1TGOA 4B8CA 2Q97A 4RWTA 4JI5K 2E5LK 4KTWA 3BP8A 3FLCO 1HNXK 5DM6L 4B9LA 2NRHA 1N32K 3VQCA 5JS1A 4FLZA 3GG4A 4TSXA 4FJ8A 2NZTA 4B1YB 1GOAA 1LWCA 3ZEUB 4DTMA 1Q82O 1KLMA 4FLVA 3UKUB 4YOWA 4FLYA 2F9WA 4E7HA 2O8BA 1DT9A 1WOQA 2ATQA 2DTUA 2I5JA 5FDLA 2HBKA 1NGGA 3W3DA 1KFSA 2YHYA 1KCFA 2IOCA 5J2NA 5AQJA 4C23A 5JLFA 1BHLA 2KLAA 3AGKA 4LY7A 2QWRA 3SZ2A 1N5YA 2JGUA 2AP1A 3OYAA 3KKRA 4GY2B 4JK9A 4RG8A 2YV0X 5M1QA 4BC3A 1HYSA 4CF8A 2NRXA 3VN5A 2A41A 3OYKA 4B9NA 1VRTA 4FZYA 4GMJB 1RT7A 3CM5A 1YJ9N 1TL1A 3DLKA 4FW2A 3CM6A 4ISFA 3ID6A 3JAMO 4YOXA 4RW4A 4H4MA 1R0AA 3SYZA 1XC3A 3EE9A 4AILC 1MWMA 1RNHA 5CYQA 3VQ4A 3ZSZA 3SMSA 4NCAA 3SUPA 2VG5A 4A59A 4FO0A 4DU1A 3DLRA 3IG1A 3I55N 2I7NA 1TV6A 3MX2A 4OKEA 4ILHA 2V51B 1QQNA 3CCMN 2GV9A 1QZ5A 4CJ7A 2CH5A 3QIOA 4FJ7A 2YNFA 4FL9A 1NJXA 4DU4A 2HB5A 2P9LA 2E2PA 3RRGA 4J8FA 1WNSA 5EOYA 4FPAA 1YIJN 3QLHA 2XHBA 4DV2K 3MEGA 4DS4A 4M3TA 3UE5A 1LWEA 2YKMA 4I9QA 5I9EB 4CEEA 4C8OA 4DTJA 4FCYA 5M1KA 2ITGA 4WFNL 4CJWA 4M7YA 3VETA 3D2EA 4CEFA 4B3RK 2I7PA 4CF1A 2HHSA 3BF3A 1X3MA 2WFBA 1QE1A 1YXQA 1NKBA 3P38A 3VEWA 4MO5A 3ENHA 3T19A 1Q81O 1CZAN 3TR8A 1GLCG 4O0JA 1ZXOA 1HQUA 3ZLJA 5J2QA 3OYBA 1ITGA 5HRSA 3ISNC 4QS8A 3CCSN 3R6MA 3AVAA 1QQMA 4X66K 4DQRA 3LZJA 1C1CA 3SBTA 2KZMA 2AJQA 1NGDA 3P1GA 3CCLN 2HHWA 3P31A 4BREA 3I56N 1HYZA 4CEAA 3G0ZA 2ZJRL 3O3GA 3N4PA 3DLGA 4QCLA 2J4RA 3RWUA 4CZLA 3A8YA 1Q8IA 3J8AA 4DUZK 2UUAK 5AQGA 3VEVA 3DRSA 1L5UA 3L2WA 4IOCL 1Z6RA 3OYMA 4BRCA 2WOMA 3LP2A 4RW6A 3CCUN 1X1PA 2HBJA 2WBNA 1XQSC 3NVKA 1TAQA 4MLEA 3LP0A 5ADXA 3SPYA 4NO7A 1I94K 1ZBIA 1IBLK 4ELTA 1KTQA 3AVCA 3P83D 4DR4K 3CF5L 3K2PA 2CGLA 4GW6A 4LSNA 4IEEA 2E88A 3J7AP 3HI0A 1LW2A 1HKCA 3HSCA 5CHIA 2WONA 3OYGA 3J80O 2G8VA 4B9QA 1N33K 5MLCQ 4IFYA 2D0PA 5DMRA 1BIZA 3VGMA 4JI1K 1EX4A 3PSFA 4JI2K 3WXJA 1E4GT 3BUZB 3TSPA 5C2DA 5AQVA 3C6HA 1ILYA 4JKBA 4OX9K 4JAXA 2BANA 3T3FA 3CMAN 3C0BA 4BROA 3HVRA 4EZ6A 1U6ZA 1NK7A 1RFQA 1I39A 4JLHA 4FJKA 4DV7K 4Z4HA 2PZSA 1T44A 2W40A 2P5OA 5GAGP 3H3OB 3SQ2A 1DGKN 3SV4A 4EP4A 2VCPA 3D7EO 2QWOA 5GIPA 2ZGZA 2BGGA 2DY4A 3WNHA 1XNQK 1MDUB 1DEJA 4E1JA 4K25A 1WSIA 5C12A 5AZIB 1NGAA 3HK2A 3SQ1A 3NF6A 1K73O 3Q7BA 4BRDA 3LZIA 1QSYA 5GAEP 3PX0A 1KQSM 4AHTA 2QW9A 1NG9A 2YJEA 2BE2A 4FLXA 3T1AA 4KHPK 5C10A 3T1YK 3MN7A 4QS7A 4A61A 3CD6N 1OKJA 4ZHRA 1NOZA 3ZEUA 1IBMK 2XY5A 3UKUA 4OJRA 3VTIA 5TKWA 3IFRA 3LDQA 1YITN 3O3FA 2F96A 2OPQA 2QEXN 1S9EA 2O4IA 2IVOA 5LL6Z 3H45C 5EVZA 1GLDG 4PWDA 4E7LA 2D0AA 5ELZA 5BREA 2NRZA 3BGRA 3MN5A 4B3TK 4JK7A 3MEDA 2CGKA 1GLAG 4E1MA 1D9FA 4JRQA 4HTLA 5HP1A 1IV0A 1MWKA 4H4OA 2ZWHA 2P5GA 1VSLA 3KLFA 4DR6K 5HROA 5FPEA 3G71N 4Y1CA 1GLLO 1N6QA 1BA1A 4Y0WA 1SZ2A 1WSEA 1T8EA 3AO1A 2XY6A 3IMXA 1BDGA 1SKRA 1CZBA 4JD2A 3KK3A 2D5RA 4CHQA 1Q9YA 1VQMN 1KVCA 1O1WA 4W5QA 3CG7A 3TAMA 1RCHA 3OYHA 4JHDB 3H46O 3NF7A 1TK0A 4KREA 2QTDA 3HVTA 4IG3A 4BVOA 3QNOA 5EY4A 4FK0A 3VESA 2G8FA 4FJXA 1XC9A 1KFDA 3MEEA 4LF8K 1NOYA 3KD1E 3SUNA 3D0PA 1ZBFA 2O8BB 4CF2A 4H03B 4IXCA 3OJSA 3KK1A 4FWSA 3EYZA 4KV8A 4AHUA 3KKSA 1XMOK 4LF6K 3TAPA 3SAHA 4BR7A 4EHTA 5IT9O 2PFUA 1HNVA 3EKUA 5FPMA 4FJGA 3QMLA 2CH6A 4ICLA 3MXMA 3CJCA 1RT5A 4CJUA 1Z25A 4Z4GA 1M1KO 1JCGA 5BRDA 4K0KK 4KH5A 2Z1IA 3T7ZA 4FJ9A 1ZYQA 3B6PA 4O8UA 1J5EK 5CY4A 3O9QA 3TU5A 4BRAA 1KSPA 2BTFA 3BDPA 1C6VA 3H6EA 1VSHA 2E8AA 5FROA 1Q9XA 4I2PA 4B9SA 2RF2A 1D8YA 4YHHK 3NH1A 1TKTA 3OYDA 3OJUA 3TAFA 4N56A 3O3HA 1X3NA 1A5XA 4DU3A 1EQYA 4HUFA 3CETA 4A2AA 2PYLA 4CFCA 1YAGA 3AGRA 3HO1A 4CVNE 2DPNA 1WB9A 3SJHA 1VQ6N 4Q0BA 1YJNN 4OKKA 5AQWA 1KRPA 3C6AA 3KTQA 2GUIA 4YY3K 3SK3A 1RDDA 1EO1A 1B92A 3WQUA 4GV3A 3F9MA 5C24A 3M8SA 2UXCK 3LDPA 3VQPA 3AA5X 5C25A 2BH1A 3U9ZA 4N47A 3CHWA 3D2EB 3W0LA 4BRNA 3DYAA 5E26A 1KVBA 3DLEA 2HOEA 1NK5A 3J81O 1U4BA 3H3NO 3VF2A 4DTPA 4KBOA 1RTHA 3DLLL 3M8PA 1KAYA 3AVIA 1HLUA 4HTUA 3SUQA 5AQTA 3EZ5A 3D6RA 4KB1A 3VEXA 2OA8A 5BN9A 1YUWA 1GLJO 5KTQA 3RMAA 3DXMB 4HWIA 4FPBA 5GINA 5BR9A 4B9UA 3VQQA 3NCIA 3QICA 3MWPA 2F8SA 1JJ2M 3QERA 3K0SA 2X74A 2G8UA 1HR0K 2XY8A 4JI6K 4FOIA 2OZMA 2P9NA 4DUYK 1IKVA 2QKKA 2HHXA 3KWGA 2JWKA 3LDOA 3UB5A 3O4WA 2GBZA 4DSKA 4BGAA 4W5RA 4PL8A 1TUYA 2F7TA 3MCAB 3KK2A 5LJVA 4BG8A 2IC3A 3O5BA 1TK5A 1TVRA 4CZKA 3CC7N 2HVHA 1D9DA 3VPZA 4RW8A 4F9OA 4XIUA 4O4GA 1M90O 3PO5A 4DWIA 2GX9A 1WAFA 3L4IA 4CIEA 3MMVA 1T05A 3JS6A 5LMUK 2V7ZA 4BRQA 4B1XB 4DQIA 4NXMK 4JKFA 4DR3K 4BG9A 3A0IX 2FSJA 3HOTA 4CF9A 5CZ1A 4PQUA 3L3UA 4IZ9A 2KW4A 2Y1JA 2D0OA 4CIFA 3E01A 3R3LA 3SLCA 1BGXT 5K14A 2P9IB 5KI6A 3LDLA 3ATVA 4CGFA 2YHXA 1LAWA 3GOIA 4BE1A 2E20A 4DR2K 1ZBLA 1SKWA 3L2VA 1HNZK 5DK5A 2VYPA 4DV6K 4PHTX 3BEXA 5AQHA 4YNQA 2ZGYA 3ENOA 1YF5L 3NHGA 4GV9A 3ZSYA 4CJ4A 3ZYYX 4E3SA 4KHSA 3CC2N 1RDWX 3SV3A 3QESA 4UQGA 1JCEA 4CHYA 3VQ6A 5HLFA 5AQOA 1IJJA 1EXQA 3CQYA 2DFFA 3IRXA 3MDQA 3CXCM 1RBSA 3I0SA 5GAHP 3DI6A 5HBMA 1NK4A 3IAYA 3V9ZA 3MK6A 1HQEA 4JHDA 5GIOA 3TAQA 4K8ZA 4CHNA 3K5NA 3F5TA 4NLBA 2ZF5O 4CHPA 3E9OA 3AO3A 3CMEN 3VQBA 4ISEA 1J54A 2DFEA 1VQ7N 3Q7CA 1WSHA 2KZZA 3IDHA 2FBYA 4K42A 3O4QA 1T6CA 2ZD1A 4DV3K 4BRLA 4JS5A 4B9MA 4O0IA 3AAPA 3ZX2A 5FLXO 3MAQA 1K8KB 1RT6A 4KHUA 2ASMA 4DLEA 4CFDA 3TARA 1IO2A 4CZFA 1QTMA 2DFHA 3UIQA 2D1KA 4E1NA 2FXUA 3J7ZO 3TSUA 3IKMA 2X78A 3HPOA 4BGBA 4BDZA 2QKBA 5HRRA 1YT3A 4FVUA 3LP1A 4FK4A 1Y97A 5AZJB 3HL8A 3T1HK 1XI1A 1JLCA 3DRRA 2OPPA 4RTFD 4BRMA 3VTHA 2B6AA 3QETA 3KK7A 4H5VA 1HJRA 2G8WA 2HNZA 1QHAA 3AVJA 2X6SA 1Y64A 4OPJA 3KWIA 3FFKB 4KTQA 5AQUA 2BDPA 2H3GX 5JVHL 4KHWA 4JD2B 4A5BA 4BC4A 3EE8A 4OO1J 3L2QA 4IG0A 3ZSQA 3EKSA 4J2BA 3I8DA 4M3ZA 4BDPA 4IO8A 4CBWA 4EZ9A 1IKXA 2UXBK 3KZBA 4XH5A 2OPRA 4B3MK 4CW7B 2NNWA 4DTUA 2F8TA 1GLFO 1J6ZA 1HNWK 3WXMB 1ATRA 4PUOA 4O55A 3OYEA 4A62A 2NRRA 2YKNA 3NF9A 2Z1HA 3LWMA 3AO5A 1Z26A 3K5LA 4FWKA 1W7AA 3ZSOA 1LV5A 1A5WA 4DMNA 1WN7A 3DOLA 4M7XA 4CD1A 3AARA 3LPUA 1NM1A 3PO4A 2G8HA 1X9WA 4JKHA 3DLBA 2V52B 3ZETB 2LSNA 1V4SA 4CJVA 3O9TA 1JLBA 3THVA 4JKDA 3VA3A 4M63C 3V4IA 3R9PA 3KVGA 1WUAA 1LOTB 4WF9L 4FM2A 4I6MB 4CJSA 1FKPA 3C6TA 1X9MA 4I9LA 1WSGA 4ID1A 3V1RA 4PKGA 4FJMA 4IJNA 2A1RA 2VWKA 1RDUA 2ZJPL 3LDNA 2A3ZA 5AQLA 4DF8A 3RR8A 2FC0A 3O4NA 1TUUA 4RW7A 4CF0A 4B8AB 1C0GA 3QO9A 5M1OA 1QQCA 1C0FA 4IJAA 3HBTA 1S1UA 1RT3A 3DXMA 1GOCA 1NGBA 4M3WA 3MECA 2FBTA 4CI6A 1T7PA 1FW6A 5AQPA 1E4FT 3CPEA 3KLHA 4QOZB 4CJEA 4U67L 3ZT3A 3N4QA 3SAGA 3F9KA 3CIPA 1S22A 4FWPA 3QEWA 1Q86O 3R8EA 5EXWA 3VENA 1RT1A 2QM1A 1XUPO 4B1ZA 5ADXH 1G15A 5BR8K 2QA4N 5IWAK 1V4TA 1FK9A 1VSKA 1KC8O 1HPMA 4E7KA 3DLHA 3D2FA 4GKKK 3LWLA 4CJLA 1FKOA 2YHWA 3ZSWA 3VQ7A 1P90A 3ZX0A 3NH2A 2QXLA 3O1BA 1UAXA 2UUCK 1VQLN 3CJ9A 1JLFA 3OYCA 1A5VA 3HM8A 2YJFA 1EKEA 4FWLA 4CZEA 4K43A 3AVHA 4FJLA 1X9SA 3FZLA 4DFPA 3BF1A 2P9IA 1NGEA 3A2FA 3U4LA 1SL2A 3DJCA 3OTOK 4JKGA 2QWPA 1L3TA 1W9HA 4FK2A 2FBXA 4CJTA 2VGNA 1YHQN 1JLQA 4BRPA 1SS6A 3LALA 4DKWA 3NGIA 3HRGA 1VAZA 1W97L 1S6PA 2VGMA 5C42A 3WXLA 4OPKA 4IWVA 1BWFO 2EWSA 4LH5A 3NH0A 1BL3A 1VSJA 2E2OA 5LMNK 1EETA 5HRPA 3MXIA 2A6AA 2P9NB 3HYFA 2IIRA 1LCUA 4FLUA 4DV4K 3I8BA 4IDHA 4C8LA 4DSJA 1S1XA 4I2QA 1B9DA 4HCCA 3O80A 3NE6A 4JKAA 2XRIA 4JN4A 1SL1A 2P9KB 1RDBA 2ETJA 4J2EA 2NUBA 4CZIA 3WUHA 3E1YA 5KPZA 4CZGA 2E4LA 3FR0A 1TL3A 2D0CA 2ASOA 2RE2A 2G8IA 1NK0A 3QINA 3C6UA 5AQFA 2P9PA 2QWMA 4Z0UA 5EU7A 4DQPA 5E41A 1VQ4N 2IAJA 4DHYA 3CC4N 3V9UA 3AAQA 1S1WA 5JLHA 2P1JA 1K8KA 3OW2M 3OS1A 4DQQA 1OVYA 1JKHA 4CK2A 1UA1A 4Z94A 4R5PA 1CLQA 3JSMA 3CJ7A 4ISGA 4DV5K 3AV9A 1OH8A 3K5OA 4DTRA 5LJWA 3WXKA 4KRFA 1BI4A 4W5TA 1OH7A 3ENBA 4NYNA 1HKBA 3VF6A 2YHAA 2Z1GA 5AZJA 4H0TB 3M8RA 5C0YA 4BDYA 3DRPA 1VHXA 2B5JA 4FSVA 3RMDA 1XMQK 5KPRA 4O5BA 2HBMA 3THYB 3ULEA 4X64K 3L4QA 1C0MA 3KHYA 3RSEB 4HUEA 1S1VA 3O8MA 2YI1A 1WBDA 3RMBA 1U45A 3C94A 4BC5A 3S3NA 1QHTA 4CGDA 1CXQA 3VQAA 1TKZA 3G25A 4CGIA 5CR4A 5AQIA 3CCRN 3KJVA 1YVNA 4OGEA 1HX1A 1NNEA 2HHVA 3OYNA 3F2KA 4FWNA 1VSFA 2RPIA 1J9AA 2D4WA 4CD3A 5F0XA 4B08A 4IO9L 4B3OA 2Q3SA 3C65A 3O9UA 4MDAA 3QBWA 3CPWM 1BIUA 1RILA 3B6OA 2ASPA 3CCJN 1C1AA 2F4VK 1ASVA 2HMIA 1HKGA 3EN9A 5LY3A 4JYAK 3LP3A 3SQ4A 4LH4A 4OPHA 3MXJA 2HHUA 2W42A 3AY9A 3S9HA 4H8KA 3TI0A 5J2PA 3FZFA 3ZETA 4CIGA 4QAGA 1Q7YO 1S5JA
chains in the Genus database with same CATH topology
4XIUA 4M3UA 4O4GA 2HW3A 2GV9A 2RN2A 4CJ5A 3TANA 3PO5A 4DWIA 1HMVA 1JXBA 1WAFA 4CFBA 4ZTJA 4B9VA 4HCBA 4CIEA 2D0BA 3QIOA 4FJ7A 4CJFA 1T05A 4KI4A 5FRMA 2YNFA 3SPZA 3WNGA 4CK1A 3RMCA 4HHTA 1NJXA 5J2MA 4DU4A 3S3OA 4BWMA 2HB5A 4DQIA 2O4GA 1B9FA 3NGZA 3RRGA 3V6DA 1JLEA 4CF9A 1UWBA 1WNSA 5CZ1A 4E19A 4IKFA 4PQUA 3L3UA 4CFAA 3NAEA 2KW4A 2Y1JA 2PY5A 1VSEA 4CIFA 3E01A 3QLHA 2XHBA 1BGXT 3MEGA 4DS4A 4M3TA 1IKYA 5K14A 3DOKA 1LWEA 2YKMA 5KI6A 4I9QA 4CEEA 4C8OA 4DTJA 4CGFA 4FCYA 1JL2A 1RBTA 2ITGA 1LAWA 3ALYA 1KVAA 4BE1A 1ZBLA 1YTUA 1SKWA 3L2VA 5FRNA 5DK5A 4CJWA 4CEFA 4DFKA 3DMJA 3KLIA 3PY8A 3FFIA 4CF1A 4F2SA 3NBPA 4E0DA 4YNQA 2HHSA 4AH9A 3VQ5A 4DTXA 1QE1A 3QEVA 4HUGA 3QEPA 1NKBA 4DF4A 3NHGA 3ZSXA 4C8MA 3T19A 3ZSYA 4CJ4A 4BE0A 4E3SA 3TR8A 4KHSA 4O0JA 3OYJA 4EP5A 3SV3A 3QESA 2QK9A 1HQUA 4UQGA 4CHYA 3AVNA 3VQ6A 3OYBA 5J2QA 5HLFA 1ITGA 5HRSA 3SQ0A 1EXQA 3ISNC 2DFFA 3IRXA 1RBSA 3I0SA 4CJPA 3AVAA 2PYJA 2OYQA 3DI6A 5HBMA 1NK4A 3IAYA 4FYDA 1RTJA 3V9ZA 4DQRA 1HQEA 1RDAA 1C1CA 3LZJA 4CESA 4YFUA 4BACA 2KQ2A 2IS3A 1SKSA 1TKDA 3TAQA 2KZMA 2AJQA 4K8ZA 4CHNA 3K5NA 3P1GA 1RTDA 2HHWA 3U3YA 3ULDA 4CHPA 1HYZA 2YNIA 4CEAA 3CYMA 3G0ZA 3O3GA 3LDSA 3AO3A 3DLGA 4E7IA 2E6LA 1VRUA 3VQBA 2E6MA 1U48A 4F3OA 4BWJA 3RWUA 4M3YA 4QCLA 1J54A 2DFEA 3HP9A 1Q8IA 2XO7A 1WSHA 3ZCMA 2KFZA 2KZZA 2FBYA 3V81A 3O4QA 3TAGA 4MFBA 4JRPA 1EP4A 2ZD1A 5JS2A 3DRSA 1L5UA 1KLNA 4JS5A 3L2WA 4B9MA 4O0IA 1TK8A 4FVMA 3MAQA 3OYMA 3OYFA 2WOMA 2A1SA 3LP2A 3QIPA 1RT6A 4RW6A 4KHUA 1X1PA 3WNEA 4CJ3A 4DLEA 4CFDA 3TARA 1IO2A 3PX4A 2DFHA 1QTMA 1TAQA 3UIQA 3PUFA 4IDKA 3LP0A 3AA2A 4E1NA 4FM1A 3SPYA 4FZXC 2X78A 1ZBIA 4B9TA 3HPOA 2G8KA 4ELTA 4BDZA 3S3MA 5HRRA 1YT3A 1KTQA 4DSLA 2QKBA 5T7BA 1ZBUA 3AVCA 1S1TA 3P83D 3LP1A 3WNFA 1Y97A 4FK4A 2HHTA 4Z4CA 4RW9A 3HL8A 3NDKA 1XI1A 1JLCA 3DRRA 3K2PA 3V9XA 2OPPA 3LAKA 3F73A 3LPTA 4GW6A 4LSNA 4CGGA 4W5OA 3KIOA 3JYTA 2B6AA 3QETA 1HPZA 1LW2A 2EHGA 2QXFA 3AVFA 4F8RA 2WONA 3OYGA 1GOBA 1HJRA 4OVLA 3U6FA 2G8WA 2HNZA 2G8VA 2OZSA 1C0TA 4PY5A 3SJJA 4DSIA 3AVJA 4IFYA 4FZZA 2X6SA 5DMRA 4OPJA 3NGYA 1BIZA 4ZTFA 3H08A 4KTQA 1EX4A 2BDPA 3HP6A 5I42A 1REVA 4KHWA 1L3UA 4DTOA 4N41A 3TWHA 4CEOA 2OPSA 3L2QA 5D3GA 4IG0A 4OKJA 1BCMA 4Z4IA 2BANA 3ZSQA 3T3FA 2XY7A 4KPYA 1CXUA 4M41A 4EZ6A 3HVRA 4J2BA 3I8DA 4M3ZA 3HPHA 3TAEA 1NK7A 4BDPA 3SUOA 1I39A 3OVNA 2IDOA 4JLHA 4LD0A 4FJKA 4Z4HA 2PZSA 2JLEA 2P5OA 3SQ2A 3SV4A 3NF8A 4EP4A 4LSLA 4KAZA 3L3VA 3SCXA 1IKXA 4EZ9A 3P5JA 1I3AA 2BGGA 4N5SA 2DY4A 2OPRA 3WNHA 2HHQA 4DTUA 2F8TA 4DTSA 3LAMA 1ASUA 1WSIA 2VG6A 4PUOA 3HK2A 3AO4A 4O55A 3OYEA 3SQ1A 3OS2A 3NF6A 4NCBA 1LW0A 2YKNA 3NF9A 2Z1HA 3LWMA 3LZIA 1QSYA 3PX0A 3AO5A 1Z26A 2YNHA 4AHTA 4CEDA 3K5LA 4DS5A 3ZSOA 1LV5A 1A5WA 2BE2A 3VQEA 4DMNA 1C0UA 1WN7A 3DOLA 2KTQA 1RTIA 3LPUA 3LANA 3VA0A 1VSMA 4FLXA 3PO4A 4Q5VA 3T1AA 2G8HA 4G1QA 4Y1DA 3QEIA 1X9WA 1L3VA 3DLBA 2YNGA 2LSNA 4CJVA 3HT3A 1XHZA 2Y1IA 1HYVA 1JLBA 3ZT1A 4CEBA 2G8FA 3THVA 4M42A 3VA3A 4KHYA 3V4IA 4AHSA 4ZHRA 4NCGA 1NOZA 1XHXA 4FM2A 2KFNA 4CJSA 2XY5A 1FKPA 3C6TA 4OGCA 4OJRA 3RTVA 3ZT2A 1X9MA 4I9LA 4HVJA 1WSGA 1U47A 3K57A 4FJIA 2EX3A 4ID1A 4J2DA 1IKWA 2F96A 3O3FA 2OPQA 2YHBA 3V1RA 4F2RA 4FJMA 2A1RA 1VSDA 1S6QA 2VWKA 2ZQBA 5KGWA 1S9EA 2O4IA 4JS4A 4DF8A 1U49A 1WSJA 4KKOA 3K59A 4E7LA 4FJJA 4PWDA 1JXEA 3RR8A 2D0AA 2FC0A 4C8KA 3O4NA 3AVBA 4RW7A 4CF0A 4B8AB 3BGRA 3QO9A 5I3UA 5KRSA 1QQCA 3MEDA 1S1UA 3C95A 1RT3A 3CFRA 4E1MA 4KHNA 1D9FA 4O44A 4JRQA 1GOCA 5HP1A 3M8QA 2VWJA 4C8NA 1MU2A 3KLGA 3L2UA 4M3XA 2HNYA 3I0RA 4KB0A 4M3WA 3MECA 4K8XA 2FBTA 4H4OA 1T7PA 1W0HA 4KFBA 2P5GA 1VSLA 3KLFA 3KLHA 3AVKA 5HROA 1ASWA 1XWLA 4QOZB 2IGIA 4IFVA 4CJEA 3G10A 4Y1CA 3V1QA 4E89A 4CK3A 3ZT3A 4DLGA 4DFMA 1N6QA 3F9KA 1WSEA 3QEWA 4M3RA 2X6NA 1T8EA 3AO1A 3OYIA 1RT1A 2XY6A 1BI4B 4OLBA 1SKRA 1G15A 1CZBA 1DTTA 1NKCA 4N76A 3KK3A 1WAJA 1FK9A 1VSKA 4Z4EA 2D5RA 4CHQA 4FJ5A 1Q9YA 4MQ3A 2VG7A 4KI6A 1KVCA 1U04A 2FBVA 3PV8A 4F4KA 1O1WA 4W5QA 4E7KA 3CG7A 3DLHA 3LWLA 3TAMA 4CJLA 1RCHA 2RKIA 1FKOA 3ZSWA 3OYHA 3L2RA 1WSFA 1F21A 3VQ7A 3IS9A 3NF7A 1TK0A 3NH2A 4KREA 4W5NA 4IG3A 3HVTA 1UAXA 4DFJA 3PX6A 3QNOA 1JLFA 4ELVA 3ZT0A 4FK0A 4KHQA 4FLWA 4KO0A 3CFPA 1UOCA 4CECA 4CJQA 3OYCA 2B4JA 2R7YA 1BQNA 3TABA 1XC9A 1RDCA 4FJXA 3SI6A 1A5VA 1QSLA 1KFDA 2ZE2A 3MEEA 1NOYA 1EKEA 3QEXA 4DTNA 3KD1E 4F3TA 3SUNA 3D0PA 1JL1A 3AVHA 1ZBFA 1IH7A 4CF2A 4FJLA 4CHZA 1T03A 4CCHA 1X9SA 4FXDA 3OJSA 3KK1A 4DFPA 3EYZA 4KV8A 4KTZA 5HRNA 4AHUA 4CJKA 3AVMA 3A2FA 3KKSA 1SL2A 1LWFA 3TAPA 3V9WA 1L3TA 1W9HA 1VSIA 1NKEA 1HNVA 4IBNA 4FJGA 4FK2A 1YVUA 2FBXA 4PA1A 4CJTA 3ITHA 5KGXA 4ICLA 1D5AA 3V1OA 4GVMA 4BE2A 1JLQA 3AVGA 3MXMA 1NJZA 4J2AA 3LALA 3NGIA 1RT5A 1UA0A 3V9SA 1L3SA 1DTQA 4CJUA 4L8RB 1Z25A 1NK6A 4Z4GA 4FLTA 1BCOA 1FXXA 1VK0A 1S6PA 4CEZA 5C42A 4OPKA 3K58A 4FM0A 4ID5A 1C1BA 3DM2A 4LH5A 3NH0A 1BL3A 1VSJA 1JLGA 3L8BA 2Z1IA 4DG1A 1EETA 3CQ8A 4FJ9A 4M45A 5HRPA 3MXIA 3HYFA 4CGJA 4FW1A 3B6PA 4FLUA 1ZYQA 4C8LA 4DSJA 4Z4FA 5CY4A 4AHRA 1S1XA 4I2QA 1B9DA 1QSSA 4HCCA 3NE6A 2HVIA 2XRIA 3ZSVA 1SL1A 1RBRA 4ELUA 1KSPA 3BDPA 3ZSRA 1C6VA 5FROA 1VSHA 1Q9XA 1RDBA 2ETJA 1IG9A 2NUBA 4I2PA 3VQ9A 2RF2A 4B9SA 3VQ8A 3KLEA 3NH1A 3OYDA 1TKTA 4NYFA 3OJUA 3TAFA 1D8YA 3AO2A 4N56A 3O3HA 1TKXA 4E7JA 2E4LA 1NK9A 1TL3A 1J53A 1A5XA 1BQMA 1JLAA 2D0CA 3ZT4A 4DU3A 1DLOA 3ASMA 3AVLA 2G8IA 3RRHA 1BISA 1NK0A 5CYMA 4HUFA 3QINA 4DSEA 4OLAA 3C6UA 3OS0A 1SV5A 4FJNA 4Z0UA 3OYLA 5EU7A 4CJRA 5E41A 4DQPA 5KRTA 2IAJA 4FJHA 3HXMA 1NJWA 3V9UA 2PYLA 4CFCA 1S1WA 3K5MA 1HRHA 2P1JA 4DQQA 3OS1A 5J1EA 1RBUA 2Z1JA 1JKHA 3U3GA 4CK2A 4DQSA 1UA1A 3HO1A 1CZ9A 4R5PA 1QS4A 1CLQA 3JSMA 4Q0BA 3AV9A 1J5OA 3K5OA 4OKKA 4DSFA 4DTRA 5CZ2A 1KRPA 3KTQA 2GUIA 4KRFA 1BI4A 1RDDA 4W5TA 4NYNA 1B92A 1HNIA 1S9GA 4WE1A 4CHOA 2YHAA 2Z1GA 5C24A 3EY1A 1SL0A 3M8SA 3NFAA 3HJFA 1TGOA 3VQPA 3M8RA 3AA5X 4B8CA 5C25A 4KTWA 4N47A 4BDYA 3DRPA 3RMDA 2B5JA 1LAVA 2HNDA 3HPGA 4B9LA 1NJYA 1RT4A 3VQCA 4O5BA 5JS1A 5SWMA 3QNNA 3DYAA 4FLZA 4TSXA 4FJ8A 1C0MA 4CE9A 3AA4A 1KVBA 1GOAA 1S1VA 3DLEA 4HUEA 1LWCA 1RT2A 1NK5A 4DTMA 3VQDA 1U4BA 3KD5E 3RMBA 1U45A 3C94A 1KLMA 1RTHA 4FLVA 4DTPA 3M8PA 4CGHA 4FLYA 1TAUA 3AA3A 3AVIA 1QHTA 4CGDA 1CXQA 4E7HA 3S3NA 3RR7A 3VQAA 2ATQA 1NK8A 4AHVA 1ZBHA 2DTUA 2I5JA 5FDLA 4HTUA 1TKZA 4CGIA 4I7FA 3SUQA 1KFSA 1KCFA 3EZ5A 2IOCA 5J2NA 3KJVA 4KB1A 1BHLA 4OGEA 2HHVA 4LY7A 3SZ2A 3OYNA 2OA8A 3HM9A 2JGUA 1N5YA 1RBVA 1SUQA 1VSFA 3KKRA 4RG8A 5KTQA 3OYAA 2YV0X 3RMAA 2RPIA 1HYSA 1J9AA 4CF8A 1K6YA 3D45A 4B08A 3VN5A 4B9UA 1WLJA 3VQQA 3OYKA 3OY9A 1VRTA 1YTAA 3NCIA 4B9NA 4FZYA 4B3OA 4AHCA 4GMJB 1RT7A 2Q3SA 5SZTA 3CM5A 3HSTB 1TL1A 2F8SA 3DLKA 1BIUA 4FW2A 1RILA 3QERA 3CM6A 2X74A 2G8UA 3B6OA 2XY8A 4J2EA 1C1AA 3CFOA 4RW4A 2OZMA 1ASVA 1IKVA 2QKKA 4H4MA 1R0AA 3SYZA 2HMIA 2HHXA 3LP3A 4AILC 1RNHA 5CYQA 3VQ4A 2GBZA 4LH4A 3ZSZA 3SQ4A 4DSKA 3MXJA 2P51A 4NCAA 4CEQA 4W5RA 2HHUA 2W42A 3SUPA 3S9HA 2VG5A 4H8KA 3TI0A 5J2PA 3SNNA 4CERA 3KK2A 3DLRA 4DU1A 3IG1A 2IC3A 1TK5A 1TV6A 1TVRA 4CIGA 4QAGA 4OKEA 2HVHA 1S5JA 1D9DA 4RW8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XIU A;  4M3U A;  4O4G A;  2HW3 A;  2GV9 A;  2RN2 A;  4CJ5 A;  3TAN A;  3PO5 A;  4DWI A;  1HMV A;  1JXB A;  1WAF A;  4CFB A;  4ZTJ A;  4B9V A;  4HCB A;  4CIE A;  2D0B A;  3QIO A;  4FJ7 A;  4CJF A;  1T05 A;  4KI4 A;  5FRM A;  2YNF A;  3SPZ A;  3WNG A;  4CK1 A;  3RMC A;  4HHT A;  1NJX A;  5J2M A;  4DU4 A;  3S3O A;  4BWM A;  2HB5 A;  4DQI A;  2O4G A;  1B9F A;  3NGZ A;  3RRG A;  3V6D A;  1JLE A;  4CF9 A;  1UWB A;  1WNS A;  5CZ1 A;  4E19 A;  4IKF A;  4PQU A;  3L3U A;  4CFA A;  3NAE A;  2KW4 A;  2Y1J A;  2PY5 A;  1VSE A;  4CIF A;  3E01 A;  3QLH A;  2XHB A;  1BGX T;  3MEG A;  4DS4 A;  4M3T A;  1IKY A;  5K14 A;  3DOK A;  1LWE A;  2YKM A;  5KI6 A;  4I9Q A;  4CEE A;  4C8O A;  4DTJ A;  4CGF A;  4FCY A;  1JL2 A;  1RBT A;  2ITG A;  1LAW A;  3ALY A;  1KVA A;  4BE1 A;  1ZBL A;  1YTU A;  1SKW A;  3L2V A;  5FRN A;  5DK5 A;  4CJW A;  4CEF A;  4DFK A;  3DMJ A;  3KLI A;  3PY8 A;  3FFI A;  4CF1 A;  4F2S A;  3NBP A;  4E0D A;  4YNQ A;  2HHS A;  4AH9 A;  3VQ5 A;  4DTX A;  1QE1 A;  3QEV A;  4HUG A;  3QEP A;  1NKB A;  4DF4 A;  3NHG A;  3ZSX A;  4C8M A;  3T19 A;  3ZSY A;  4CJ4 A;  4BE0 A;  4E3S A;  3TR8 A;  4KHS A;  4O0J A;  3OYJ A;  4EP5 A;  3SV3 A;  3QES A;  2QK9 A;  1HQU A;  4UQG A;  4CHY A;  3AVN A;  3VQ6 A;  3OYB A;  5J2Q A;  5HLF A;  1ITG A;  5HRS A;  3SQ0 A;  1EXQ A;  3ISN C;  2DFF A;  3IRX A;  1RBS A;  3I0S A;  4CJP A;  3AVA A;  2PYJ A;  2OYQ A;  3DI6 A;  5HBM A;  1NK4 A;  3IAY A;  4FYD A;  1RTJ A;  3V9Z A;  4DQR A;  1HQE A;  1RDA A;  1C1C A;  3LZJ A;  4CES A;  4YFU A;  4BAC A;  2KQ2 A;  2IS3 A;  1SKS A;  1TKD A;  3TAQ A;  2KZM A;  2AJQ A;  4K8Z A;  4CHN A;  3K5N A;  3P1G A;  1RTD A;  2HHW A;  3U3Y A;  3ULD A;  4CHP A;  1HYZ A;  2YNI A;  4CEA A;  3CYM A;  3G0Z A;  3O3G A;  3LDS A;  3AO3 A;  3DLG A;  4E7I A;  2E6L A;  1VRU A;  3VQB A;  2E6M A;  1U48 A;  4F3O A;  4BWJ A;  3RWU A;  4M3Y A;  4QCL A;  1J54 A;  2DFE A;  3HP9 A;  1Q8I A;  2XO7 A;  1WSH A;  3ZCM A;  2KFZ A;  2KZZ A;  2FBY A;  3V81 A;  3O4Q A;  3TAG A;  4MFB A;  4JRP A;  1EP4 A;  2ZD1 A;  5JS2 A;  3DRS A;  1L5U A;  1KLN A;  4JS5 A;  3L2W A;  4B9M A;  4O0I A;  1TK8 A;  4FVM A;  3MAQ A;  3OYM A;  3OYF A;  2WOM A;  2A1S A;  3LP2 A;  3QIP A;  1RT6 A;  4RW6 A;  4KHU A;  1X1P A;  3WNE A;  4CJ3 A;  4DLE A;  4CFD A;  3TAR A;  1IO2 A;  3PX4 A;  2DFH A;  1QTM A;  1TAQ A;  3UIQ A;  3PUF A;  4IDK A;  3LP0 A;  3AA2 A;  4E1N A;  4FM1 A;  3SPY A;  4FZX C;  2X78 A;  1ZBI A;  4B9T A;  3HPO A;  2G8K A;  4ELT A;  4BDZ A;  3S3M A;  5HRR A;  1YT3 A;  1KTQ A;  4DSL A;  2QKB A;  5T7B A;  1ZBU A;  3AVC A;  1S1T A;  3P83 D;  3LP1 A;  3WNF A;  1Y97 A;  4FK4 A;  2HHT A;  4Z4C A;  4RW9 A;  3HL8 A;  3NDK A;  1XI1 A;  1JLC A;  3DRR A;  3K2P A;  3V9X A;  2OPP A;  3LAK A;  3F73 A;  3LPT A;  4GW6 A;  4LSN A;  4CGG A;  4W5O A;  3KIO A;  3JYT A;  2B6A A;  3QET A;  1HPZ A;  1LW2 A;  2EHG A;  2QXF A;  3AVF A;  4F8R A;  2WON A;  3OYG A;  1GOB A;  1HJR A;  4OVL A;  3U6F A;  2G8W A;  2HNZ A;  2G8V A;  2OZS A;  1C0T A;  4PY5 A;  3SJJ A;  4DSI A;  3AVJ A;  4IFY A;  4FZZ A;  2X6S A;  5DMR A;  4OPJ A;  3NGY A;  1BIZ A;  4ZTF A;  3H08 A;  4KTQ A;  1EX4 A;  2BDP A;  3HP6 A;  5I42 A;  1REV A;  4KHW A;  1L3U A;  4DTO A;  4N41 A;  3TWH A;  4CEO A;  2OPS A;  3L2Q A;  5D3G A;  4IG0 A;  4OKJ A;  1BCM A;  4Z4I A;  2BAN A;  3ZSQ A;  3T3F A;  2XY7 A;  4KPY A;  1CXU A;  4M41 A;  4EZ6 A;  3HVR A;  4J2B A;  3I8D A;  4M3Z A;  3HPH A;  3TAE A;  1NK7 A;  4BDP A;  3SUO A;  1I39 A;  3OVN A;  2IDO A;  4JLH A;  4LD0 A;  4FJK A;  4Z4H A;  2PZS A;  2JLE A;  2P5O A;  3SQ2 A;  3SV4 A;  3NF8 A;  4EP4 A;  4LSL A;  4KAZ A;  3L3V A;  3SCX A;  1IKX A;  4EZ9 A;  3P5J A;  1I3A A;  2BGG A;  4N5S A;  2DY4 A;  2OPR A;  3WNH A;  2HHQ A;  4DTU A;  2F8T A;  4DTS A;  3LAM A;  1ASU A;  1WSI A;  2VG6 A;  4PUO A;  3HK2 A;  3AO4 A;  4O55 A;  3OYE A;  3SQ1 A;  3OS2 A;  3NF6 A;  4NCB A;  1LW0 A;  2YKN A;  3NF9 A;  2Z1H A;  3LWM A;  3LZI A;  1QSY A;  3PX0 A;  3AO5 A;  1Z26 A;  2YNH A;  4AHT A;  4CED A;  3K5L A;  4DS5 A;  3ZSO A;  1LV5 A;  1A5W A;  2BE2 A;  3VQE A;  4DMN A;  1C0U A;  1WN7 A;  3DOL A;  2KTQ A;  1RTI A;  3LPU A;  3LAN A;  3VA0 A;  1VSM A;  4FLX A;  3PO4 A;  4Q5V A;  3T1A A;  2G8H A;  4G1Q A;  4Y1D A;  3QEI A;  1X9W A;  1L3V A;  3DLB A;  2YNG A;  2LSN A;  4CJV A;  3HT3 A;  1XHZ A;  2Y1I A;  1HYV A;  1JLB A;  3ZT1 A;  4CEB A;  2G8F A;  3THV A;  4M42 A;  3VA3 A;  4KHY A;  3V4I A;  4AHS A;  4ZHR A;  4NCG A;  1NOZ A;  1XHX A;  4FM2 A;  2KFN A;  4CJS A;  2XY5 A;  1FKP A;  3C6T A;  4OGC A;  4OJR A;  3RTV A;  3ZT2 A;  1X9M A;  4I9L A;  4HVJ A;  1WSG A;  1U47 A;  3K57 A;  4FJI A;  2EX3 A;  4ID1 A;  4J2D A;  1IKW A;  2F96 A;  3O3F A;  2OPQ A;  2YHB A;  3V1R A;  4F2R A;  4FJM A;  2A1R A;  1VSD A;  1S6Q A;  2VWK A;  2ZQB A;  5KGW A;  1S9E A;  2O4I A;  4JS4 A;  4DF8 A;  1U49 A;  1WSJ A;  4KKO A;  3K59 A;  4E7L A;  4FJJ A;  4PWD A;  1JXE A;  3RR8 A;  2D0A A;  2FC0 A;  4C8K A;  3O4N A;  3AVB A;  4RW7 A;  4CF0 A;  4B8A B;  3BGR A;  3QO9 A;  5I3U A;  5KRS A;  1QQC A;  3MED A;  1S1U A;  3C95 A;  1RT3 A;  3CFR A;  4E1M A;  4KHN A;  1D9F A;  4O44 A;  4JRQ A;  1GOC A;  5HP1 A;  3M8Q A;  2VWJ A;  4C8N A;  1MU2 A;  3KLG A;  3L2U A;  4M3X A;  2HNY A;  3I0R A;  4KB0 A;  4M3W A;  3MEC A;  4K8X A;  2FBT A;  4H4O A;  1T7P A;  1W0H A;  4KFB A;  2P5G A;  1VSL A;  3KLF A;  3KLH A;  3AVK A;  5HRO A;  1ASW A;  1XWL A;  4QOZ B;  2IGI A;  4IFV A;  4CJE A;  3G10 A;  4Y1C A;  3V1Q A;  4E89 A;  4CK3 A;  3ZT3 A;  4DLG A;  4DFM A;  1N6Q A;  3F9K A;  1WSE A;  3QEW A;  4M3R A;  2X6N A;  1T8E A;  3AO1 A;  3OYI A;  1RT1 A;  2XY6 A;  1BI4 B;  4OLB A;  1SKR A;  1G15 A;  1CZB A;  1DTT A;  1NKC A;  4N76 A;  3KK3 A;  1WAJ A;  1FK9 A;  1VSK A;  4Z4E A;  2D5R A;  4CHQ A;  4FJ5 A;  1Q9Y A;  4MQ3 A;  2VG7 A;  4KI6 A;  1KVC A;  1U04 A;  2FBV A;  3PV8 A;  4F4K A;  1O1W A;  4W5Q A;  4E7K A;  3CG7 A;  3DLH A;  3LWL A;  3TAM A;  4CJL A;  1RCH A;  2RKI A;  1FKO A;  3ZSW A;  3OYH A;  3L2R A;  1WSF A;  1F21 A;  3VQ7 A;  3IS9 A;  3NF7 A;  1TK0 A;  3NH2 A;  4KRE A;  4W5N A;  4IG3 A;  3HVT A;  1UAX A;  4DFJ A;  3PX6 A;  3QNO A;  1JLF A;  4ELV A;  3ZT0 A;  4FK0 A;  4KHQ A;  4FLW A;  4KO0 A;  3CFP A;  1UOC A;  4CEC A;  4CJQ A;  3OYC A;  2B4J A;  2R7Y A;  1BQN A;  3TAB A;  1XC9 A;  1RDC A;  4FJX A;  3SI6 A;  1A5V A;  1QSL A;  1KFD A;  2ZE2 A;  3MEE A;  1NOY A;  1EKE A;  3QEX A;  4DTN A;  3KD1 E;  4F3T A;  3SUN A;  3D0P A;  1JL1 A;  3AVH A;  1ZBF A;  1IH7 A;  4CF2 A;  4FJL A;  4CHZ A;  1T03 A;  4CCH A;  1X9S A;  4FXD A;  3OJS A;  3KK1 A;  4DFP A;  3EYZ A;  4KV8 A;  4KTZ A;  5HRN A;  4AHU A;  4CJK A;  3AVM A;  3A2F A;  3KKS A;  1SL2 A;  1LWF A;  3TAP A;  3V9W A;  1L3T A;  1W9H A;  1VSI A;  1NKE A;  1HNV A;  4IBN A;  4FJG A;  4FK2 A;  1YVU A;  2FBX A;  4PA1 A;  4CJT A;  3ITH A;  5KGX A;  4ICL A;  1D5A A;  3V1O A;  4GVM A;  4BE2 A;  1JLQ A;  3AVG A;  3MXM A;  1NJZ A;  4J2A A;  3LAL A;  3NGI A;  1RT5 A;  1UA0 A;  3V9S A;  1L3S A;  1DTQ A;  4CJU A;  4L8R B;  1Z25 A;  1NK6 A;  4Z4G A;  4FLT A;  1BCO A;  1FXX A;  1VK0 A;  1S6P A;  4CEZ A;  5C42 A;  4OPK A;  3K58 A;  4FM0 A;  4ID5 A;  1C1B A;  3DM2 A;  4LH5 A;  3NH0 A;  1BL3 A;  1VSJ A;  1JLG A;  3L8B A;  2Z1I A;  4DG1 A;  1EET A;  3CQ8 A;  4FJ9 A;  4M45 A;  5HRP A;  3MXI A;  3HYF A;  4CGJ A;  4FW1 A;  3B6P A;  4FLU A;  1ZYQ A;  4C8L A;  4DSJ A;  4Z4F A;  5CY4 A;  4AHR A;  1S1X A;  4I2Q A;  1B9D A;  1QSS A;  4HCC A;  3NE6 A;  2HVI A;  2XRI A;  3ZSV A;  1SL1 A;  1RBR A;  4ELU A;  1KSP A;  3BDP A;  3ZSR A;  1C6V A;  5FRO A;  1VSH A;  1Q9X A;  1RDB A;  2ETJ A;  1IG9 A;  2NUB A;  4I2P A;  3VQ9 A;  2RF2 A;  4B9S A;  3VQ8 A;  3KLE A;  3NH1 A;  3OYD A;  1TKT A;  4NYF A;  3OJU A;  3TAF A;  1D8Y A;  3AO2 A;  4N56 A;  3O3H A;  1TKX A;  4E7J A;  2E4L A;  1NK9 A;  1TL3 A;  1J53 A;  1A5X A;  1BQM A;  1JLA A;  2D0C A;  3ZT4 A;  4DU3 A;  1DLO A;  3ASM A;  3AVL A;  2G8I A;  3RRH A;  1BIS A;  1NK0 A;  5CYM A;  4HUF A;  3QIN A;  4DSE A;  4OLA A;  3C6U A;  3OS0 A;  1SV5 A;  4FJN A;  4Z0U A;  3OYL A;  5EU7 A;  4CJR A;  5E41 A;  4DQP A;  5KRT A;  2IAJ A;  4FJH A;  3HXM A;  1NJW A;  3V9U A;  2PYL A;  4CFC A;  1S1W A;  3K5M A;  1HRH A;  2P1J A;  4DQQ A;  3OS1 A;  5J1E A;  1RBU A;  2Z1J A;  1JKH A;  3U3G A;  4CK2 A;  4DQS A;  1UA1 A;  3HO1 A;  1CZ9 A;  4R5P A;  1QS4 A;  1CLQ A;  3JSM A;  4Q0B A;  3AV9 A;  1J5O A;  3K5O A;  4OKK A;  4DSF A;  4DTR A;  5CZ2 A;  1KRP A;  3KTQ A;  2GUI A;  4KRF A;  1BI4 A;  1RDD A;  4W5T A;  4NYN A;  1B92 A;  1HNI A;  1S9G A;  4WE1 A;  4CHO A;  2YHA A;  2Z1G A;  5C24 A;  3EY1 A;  1SL0 A;  3M8S A;  3NFA A;  3HJF A;  1TGO A;  3VQP A;  3M8R A;  3AA5 X;  4B8C A;  5C25 A;  4KTW A;  4N47 A;  4BDY A;  3DRP A;  3RMD A;  2B5J A;  1LAV A;  2HND A;  3HPG A;  4B9L A;  1NJY A;  1RT4 A;  3VQC A;  4O5B A;  5JS1 A;  5SWM A;  3QNN A;  3DYA A;  4FLZ A;  4TSX A;  4FJ8 A;  1C0M A;  4CE9 A;  3AA4 A;  1KVB A;  1GOA A;  1S1V A;  3DLE A;  4HUE A;  1LWC A;  1RT2 A;  1NK5 A;  4DTM A;  3VQD A;  1U4B A;  3KD5 E;  3RMB A;  1U45 A;  3C94 A;  1KLM A;  1RTH A;  4FLV A;  4DTP A;  3M8P A;  4CGH A;  4FLY A;  1TAU A;  3AA3 A;  3AVI A;  1QHT A;  4CGD A;  1CXQ A;  4E7H A;  3S3N A;  3RR7 A;  3VQA A;  2ATQ A;  1NK8 A;  4AHV A;  1ZBH A;  2DTU A;  2I5J A;  5FDL A;  4HTU A;  1TKZ A;  4CGI A;  4I7F A;  3SUQ A;  1KFS A;  1KCF A;  3EZ5 A;  2IOC A;  5J2N A;  3KJV A;  4KB1 A;  1BHL A;  4OGE A;  2HHV A;  4LY7 A;  3SZ2 A;  3OYN A;  2OA8 A;  3HM9 A;  2JGU A;  1N5Y A;  1RBV A;  1SUQ A;  1VSF A;  3KKR A;  4RG8 A;  5KTQ A;  3OYA A;  2YV0 X;  3RMA A;  2RPI A;  1HYS A;  1J9A A;  4CF8 A;  1K6Y A;  3D45 A;  4B08 A;  3VN5 A;  4B9U A;  1WLJ A;  3VQQ A;  3OYK A;  3OY9 A;  1VRT A;  1YTA A;  3NCI A;  4B9N A;  4FZY A;  4B3O A;  4AHC A;  4GMJ B;  1RT7 A;  2Q3S A;  5SZT A;  3CM5 A;  3HST B;  1TL1 A;  2F8S A;  3DLK A;  1BIU A;  4FW2 A;  1RIL A;  3QER A;  3CM6 A;  2X74 A;  2G8U A;  3B6O A;  2XY8 A;  4J2E A;  1C1A A;  3CFO A;  4RW4 A;  2OZM A;  1ASV A;  1IKV A;  2QKK A;  4H4M A;  1R0A A;  3SYZ A;  2HMI A;  2HHX A;  3LP3 A;  4AIL C;  1RNH A;  5CYQ A;  3VQ4 A;  2GBZ A;  4LH4 A;  3ZSZ A;  3SQ4 A;  4DSK A;  3MXJ A;  2P51 A;  4NCA A;  4CEQ A;  4W5R A;  2HHU A;  2W42 A;  3SUP A;  3S9H A;  2VG5 A;  4H8K A;  3TI0 A;  5J2P A;  3SNN A;  4CER A;  3KK2 A;  3DLR A;  4DU1 A;  3IG1 A;  2IC3 A;  1TK5 A;  1TV6 A;  1TVR A;  4CIG A;  4QAG A;  4OKE A;  2HVH A;  1S5J A;  1D9D A;  4RW8 A; 
#chains in the Genus database with same CATH topology
 4I6M A;  2HW3 A;  1G99 A;  1NU0 A;  3TAN A;  1HMV A;  4ZTJ A;  2GWJ A;  4CFB A;  4HCB A;  3BZK A;  4H0X B;  4KI4 A;  4CJF A;  3SPZ A;  3WNG A;  4CK1 A;  3RMC A;  5J2M A;  4BWM A;  4AQY K;  3NGZ A;  3GE1 A;  1UWB A;  4E19 A;  2FSK A;  4IKF A;  3NAE A;  4H5T A;  3VEY A;  1VSE A;  3K9K A;  4DR5 K;  3C7N A;  1RBT A;  3LM9 A;  1YTU A;  1S72 N;  3BY5 A;  3FFI A;  4F2S A;  4EFH A;  3NBP A;  4E0D A;  4DTX A;  4WFB L;  4DF4 A;  4BE0 A;  3ID8 A;  3OYJ A;  4EP5 A;  3VGK A;  4LF4 K;  4BR5 A;  2QK9 A;  4BY9 C;  3AVN A;  3O6W A;  5AQZ A;  2OCE A;  4G9Z A;  3QBX A;  4JI8 K;  4CZM A;  3CER A;  2PYJ A;  5GAD P;  4FYD A;  3TTF A;  4BAC A;  4YFU A;  1TKD A;  3H1V X;  1RTD A;  5C2F A;  4BRK A;  3I33 A;  4E7I A;  3LDS A;  1VRU A;  4F3O A;  4M3Y A;  5JVG L;  3ZCM A;  3OBY A;  4MFB A;  5C15 A;  1EP4 A;  5JS2 A;  1KLN A;  4FVM A;  3QIP A;  4LC9 B;  3MWT A;  4FM1 A;  4IDK A;  4B9T A;  2VQF K;  4MLH A;  3S3M A;  5T7B A;  1ZBU A;  1S1T A;  4L3Q A;  3DWL A;  4CBU A;  4Z4C A;  4RW9 A;  1NJI O;  3NDK A;  3THW B;  3LAK A;  3LPT A;  4CGG A;  4W5O A;  3KIO A;  3JYT A;  1NLV A;  1HPZ A;  2IVN A;  2QXF A;  3QDK A;  5M1N A;  4F8R A;  1GOB A;  3U6F A;  1C0T A;  4BRF A;  1ATN A;  3SJJ A;  4FZZ A;  3CJB A;  3WQT A;  4ZTF A;  3H08 A;  3SAF A;  2P9K A;  5M1P A;  1QZ6 A;  2UXD K;  1ZBS A;  5I42 A;  1REV A;  1L3U A;  5AFU A;  4JK8 A;  4H0V B;  3VOV A;  3O08 A;  2YX6 A;  1S3X A;  4XEI A;  4CEO A;  5KPT A;  2OPS A;  3CCV N;  5E84 A;  4OKJ A;  1VQO N;  4Z4I A;  3D2F B;  4JV5 K;  5KQD A;  2NRT A;  4M41 A;  2F9T A;  3HZ6 A;  2JLE A;  4JI4 K;  3B8A X;  3NF8 A;  4KAZ A;  3L3V A;  3SCX A;  2A40 A;  3P5J A;  1I3A A;  4N5S A;  1NGF A;  3FE1 A;  3R1X A;  1OVQ A;  4DTS A;  3LAM A;  4O5F A;  1ASU A;  4WQ4 A;  3OS2 A;  3LL3 A;  2FF3 B;  1H1V A;  2HBL A;  4DS5 A;  2YNH A;  4CED A;  4GNI A;  4JKG B;  3A5N C;  1C0U A;  2KTQ A;  1RTI A;  3LAN A;  3VA0 A;  1VQN N;  3TSQ A;  2V7Y A;  4G1Q A;  4Y1D A;  2ZJQ L;  3THY A;  2HHH K;  2Y1I A;  4CEB A;  3RSE A;  2Q1N A;  4AHS A;  4NCG A;  2KFN A;  3A5O C;  4OGC A;  1BU6 O;  3ZT2 A;  2VWB A;  2FF6 A;  4HVJ A;  4FJI A;  2FSN A;  4J2D A;  4F2R A;  2ZQB A;  4JS4 A;  4IOX A;  1HJO A;  1WSJ A;  4KKO A;  4B3S K;  2QWL A;  3O9S A;  3AVB A;  5I3U A;  2ITM A;  5KRS A;  2BUP A;  1BO5 O;  3C95 A;  4WCE L;  1N8R O;  4KHN A;  3QFP A;  4O44 A;  2HST A;  4YOY A;  3PIP L;  3KLG A;  3L2U A;  2P9P B;  3I0R A;  2YCH A;  4KB0 A;  4EIA A;  4K8X A;  4BQZ A;  4WYB A;  1W0H A;  3AVK A;  1ASW A;  1XWL A;  2IGI A;  4DB3 A;  4IFV A;  1T3V A;  3G10 A;  3VEO A;  3V1Q A;  4E89 A;  4CK3 A;  1NGH A;  3O1W A;  3CQX A;  1BI4 B;  1NKC A;  4Z4E A;  2VQE K;  3FZM A;  4KI6 A;  2VG7 A;  5FPD A;  4JI7 K;  4F4K A;  3QB0 A;  4DCH A;  2GWK A;  3ZX3 A;  2P9S B;  3L2R A;  1WSF A;  1F21 A;  5F2R A;  3EO3 A;  3ULE B;  4FOE A;  3FZK A;  4ELV A;  3ZT0 A;  4KHQ A;  2CGJ A;  4KO0 A;  4YOU A;  4CEC A;  3CFP A;  4FLW A;  2G8K A;  2B4J A;  3TAB A;  3SI6 A;  2ZE2 A;  3SMP A;  4F3T A;  1IH7 A;  4CJK A;  3AVM A;  1VQ8 N;  1VSI A;  4IBN A;  5KGX A;  2GUP A;  2NRV A;  4JEP A;  3V1O A;  4GVM A;  4BE2 A;  3AVG A;  4YOR A;  3ATU A;  3V9S A;  4L8R B;  4FLT A;  1BCO A;  3M6G A;  1VK0 A;  3FZH A;  4FM0 A;  2GEL A;  3L8B A;  2GEM A;  4DG1 A;  4Z4F A;  2P9U B;  4YOV A;  2HVI A;  1TYQ A;  1VQ5 N;  3GDQ A;  5F1X A;  1RBR A;  3ZSR A;  4BVP A;  1IG9 A;  3PSI A;  4NYF A;  1TKX A;  1NK9 A;  4FJ5 A;  1J53 A;  4JKE A;  1BQM A;  1JLA A;  5BRF A;  3AVL A;  4H0Y B;  1VQ9 N;  4V19 S;  4DSE A;  4X65 K;  3THX A;  4CJR A;  5KRT A;  3WEE B;  1OH6 A;  4FJH A;  3HXM A;  4BRH A;  4MDB A;  4BR0 A;  4CBX A;  1HRH A;  4WQ5 A;  5J1E A;  1RBU A;  4DQS A;  4AM6 A;  1NMD A;  1U2V B;  4YDU A;  4LF7 K;  1J5O A;  3P39 A;  5BPL A;  1HNI A;  5AR0 A;  3C7N B;  3CJ1 A;  4RCH A;  3M1F A;  4CHO A;  3THW A;  1SL0 A;  3NFA A;  3MX5 A;  4WQ4 C;  4PKI A;  2JWL A;  5A2Q O;  1LAV A;  2HND A;  3HPG A;  1NJY A;  1RT4 A;  3EL2 A;  5SWM A;  3QNN A;  4CE9 A;  3AA4 A;  3QFU A;  2W6L A;  1R59 O;  3KD5 E;  1RT2 A;  3VQD A;  4C1N I;  4CGH A;  1TAU A;  3AA3 A;  1ESV A;  3RR7 A;  5AQK A;  1NK8 A;  4AHV A;  1ZBH A;  4JI3 K;  4B1V A;  1KXP A;  2RHK A;  4I7F A;  3PIO L;  1WBB A;  1SAZ A;  2Q0U A;  1VQP N;  1N36 K;  4BRI A;  4BRG A;  3G4S N;  3DXK B;  3EEQ A;  3WXI A;  3HM9 A;  1RBV A;  3VER A;  1SUQ A;  4ILG B;  2O8E A;  1K6Y A;  3D45 A;  2E1Y A;  3CCE N;  1WLJ A;  1D4X A;  1YTA A;  3OY9 A;  4AHC A;  5SZT A;  4A57 A;  1EWQ A;  1KAX A;  3HST B;  5M1F A;  3VEZ A;  2HF3 A;  3CFO A;  5AJ3 K;  1HUX A;  1NMN A;  2Q2R A;  5BPN A;  2O8F B;  2P51 A;  5DM7 L;  4CEQ A;  1P8Z A;  5EX5 A;  3SNN A;  4CER A;  2O8C A;  3H1Q A;  4X62 K;  3M5R A;  1NGI A;  1W2B M;  4KH6 A;  4NXN K;  4M3U A;  4CJ5 A;  1BOT O;  2RN2 A;  4GVE A;  4KH4 A;  1JXB A;  4B9V A;  2D0B A;  5FRM A;  1XNR K;  1BA0 A;  1IBK K;  4HHT A;  3E9P A;  3S3O A;  2O4G A;  1B9F A;  5TKY A;  2QI2 A;  3V6D A;  1JLE A;  2WC9 A;  4CFA A;  2O8D B;  2PY5 A;  2FLO A;  1IKY A;  3DOK A;  3BZC A;  1JL2 A;  2A5X A;  1KVA A;  3ALY A;  2A42 A;  3VF4 A;  2NLX A;  4B1U B;  4GV6 A;  5FRN A;  3MN6 A;  2KHO A;  4DFK A;  3DMJ A;  3KLI A;  3PY8 A;  4DR1 K;  1QQO A;  4K41 A;  3VQ5 A;  4AH9 A;  1T6D A;  3QEV A;  5AQX A;  4HUG A;  3QEP A;  1GLB G;  3ZSX A;  4C8M A;  3IUC A;  4UY8 O;  1NWK A;  4A5A A;  4H5R A;  1KAZ A;  3L6Q A;  3SQ0 A;  4LFC K;  4CJP A;  1N34 K;  5CE3 A;  2OYQ A;  1E3M A;  3PLA A;  2W6K A;  1RTJ A;  5JMV A;  1RDA A;  2P9S A;  4CES A;  1SKS A;  2KQ2 A;  2IS3 A;  2UUB K;  2E2N A;  3OA9 A;  2UYT A;  3U3Y A;  4LFB K;  3ULD A;  2YNI A;  3CYM A;  2E6L A;  1U48 A;  2E6M A;  4BWJ A;  2HF4 A;  3HP9 A;  3JXU A;  3UKR B;  2XO7 A;  2KFZ A;  4LF9 K;  3V81 A;  3TAG A;  4JRP A;  1TK8 A;  3OYF A;  2Q0R A;  4FWQ A;  2A1S A;  4MO4 A;  1NGJ A;  1Z05 A;  3WNE A;  4CJ3 A;  3PX4 A;  3DAW A;  3PUF A;  3AA2 A;  4FZX C;  2IVP A;  2AA4 A;  4BC2 A;  4CZH A;  4WQ5 C;  1QVF M;  4DSL A;  1BUP A;  1YJW N;  3WNF A;  4YDU C;  3A5M C;  2HHT A;  4NB4 A;  3V9X A;  1EWR A;  3MCP A;  3F73 A;  2HMP A;  1ATS A;  2EHG A;  3AVF A;  2OTL N;  4DR7 K;  4OVL A;  1JCF A;  2OZS A;  4PY5 A;  4DSI A;  5BN8 A;  2P9U A;  3T69 A;  1GLE G;  3NGY A;  1Q18 A;  3HP6 A;  4DTO A;  4XH4 A;  3P4I A;  4N41 A;  3TWH A;  3G6E N;  3S41 A;  5D3G A;  1BCM A;  2XY7 A;  4KPY A;  1CXU A;  4H0O A;  3HPH A;  3TAE A;  3SUO A;  3OVN A;  2IDO A;  4LD0 A;  2PBD A;  3WEE A;  4LSL A;  4FWR A;  3TTC A;  5KQ8 A;  2HHQ A;  4DQ8 A;  1U2V A;  1O13 A;  1NBW A;  2VG6 A;  3AO4 A;  4IFE A;  2OAN A;  4H0P A;  4NCB A;  1LW0 A;  4ILJ A;  1ZC6 A;  3EZW A;  3VQE A;  3O9R A;  1VSM A;  4H5N A;  1K9M O;  4Q5V A;  3QEI A;  1L3V A;  2YNG A;  3HT3 A;  1XHZ A;  1HYV A;  3ZT1 A;  4AF1 A;  4M42 A;  1VQK N;  4JKC A;  4KHY A;  3A5L C;  1XHX A;  4NLC A;  3RTV A;  1U47 A;  3K57 A;  4O8K A;  2EX3 A;  4OPA A;  1IKW A;  2YHB A;  2NRW A;  1TYQ B;  1VSD A;  4XH1 A;  1S6Q A;  4PL7 A;  4IOA L;  5KGW A;  2E2Q A;  2P9L B;  3FGU A;  3NVM A;  1U49 A;  3K59 A;  4FJJ A;  1JXE A;  3DXK A;  4C8K A;  3HOS A;  3VMF B;  3LM2 A;  3OBW A;  3RVC A;  2ZM6 K;  3CFR A;  3M8Q A;  2VWJ A;  4C8N A;  1MU2 A;  4M3X A;  2HNY A;  3K9J A;  3THX B;  3HTV A;  4KFB A;  2UU9 K;  5AQQ A;  2QWN A;  4FWM A;  3M3Z A;  1YI2 N;  4BR2 A;  2PAV A;  3U9D A;  4U7B A;  3GBT A;  4FWO A;  4DLG A;  4DFM A;  3CCQ N;  1KD1 O;  2O8F A;  3NMU A;  4M3R A;  2X6N A;  3OYI A;  4OLB A;  3WT0 A;  4PKH A;  1DTT A;  4YOT A;  4N76 A;  1WAJ A;  4C1N K;  4MQ3 A;  4BR9 A;  1U04 A;  2FBV A;  4JNE A;  3PV8 A;  5HOO A;  2RKI A;  4WFA L;  3U8X A;  3IS9 A;  4A2B A;  4W5N A;  4DFJ A;  3PX6 A;  4IEI A;  1UOC A;  4CJQ A;  1X9J A;  2R7Y A;  1BQN A;  1RDC A;  1QSL A;  4BQL A;  5JIC A;  4DV1 K;  3QEX A;  4DTN A;  1BG3 A;  4LFA K;  4GKJ K;  1JL1 A;  2O8D A;  1SQK A;  1RGI A;  4CHZ A;  5AZI A;  1T03 A;  4CCH A;  4FXD A;  5BPM A;  5AFU H;  4KTZ A;  5HRN A;  2OTJ N;  1LWF A;  5B8H A;  3V9W A;  4H5W A;  1NKE A;  3TPQ A;  5AQY A;  1YVU A;  4PA1 A;  3SBG A;  3ITH A;  4AM7 A;  2KKZ A;  1D5A A;  2Q31 A;  1NJZ A;  4J2A A;  1IG8 A;  2O8E B;  3CJA A;  3GL1 A;  1UA0 A;  4CZJ A;  4LF5 K;  1L3S A;  1DTQ A;  4BR4 A;  1NGC A;  2WUS A;  1NK6 A;  4EHU A;  3J7Y P;  2Q36 A;  1FXX A;  4CEZ A;  3K58 A;  4ID5 A;  1C1B A;  3DM2 A;  5BRH A;  1JLG A;  3E66 A;  3CQ8 A;  4M45 A;  4CGJ A;  4FW1 A;  4AHR A;  2W41 A;  1QSS A;  5HL7 L;  5H1S Q;  3ZSV A;  1DKG D;  4ELU A;  3TTD A;  4EAH D;  1QVG M;  5AQN A;  3VQ9 A;  3VQ8 A;  3KLE A;  3AO2 A;  2O8C B;  3L0Q A;  3CI5 A;  4E7J A;  3ZT4 A;  3OHR A;  2WTU A;  1DLO A;  3ASM A;  3RRH A;  1BIS A;  5CYM A;  3UKR A;  1K8A O;  2QWQ A;  4OLA A;  2GTD A;  3OS0 A;  5AQM A;  1SV5 A;  4FJN A;  3OYL A;  4DV0 K;  3E9L A;  1NJW A;  3K5M A;  1MA9 B;  2Z1J A;  3U3G A;  3VGL A;  1CZ9 A;  1QS4 A;  1FJG K;  4R79 A;  4B1W B;  2E1Z A;  4JI0 K;  1OH5 A;  4DSF A;  5CZ2 A;  3MN9 A;  4QS9 A;  5FPN A;  1S9G A;  4WE1 A;  5AQS A;  3EY1 A;  5AQR A;  3HJF A;  1TGO A;  4B8C A;  2Q97 A;  4RWT A;  4JI5 K;  2E5L K;  4KTW A;  3BP8 A;  3FLC O;  1HNX K;  5DM6 L;  4B9L A;  2NRH A;  1N32 K;  3VQC A;  5JS1 A;  4FLZ A;  3GG4 A;  4TSX A;  4FJ8 A;  2NZT A;  4B1Y B;  1GOA A;  1LWC A;  3ZEU B;  4DTM A;  1Q82 O;  1KLM A;  4FLV A;  3UKU B;  4YOW A;  4FLY A;  2F9W A;  4E7H A;  2O8B A;  1DT9 A;  1WOQ A;  2ATQ A;  2DTU A;  2I5J A;  5FDL A;  2HBK A;  1NGG A;  3W3D A;  1KFS A;  2YHY A;  1KCF A;  2IOC A;  5J2N A;  5AQJ A;  4C23 A;  5JLF A;  1BHL A;  2KLA A;  3AGK A;  4LY7 A;  2QWR A;  3SZ2 A;  1N5Y A;  2JGU A;  2AP1 A;  3OYA A;  3KKR A;  4GY2 B;  4JK9 A;  4RG8 A;  2YV0 X;  5M1Q A;  4BC3 A;  1HYS A;  4CF8 A;  2NRX A;  3VN5 A;  2A41 A;  3OYK A;  4B9N A;  1VRT A;  4FZY A;  4GMJ B;  1RT7 A;  3CM5 A;  1YJ9 N;  1TL1 A;  3DLK A;  4FW2 A;  3CM6 A;  4ISF A;  3ID6 A;  3JAM O;  4YOX A;  4RW4 A;  4H4M A;  1R0A A;  3SYZ A;  1XC3 A;  3EE9 A;  4AIL C;  1MWM A;  1RNH A;  5CYQ A;  3VQ4 A;  3ZSZ A;  3SMS A;  4NCA A;  3SUP A;  2VG5 A;  4A59 A;  4FO0 A;  4DU1 A;  3DLR A;  3IG1 A;  3I55 N;  2I7N A;  1TV6 A;  3MX2 A;  4OKE A;  4ILH A;  2V51 B;  1QQN A;  3CCM N;  2GV9 A;  1QZ5 A;  4CJ7 A;  2CH5 A;  3QIO A;  4FJ7 A;  2YNF A;  4FL9 A;  1NJX A;  4DU4 A;  2HB5 A;  2P9L A;  2E2P A;  3RRG A;  4J8F A;  1WNS A;  5EOY A;  4FPA A;  1YIJ N;  3QLH A;  2XHB A;  4DV2 K;  3MEG A;  4DS4 A;  4M3T A;  3UE5 A;  1LWE A;  2YKM A;  4I9Q A;  5I9E B;  4CEE A;  4C8O A;  4DTJ A;  4FCY A;  5M1K A;  2ITG A;  4WFN L;  4CJW A;  4M7Y A;  3VET A;  3D2E A;  4CEF A;  4B3R K;  2I7P A;  4CF1 A;  2HHS A;  3BF3 A;  1X3M A;  2WFB A;  1QE1 A;  1YXQ A;  1NKB A;  3P38 A;  3VEW A;  4MO5 A;  3ENH A;  3T19 A;  1Q81 O;  1CZA N;  3TR8 A;  1GLC G;  4O0J A;  1ZXO A;  1HQU A;  3ZLJ A;  5J2Q A;  3OYB A;  1ITG A;  5HRS A;  3ISN C;  4QS8 A;  3CCS N;  3R6M A;  3AVA A;  1QQM A;  4X66 K;  4DQR A;  3LZJ A;  1C1C A;  3SBT A;  2KZM A;  2AJQ A;  1NGD A;  3P1G A;  3CCL N;  2HHW A;  3P31 A;  4BRE A;  3I56 N;  1HYZ A;  4CEA A;  3G0Z A;  2ZJR L;  3O3G A;  3N4P A;  3DLG A;  4QCL A;  2J4R A;  3RWU A;  4CZL A;  3A8Y A;  1Q8I A;  3J8A A;  4DUZ K;  2UUA K;  5AQG A;  3VEV A;  3DRS A;  1L5U A;  3L2W A;  4IOC L;  1Z6R A;  3OYM A;  4BRC A;  2WOM A;  3LP2 A;  4RW6 A;  3CCU N;  1X1P A;  2HBJ A;  2WBN A;  1XQS C;  3NVK A;  1TAQ A;  4MLE A;  3LP0 A;  5ADX A;  3SPY A;  4NO7 A;  1I94 K;  1ZBI A;  1IBL K;  4ELT A;  1KTQ A;  3AVC A;  3P83 D;  4DR4 K;  3CF5 L;  3K2P A;  2CGL A;  4GW6 A;  4LSN A;  4IEE A;  2E88 A;  3J7A P;  3HI0 A;  1LW2 A;  1HKC A;  3HSC A;  5CHI A;  2WON A;  3OYG A;  3J80 O;  2G8V A;  4B9Q A;  1N33 K;  5MLC Q;  4IFY A;  2D0P A;  5DMR A;  1BIZ A;  3VGM A;  4JI1 K;  1EX4 A;  3PSF A;  4JI2 K;  3WXJ A;  1E4G T;  3BUZ B;  3TSP A;  5C2D A;  5AQV A;  3C6H A;  1ILY A;  4JKB A;  4OX9 K;  4JAX A;  2BAN A;  3T3F A;  3CMA N;  3C0B A;  4BRO A;  3HVR A;  4EZ6 A;  1U6Z A;  1NK7 A;  1RFQ A;  1I39 A;  4JLH A;  4FJK A;  4DV7 K;  4Z4H A;  2PZS A;  1T44 A;  2W40 A;  2P5O A;  5GAG P;  3H3O B;  3SQ2 A;  1DGK N;  3SV4 A;  4EP4 A;  2VCP A;  3D7E O;  2QWO A;  5GIP A;  2ZGZ A;  2BGG A;  2DY4 A;  3WNH A;  1XNQ K;  1MDU B;  1DEJ A;  4E1J A;  4K25 A;  1WSI A;  5C12 A;  5AZI B;  1NGA A;  3HK2 A;  3SQ1 A;  3NF6 A;  1K73 O;  3Q7B A;  4BRD A;  3LZI A;  1QSY A;  5GAE P;  3PX0 A;  1KQS M;  4AHT A;  2QW9 A;  1NG9 A;  2YJE A;  2BE2 A;  4FLX A;  3T1A A;  4KHP K;  5C10 A;  3T1Y K;  3MN7 A;  4QS7 A;  4A61 A;  3CD6 N;  1OKJ A;  4ZHR A;  1NOZ A;  3ZEU A;  1IBM K;  2XY5 A;  3UKU A;  4OJR A;  3VTI A;  5TKW A;  3IFR A;  3LDQ A;  1YIT N;  3O3F A;  2F96 A;  2OPQ A;  2QEX N;  1S9E A;  2O4I A;  2IVO A;  5LL6 Z;  3H45 C;  5EVZ A;  1GLD G;  4PWD A;  4E7L A;  2D0A A;  5ELZ A;  5BRE A;  2NRZ A;  3BGR A;  3MN5 A;  4B3T K;  4JK7 A;  3MED A;  2CGK A;  1GLA G;  4E1M A;  1D9F A;  4JRQ A;  4HTL A;  5HP1 A;  1IV0 A;  1MWK A;  4H4O A;  2ZWH A;  2P5G A;  1VSL A;  3KLF A;  4DR6 K;  5HRO A;  5FPE A;  3G71 N;  4Y1C A;  1GLL O;  1N6Q A;  1BA1 A;  4Y0W A;  1SZ2 A;  1WSE A;  1T8E A;  3AO1 A;  2XY6 A;  3IMX A;  1BDG A;  1SKR A;  1CZB A;  4JD2 A;  3KK3 A;  2D5R A;  4CHQ A;  1Q9Y A;  1VQM N;  1KVC A;  1O1W A;  4W5Q A;  3CG7 A;  3TAM A;  1RCH A;  3OYH A;  4JHD B;  3H46 O;  3NF7 A;  1TK0 A;  4KRE A;  2QTD A;  3HVT A;  4IG3 A;  4BVO A;  3QNO A;  5EY4 A;  4FK0 A;  3VES A;  2G8F A;  4FJX A;  1XC9 A;  1KFD A;  3MEE A;  4LF8 K;  1NOY A;  3KD1 E;  3SUN A;  3D0P A;  1ZBF A;  2O8B B;  4CF2 A;  4H03 B;  4IXC A;  3OJS A;  3KK1 A;  4FWS A;  3EYZ A;  4KV8 A;  4AHU A;  3KKS A;  1XMO K;  4LF6 K;  3TAP A;  3SAH A;  4BR7 A;  4EHT A;  5IT9 O;  2PFU A;  1HNV A;  3EKU A;  5FPM A;  4FJG A;  3QML A;  2CH6 A;  4ICL A;  3MXM A;  3CJC A;  1RT5 A;  4CJU A;  1Z25 A;  4Z4G A;  1M1K O;  1JCG A;  5BRD A;  4K0K K;  4KH5 A;  2Z1I A;  3T7Z A;  4FJ9 A;  1ZYQ A;  3B6P A;  4O8U A;  1J5E K;  5CY4 A;  3O9Q A;  3TU5 A;  4BRA A;  1KSP A;  2BTF A;  3BDP A;  1C6V A;  3H6E A;  1VSH A;  2E8A A;  5FRO A;  1Q9X A;  4I2P A;  4B9S A;  2RF2 A;  1D8Y A;  4YHH K;  3NH1 A;  1TKT A;  3OYD A;  3OJU A;  3TAF A;  4N56 A;  3O3H A;  1X3N A;  1A5X A;  4DU3 A;  1EQY A;  4HUF A;  3CET A;  4A2A A;  2PYL A;  4CFC A;  1YAG A;  3AGR A;  3HO1 A;  4CVN E;  2DPN A;  1WB9 A;  3SJH A;  1VQ6 N;  4Q0B A;  1YJN N;  4OKK A;  5AQW A;  1KRP A;  3C6A A;  3KTQ A;  2GUI A;  4YY3 K;  3SK3 A;  1RDD A;  1EO1 A;  1B92 A;  3WQU A;  4GV3 A;  3F9M A;  5C24 A;  3M8S A;  2UXC K;  3LDP A;  3VQP A;  3AA5 X;  5C25 A;  2BH1 A;  3U9Z A;  4N47 A;  3CHW A;  3D2E B;  3W0L A;  4BRN A;  3DYA A;  5E26 A;  1KVB A;  3DLE A;  2HOE A;  1NK5 A;  3J81 O;  1U4B A;  3H3N O;  3VF2 A;  4DTP A;  4KBO A;  1RTH A;  3DLL L;  3M8P A;  1KAY A;  3AVI A;  1HLU A;  4HTU A;  3SUQ A;  5AQT A;  3EZ5 A;  3D6R A;  4KB1 A;  3VEX A;  2OA8 A;  5BN9 A;  1YUW A;  1GLJ O;  5KTQ A;  3RMA A;  3DXM B;  4HWI A;  4FPB A;  5GIN A;  5BR9 A;  4B9U A;  3VQQ A;  3NCI A;  3QIC A;  3MWP A;  2F8S A;  1JJ2 M;  3QER A;  3K0S A;  2X74 A;  2G8U A;  1HR0 K;  2XY8 A;  4JI6 K;  4FOI A;  2OZM A;  2P9N A;  4DUY K;  1IKV A;  2QKK A;  2HHX A;  3KWG A;  2JWK A;  3LDO A;  3UB5 A;  3O4W A;  2GBZ A;  4DSK A;  4BGA A;  4W5R A;  4PL8 A;  1TUY A;  2F7T A;  3MCA B;  3KK2 A;  5LJV A;  4BG8 A;  2IC3 A;  3O5B A;  1TK5 A;  1TVR A;  4CZK A;  3CC7 N;  2HVH A;  1D9D A;  3VPZ A;  4RW8 A;  4F9O A;  4XIU A;  4O4G A;  1M90 O;  3PO5 A;  4DWI A;  2GX9 A;  1WAF A;  3L4I A;  4CIE A;  3MMV A;  1T05 A;  3JS6 A;  5LMU K;  2V7Z A;  4BRQ A;  4B1X B;  4DQI A;  4NXM K;  4JKF A;  4DR3 K;  4BG9 A;  3A0I X;  2FSJ A;  3HOT A;  4CF9 A;  5CZ1 A;  4PQU A;  3L3U A;  4IZ9 A;  2KW4 A;  2Y1J A;  2D0O A;  4CIF A;  3E01 A;  3R3L A;  3SLC A;  1BGX T;  5K14 A;  2P9I B;  5KI6 A;  3LDL A;  3ATV A;  4CGF A;  2YHX A;  1LAW A;  3GOI A;  4BE1 A;  2E20 A;  4DR2 K;  1ZBL A;  1SKW A;  3L2V A;  1HNZ K;  5DK5 A;  2VYP A;  4DV6 K;  4PHT X;  3BEX A;  5AQH A;  4YNQ A;  2ZGY A;  3ENO A;  1YF5 L;  3NHG A;  4GV9 A;  3ZSY A;  4CJ4 A;  3ZYY X;  4E3S A;  4KHS A;  3CC2 N;  1RDW X;  3SV3 A;  3QES A;  4UQG A;  1JCE A;  4CHY A;  3VQ6 A;  5HLF A;  5AQO A;  1IJJ A;  1EXQ A;  3CQY A;  2DFF A;  3IRX A;  3MDQ A;  3CXC M;  1RBS A;  3I0S A;  5GAH P;  3DI6 A;  5HBM A;  1NK4 A;  3IAY A;  3V9Z A;  3MK6 A;  1HQE A;  4JHD A;  5GIO A;  3TAQ A;  4K8Z A;  4CHN A;  3K5N A;  3F5T A;  4NLB A;  2ZF5 O;  4CHP A;  3E9O A;  3AO3 A;  3CME N;  3VQB A;  4ISE A;  1J54 A;  2DFE A;  1VQ7 N;  3Q7C A;  1WSH A;  2KZZ A;  3IDH A;  2FBY A;  4K42 A;  3O4Q A;  1T6C A;  2ZD1 A;  4DV3 K;  4BRL A;  4JS5 A;  4B9M A;  4O0I A;  3AAP A;  3ZX2 A;  5FLX O;  3MAQ A;  1K8K B;  1RT6 A;  4KHU A;  2ASM A;  4DLE A;  4CFD A;  3TAR A;  1IO2 A;  4CZF A;  1QTM A;  2DFH A;  3UIQ A;  2D1K A;  4E1N A;  2FXU A;  3J7Z O;  3TSU A;  3IKM A;  2X78 A;  3HPO A;  4BGB A;  4BDZ A;  2QKB A;  5HRR A;  1YT3 A;  4FVU A;  3LP1 A;  4FK4 A;  1Y97 A;  5AZJ B;  3HL8 A;  3T1H K;  1XI1 A;  1JLC A;  3DRR A;  2OPP A;  4RTF D;  4BRM A;  3VTH A;  2B6A A;  3QET A;  3KK7 A;  4H5V A;  1HJR A;  2G8W A;  2HNZ A;  1QHA A;  3AVJ A;  2X6S A;  1Y64 A;  4OPJ A;  3KWI A;  3FFK B;  4KTQ A;  5AQU A;  2BDP A;  2H3G X;  5JVH L;  4KHW A;  4JD2 B;  4A5B A;  4BC4 A;  3EE8 A;  4OO1 J;  3L2Q A;  4IG0 A;  3ZSQ A;  3EKS A;  4J2B A;  3I8D A;  4M3Z A;  4BDP A;  4IO8 A;  4CBW A;  4EZ9 A;  1IKX A;  2UXB K;  3KZB A;  4XH5 A;  2OPR A;  4B3M K;  4CW7 B;  2NNW A;  4DTU A;  2F8T A;  1GLF O;  1J6Z A;  1HNW K;  3WXM B;  1ATR A;  4PUO A;  4O55 A;  3OYE A;  4A62 A;  2NRR A;  2YKN A;  3NF9 A;  2Z1H A;  3LWM A;  3AO5 A;  1Z26 A;  3K5L A;  4FWK A;  1W7A A;  3ZSO A;  1LV5 A;  1A5W A;  4DMN A;  1WN7 A;  3DOL A;  4M7X A;  4CD1 A;  3AAR A;  3LPU A;  1NM1 A;  3PO4 A;  2G8H A;  1X9W A;  4JKH A;  3DLB A;  2V52 B;  3ZET B;  2LSN A;  1V4S A;  4CJV A;  3O9T A;  1JLB A;  3THV A;  4JKD A;  3VA3 A;  4M63 C;  3V4I A;  3R9P A;  3KVG A;  1WUA A;  1LOT B;  4WF9 L;  4FM2 A;  4I6M B;  4CJS A;  1FKP A;  3C6T A;  1X9M A;  4I9L A;  1WSG A;  4ID1 A;  3V1R A;  4PKG A;  4FJM A;  4IJN A;  2A1R A;  2VWK A;  1RDU A;  2ZJP L;  3LDN A;  2A3Z A;  5AQL A;  4DF8 A;  3RR8 A;  2FC0 A;  3O4N A;  1TUU A;  4RW7 A;  4CF0 A;  4B8A B;  1C0G A;  3QO9 A;  5M1O A;  1QQC A;  1C0F A;  4IJA A;  3HBT A;  1S1U A;  1RT3 A;  3DXM A;  1GOC A;  1NGB A;  4M3W A;  3MEC A;  2FBT A;  4CI6 A;  1T7P A;  1FW6 A;  5AQP A;  1E4F T;  3CPE A;  3KLH A;  4QOZ B;  4CJE A;  4U67 L;  3ZT3 A;  3N4Q A;  3SAG A;  3F9K A;  3CIP A;  1S22 A;  4FWP A;  3QEW A;  1Q86 O;  3R8E A;  5EXW A;  3VEN A;  1RT1 A;  2QM1 A;  1XUP O;  4B1Z A;  5ADX H;  1G15 A;  5BR8 K;  2QA4 N;  5IWA K;  1V4T A;  1FK9 A;  1VSK A;  1KC8 O;  1HPM A;  4E7K A;  3DLH A;  3D2F A;  4GKK K;  3LWL A;  4CJL A;  1FKO A;  2YHW A;  3ZSW A;  3VQ7 A;  1P90 A;  3ZX0 A;  3NH2 A;  2QXL A;  3O1B A;  1UAX A;  2UUC K;  1VQL N;  3CJ9 A;  1JLF A;  3OYC A;  1A5V A;  3HM8 A;  2YJF A;  1EKE A;  4FWL A;  4CZE A;  4K43 A;  3AVH A;  4FJL A;  1X9S A;  3FZL A;  4DFP A;  3BF1 A;  2P9I A;  1NGE A;  3A2F A;  3U4L A;  1SL2 A;  3DJC A;  3OTO K;  4JKG A;  2QWP A;  1L3T A;  1W9H A;  4FK2 A;  2FBX A;  4CJT A;  2VGN A;  1YHQ N;  1JLQ A;  4BRP A;  1SS6 A;  3LAL A;  4DKW A;  3NGI A;  3HRG A;  1VAZ A;  1W97 L;  1S6P A;  2VGM A;  5C42 A;  3WXL A;  4OPK A;  4IWV A;  1BWF O;  2EWS A;  4LH5 A;  3NH0 A;  1BL3 A;  1VSJ A;  2E2O A;  5LMN K;  1EET A;  5HRP A;  3MXI A;  2A6A A;  2P9N B;  3HYF A;  2IIR A;  1LCU A;  4FLU A;  4DV4 K;  3I8B A;  4IDH A;  4C8L A;  4DSJ A;  1S1X A;  4I2Q A;  1B9D A;  4HCC A;  3O80 A;  3NE6 A;  4JKA A;  2XRI A;  4JN4 A;  1SL1 A;  2P9K B;  1RDB A;  2ETJ A;  4J2E A;  2NUB A;  4CZI A;  3WUH A;  3E1Y A;  5KPZ A;  4CZG A;  2E4L A;  3FR0 A;  1TL3 A;  2D0C A;  2ASO A;  2RE2 A;  2G8I A;  1NK0 A;  3QIN A;  3C6U A;  5AQF A;  2P9P A;  2QWM A;  4Z0U A;  5EU7 A;  4DQP A;  5E41 A;  1VQ4 N;  2IAJ A;  4DHY A;  3CC4 N;  3V9U A;  3AAQ A;  1S1W A;  5JLH A;  2P1J A;  1K8K A;  3OW2 M;  3OS1 A;  4DQQ A;  1OVY A;  1JKH A;  4CK2 A;  1UA1 A;  4Z94 A;  4R5P A;  1CLQ A;  3JSM A;  3CJ7 A;  4ISG A;  4DV5 K;  3AV9 A;  1OH8 A;  3K5O A;  4DTR A;  5LJW A;  3WXK A;  4KRF A;  1BI4 A;  4W5T A;  1OH7 A;  3ENB A;  4NYN A;  1HKB A;  3VF6 A;  2YHA A;  2Z1G A;  5AZJ A;  4H0T B;  3M8R A;  5C0Y A;  4BDY A;  3DRP A;  1VHX A;  2B5J A;  4FSV A;  3RMD A;  1XMQ K;  5KPR A;  4O5B A;  2HBM A;  3THY B;  3ULE A;  4X64 K;  3L4Q A;  1C0M A;  3KHY A;  3RSE B;  4HUE A;  1S1V A;  3O8M A;  2YI1 A;  1WBD A;  3RMB A;  1U45 A;  3C94 A;  4BC5 A;  3S3N A;  1QHT A;  4CGD A;  1CXQ A;  3VQA A;  1TKZ A;  3G25 A;  4CGI A;  5CR4 A;  5AQI A;  3CCR N;  3KJV A;  1YVN A;  4OGE A;  1HX1 A;  1NNE A;  2HHV A;  3OYN A;  3F2K A;  4FWN A;  1VSF A;  2RPI A;  1J9A A;  2D4W A;  4CD3 A;  5F0X A;  4B08 A;  4IO9 L;  4B3O A;  2Q3S A;  3C65 A;  3O9U A;  4MDA A;  3QBW A;  3CPW M;  1BIU A;  1RIL A;  3B6O A;  2ASP A;  3CCJ N;  1C1A A;  2F4V K;  1ASV A;  2HMI A;  1HKG A;  3EN9 A;  5LY3 A;  4JYA K;  3LP3 A;  3SQ4 A;  4LH4 A;  4OPH A;  3MXJ A;  2HHU A;  2W42 A;  3AY9 A;  3S9H A;  4H8K A;  3TI0 A;  5J2P A;  3FZF A;  3ZET A;  4CIG A;  4QAG A;  1Q7Y O;  1S5J A; 
#chains in the Genus database with same CATH homology
 4XIU A;  4M3U A;  4O4G A;  2HW3 A;  2GV9 A;  2RN2 A;  4CJ5 A;  3TAN A;  3PO5 A;  4DWI A;  1HMV A;  1JXB A;  1WAF A;  4CFB A;  4ZTJ A;  4B9V A;  4HCB A;  4CIE A;  2D0B A;  3QIO A;  4FJ7 A;  4CJF A;  1T05 A;  4KI4 A;  5FRM A;  2YNF A;  3SPZ A;  3WNG A;  4CK1 A;  3RMC A;  4HHT A;  1NJX A;  5J2M A;  4DU4 A;  3S3O A;  4BWM A;  2HB5 A;  4DQI A;  2O4G A;  1B9F A;  3NGZ A;  3RRG A;  3V6D A;  1JLE A;  4CF9 A;  1UWB A;  1WNS A;  5CZ1 A;  4E19 A;  4IKF A;  4PQU A;  3L3U A;  4CFA A;  3NAE A;  2KW4 A;  2Y1J A;  2PY5 A;  1VSE A;  4CIF A;  3E01 A;  3QLH A;  2XHB A;  1BGX T;  3MEG A;  4DS4 A;  4M3T A;  1IKY A;  5K14 A;  3DOK A;  1LWE A;  2YKM A;  5KI6 A;  4I9Q A;  4CEE A;  4C8O A;  4DTJ A;  4CGF A;  4FCY A;  1JL2 A;  1RBT A;  2ITG A;  1LAW A;  3ALY A;  1KVA A;  4BE1 A;  1ZBL A;  1YTU A;  1SKW A;  3L2V A;  5FRN A;  5DK5 A;  4CJW A;  4CEF A;  4DFK A;  3DMJ A;  3KLI A;  3PY8 A;  3FFI A;  4CF1 A;  4F2S A;  3NBP A;  4E0D A;  4YNQ A;  2HHS A;  4AH9 A;  3VQ5 A;  4DTX A;  1QE1 A;  3QEV A;  4HUG A;  3QEP A;  1NKB A;  4DF4 A;  3NHG A;  3ZSX A;  4C8M A;  3T19 A;  3ZSY A;  4CJ4 A;  4BE0 A;  4E3S A;  3TR8 A;  4KHS A;  4O0J A;  3OYJ A;  4EP5 A;  3SV3 A;  3QES A;  2QK9 A;  1HQU A;  4UQG A;  4CHY A;  3AVN A;  3VQ6 A;  3OYB A;  5J2Q A;  5HLF A;  1ITG A;  5HRS A;  3SQ0 A;  1EXQ A;  3ISN C;  2DFF A;  3IRX A;  1RBS A;  3I0S A;  4CJP A;  3AVA A;  2PYJ A;  2OYQ A;  3DI6 A;  5HBM A;  1NK4 A;  3IAY A;  4FYD A;  1RTJ A;  3V9Z A;  4DQR A;  1HQE A;  1RDA A;  1C1C A;  3LZJ A;  4CES A;  4YFU A;  4BAC A;  2KQ2 A;  2IS3 A;  1SKS A;  1TKD A;  3TAQ A;  2KZM A;  2AJQ A;  4K8Z A;  4CHN A;  3K5N A;  3P1G A;  1RTD A;  2HHW A;  3U3Y A;  3ULD A;  4CHP A;  1HYZ A;  2YNI A;  4CEA A;  3CYM A;  3G0Z A;  3O3G A;  3LDS A;  3AO3 A;  3DLG A;  4E7I A;  2E6L A;  1VRU A;  3VQB A;  2E6M A;  1U48 A;  4F3O A;  4BWJ A;  3RWU A;  4M3Y A;  4QCL A;  1J54 A;  2DFE A;  3HP9 A;  1Q8I A;  2XO7 A;  1WSH A;  3ZCM A;  2KFZ A;  2KZZ A;  2FBY A;  3V81 A;  3O4Q A;  3TAG A;  4MFB A;  4JRP A;  1EP4 A;  2ZD1 A;  5JS2 A;  3DRS A;  1L5U A;  1KLN A;  4JS5 A;  3L2W A;  4B9M A;  4O0I A;  1TK8 A;  4FVM A;  3MAQ A;  3OYM A;  3OYF A;  2WOM A;  2A1S A;  3LP2 A;  3QIP A;  1RT6 A;  4RW6 A;  4KHU A;  1X1P A;  3WNE A;  4CJ3 A;  4DLE A;  4CFD A;  3TAR A;  1IO2 A;  3PX4 A;  2DFH A;  1QTM A;  1TAQ A;  3UIQ A;  3PUF A;  4IDK A;  3LP0 A;  3AA2 A;  4E1N A;  4FM1 A;  3SPY A;  4FZX C;  2X78 A;  1ZBI A;  4B9T A;  3HPO A;  2G8K A;  4ELT A;  4BDZ A;  3S3M A;  5HRR A;  1YT3 A;  1KTQ A;  4DSL A;  2QKB A;  5T7B A;  1ZBU A;  3AVC A;  1S1T A;  3P83 D;  3LP1 A;  3WNF A;  1Y97 A;  4FK4 A;  2HHT A;  4Z4C A;  4RW9 A;  3HL8 A;  3NDK A;  1XI1 A;  1JLC A;  3DRR A;  3K2P A;  3V9X A;  2OPP A;  3LAK A;  3F73 A;  3LPT A;  4GW6 A;  4LSN A;  4CGG A;  4W5O A;  3KIO A;  3JYT A;  2B6A A;  3QET A;  1HPZ A;  1LW2 A;  2EHG A;  2QXF A;  3AVF A;  4F8R A;  2WON A;  3OYG A;  1GOB A;  1HJR A;  4OVL A;  3U6F A;  2G8W A;  2HNZ A;  2G8V A;  2OZS A;  1C0T A;  4PY5 A;  3SJJ A;  4DSI A;  3AVJ A;  4IFY A;  4FZZ A;  2X6S A;  5DMR A;  4OPJ A;  3NGY A;  1BIZ A;  4ZTF A;  3H08 A;  4KTQ A;  1EX4 A;  2BDP A;  3HP6 A;  5I42 A;  1REV A;  4KHW A;  1L3U A;  4DTO A;  4N41 A;  3TWH A;  4CEO A;  2OPS A;  3L2Q A;  5D3G A;  4IG0 A;  4OKJ A;  1BCM A;  4Z4I A;  2BAN A;  3ZSQ A;  3T3F A;  2XY7 A;  4KPY A;  1CXU A;  4M41 A;  4EZ6 A;  3HVR A;  4J2B A;  3I8D A;  4M3Z A;  3HPH A;  3TAE A;  1NK7 A;  4BDP A;  3SUO A;  1I39 A;  3OVN A;  2IDO A;  4JLH A;  4LD0 A;  4FJK A;  4Z4H A;  2PZS A;  2JLE A;  2P5O A;  3SQ2 A;  3SV4 A;  3NF8 A;  4EP4 A;  4LSL A;  4KAZ A;  3L3V A;  3SCX A;  1IKX A;  4EZ9 A;  3P5J A;  1I3A A;  2BGG A;  4N5S A;  2DY4 A;  2OPR A;  3WNH A;  2HHQ A;  4DTU A;  2F8T A;  4DTS A;  3LAM A;  1ASU A;  1WSI A;  2VG6 A;  4PUO A;  3HK2 A;  3AO4 A;  4O55 A;  3OYE A;  3SQ1 A;  3OS2 A;  3NF6 A;  4NCB A;  1LW0 A;  2YKN A;  3NF9 A;  2Z1H A;  3LWM A;  3LZI A;  1QSY A;  3PX0 A;  3AO5 A;  1Z26 A;  2YNH A;  4AHT A;  4CED A;  3K5L A;  4DS5 A;  3ZSO A;  1LV5 A;  1A5W A;  2BE2 A;  3VQE A;  4DMN A;  1C0U A;  1WN7 A;  3DOL A;  2KTQ A;  1RTI A;  3LPU A;  3LAN A;  3VA0 A;  1VSM A;  4FLX A;  3PO4 A;  4Q5V A;  3T1A A;  2G8H A;  4G1Q A;  4Y1D A;  3QEI A;  1X9W A;  1L3V A;  3DLB A;  2YNG A;  2LSN A;  4CJV A;  3HT3 A;  1XHZ A;  2Y1I A;  1HYV A;  1JLB A;  3ZT1 A;  4CEB A;  2G8F A;  3THV A;  4M42 A;  3VA3 A;  4KHY A;  3V4I A;  4AHS A;  4ZHR A;  4NCG A;  1NOZ A;  1XHX A;  4FM2 A;  2KFN A;  4CJS A;  2XY5 A;  1FKP A;  3C6T A;  4OGC A;  4OJR A;  3RTV A;  3ZT2 A;  1X9M A;  4I9L A;  4HVJ A;  1WSG A;  1U47 A;  3K57 A;  4FJI A;  2EX3 A;  4ID1 A;  4J2D A;  1IKW A;  2F96 A;  3O3F A;  2OPQ A;  2YHB A;  3V1R A;  4F2R A;  4FJM A;  2A1R A;  1VSD A;  1S6Q A;  2VWK A;  2ZQB A;  5KGW A;  1S9E A;  2O4I A;  4JS4 A;  4DF8 A;  1U49 A;  1WSJ A;  4KKO A;  3K59 A;  4E7L A;  4FJJ A;  4PWD A;  1JXE A;  3RR8 A;  2D0A A;  2FC0 A;  4C8K A;  3O4N A;  3AVB A;  4RW7 A;  4CF0 A;  4B8A B;  3BGR A;  3QO9 A;  5I3U A;  5KRS A;  1QQC A;  3MED A;  1S1U A;  3C95 A;  1RT3 A;  3CFR A;  4E1M A;  4KHN A;  1D9F A;  4O44 A;  4JRQ A;  1GOC A;  5HP1 A;  3M8Q A;  2VWJ A;  4C8N A;  1MU2 A;  3KLG A;  3L2U A;  4M3X A;  2HNY A;  3I0R A;  4KB0 A;  4M3W A;  3MEC A;  4K8X A;  2FBT A;  4H4O A;  1T7P A;  1W0H A;  4KFB A;  2P5G A;  1VSL A;  3KLF A;  3KLH A;  3AVK A;  5HRO A;  1ASW A;  1XWL A;  4QOZ B;  2IGI A;  4IFV A;  4CJE A;  3G10 A;  4Y1C A;  3V1Q A;  4E89 A;  4CK3 A;  3ZT3 A;  4DLG A;  4DFM A;  1N6Q A;  3F9K A;  1WSE A;  3QEW A;  4M3R A;  2X6N A;  1T8E A;  3AO1 A;  3OYI A;  1RT1 A;  2XY6 A;  1BI4 B;  4OLB A;  1SKR A;  1G15 A;  1CZB A;  1DTT A;  1NKC A;  4N76 A;  3KK3 A;  1WAJ A;  1FK9 A;  1VSK A;  4Z4E A;  2D5R A;  4CHQ A;  4FJ5 A;  1Q9Y A;  4MQ3 A;  2VG7 A;  4KI6 A;  1KVC A;  1U04 A;  2FBV A;  3PV8 A;  4F4K A;  1O1W A;  4W5Q A;  4E7K A;  3CG7 A;  3DLH A;  3LWL A;  3TAM A;  4CJL A;  1RCH A;  2RKI A;  1FKO A;  3ZSW A;  3OYH A;  3L2R A;  1WSF A;  1F21 A;  3VQ7 A;  3IS9 A;  3NF7 A;  1TK0 A;  3NH2 A;  4KRE A;  4W5N A;  4IG3 A;  3HVT A;  1UAX A;  4DFJ A;  3PX6 A;  3QNO A;  1JLF A;  4ELV A;  3ZT0 A;  4FK0 A;  4KHQ A;  4FLW A;  4KO0 A;  3CFP A;  1UOC A;  4CEC A;  4CJQ A;  3OYC A;  2B4J A;  2R7Y A;  1BQN A;  3TAB A;  1XC9 A;  1RDC A;  4FJX A;  3SI6 A;  1A5V A;  1QSL A;  1KFD A;  2ZE2 A;  3MEE A;  1NOY A;  1EKE A;  3QEX A;  4DTN A;  3KD1 E;  4F3T A;  3SUN A;  3D0P A;  1JL1 A;  3AVH A;  1ZBF A;  1IH7 A;  4CF2 A;  4FJL A;  4CHZ A;  1T03 A;  4CCH A;  1X9S A;  4FXD A;  3OJS A;  3KK1 A;  4DFP A;  3EYZ A;  4KV8 A;  4KTZ A;  5HRN A;  4AHU A;  4CJK A;  3AVM A;  3A2F A;  3KKS A;  1SL2 A;  1LWF A;  3TAP A;  3V9W A;  1L3T A;  1W9H A;  1VSI A;  1NKE A;  1HNV A;  4IBN A;  4FJG A;  4FK2 A;  1YVU A;  2FBX A;  4PA1 A;  4CJT A;  3ITH A;  5KGX A;  4ICL A;  1D5A A;  3V1O A;  4GVM A;  4BE2 A;  1JLQ A;  3AVG A;  3MXM A;  1NJZ A;  4J2A A;  3LAL A;  3NGI A;  1RT5 A;  1UA0 A;  3V9S A;  1L3S A;  1DTQ A;  4CJU A;  4L8R B;  1Z25 A;  1NK6 A;  4Z4G A;  4FLT A;  1BCO A;  1FXX A;  1VK0 A;  1S6P A;  4CEZ A;  5C42 A;  4OPK A;  3K58 A;  4FM0 A;  4ID5 A;  1C1B A;  3DM2 A;  4LH5 A;  3NH0 A;  1BL3 A;  1VSJ A;  1JLG A;  3L8B A;  2Z1I A;  4DG1 A;  1EET A;  3CQ8 A;  4FJ9 A;  4M45 A;  5HRP A;  3MXI A;  3HYF A;  4CGJ A;  4FW1 A;  3B6P A;  4FLU A;  1ZYQ A;  4C8L A;  4DSJ A;  4Z4F A;  5CY4 A;  4AHR A;  1S1X A;  4I2Q A;  1B9D A;  1QSS A;  4HCC A;  3NE6 A;  2HVI A;  2XRI A;  3ZSV A;  1SL1 A;  1RBR A;  4ELU A;  1KSP A;  3BDP A;  3ZSR A;  1C6V A;  5FRO A;  1VSH A;  1Q9X A;  1RDB A;  2ETJ A;  1IG9 A;  2NUB A;  4I2P A;  3VQ9 A;  2RF2 A;  4B9S A;  3VQ8 A;  3KLE A;  3NH1 A;  3OYD A;  1TKT A;  4NYF A;  3OJU A;  3TAF A;  1D8Y A;  3AO2 A;  4N56 A;  3O3H A;  1TKX A;  4E7J A;  2E4L A;  1NK9 A;  1TL3 A;  1J53 A;  1A5X A;  1BQM A;  1JLA A;  2D0C A;  3ZT4 A;  4DU3 A;  1DLO A;  3ASM A;  3AVL A;  2G8I A;  3RRH A;  1BIS A;  1NK0 A;  5CYM A;  4HUF A;  3QIN A;  4DSE A;  4OLA A;  3C6U A;  3OS0 A;  1SV5 A;  4FJN A;  4Z0U A;  3OYL A;  5EU7 A;  4CJR A;  5E41 A;  4DQP A;  5KRT A;  2IAJ A;  4FJH A;  3HXM A;  1NJW A;  3V9U A;  2PYL A;  4CFC A;  1S1W A;  3K5M A;  1HRH A;  2P1J A;  4DQQ A;  3OS1 A;  5J1E A;  1RBU A;  2Z1J A;  1JKH A;  3U3G A;  4CK2 A;  4DQS A;  1UA1 A;  3HO1 A;  1CZ9 A;  4R5P A;  1QS4 A;  1CLQ A;  3JSM A;  4Q0B A;  3AV9 A;  1J5O A;  3K5O A;  4OKK A;  4DSF A;  4DTR A;  5CZ2 A;  1KRP A;  3KTQ A;  2GUI A;  4KRF A;  1BI4 A;  1RDD A;  4W5T A;  4NYN A;  1B92 A;  1HNI A;  1S9G A;  4WE1 A;  4CHO A;  2YHA A;  2Z1G A;  5C24 A;  3EY1 A;  1SL0 A;  3M8S A;  3NFA A;  3HJF A;  1TGO A;  3VQP A;  3M8R A;  3AA5 X;  4B8C A;  5C25 A;  4KTW A;  4N47 A;  4BDY A;  3DRP A;  3RMD A;  2B5J A;  1LAV A;  2HND A;  3HPG A;  4B9L A;  1NJY A;  1RT4 A;  3VQC A;  4O5B A;  5JS1 A;  5SWM A;  3QNN A;  3DYA A;  4FLZ A;  4TSX A;  4FJ8 A;  1C0M A;  4CE9 A;  3AA4 A;  1KVB A;  1GOA A;  1S1V A;  3DLE A;  4HUE A;  1LWC A;  1RT2 A;  1NK5 A;  4DTM A;  3VQD A;  1U4B A;  3KD5 E;  3RMB A;  1U45 A;  3C94 A;  1KLM A;  1RTH A;  4FLV A;  4DTP A;  3M8P A;  4CGH A;  4FLY A;  1TAU A;  3AA3 A;  3AVI A;  1QHT A;  4CGD A;  1CXQ A;  4E7H A;  3S3N A;  3RR7 A;  3VQA A;  2ATQ A;  1NK8 A;  4AHV A;  1ZBH A;  2DTU A;  2I5J A;  5FDL A;  4HTU A;  1TKZ A;  4CGI A;  4I7F A;  3SUQ A;  1KFS A;  1KCF A;  3EZ5 A;  2IOC A;  5J2N A;  3KJV A;  4KB1 A;  1BHL A;  4OGE A;  2HHV A;  4LY7 A;  3SZ2 A;  3OYN A;  2OA8 A;  3HM9 A;  2JGU A;  1N5Y A;  1RBV A;  1SUQ A;  1VSF A;  3KKR A;  4RG8 A;  5KTQ A;  3OYA A;  2YV0 X;  3RMA A;  2RPI A;  1HYS A;  1J9A A;  4CF8 A;  1K6Y A;  3D45 A;  4B08 A;  3VN5 A;  4B9U A;  1WLJ A;  3VQQ A;  3OYK A;  3OY9 A;  1VRT A;  1YTA A;  3NCI A;  4B9N A;  4FZY A;  4B3O A;  4AHC A;  4GMJ B;  1RT7 A;  2Q3S A;  5SZT A;  3CM5 A;  3HST B;  1TL1 A;  2F8S A;  3DLK A;  1BIU A;  4FW2 A;  1RIL A;  3QER A;  3CM6 A;  2X74 A;  2G8U A;  3B6O A;  2XY8 A;  4J2E A;  1C1A A;  3CFO A;  4RW4 A;  2OZM A;  1ASV A;  1IKV A;  2QKK A;  4H4M A;  1R0A A;  3SYZ A;  2HMI A;  2HHX A;  3LP3 A;  4AIL C;  1RNH A;  5CYQ A;  3VQ4 A;  2GBZ A;  4LH4 A;  3ZSZ A;  3SQ4 A;  4DSK A;  3MXJ A;  2P51 A;  4NCA A;  4CEQ A;  4W5R A;  2HHU A;  2W42 A;  3SUP A;  3S9H A;  2VG5 A;  4H8K A;  3TI0 A;  5J2P A;  3SNN A;  4CER A;  3KK2 A;  3DLR A;  4DU1 A;  3IG1 A;  2IC3 A;  1TK5 A;  1TV6 A;  1TVR A;  4CIG A;  4QAG A;  4OKE A;  2HVH A;  1S5J A;  1D9D A;  4RW8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...