2Z1HA

Crystal structure of e.coli rnase hi surface charged mutant(q4r/t92k/q105k/q113r/q115k/n143k/t145k)
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
155
structure length
155
Chain Sequence
b'MLKRVEIFTDGSCLGNPGPGGYGAILRYRGREKTFSAGYTRTTNNRMELMAAIVALEALKEHCEVILSTDSQYVRQGITQWIHNWKKRGWKKADKKPVKNVDLWKRLDAALGRHKIKWEWVKGHAGHPENERCDELARAAAMKPKLEDTGYQVEV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease HI
publication title Protein Thermostabilization Requires a Fine-tuned Placement of Surface-charged Residues
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 47
structure length 155
sequence length 155
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2007-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2z1hA00
4OLAA 4C8NA 5EU7A 3ZSVA 1ASUA 1TKTA 2FBYA 5K14A 3VQPA 4B9LA 2OYQA 2ATQA 1BIZA 3V9WA 3RMDA 4OGCA 1YTAA 3SUPA 3NBPA 1SL2A 4CFBA 3HJFA 3SI6A 2AJQA 4M3RA 1LAWA 1NKCA 1JLQA 3ZSXA 4FJ7A 3NH0A 4O44A 3LDSA 3K58A 1KRPA 1ZBLA 2ZD1A 3RWUA 1HPZA 4CESA 3SQ1A 3KLEA 4B9SA 5D3GA 1IKWA 2X78A 3OS2A 1KLNA 3G0ZA 4MFBA 4JS4A 1R0AA 4I9QA 4LSLA 2HW3A 3OYKA 1NJYA 3KKSA 4CJQA 1CXQA 3KTQA 4N41A 3DRPA 1NK0A 2VG5A 2XHBA 4N47A 4Z4IA 4OPJA 4AHRA 2GUIA 4OKEA 3OYNA 4E3SA 4NCBA 3OJSA 4OKKA 4CGHA 1HNVA 4CEBA 4CEQA 1KVBA 1BIUA 1RBTA 2FBXA 2IGIA 1WLJA 3M8RA 1U45A 4NYNA 3DI6A 4FJ9A 4Y1DA 1HMVA 3MXJA 3LZIA 1QS4A 2YHBA 3QEXA 3SZ2A 1RT5A 3LANA 3OYCA 3QEIA 1VSMA 2RF2A 3U3YA 1TK8A 4FW1A 3M8QA 1ZBIA 3ZT4A 1KFDA 3ZSZA 2I5JA 3HL8A 4KB1A 4CERA 4E1NA 3V6DA 3OYAA 1L3TA 3A2FA 3VQCA 4CHNA 4AH9A 4LY7A 4YFUA 3CFOA 2KFZA 4KO0A 3F9KA 2X74A 2IS3A 4CIGA 1NK5A 2HMIA 2P5GA 5SZTA 4LD0A 1K6YA 4GMJB 2KQ2A 1TVRA 3K5LA 3SNNA 1IKVA 1RDDA 5KRSA 2PY5A 1KTQA 4O55A 4CEOA 5KTQA 1ZBFA 3F73A 2OPSA 4CIEA 1JL1A 4H4MA 4C8MA 4B9NA 2HB5A 3DRSA 5FROA 3T3FA 3IAYA 4CHPA 3OYEA 1LAVA 3KIOA 4B9TA 1DTQA 2FC0A 2HVIA 2HHTA 3DLEA 3TABA 3VQAA 4KFBA 1ZBHA 5CY4A 2NUBA 4DFPA 4FJLA 5J2MA 5JS1A 3AVNA 1HRHA 3QO9A 1D9DA 1BI4A 3L2WA 2KW4A 3KLFA 4EZ6A 3S3OA 1U47A 4IKFA 1FKPA 2YV0X 4C8OA 2PYJA 3KLHA 1HYSA 3I0SA 2DFEA 3LAKA 3V4IA 1B92A 4F8RA 2HHXA 1VSJA 1C1AA 1D8YA 4GW6A 4DQPA 1BQMA 4O0IA 1TKDA 4KPYA 3ZT1A 1SKSA 4FK0A 4KI6A 2R7YA 2G8HA 1KCFA 3KLIA 3L2RA 3EZ5A 5HLFA 4CF9A 4B9UA 1EXQA 3ZT0A 4CHOA 4CF2A 3NAEA 1RTJA 2HNYA 4E7JA 4KI4A 1S1TA 3TAEA 3PX0A 5JS2A 3V9UA 3V1RA 2XY5A 3CFPA 4M41A 4AHSA 2OPPA 4CK1A 2QKBA 4QOZB 4HHTA 4Z0UA 4HUGA 4FM2A 3LWMA 5I3UA 2XY7A 3VQQA 1J54A 2X6NA 3DOLA 2F8SA 2ZE2A 2FBTA 3AVHA 4OJRA 4E89A 4FJ8A 1QSLA 4L8RB 1TAUA 3P5JA 4CJFA 3QNNA 3V9XA 5FDLA 4CF8A 3SJJA 4K8ZA 4DTMA 5HRPA 3TANA 4IG0A 3SPYA 4RW4A 4DLEA 4ZHRA 3PX6A 4CJKA 1KFSA 1ITGA 2P5OA 1IKXA 3RRHA 3O4QA 3DMJA 1EETA 1VSFA 5CYMA 4DG1A 4FJIA 3O3HA 1BCOA 5HRRA 3MEEA 2ITGA 3HK2A 1RT3A 4O0JA 4FCYA 1EKEA 2P1JA 1BL3A 3ZCMA 1W0HA 5J2NA 4E7LA 2OZSA 2DFHA 4Y1CA 3QINA 3VQ8A 2RN2A 4OGEA 5DK5A 4BWMA 3NE6A 3VA0A 2FBVA 3K5MA 4B8AB 4E7HA 5J2QA 4FJNA 3ZT3A 4F4KA 1N5YA 2BANA 1S1VA 1RTIA 3OYLA 1VRTA 1T8EA 1VK0A 4KAZA 1NJZA 1BI4B 2QXFA 3OYDA 1C1BA 4W5NA 2VG7A 1WN7A 4DFMA 1YTUA 2A1RA 4BWJA 3P83D 1C0UA 3HPOA 3JSMA 4CJTA 1JLAA 3PX4A 3AA2A 5KGXA 2A1SA 4DQSA 4JS5A 2RKIA 4ELUA 4HUEA 1HQEA 3NFAA 3NF9A 4DTJA 1QSYA 2WOMA 3L2UA 4DQRA 1YVUA 1S5JA 3OS0A 3QETA 4FZZA 2YKMA 3AVJA 4IFYA 4DMNA 3HP9A 5SWMA 3KK1A 1IG9A 3ZSOA 1RDBA 1FKOA 3KK2A 4DTSA 3NH2A 3AVCA 3OYFA 3T19A 1D5AA 3HSTB 3KD5E 4IBNA 4W5QA 4DTOA 5KGWA 4O4GA 1KVAA 2E4LA 3V1OA 5HRNA 3HP6A 5C42A 2F96A 4CJSA 3AVIA 2Q3SA 3OYMA 3QERA 4M3YA 2DTUA 4M3XA 4K8XA 2HNDA 4E1MA 1O1WA 1UOCA 4FJMA 1KSPA 3D0PA 2KFNA 3MECA 4DU1A 3MXIA 1TGOA 3G10A 1XI1A 4DSEA 1T03A 3VQ6A 1Z26A 3OYIA 1SV5A 3DM2A 4DWIA 1IKYA 1S1UA 1S9EA 1CLQA 3AA5X 3HXMA 1TK5A 4DU4A 3QNOA 1BHLA 1WSJA 3AO5A 3C6TA 1HNIA 3E01A 4CIFA 3RTVA 1XC9A 1T7PA 3AO3A 2YNHA 1SL1A 3OS1A 3O3GA 3K59A 1HQUA 4F3OA 3HVTA 4FK4A 1CXUA 1DTTA 1QTMA 3RMCA 1FK9A 3SUQA 3L3UA 2D0AA 3WNGA 4M42A 1RCHA 1NJWA 4GVMA 2Z1GA 1I39A 3ZSQA 1FXXA 3RR8A 1TKZA 3H08A 2OA8A 4FJXA 3O3FA 4J2BA 4KHWA 2QK9A 1EX4A 1Q8IA 5CZ2A 4CHYA 5HRSA 1Y97A 3SQ2A 1I3AA 2G8KA 4ELVA 2KZZA 4IFVA 3VQBA 4BACA 4HCCA 3B6OA 2GBZA 5CYQA 4FJJA 1QE1A 1C6VA 3ISNC 4Q5VA 4ZTFA 3DLBA 4B9VA 1NK6A 1RBUA 2IDOA 3C6UA 4DTUA 4KB0A 3L2VA 4JLHA 4IG3A 3NHGA 4RW9A 3MEDA 4W5OA 1RNHA 2HNZA 3TAGA 1NK7A 5DMRA 3RMBA 4M3WA 5FRMA 1KLMA 2YNFA 1GOCA 2G8IA 4FZXC 2O4IA 4CEEA 4FLXA 3SYZA 3SPZA 4E0DA 4DTPA 3S3MA 2JLEA 1L3VA 1JXBA 2IC3A 1C0MA 1HYVA 3QIOA 2E6MA 3VQ5A 4CFAA 1BQNA 4EP4A 1BCMA 3PY8A 2HHUA 4CGJA 2BDPA 1U49A 3AVMA 2D5RA 3K2PA 1U4BA 2B6AA 3NGYA 1J9AA 1JLGA 1SKWA 4KTQA 1B9DA 2OPQA 4OVLA 4UQGA 5C25A 3SUNA 1RILA 4BE2A 2OZMA 1BISA 4M3UA 4M45A 4DTXA 3SV3A 5C24A 3LPTA 4CK2A 4FJHA 4M3ZA 4FM0A 3SQ4A 1RT6A 3AO2A 1UWBA 3VA3A 1W9HA 4ICLA 3HPGA 4CF1A 3THVA 1TL1A 4FLTA 4C8LA 4M3TA 4NYFA 3NF8A 4BE0A 4H8KA 1DLOA 1LWEA 4CEDA 3I8DA 1JLEA 3KKRA 1GOAA 3LP3A 4CFCA 2F8TA 2YHAA 4DSLA 5HP1A 1N6QA 4HVJA 3LP2A 2Z1IA 1RT2A 1UA1A 4FYDA 3QLHA 1NK4A 2O4GA 4CJPA 3ITHA 4CJVA 1NKEA 1LWFA 4CJ4A 3HYFA 4AHCA 1VSEA 3L2QA 2PYLA 1WSGA 2B5JA 1NOZA 4FW2A 3C94A 4KV8A 3VN5A 4E7KA 3AVAA 3PO4A 4BDYA 2LSNA 3AVBA 3LZJA 3V9SA 4FLYA 1HYZA 4FLZA 3M8PA 2OPRA 4CJEA 4BDPA 1L3SA 2HHVA 4I2PA 5E41A 1BGXT 2B4JA 3RRGA 4KKOA 3LP1A 1B9FA 4CJUA 4N76A 2YNIA 2XO7A 4DF8A 5KI6A 3NH1A 3MAQA 4DQQA 4I9LA 4E7IA 5HROA 3AA3A 2EX3A 3HM9A 4FVMA 3NF6A 4DSKA 3VQ9A 3ZSYA 3QEWA 4XIUA 3M8SA 1IH7A 4CK3A 3K57A 3L8BA 3WNEA 3OVNA 3P1GA 1WSEA 1MU2A 2BE2A 3OJUA 3SV4A 3OYBA 3O4NA 4JRPA 1X1PA 4QAGA 1YT3A 1Z25A 2XRIA 4CJ3A 1U48A 4J2EA 1RT4A 4B8CA 4W5TA 4CGFA 4NCAA 2Y1IA 4FK2A 4RG8A 4HTUA 4FXDA 4CECA 3AO4A 2D0CA 4KHNA 4DSIA 1JXEA 1VSKA 1WSFA 4FZYA 3WNFA 1RT1A 1A5VA 3AVLA 3OY9A 1QQCA 1TK0A 1NJXA 3B6PA 4KTWA 1XHZA 2DFFA 2XY8A 4KREA 1A5WA 2YNGA 3BGRA 2Y1JA 3CM6A 3DLGA 3VQDA 4RW6A 1WAJA 5CZ1A 2HHSA 1WSHA 1RTHA 2YKNA 2G8WA 1QHTA 1VSIA 3DRRA 4CJWA 3DLHA 3OYJA 3NCIA 4KHQA 1A5XA 1NKBA 3UIQA 4RW7A 2VWKA 3CM5A 1TL3A 1UAXA 4CEFA 2HHWA 1JL2A 1REVA 4FJGA 1NOYA 3S3NA 2JGUA 1T05A 3HVRA 3DOKA 3LP0A 1LV5A 4HUFA 1KVCA 4AHTA 3KK3A 1HJRA 4C8KA 3NDKA 4MQ3A 2P51A 1X9SA 4B3OA 2DY4A 2GV9A 1L3UA 3D45A 3AO1A 2ETJA 2KZMA 2RPIA 4EZ9A 2EHGA 1JLFA 4EP5A 5FRNA 3CQ8A 1RBSA 1RDAA 1JKHA 3VQ4A 4G1QA 3TWHA 4CF0A 3V9ZA 4KHYA 2WONA 3CYMA 4CJ5A 4E19A 1J5OA 3S9HA 4ID5A 4PUOA 4I2QA 3DYAA 3I0RA 3ZSWA 1ZBUA 3QESA 1NK8A 4NCGA 3AA4A 1TKXA 5I42A 1SL0A 5J1EA 4FM1A 3TAQA 4R5PA 3KD1E 4N56A 2Z1HA 5HBMA 3TAMA 3EY1A 4Z4EA 4HCBA 1UA0A 1RDCA 1D9FA 4CGIA 1XHXA 4OLBA 3KLGA 4LH5A 4CGGA 1TV6A 1SKRA 2D0BA 4B9MA 4FLWA 1RBVA 2VWJA 1X9WA 4Z4GA 1S6QA 1VRUA 4LH4A 3L3VA 2VG6A 4FLUA 4PA1A 3ZT2A 3QEPA 1S9GA 3NF7A 4CJRA 3AVFA 3V81A 1NK9A 3LAMA 4CE9A 2BGGA 1JLCA 3ASMA 4CHQA 4KRFA 4AHUA 3EYZA 4KHSA 4DF4A 1J53A 3BDPA 1VSDA 1LWCA 1U04A 4TSXA 1TAQA 3LWLA 4KHUA 1LW2A 2Z1JA 3U6FA 3T1AA 3VQ7A 1VSLA 1RT7A 1GOBA 3C95A 3U3GA 3K5OA 3HT3A 3HO1A 1QSSA 3TI0A 3RMAA 4WE1A 2KTQA 4Z4HA 4Z4CA 1WNSA 4AHVA 3HPHA 4DQIA 4FJ5A 3NGIA 3CG7A 3NGZA 4DTNA 3MXMA 1VSHA 4Z4FA 3K5NA 4PWDA 1LW0A 1C1CA 4FLVA 3ZSRA 4DFJA 2PZSA 4DS4A 3QEVA 3PO5A 3JYTA 1Q9YA 4LSNA 4DTRA 5J2PA 4DFKA 3ULDA 3AVKA 3ALYA 2G8VA 4Q0BA 4ID1A 4QCLA 1SUQA 5T7BA 4JRQA 3TARA 4F2RA 2IAJA 4O5BA 4YNQA 1S6PA 3FFIA 1IO2A 1C0TA 1CZBA 3DLRA 4RW8A 4CFDA 4W5RA 3OYGA 4DS5A 1WAFA 3LPUA 1G15A 4KTZA 4OKJA 3SQ0A 3TAFA 1RTDA 4ELTA 4CEAA 4I7FA 3QIPA 3PUFA 4F3TA 4BE1A 4PQUA 1RBRA 4IDKA 2QKKA 3DLKA 3WNHA 3AVGA 4OPKA 4DSFA 3LALA 2HHQA 4DSJA 3VQEA 3OYHA 2XY6A 3TAPA 2ZQBA 4DU3A 4FJKA 5KRTA 1ASWA 4N5SA 3RR7A 1S1WA 1EP4A 4PY5A 3KJVA 4F2SA 2G8FA 3MEGA 4DLGA 4AILC 3SCXA 4J2DA 1WSIA 1XWLA 3IRXA 4CGDA 4B08A 4BDZA 4ZTJA 1F21A 3IS9A 4CEZA 4CCHA 1S1XA 3IG1A 2E6LA 4CHZA 2IOCA 3TR8A 1L5UA 2HVHA 1ZYQA 3PV8A 2G8UA 3SUOA 3V1QA 1X9MA 2W42A 4CJLA 3CFRA 1Q9XA 3AV9A 1JLBA 2X6SA 1CZ9A 4J2AA 1ASVA 4H4OA
chains in the Genus database with same CATH superfamily
1NGDA 1DGKN 3ZSVA 1ASUA 1YUWA 4JD2A 2FBYA 3QBXA 4B9LA 1GLAG 2OYQA 2ATQA 3TTFA 4GKKK 3V9WA 1BUPA 3CETA 4FWRA 3C6AA 3SUPA 4L3QA 3HJFA 3SI6A 2AJQA 1LAWA 1JLQA 3RWUA 3VF4A 3HBTA 4A59A 1HPZA 4CESA 2NRRA 3SQ1A 1ILYA 4JI7K 2KLAA 2F4VK 1IKWA 2D1KA 2X78A 3OS2A 2HW3A 4I9QA 3KTQA 1NK0A 5AQUA 4Z4IA 4OPJA 2GUIA 4OKEA 4OKKA 4CGHA 3D2FA 1KXPA 1O13A 1WLJA 3CC2N 4FJ9A 4Y1DA 1BU6O 3QEXA 5ELZA 1GLBG 1HKCA 1RT5A 3H3OB 1TK8A 3K9JA 4I6MB 4KB1A 1L3TA 3OYAA 2O8EB 4AH9A 4YFUA 3UKUB 2FSJA 2KFZA 4KO0A 3O80A 5SZTA 2CH5A 2P9IB 2KQ2A 4IOXA 3D6RA 2BH1A 1IKVA 1RDDA 5GAGP 4FPBA 4WFNL 4YOTA 4BREA 2OPSA 5AQKA 5KQDA 1XNRK 2HB5A 5FROA 3T3FA 3IAYA 4DR7K 4JI8K 4JD2B 1VQON 5JLFA 3ENBA 3L4QA 5ADXH 5CY4A 2CH6A 4MLEA 5J2MA 3CQXA 1HRHA 2KW4A 4EZ6A 3CMAN 1FKPA 3EN9A 4PL8A 3I0SA 2DFEA 4ILGB 3H1VX 1D8YA 4DQPA 3WT0A 3MMVA 4BGBA 5HLFA 3ZT0A 4CHOA 3NAEA 1YHQN 1NWKA 3FFKB 5JS2A 3V1RA 2XY5A 3ID8A 2OPPA 4AHSA 2O8DB 3LWMA 2D0OA 3ZETA 4PKIA 3H6EA 2NRHA 2GEMA 1MWMA 3CD6N 4CD3A 4AF1A 2BTFA 4K8ZA 2E2PA 4JK7A 1VQ4N 3TANA 4IG0A 3SPYA 4DLEA 3PX6A 2P5OA 4K25A 1Q82O 4DCHA 3ZCMA 2HF4A 4E7LA 4BR7A 4Y1CA 3QINA 2WC9A 4BWMA 1XUPO 4FJNA 4B8AB 4F4KA 1IBMK 2BANA 4E1JA 1RTIA 3RVCA 1NJZA 2GELA 5MLCQ 1OVYA 4BWJA 1C0UA 3HPOA 3ENHA 1TYQA 4WCEL 1VQ8N 1NGBA 4HUEA 1HQEA 3NF9A 4LF6K 2VWBA 2HHHK 1YVUA 3OS0A 3AVJA 3IFRA 3EKSA 4JI5K 3NH2A 3AVCA 4FWOA 4IO8A 1BG3A 3T19A 3ZETB 4DR6K 3QDKA 2E4LA 5C42A 1BO5O 1Q18A 4M3XA 4K8XA 1WBDA 4FJMA 5GIPA 3F5TA 4CZEA 3ULEB 4CZMA 1T6DA 3VGMA 3MN7A 1SV5A 3DM2A 1S1UA 4HTLA 2EWSA 1BHLA 1EWRA 4U67L 1BA0A 4YOVA 1GLFO 4F3OA 2WTUA 4FK4A 1DTTA 1M90O 3AY9A 3WNGA 1HX1A 3IMXA 1RCHA 1NJWA 4M42A 2Z1GA 1I39A 3CJCA 2QK9A 3O3FA 4J2BA 1EX4A 1YITN 4CHYA 1Y97A 3PIPL 4ELVA 1GLDG 4JHDB 4BACA 2GBZA 5CYQA 1QE1A 5AZIA 4A5AA 2RHKA 3RSEB 4YHHK 1NK6A 2IDOA 2D4WA 3HRGA 3R3LA 4NLCA 5AQSA 3NVKA 5DMRA 4GV9A 4M3WA 4FWSA 5FRMA 1KLMA 3PSFA 1ATSA 2Q31A 1GOCA 3P39A 3SYZA 5FPEA 1L3VA 3BEXA 2IC3A 1C0MA 4EP4A 2E6MA 5GAHP 2YHYA 2PAVA 4R79A 1U4BA 3K2PA 1SKWA 2BGGA 2F8SA 4O8KA 4BR9A 3SUNA 4M3UA 4M45A 5C24A 2NRVA 3LPTA 4B1XB 1NM1A 4FJHA 4FM0A 3VA3A 4JK9A 3NF8A 4JKEA 3L6QA 1XC3A 2OTJN 3LP3A 5HP1A 1N6QA 4JV5K 4M7XA 1YAGA 2QM1A 4NB4A 5BRHA 4IEIA 4OPHA 3F9MA 3CI5A 4BROA 4AHCA 4JI2K 2FF6A 1NBWA 4FW2A 1XMOK 4E7KA 3AVAA 4YDUC 2LSNA 3AVBA 4BRIA 3V9SA 3M8PA 1T3VA 4CJEA 5C0YA 3GG4A 1L3SA 5F0XA 3NVMA 5BN8A 4I2PA 1BGXT 2B4JA 2UU9K 3R6MA 3RRGA 5AR0A 2YNIA 3BUZB 4H5RA 5KI6A 3AA3A 4B3MK 2EX3A 2W6LA 3NF6A 3EEQA 3CJ7A 1IH7A 4CK3A 3MCPA 3L8BA 3P1GA 3K0SA 4B3SK 1NNEA 2BE2A 3OJUA 3OYBA 1X1PA 4LFAK 1Z25A 2FSKA 4CJ3A 1U48A 4B8CA 4J2EA 4CGFA 3OW2M 1Z6RA 1YVNA 2D0CA 4KHNA 3WNFA 1RT1A 3B6PA 2PFUA 1H1VA 3LDLA 4DR5K 4KTWA 3VEVA 3LM2A 5BPLA 3CM6A 2HBLA 4YOUA 4B1ZA 1WAJA 2NRZA 4BRPA 1WSHA 1RTHA 2YKNA 1N36K 1X3MA 3OYJA 5AQFA 4RW7A 2HHWA 1JL2A 3VEOA 3S3NA 4CZKA 5KQ8A 1T05A 1LV5A 4HUFA 3N4QA 3VOVA 3ZX0A 1X9SA 2QA4N 1L3UA 4AM7A 5AFUA 4EZ9A 2EHGA 3G6EN 3CQ8A 4CF0A 2WONA 4E19A 3O9QA 4PUOA 3ZSWA 2Q0RA 4NCGA 1TKXA 3DXMB 4FM1A 1SL0A 2AA4A 1D9FA 4CGIA 3A5NC 4K42A 1RBVA 1X9WA 4Z4GA 1S6QA 1VRUA 3JS6A 4LH4A 3DAWA 2VG6A 4PA1A 3QEPA 4CJRA 4MO5A 3LAMA 4H0YB 1NK9A 4AHUA 4DR3K 2H3GX 1LW2A 3C95A 4O5FA 3O9UA 2CGJA 3HPHA 5JVGL 3VGLA 4FJ5A 3E66A 3NGZA 3MXMA 3J8AA 2O8CB 4Z4FA 4C1NK 3K5NA 1C1CA 4FLVA 1KAXA 4JKCA 1NJIO 3PO5A 5LJVA 4LSNA 4CZGA 4Q0BA 3AVKA 4JKHA 1SUQA 2W41A 4LF4K 3TARA 2IAJA 4YNQA 3CIPA 4BR0A 2P9LA 1CZBA 4H0OA 1WAFA 4KTZA 4OKJA 3SQ0A 3TAFA 5AQMA 2QWMA 3QIPA 2YHWA 2ITMA 3CERA 2Q2RA 4OPKA 3LALA 3VQEA 3OYHA 2ZQBA 4DU3A 3WXLA 4BRDA 5M1FA 4N5SA 1EP4A 4PKHA 5JLHA 3IS9A 4CEZA 2IOCA 4DB3A 3B8AX 3EKUA 1ZYQA 3BF1A 2ASMA 5FLXO 4HWIA 4CJLA 4EHUA 3O9SA 5AQNA 1CZAN 4OLAA 4JYAK 1Q81O 4WFBL 3Q7BA 3VQPA 3WXJA 3RMDA 4OGCA 4KH4A 1YTAA 5AQTA 2NRXA 4CFBA 2CGLA 1JCFA 3N4PA 4M3RA 4FJ7A 1FJGK 3UB5A 3KLEA 5FPMA 4B9SA 3UKRA 4H5NA 4JS4A 3OYKA 1NJYA 4CJQA 1CXQA 4M63C 2XHBA 5AQYA 3VGKA 4AHRA 2P9LB 4YOXA 4E3SA 5M1OA 3OJSA 4CEBA 1KVBA 1RBTA 1U45A 3M8RA 3MXJA 2YHBA 4DV5K 3J7ZO 3QFUA 3LANA 3OYCA 1XMQK 3U3YA 4FW1A 1ZBIA 3ZT4A 1KFDA 4CERA 2UUBK 4LY7A 3CCJN 4FWKA 3CFOA 4CIGA 2IS3A 4YDUA 3TSPA 5AQPA 1U2VA 4CEOA 3FZLA 1ZBFA 3IDHA 4CIEA 4H4MA 4B9NA 3DRSA 3OYEA 4B9TA 4DV7K 2YI1A 2HVIA 4BRHA 4IO9L 2P9KA 4KFBA 5BPMA 1N34K 3K9KA 4YY3K 4DFPA 4FJLA 4LC9B 5JS1A 3QO9A 1BI4A 4H5VA 3KLFA 1U47A 4IKFA 3KLHA 4A2AA 3UKRB 4J8FA 2HHXA 3LAKA 3V4IA 1C1AA 4CZJA 4KPYA 3CJ1A 3ZT1A 3F2KA 2R7YA 1KCFA 3KLIA 3L2RA 1HNXK 2E1ZA 3EZ5A 4B9UA 5C12A 4E7JA 3PX0A 3V9UA 4M41A 2QKBA 3LDNA 4QOZB 4O8UA 4HHTA 4HUGA 2YX6A 1FW6A 2QWRA 3VQQA 3O08A 4MDAA 4XH1A 3CCEN 2UUAK 4E89A 4FJ8A 1TAUA 3P5JA 1HNZK 3AGRA 3ATUA 4BRNA 4A62A 4YOWA 2P9NA 1IKXA 5CYMA 4I6MA 4H0XB 3O3HA 1U6ZA 4JEPA 2O8EA 1RT3A 1U2VB 2Q1NA 3G25A 3HM8A 5CR4A 4FCYA 3UKUA 1W0HA 1NMNA 3VQ8A 2P9IA 5TKWA 4MLHA 3ZT3A 4FO0A 1SQKA 2P9KB 5LJWA 3GL1A 3OYLA 1VRTA 1T8EA 1VK0A 3SMSA 3MWPA 1BI4B 4BRKA 1WN7A 3P83D 1JLAA 4AQYK 4JS5A 1NGIA 4RWTA 4Y0WA 2WOMA 5JMVA 3WQTA 1S5JA 5EOYA 3CC7N 4FWMA 2YKMA 4IFYA 4DMNA 4ISEA 5LMNK 3ZSOA 1IG9A 1RGIA 2P9PB 3OYFA 4A61A 3HSTB 1ZXOA 3S41A 4DTOA 4YORA 4CZHA 2FF3B 5BPNA 2F96A 2O8DA 3D0PA 3AARA 2P9NB 3MECA 3KHYA 3MXIA 1V4SA 1S9EA 1CLQA 3AA5X 3WUHA 3QNOA 1T7PA 3AO3A 4FWQA 1YJWN 1HQUA 1X9JA 1CXUA 1HJOA 2D0AA 3VMFB 2FXUA 4GVMA 3ZSQA 3MCAB 1TKZA 3TPQA 3VEYA 2VYPA 5CZ2A 4IOCL 5HRSA 5BN9A 2G8KA 3CPWM 1YI2N 3DLBA 4B9VA 1RBUA 5ADXA 1QQNA 3O9TA 4JLHA 3DWLA 4JKDA 4W5OA 1NK7A 4LF7K 2YNFA 3CJAA 5AQOA 3SBGA 1J5EK 3SPZA 4E0DA 4ISFA 2F7TA 3S3MA 2JLEA 4RCHA 3VQ5A 1BQNA 4CGJA 1U49A 4LF9K 2OPQA 1RILA 4CK2A 1RT6A 3VERA 3LL3A 1QZ5A 1W9HA 3THVA 3HPGA 1TL1A 4M3TA 1VQPN 4NYFA 4X66K 1IBKK 4BE0A 1LWEA 2AP1A 3KKRA 4WQ5C 5AQJA 4CFCA 2F8TA 3ULEA 2V51B 4DSLA 5FPDA 1K8KB 2V7YA 2W6KA 2Z1IA 4FYDA 5E26A 3GDQA 3QLHA 4ISGA 2QI2A 1NKEA 4CJ4A 3HYFA 4CBUA 2PYLA 4DUZK 2B5JA 1NOZA 4H03B 3C94A 3C0BA 1S22A 4DHYA 3E9LA 3I55N 3BF3A 3LDQA 2RE2A 4H5WA 2OPRA 3ZX3A 4IZ9A 1WB9A 4KKOA 1B9FA 4MDBA 4FVUA 4JHDA 4DF8A 3NH1A 1DT9A 4I9LA 3RSEA 3HM9A 2IVOA 4XIUA 3OVNA 1WSEA 3WEEB 3O4NA 4FWNA 3KWGA 3MX5A 2XRIA 2OTLN 1RT4A 2Y1IA 4HTUA 4CECA 1GLJO 5GINA 3ZLJA 4DSIA 1VSKA 4NO7A 1VAZA 3AVLA 1QQCA 1TK0A 2DFFA 2XY8A 3VQDA 2ASPA 4RW6A 3CXCM 1QHTA 3DRRA 3DLHA 3BY5A 2VWKA 1N8RO 4A57A 1VQ5N 4AM6A 3DOKA 3LP0A 4AHTA 3KK3A 4B3OA 3HSCA 5AQZA 2DY4A 3HOSA 4BVOA 3AO1A 4B1VA 2KZMA 1JLFA 5FRNA 1RDWX 1RBSA 3V9ZA 3TWHA 4G1QA 4LFBK 4CJ5A 2FLOA 3S9HA 4I2QA 3PSIA 3DYAA 1ZBUA 4A2BA 1QVGM 4X65K 5AQVA 4R5PA 3KD1E 4X64K 2Z1HA 2HBKA 3QB0A 3EY1A 1JCGA 4HCBA 2QXLA 3OBWA 1UA0A 4CZFA 1OKJA 1XHXA 4OLBA 4GY2B 3KLGA 1TV6A 2D0BA 3H3NO 1EO1A 1KAZA 2ZGYA 4BG8A 3AVFA 3V81A 4KRFA 4CE9A 1JLCA 4CHQA 5KPZA 4DF4A 1J53A 4DV6K 1LWCA 4TSXA 3LWLA 1BOTO 2P9SB 1VSLA 1RT7A 1GOBA 3K5OA 3TI0A 3RMAA 4Z4CA 3NGIA 3CG7A 3H1QA 4DTNA 1QZ6A 1HLUA 2D0PA 3QEVA 1Q9YA 4DFKA 3ULDA 3TSQA 2G8VA 1VQ7N 2BUPA 4NXNK 1S6PA 3FFIA 3VESA 3DLRA 3VF6A 4DS5A 3OYGA 3LPUA 1G15A 2OCEA 4BRMA 3QBWA 2GUPA 4K43A 4BC5A 1T44A 4I7FA 3PUFA 4BE1A 4PQUA 2FSNA 3AVGA 4DSJA 2XY6A 4JI0K 3TAPA 3ENOA 4PY5A 4DLGA 1XWLA 3IRXA 3GE1A 4B08A 4CCHA 3Q7CA 1L5UA 2HVHA 3DXMA 4CVNE 3SUOA 1X9MA 2O8BA 2W42A 2V7ZA 3DXKA 1JLBA 2QWPA 4QS8A 4C1NI 3BZCA 5EU7A 3CCVN 4BRCA 3HTVA 4BC3A 3NBPA 3L0QA 3KWIA 4BY9C 3D2EA 2ZD1A 2YJFA 2O8FB 5D3GA 2OANA 1KLNA 1R0AA 4LSLA 2O8CA 3DRPA 3O4WA 4JAXA 3OYNA 4NCBA 1IG8A 2KKZA 2FBXA 4NXMK 4U7BA 5F1XA 1HMVA 4WQ5A 1QS4A 3SZ2A 5EY4A 3QEIA 2RF2A 4IDHA 4K41A 3M8QA 1YXQA 3ZSZA 3V6DA 4BRLA 3A2FA 3VQCA 2E8AA 4CHNA 1NU0A 4BRQA 3J81O 2F9TA 4LD0A 4GMJB 4BC2A 1TVRA 2O8BB 5KRSA 2PY5A 1VQ6N 1KTQA 3DXKB 2IIRA 4GNIA 5KTQA 4C8MA 2V52B 1BA1A 4CHPA 3KIOA 1DTQA 2HHTA 3DLEA 3TABA 3CCMN 4B3RK 5M1KA 2NUBA 1BWFO 4XH4A 3TTCA 2P9UA 4H0VB 2VQFK 3D2EB 3THYB 2YV0X 4C8OA 2PYJA 1B92A 4GW6A 4NLBA 1XNQK 2G8HA 1IBLK 1VQ9N 2VGMA 4GKJK 4GV6A 5IWAK 4DV0K 4CI6A 2GTDA 1S1TA 4H5TA 3TAEA 1Y64A 3CFPA 3SAGA 1ZBSA 5LY3A 1J54A 2Q0UA 2ZE2A 2FBTA 4H0PA 1MDUB 1QSLA 4L8RB 4CJFA 3SJJA 4DTMA 1I94K 4FOIA 4RW4A 4ZHRA 2ZWHA 4CJKA 1KFSA 3RRHA 1EETA 4B9QA 4PKGA 1BCOA 3MEEA 4DR2K 1NLVA 2QWLA 4DV4K 4O0JA 1EKEA 2P1JA 3NE6A 4DSKA 2RN2A 5DK5A 3VA0A 4E7HA 2FBVA 3K5MA 5B8HA 1N5YA 4DKWA 2Q36A 1S1VA 5LMUK 2P9UB 5AQQA 4DV2K 1JCEA 3U4LA 3OYDA 1C1BA 4DFMA 1YTUA 2A1RA 1E4FT 3I8BA 4CJTA 3AA2A 5KGXA 2A1SA 4DQSA 2RKIA 2VGNA 2F9WA 4ELUA 2JWLA 3L2UA 3P31A 1CZ9A 3QETA 3D7EO 2E5LK 3HI0A 3KK1A 3HP9A 1XQSC 1RDBA 1P90A 1N33K 4CD1A 3KK7A 5KGWA 3MX2A 3HP6A 3QERA 3AVIA 4M3YA 2DTUA 3ZEUB 1W97L 2HNDA 4E1MA 1UOCA 3A0IX 1KSPA 2KFNA 4V19S 4DU1A 1S3XA 1TGOA 1E3MA 4DSEA 1T03A 3VQ6A 1MWKA 3VETA 3OYIA 1IKYA 1IJJA 1TK5A 3HXMA 4DU4A 1WSJA 3E01A 3RTVA 1DKGD 2YNHA 3K59A 1QTMA 1FK9A 2UYTA 3SUQA 3FGUA 1ATNA 3MDQA 4PL7A 5GIOA 1FXXA 3BP8A 2OA8A 3SQ2A 1HKGA 2KZZA 1GLEG 4IFVA 3B6OA 4BR5A 4WQ4C 4FJJA 4Q5VA 1C6VA 2A40A 4CBWA 3C6UA 4DTUA 3L2VA 3NHGA 4RW9A 1KQSM 3I33A 2HNZA 2Q97A 5AZJB 4IWVA 3EE8A 3M5RA 5EVZA 4ILJA 3J7YP 4FZXC 2G8IA 4FLXA 3O1BA 3AAQA 4WF9L 3PY8A 3QIOA 1WBBA 1Q7YO 1C0GA 2BDPA 2P9PA 2D5RA 2B6AA 1J9AA 1JLGA 4KTQA 4UQGA 2OZMA 5C25A 4BE2A 4FXDA 1BISA 3LDOA 4DTXA 3ID6A 3C7NA 4M3ZA 3AO2A 2ASOA 1GLCG 4C8LA 3R8EA 3IKMA 1DLOA 4CEDA 3J80O 1JLEA 4BQZA 3UE5A 4IFEA 3FR0A 4HVJA 1UA1A 1NK4A 3VTIA 5C2DA 4CJPA 3ITHA 3EO3A 4CJVA 1LWFA 3FLCO 3LM9A 1VSEA 3T69A 1WSGA 5KPTA 3PO4A 3SAHA 3VN5A 4WYBA 4BRAA 2IVNA 5C10A 3LZJA 4FLYA 1HYZA 2GWKA 4WFAL 4A5BA 4GV3A 4JK8A 4OPAA 2HHVA 5I9EB 4EFHA 1V4TA 4QS7A 3ZX2A 4DQQA 4E7IA 4BG9A 3VQ9A 3QEWA 1NG9A 3P4IA 3M8SA 3WNEA 3U9DA 2UXBK 1NGAA 1MU2A 3SV4A 4JRPA 3OTOK 4G9ZA 1HUXA 4FK2A 1OH8A 4NCAA 4RG8A 3C7NB 3AO4A 1JXEA 1WSFA 1A5VA 1NJXA 3QMLA 3MN6A 4JI6K 1XHZA 4KREA 1A5WA 3A5LC 2YNGA 3BGRA 2Y1JA 1TUUA 5BRFA 2G8WA 1VSIA 4CJWA 3WXMB 4KHQA 3O9RA 1NKBA 3UIQA 1TL3A 1UAXA 3PIOL 1REVA 1K8KA 2HOEA 1SZ2A 1EWQA 4GVEA 1KVCA 2UXDK 1HJRA 4IJAA 1LOTB 3C6HA 3D45A 1MA9B 5LL6Z 5GADP 5H1SQ 3CF5L 4KHYA 3CYMA 5M1NA 1J5OA 5EXWA 4ID5A 1OH5A 2NZTA 2WFBA 3WXIA 3TAMA 5JVHL 4OX9K 3WXKA 3E9PA 4B9MA 4FLWA 2VWJA 3L3VA 4FLUA 1S9GA 3A5OC 3NF7A 3ASMA 3PLAA 3JAMO 1VSDA 3BDPA 3WEEA 3U6FA 4FWLA 3U3GA 3HT3A 3HO1A 3E1YA 1WNSA 4AHVA 4DQIA 1WOQA 1Z05A 3GBTA 1VSHA 1LW0A 3ZSRA 4H0TB 4DS4A 2ZJPL 1WUAA 1QVFM 4QS9A 2ZJRL 3D2FB 4OO1J 4JRQA 2A3ZA 4F2RA 1DEJA 1IO2A 1C0TA 1NGCA 4W5RA 5JICA 4CBXA 3VEXA 4ELTA 1BDGA 1NGJA 4CEAA 1RBRA 4IDKA 2QKKA 4X62K 3DLKA 3WNHA 4DSFA 2HHQA 3THWA 3EE9A 3O5BA 2E2QA 1QHAA 5KRTA 4FJKA 1ASWA 3AAPA 1S1WA 5DM7L 3KJVA 1HR0K 4AILC 3VF2A 5C15A 4F2SA 4J2DA 4BDZA 2E20A 1P8ZA 3PV8A 1HPMA 1HKBA 4WQ4A 4FOEA 2UUCK 2X6SA 4J2AA 5IT9O 1ASVA 2WBNA 4H4OA 4DV3K 5AQRA 4EAHD 4C8NA 5HL7L 1TKTA 1VHXA 3C65A 5K14A 2GWJA 5DM6L 5HOOA 3DLLL 1BIZA 2HBMA 3SLCA 2QWQA 1SL2A 1NKCA 3ZSXA 3NH0A 2P9SA 4O44A 3LDSA 3K58A 1KRPA 1ZBLA 3MN5A 3P38A 4XH5A 3SAFA 1NGHA 3J7AP 3G0ZA 3O8MA 4MFBA 3KKSA 4N41A 2VG5A 4LF5K 1J6ZA 4N47A 1QQMA 3A8YA 4YOYA 1E4GT 4BGAA 1HNVA 4CEQA 1BIUA 2IGIA 1HNWK 4NYNA 3DI6A 2DPNA 2KHOA 3LZIA 3R1XA 3THWB 1KC8O 1VSMA 4DR4K 1G99A 3FZKA 2I5JA 3HL8A 4E1NA 3W3DA 4B1YB 2HMIA 3F9KA 2X74A 1NK5A 2P5GA 3ZYYX 2HF3A 1K6YA 4RTFD 3K5LA 3SNNA 2QTDA 1NGFA 1OH6A 3CC4N 5BRDA 4O55A 3F73A 1JL1A 4JI3K 1LAVA 2FC0A 4JI1K 3VQAA 3JXUA 1TYQB 1ZBHA 3AVNA 3AGKA 1D9DA 3L2WA 3S3OA 2HBJA 2ZJQL 2GX9A 3KZBA 1HYSA 1VSJA 3QICA 1BQMA 4O0IA 1TKDA 4FK0A 5AQLA 1SKSA 4B1WB 3VTHA 4KI6A 5GAEP 5A2QO 5TKYA 4CF9A 1ATRA 2O8FA 1EXQA 4CF2A 1RTJA 2HNYA 3A5MC 4KI4A 4F8RA 2E88A 3IUCA 4CK1A 4JNEA 4KBOA 4Z0UA 4FM2A 3QFPA 5I3UA 2XY7A 2X6NA 3DOLA 4IXCA 4JN4A 1M1KO 4OJRA 3AVHA 4K0KK 1KD1O 3QNNA 1NGEA 3V9XA 5FDLA 4CF8A 4CZLA 4DQ8A 5HRPA 2WUSA 2ZM6K 2HSTA 1ITGA 4DV1K 4BR4A 3O4QA 3DMJA 3OHRA 1VSFA 3FZMA 4DG1A 4FJIA 5HRRA 1VQNN 2ITGA 3HK2A 1NGGA 4JKGA 3CCSN 5AJ3K 4KH5A 1BL3A 5J2NA 4CZIA 2OZSA 2DFHA 3CJ9A 4OGEA 2YCHA 5J2QA 1T6CA 3OBYA 1OH7A 5AZIB 5FPNA 4KAZA 2QXFA 4W5NA 2VG7A 4FL9A 3I56N 3JSMA 3PX4A 3BZKA 2J4RA 3M3ZA 3NFAA 1QSYA 4DTJA 4DQRA 3THYA 1RFQA 4FZZA 3DJCA 5SWMA 1FKOA 3KK2A 4DTSA 4BQLA 1OVQA 1D5AA 3KD5E 4IBNA 5M1QA 4DUYK 4W5QA 4O4GA 1KVAA 3V1OA 5HRNA 2NRTA 4EHTA 4CJSA 2Q3SA 3OYMA 3O6WA 3O1WA 4CW7B 1O1WA 5KPRA 3G10A 1XI1A 1QQOA 1Z26A 4DWIA 1YF5L 3VENA 4JKGB 5BR9A 3CPEA 3AO5A 3C6TA 1HNIA 4CIFA 1XC9A 1SL1A 1GLLO 3OS1A 3G71N 3O3GA 3HVTA 3EZWA 1TUYA 2VQEK 3RMCA 3L3UA 5AFUH 1R59O 3MWTA 1LCUA 3RR8A 4KHWA 3H08A 4FJXA 1Q8IA 4LF8K 2YJEA 3T1YK 1I3AA 3VQBA 4HCCA 5CE3A 5AQGA 4Z94A 3ISNC 4ZTFA 4C23A 1YIJN 3GOIA 5AQHA 4KB0A 1YJNN 5CHIA 4IG3A 3MEDA 1RNHA 3TAGA 3RMBA 3FZHA 4JKAA 4EIAA 2O4IA 4CEEA 4DTPA 4DR1K 1X3NA 4BC4A 1JXBA 1HYVA 2QWNA 4CFAA 2I7NA 3VPZA 1BCMA 2HHUA 4BRFA 3AVMA 3U8XA 3NGYA 1B9DA 4OVLA 1Q86O 2YHXA 3SV3A 1ESVA 3T1HK 3SQ4A 4JKFA 1UWBA 3WQUA 4F9OA 4ICLA 4CF1A 4JKBA 3ZEUA 4FLTA 5F2RA 4H8KA 3NMUA 3I8DA 3CCQN 1GOAA 1SAZA 2YHAA 3LP2A 1RT2A 5AQIA 3M1FA 1D4XA 3KVGA 2O4GA 3L2QA 2ZF5O 4BRGA 4KV8A 3EL2A 1VQLN 4BDYA 3MN9A 2NLXA 4FLZA 1K8AO 2NNWA 4BDPA 3SMPA 1W7AA 1W2BM 2E2NA 3U9ZA 5E41A 1S72N 4N76A 3LP1A 4CJUA 3VEZA 4KHPK 1K9MO 2IVPA 1VQKN 5AQXA 2XO7A 3LDPA 3MAQA 2A41A 5HROA 1SS6A 3H45C 5AQWA 4FVMA 3ZSYA 4FSVA 2I7PA 3MK6A 3K57A 3THXA 2CGKA 4MO4A 2HMPA 3HOTA 2VCPA 5AZJA 5E84A 4CJ7A 4BR2A 4QAGA 1YT3A 4W5TA 3M6GA 3TTDA 4FZYA 4BVPA 3OY9A 1VQMN 3CCLN 4B1UB 3VEWA 5BREA 3DLGA 5CZ1A 2HHSA 3FZFA 3NCIA 1A5XA 3CM5A 4CEFA 2W40A 4FJGA 1NOYA 2JGUA 3HVRA 4XEIA 4C8KA 3NDKA 4MQ3A 2P51A 2ZGZA 2GV9A 3CJBA 2ETJA 3R9PA 5C2FA 2RPIA 4KH6A 2QWOA 4EP5A 1RDAA 1JKHA 3VQ4A 3W0LA 3CQYA 3I0RA 3QESA 1NK8A 3SK3A 3AA4A 5I42A 5J1EA 3TAQA 3FE1A 5HBMA 4N56A 3THXB 4Z4EA 2QEXN 2QW9A 1RDCA 5M1PA 2A5XA 4LH5A 3T7ZA 4CGGA 1SKRA 3CCUN 4JI4K 3TU5A 3ZT2A 4IJNA 3CHWA 3EYZA 3CCRN 4KHSA 4UY8O 4ILHA 1U04A 1TAQA 4KHUA 2Z1JA 3T1AA 3VQ7A 3CMEN 4IOAL 1QSSA 4WE1A 2KTQA 4Z4HA 3G4SN 3TSUA 4PHTX 2PBDA 3HZ6A 4PWDA 1EQYA 1N32K 2PZSA 4DFJA 3OA9A 3JYTA 2A42A 4DTRA 5J2PA 1C0FA 3ALYA 1RDUA 4ID1A 4QCLA 2UXCK 1K73O 5T7BA 3ATVA 4O5BA 5EX5A 2A6AA 4RW8A 4CFDA 1RTDA 2NRWA 1NMDA 4F3TA 4IEEA 3SJHA 3E9OA 2JWKA 1KAYA 3H46O 1IV0A 5BR8K 3RR7A 4M7YA 2E1YA 4LFCK 1JJ2M 2G8FA 3MEGA 3SCXA 1YJ9N 1WSIA 4CGDA 4B3TK 4ZTJA 1F21A 1S1XA 3IG1A 2E6LA 4CHZA 3TR8A 4FWPA 3L4IA 2G8UA 3V1QA 3CFRA 1Q9XA 1ZC6A 3AV9A 2E2OA 4FPAA 3SBTA
chains in the Genus database with same CATH topology
4OLAA 4C8NA 5EU7A 3ZSVA 1ASUA 1TKTA 2FBYA 5K14A 3VQPA 4B9LA 2OYQA 2ATQA 1BIZA 3V9WA 3RMDA 4OGCA 1YTAA 3SUPA 3NBPA 1SL2A 4CFBA 3HJFA 3SI6A 2AJQA 4M3RA 1LAWA 1NKCA 1JLQA 3ZSXA 4FJ7A 3NH0A 4O44A 3LDSA 3K58A 1KRPA 1ZBLA 2ZD1A 3RWUA 1HPZA 4CESA 3SQ1A 3KLEA 4B9SA 5D3GA 1IKWA 2X78A 3OS2A 1KLNA 3G0ZA 4MFBA 4JS4A 1R0AA 4I9QA 4LSLA 2HW3A 3OYKA 1NJYA 3KKSA 4CJQA 1CXQA 3KTQA 4N41A 3DRPA 1NK0A 2VG5A 2XHBA 4N47A 4Z4IA 4OPJA 4AHRA 2GUIA 4OKEA 3OYNA 4E3SA 4NCBA 3OJSA 4OKKA 4CGHA 1HNVA 4CEBA 4CEQA 1KVBA 1BIUA 1RBTA 2FBXA 2IGIA 1WLJA 3M8RA 1U45A 4NYNA 3DI6A 4FJ9A 4Y1DA 1HMVA 3MXJA 3LZIA 1QS4A 2YHBA 3QEXA 3SZ2A 1RT5A 3LANA 3OYCA 3QEIA 1VSMA 2RF2A 3U3YA 1TK8A 4FW1A 3M8QA 1ZBIA 3ZT4A 1KFDA 3ZSZA 2I5JA 3HL8A 4KB1A 4CERA 4E1NA 3V6DA 3OYAA 1L3TA 3A2FA 3VQCA 4CHNA 4AH9A 4LY7A 4YFUA 3CFOA 2KFZA 4KO0A 3F9KA 2X74A 2IS3A 4CIGA 1NK5A 2HMIA 2P5GA 5SZTA 4LD0A 1K6YA 4GMJB 2KQ2A 1TVRA 3K5LA 3SNNA 1IKVA 1RDDA 5KRSA 2PY5A 1KTQA 4O55A 4CEOA 5KTQA 1ZBFA 3F73A 2OPSA 4CIEA 1JL1A 4H4MA 4C8MA 4B9NA 2HB5A 3DRSA 5FROA 3T3FA 3IAYA 4CHPA 3OYEA 1LAVA 3KIOA 4B9TA 1DTQA 2FC0A 2HVIA 2HHTA 3DLEA 3TABA 3VQAA 4KFBA 1ZBHA 5CY4A 2NUBA 4DFPA 4FJLA 5J2MA 5JS1A 3AVNA 1HRHA 3QO9A 1D9DA 1BI4A 3L2WA 2KW4A 3KLFA 4EZ6A 3S3OA 1U47A 4IKFA 1FKPA 2YV0X 4C8OA 2PYJA 3KLHA 1HYSA 3I0SA 2DFEA 3LAKA 3V4IA 1B92A 4F8RA 2HHXA 1VSJA 1C1AA 1D8YA 4GW6A 4DQPA 1BQMA 4O0IA 1TKDA 4KPYA 3ZT1A 1SKSA 4FK0A 4KI6A 2R7YA 2G8HA 1KCFA 3KLIA 3L2RA 3EZ5A 5HLFA 4CF9A 4B9UA 1EXQA 3ZT0A 4CHOA 4CF2A 3NAEA 1RTJA 2HNYA 4E7JA 4KI4A 1S1TA 3TAEA 3PX0A 5JS2A 3V9UA 3V1RA 2XY5A 3CFPA 4M41A 4AHSA 2OPPA 4CK1A 2QKBA 4QOZB 4HHTA 4Z0UA 4HUGA 4FM2A 3LWMA 5I3UA 2XY7A 3VQQA 1J54A 2X6NA 3DOLA 2F8SA 2ZE2A 2FBTA 3AVHA 4OJRA 4E89A 4FJ8A 1QSLA 4L8RB 1TAUA 3P5JA 4CJFA 3QNNA 3V9XA 5FDLA 4CF8A 3SJJA 4K8ZA 4DTMA 5HRPA 3TANA 4IG0A 3SPYA 4RW4A 4DLEA 4ZHRA 3PX6A 4CJKA 1KFSA 1ITGA 2P5OA 1IKXA 3RRHA 3O4QA 3DMJA 1EETA 1VSFA 5CYMA 4DG1A 4FJIA 3O3HA 1BCOA 5HRRA 3MEEA 2ITGA 3HK2A 1RT3A 4O0JA 4FCYA 1EKEA 2P1JA 1BL3A 3ZCMA 1W0HA 5J2NA 4E7LA 2OZSA 2DFHA 4Y1CA 3QINA 3VQ8A 2RN2A 4OGEA 5DK5A 4BWMA 3NE6A 3VA0A 2FBVA 3K5MA 4B8AB 4E7HA 5J2QA 4FJNA 3ZT3A 4F4KA 1N5YA 2BANA 1S1VA 1RTIA 3OYLA 1VRTA 1T8EA 1VK0A 4KAZA 1NJZA 1BI4B 2QXFA 3OYDA 1C1BA 4W5NA 2VG7A 1WN7A 4DFMA 1YTUA 2A1RA 4BWJA 3P83D 1C0UA 3HPOA 3JSMA 4CJTA 1JLAA 3PX4A 3AA2A 5KGXA 2A1SA 4DQSA 4JS5A 2RKIA 4ELUA 4HUEA 1HQEA 3NFAA 3NF9A 4DTJA 1QSYA 2WOMA 3L2UA 4DQRA 1YVUA 1S5JA 3OS0A 3QETA 4FZZA 2YKMA 3AVJA 4IFYA 4DMNA 3HP9A 5SWMA 3KK1A 1IG9A 3ZSOA 1RDBA 1FKOA 3KK2A 4DTSA 3NH2A 3AVCA 3OYFA 3T19A 1D5AA 3HSTB 3KD5E 4IBNA 4W5QA 4DTOA 5KGWA 4O4GA 1KVAA 2E4LA 3V1OA 5HRNA 3HP6A 5C42A 2F96A 4CJSA 3AVIA 2Q3SA 3OYMA 3QERA 4M3YA 2DTUA 4M3XA 4K8XA 2HNDA 4E1MA 1O1WA 1UOCA 4FJMA 1KSPA 3D0PA 2KFNA 3MECA 4DU1A 3MXIA 1TGOA 3G10A 1XI1A 4DSEA 1T03A 3VQ6A 1Z26A 3OYIA 1SV5A 3DM2A 4DWIA 1IKYA 1S1UA 1S9EA 1CLQA 3AA5X 3HXMA 1TK5A 4DU4A 3QNOA 1BHLA 1WSJA 3AO5A 3C6TA 1HNIA 3E01A 4CIFA 3RTVA 1XC9A 1T7PA 3AO3A 2YNHA 1SL1A 3OS1A 3O3GA 3K59A 1HQUA 4F3OA 3HVTA 4FK4A 1CXUA 1DTTA 1QTMA 3RMCA 1FK9A 3SUQA 3L3UA 2D0AA 3WNGA 4M42A 1RCHA 1NJWA 4GVMA 2Z1GA 1I39A 3ZSQA 1FXXA 3RR8A 1TKZA 3H08A 2OA8A 4FJXA 3O3FA 4J2BA 4KHWA 2QK9A 1EX4A 1Q8IA 5CZ2A 4CHYA 5HRSA 1Y97A 3SQ2A 1I3AA 2G8KA 4ELVA 2KZZA 4IFVA 3VQBA 4BACA 4HCCA 3B6OA 2GBZA 5CYQA 4FJJA 1QE1A 1C6VA 3ISNC 4Q5VA 4ZTFA 3DLBA 4B9VA 1NK6A 1RBUA 2IDOA 3C6UA 4DTUA 4KB0A 3L2VA 4JLHA 4IG3A 3NHGA 4RW9A 3MEDA 4W5OA 1RNHA 2HNZA 3TAGA 1NK7A 5DMRA 3RMBA 4M3WA 5FRMA 1KLMA 2YNFA 1GOCA 2G8IA 4FZXC 2O4IA 4CEEA 4FLXA 3SYZA 3SPZA 4E0DA 4DTPA 3S3MA 2JLEA 1L3VA 1JXBA 2IC3A 1C0MA 1HYVA 3QIOA 2E6MA 3VQ5A 4CFAA 1BQNA 4EP4A 1BCMA 3PY8A 2HHUA 4CGJA 2BDPA 1U49A 3AVMA 2D5RA 3K2PA 1U4BA 2B6AA 3NGYA 1J9AA 1JLGA 1SKWA 4KTQA 1B9DA 2OPQA 4OVLA 4UQGA 5C25A 3SUNA 1RILA 4BE2A 2OZMA 1BISA 4M3UA 4M45A 4DTXA 3SV3A 5C24A 3LPTA 4CK2A 4FJHA 4M3ZA 4FM0A 3SQ4A 1RT6A 3AO2A 1UWBA 3VA3A 1W9HA 4ICLA 3HPGA 4CF1A 3THVA 1TL1A 4FLTA 4C8LA 4M3TA 4NYFA 3NF8A 4BE0A 4H8KA 1DLOA 1LWEA 4CEDA 3I8DA 1JLEA 3KKRA 1GOAA 3LP3A 4CFCA 2F8TA 2YHAA 4DSLA 5HP1A 1N6QA 4HVJA 3LP2A 2Z1IA 1RT2A 1UA1A 4FYDA 3QLHA 1NK4A 2O4GA 4CJPA 3ITHA 4CJVA 1NKEA 1LWFA 4CJ4A 3HYFA 4AHCA 1VSEA 3L2QA 2PYLA 1WSGA 2B5JA 1NOZA 4FW2A 3C94A 4KV8A 3VN5A 4E7KA 3AVAA 3PO4A 4BDYA 2LSNA 3AVBA 3LZJA 3V9SA 4FLYA 1HYZA 4FLZA 3M8PA 2OPRA 4CJEA 4BDPA 1L3SA 2HHVA 4I2PA 5E41A 1BGXT 2B4JA 3RRGA 4KKOA 3LP1A 1B9FA 4CJUA 4N76A 2YNIA 2XO7A 4DF8A 5KI6A 3NH1A 3MAQA 4DQQA 4I9LA 4E7IA 5HROA 3AA3A 2EX3A 3HM9A 4FVMA 3NF6A 4DSKA 3VQ9A 3ZSYA 3QEWA 4XIUA 3M8SA 1IH7A 4CK3A 3K57A 3L8BA 3WNEA 3OVNA 3P1GA 1WSEA 1MU2A 2BE2A 3OJUA 3SV4A 3OYBA 3O4NA 4JRPA 1X1PA 4QAGA 1YT3A 1Z25A 2XRIA 4CJ3A 1U48A 4J2EA 1RT4A 4B8CA 4W5TA 4CGFA 4NCAA 2Y1IA 4FK2A 4RG8A 4HTUA 4FXDA 4CECA 3AO4A 2D0CA 4KHNA 4DSIA 1JXEA 1VSKA 1WSFA 4FZYA 3WNFA 1RT1A 1A5VA 3AVLA 3OY9A 1QQCA 1TK0A 1NJXA 3B6PA 4KTWA 1XHZA 2DFFA 2XY8A 4KREA 1A5WA 2YNGA 3BGRA 2Y1JA 3CM6A 3DLGA 3VQDA 4RW6A 1WAJA 5CZ1A 2HHSA 1WSHA 1RTHA 2YKNA 2G8WA 1QHTA 1VSIA 3DRRA 4CJWA 3DLHA 3OYJA 3NCIA 4KHQA 1A5XA 1NKBA 3UIQA 4RW7A 2VWKA 3CM5A 1TL3A 1UAXA 4CEFA 2HHWA 1JL2A 1REVA 4FJGA 1NOYA 3S3NA 2JGUA 1T05A 3HVRA 3DOKA 3LP0A 1LV5A 4HUFA 1KVCA 4AHTA 3KK3A 1HJRA 4C8KA 3NDKA 4MQ3A 2P51A 1X9SA 4B3OA 2DY4A 2GV9A 1L3UA 3D45A 3AO1A 2ETJA 2KZMA 2RPIA 4EZ9A 2EHGA 1JLFA 4EP5A 5FRNA 3CQ8A 1RBSA 1RDAA 1JKHA 3VQ4A 4G1QA 3TWHA 4CF0A 3V9ZA 4KHYA 2WONA 3CYMA 4CJ5A 4E19A 1J5OA 3S9HA 4ID5A 4PUOA 4I2QA 3DYAA 3I0RA 3ZSWA 1ZBUA 3QESA 1NK8A 4NCGA 3AA4A 1TKXA 5I42A 1SL0A 5J1EA 4FM1A 3TAQA 4R5PA 3KD1E 4N56A 2Z1HA 5HBMA 3TAMA 3EY1A 4Z4EA 4HCBA 1UA0A 1RDCA 1D9FA 4CGIA 1XHXA 4OLBA 3KLGA 4LH5A 4CGGA 1TV6A 1SKRA 2D0BA 4B9MA 4FLWA 1RBVA 2VWJA 1X9WA 4Z4GA 1S6QA 1VRUA 4LH4A 3L3VA 2VG6A 4FLUA 4PA1A 3ZT2A 3QEPA 1S9GA 3NF7A 4CJRA 3AVFA 3V81A 1NK9A 3LAMA 4CE9A 2BGGA 1JLCA 3ASMA 4CHQA 4KRFA 4AHUA 3EYZA 4KHSA 4DF4A 1J53A 3BDPA 1VSDA 1LWCA 1U04A 4TSXA 1TAQA 3LWLA 4KHUA 1LW2A 2Z1JA 3U6FA 3T1AA 3VQ7A 1VSLA 1RT7A 1GOBA 3C95A 3U3GA 3K5OA 3HT3A 3HO1A 1QSSA 3TI0A 3RMAA 4WE1A 2KTQA 4Z4HA 4Z4CA 1WNSA 4AHVA 3HPHA 4DQIA 4FJ5A 3NGIA 3CG7A 3NGZA 4DTNA 3MXMA 1VSHA 4Z4FA 3K5NA 4PWDA 1LW0A 1C1CA 4FLVA 3ZSRA 4DFJA 2PZSA 4DS4A 3QEVA 3PO5A 3JYTA 1Q9YA 4LSNA 4DTRA 5J2PA 4DFKA 3ULDA 3AVKA 3ALYA 2G8VA 4Q0BA 4ID1A 4QCLA 1SUQA 5T7BA 4JRQA 3TARA 4F2RA 2IAJA 4O5BA 4YNQA 1S6PA 3FFIA 1IO2A 1C0TA 1CZBA 3DLRA 4RW8A 4CFDA 4W5RA 3OYGA 4DS5A 1WAFA 3LPUA 1G15A 4KTZA 4OKJA 3SQ0A 3TAFA 1RTDA 4ELTA 4CEAA 4I7FA 3QIPA 3PUFA 4F3TA 4BE1A 4PQUA 1RBRA 4IDKA 2QKKA 3DLKA 3WNHA 3AVGA 4OPKA 4DSFA 3LALA 2HHQA 4DSJA 3VQEA 3OYHA 2XY6A 3TAPA 2ZQBA 4DU3A 4FJKA 5KRTA 1ASWA 4N5SA 3RR7A 1S1WA 1EP4A 4PY5A 3KJVA 4F2SA 2G8FA 3MEGA 4DLGA 4AILC 3SCXA 4J2DA 1WSIA 1XWLA 3IRXA 4CGDA 4B08A 4BDZA 4ZTJA 1F21A 3IS9A 4CEZA 4CCHA 1S1XA 3IG1A 2E6LA 4CHZA 2IOCA 3TR8A 1L5UA 2HVHA 1ZYQA 3PV8A 2G8UA 3SUOA 3V1QA 1X9MA 2W42A 4CJLA 3CFRA 1Q9XA 3AV9A 1JLBA 2X6SA 1CZ9A 4J2AA 1ASVA 4H4OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OLA A;  4C8N A;  5EU7 A;  3ZSV A;  1ASU A;  1TKT A;  2FBY A;  5K14 A;  3VQP A;  4B9L A;  2OYQ A;  2ATQ A;  1BIZ A;  3V9W A;  3RMD A;  4OGC A;  1YTA A;  3SUP A;  3NBP A;  1SL2 A;  4CFB A;  3HJF A;  3SI6 A;  2AJQ A;  4M3R A;  1LAW A;  1NKC A;  1JLQ A;  3ZSX A;  4FJ7 A;  3NH0 A;  4O44 A;  3LDS A;  3K58 A;  1KRP A;  1ZBL A;  2ZD1 A;  3RWU A;  1HPZ A;  4CES A;  3SQ1 A;  3KLE A;  4B9S A;  5D3G A;  1IKW A;  2X78 A;  3OS2 A;  1KLN A;  3G0Z A;  4MFB A;  4JS4 A;  1R0A A;  4I9Q A;  4LSL A;  2HW3 A;  3OYK A;  1NJY A;  3KKS A;  4CJQ A;  1CXQ A;  3KTQ A;  4N41 A;  3DRP A;  1NK0 A;  2VG5 A;  2XHB A;  4N47 A;  4Z4I A;  4OPJ A;  4AHR A;  2GUI A;  4OKE A;  3OYN A;  4E3S A;  4NCB A;  3OJS A;  4OKK A;  4CGH A;  1HNV A;  4CEB A;  4CEQ A;  1KVB A;  1BIU A;  1RBT A;  2FBX A;  2IGI A;  1WLJ A;  3M8R A;  1U45 A;  4NYN A;  3DI6 A;  4FJ9 A;  4Y1D A;  1HMV A;  3MXJ A;  3LZI A;  1QS4 A;  2YHB A;  3QEX A;  3SZ2 A;  1RT5 A;  3LAN A;  3OYC A;  3QEI A;  1VSM A;  2RF2 A;  3U3Y A;  1TK8 A;  4FW1 A;  3M8Q A;  1ZBI A;  3ZT4 A;  1KFD A;  3ZSZ A;  2I5J A;  3HL8 A;  4KB1 A;  4CER A;  4E1N A;  3V6D A;  3OYA A;  1L3T A;  3A2F A;  3VQC A;  4CHN A;  4AH9 A;  4LY7 A;  4YFU A;  3CFO A;  2KFZ A;  4KO0 A;  3F9K A;  2X74 A;  2IS3 A;  4CIG A;  1NK5 A;  2HMI A;  2P5G A;  5SZT A;  4LD0 A;  1K6Y A;  4GMJ B;  2KQ2 A;  1TVR A;  3K5L A;  3SNN A;  1IKV A;  1RDD A;  5KRS A;  2PY5 A;  1KTQ A;  4O55 A;  4CEO A;  5KTQ A;  1ZBF A;  3F73 A;  2OPS A;  4CIE A;  1JL1 A;  4H4M A;  4C8M A;  4B9N A;  2HB5 A;  3DRS A;  5FRO A;  3T3F A;  3IAY A;  4CHP A;  3OYE A;  1LAV A;  3KIO A;  4B9T A;  1DTQ A;  2FC0 A;  2HVI A;  2HHT A;  3DLE A;  3TAB A;  3VQA A;  4KFB A;  1ZBH A;  5CY4 A;  2NUB A;  4DFP A;  4FJL A;  5J2M A;  5JS1 A;  3AVN A;  1HRH A;  3QO9 A;  1D9D A;  1BI4 A;  3L2W A;  2KW4 A;  3KLF A;  4EZ6 A;  3S3O A;  1U47 A;  4IKF A;  1FKP A;  2YV0 X;  4C8O A;  2PYJ A;  3KLH A;  1HYS A;  3I0S A;  2DFE A;  3LAK A;  3V4I A;  1B92 A;  4F8R A;  2HHX A;  1VSJ A;  1C1A A;  1D8Y A;  4GW6 A;  4DQP A;  1BQM A;  4O0I A;  1TKD A;  4KPY A;  3ZT1 A;  1SKS A;  4FK0 A;  4KI6 A;  2R7Y A;  2G8H A;  1KCF A;  3KLI A;  3L2R A;  3EZ5 A;  5HLF A;  4CF9 A;  4B9U A;  1EXQ A;  3ZT0 A;  4CHO A;  4CF2 A;  3NAE A;  1RTJ A;  2HNY A;  4E7J A;  4KI4 A;  1S1T A;  3TAE A;  3PX0 A;  5JS2 A;  3V9U A;  3V1R A;  2XY5 A;  3CFP A;  4M41 A;  4AHS A;  2OPP A;  4CK1 A;  2QKB A;  4QOZ B;  4HHT A;  4Z0U A;  4HUG A;  4FM2 A;  3LWM A;  5I3U A;  2XY7 A;  3VQQ A;  1J54 A;  2X6N A;  3DOL A;  2F8S A;  2ZE2 A;  2FBT A;  3AVH A;  4OJR A;  4E89 A;  4FJ8 A;  1QSL A;  4L8R B;  1TAU A;  3P5J A;  4CJF A;  3QNN A;  3V9X A;  5FDL A;  4CF8 A;  3SJJ A;  4K8Z A;  4DTM A;  5HRP A;  3TAN A;  4IG0 A;  3SPY A;  4RW4 A;  4DLE A;  4ZHR A;  3PX6 A;  4CJK A;  1KFS A;  1ITG A;  2P5O A;  1IKX A;  3RRH A;  3O4Q A;  3DMJ A;  1EET A;  1VSF A;  5CYM A;  4DG1 A;  4FJI A;  3O3H A;  1BCO A;  5HRR A;  3MEE A;  2ITG A;  3HK2 A;  1RT3 A;  4O0J A;  4FCY A;  1EKE A;  2P1J A;  1BL3 A;  3ZCM A;  1W0H A;  5J2N A;  4E7L A;  2OZS A;  2DFH A;  4Y1C A;  3QIN A;  3VQ8 A;  2RN2 A;  4OGE A;  5DK5 A;  4BWM A;  3NE6 A;  3VA0 A;  2FBV A;  3K5M A;  4B8A B;  4E7H A;  5J2Q A;  4FJN A;  3ZT3 A;  4F4K A;  1N5Y A;  2BAN A;  1S1V A;  1RTI A;  3OYL A;  1VRT A;  1T8E A;  1VK0 A;  4KAZ A;  1NJZ A;  1BI4 B;  2QXF A;  3OYD A;  1C1B A;  4W5N A;  2VG7 A;  1WN7 A;  4DFM A;  1YTU A;  2A1R A;  4BWJ A;  3P83 D;  1C0U A;  3HPO A;  3JSM A;  4CJT A;  1JLA A;  3PX4 A;  3AA2 A;  5KGX A;  2A1S A;  4DQS A;  4JS5 A;  2RKI A;  4ELU A;  4HUE A;  1HQE A;  3NFA A;  3NF9 A;  4DTJ A;  1QSY A;  2WOM A;  3L2U A;  4DQR A;  1YVU A;  1S5J A;  3OS0 A;  3QET A;  4FZZ A;  2YKM A;  3AVJ A;  4IFY A;  4DMN A;  3HP9 A;  5SWM A;  3KK1 A;  1IG9 A;  3ZSO A;  1RDB A;  1FKO A;  3KK2 A;  4DTS A;  3NH2 A;  3AVC A;  3OYF A;  3T19 A;  1D5A A;  3HST B;  3KD5 E;  4IBN A;  4W5Q A;  4DTO A;  5KGW A;  4O4G A;  1KVA A;  2E4L A;  3V1O A;  5HRN A;  3HP6 A;  5C42 A;  2F96 A;  4CJS A;  3AVI A;  2Q3S A;  3OYM A;  3QER A;  4M3Y A;  2DTU A;  4M3X A;  4K8X A;  2HND A;  4E1M A;  1O1W A;  1UOC A;  4FJM A;  1KSP A;  3D0P A;  2KFN A;  3MEC A;  4DU1 A;  3MXI A;  1TGO A;  3G10 A;  1XI1 A;  4DSE A;  1T03 A;  3VQ6 A;  1Z26 A;  3OYI A;  1SV5 A;  3DM2 A;  4DWI A;  1IKY A;  1S1U A;  1S9E A;  1CLQ A;  3AA5 X;  3HXM A;  1TK5 A;  4DU4 A;  3QNO A;  1BHL A;  1WSJ A;  3AO5 A;  3C6T A;  1HNI A;  3E01 A;  4CIF A;  3RTV A;  1XC9 A;  1T7P A;  3AO3 A;  2YNH A;  1SL1 A;  3OS1 A;  3O3G A;  3K59 A;  1HQU A;  4F3O A;  3HVT A;  4FK4 A;  1CXU A;  1DTT A;  1QTM A;  3RMC A;  1FK9 A;  3SUQ A;  3L3U A;  2D0A A;  3WNG A;  4M42 A;  1RCH A;  1NJW A;  4GVM A;  2Z1G A;  1I39 A;  3ZSQ A;  1FXX A;  3RR8 A;  1TKZ A;  3H08 A;  2OA8 A;  4FJX A;  3O3F A;  4J2B A;  4KHW A;  2QK9 A;  1EX4 A;  1Q8I A;  5CZ2 A;  4CHY A;  5HRS A;  1Y97 A;  3SQ2 A;  1I3A A;  2G8K A;  4ELV A;  2KZZ A;  4IFV A;  3VQB A;  4BAC A;  4HCC A;  3B6O A;  2GBZ A;  5CYQ A;  4FJJ A;  1QE1 A;  1C6V A;  3ISN C;  4Q5V A;  4ZTF A;  3DLB A;  4B9V A;  1NK6 A;  1RBU A;  2IDO A;  3C6U A;  4DTU A;  4KB0 A;  3L2V A;  4JLH A;  4IG3 A;  3NHG A;  4RW9 A;  3MED A;  4W5O A;  1RNH A;  2HNZ A;  3TAG A;  1NK7 A;  5DMR A;  3RMB A;  4M3W A;  5FRM A;  1KLM A;  2YNF A;  1GOC A;  2G8I A;  4FZX C;  2O4I A;  4CEE A;  4FLX A;  3SYZ A;  3SPZ A;  4E0D A;  4DTP A;  3S3M A;  2JLE A;  1L3V A;  1JXB A;  2IC3 A;  1C0M A;  1HYV A;  3QIO A;  2E6M A;  3VQ5 A;  4CFA A;  1BQN A;  4EP4 A;  1BCM A;  3PY8 A;  2HHU A;  4CGJ A;  2BDP A;  1U49 A;  3AVM A;  2D5R A;  3K2P A;  1U4B A;  2B6A A;  3NGY A;  1J9A A;  1JLG A;  1SKW A;  4KTQ A;  1B9D A;  2OPQ A;  4OVL A;  4UQG A;  5C25 A;  3SUN A;  1RIL A;  4BE2 A;  2OZM A;  1BIS A;  4M3U A;  4M45 A;  4DTX A;  3SV3 A;  5C24 A;  3LPT A;  4CK2 A;  4FJH A;  4M3Z A;  4FM0 A;  3SQ4 A;  1RT6 A;  3AO2 A;  1UWB A;  3VA3 A;  1W9H A;  4ICL A;  3HPG A;  4CF1 A;  3THV A;  1TL1 A;  4FLT A;  4C8L A;  4M3T A;  4NYF A;  3NF8 A;  4BE0 A;  4H8K A;  1DLO A;  1LWE A;  4CED A;  3I8D A;  1JLE A;  3KKR A;  1GOA A;  3LP3 A;  4CFC A;  2F8T A;  2YHA A;  4DSL A;  5HP1 A;  1N6Q A;  4HVJ A;  3LP2 A;  2Z1I A;  1RT2 A;  1UA1 A;  4FYD A;  3QLH A;  1NK4 A;  2O4G A;  4CJP A;  3ITH A;  4CJV A;  1NKE A;  1LWF A;  4CJ4 A;  3HYF A;  4AHC A;  1VSE A;  3L2Q A;  2PYL A;  1WSG A;  2B5J A;  1NOZ A;  4FW2 A;  3C94 A;  4KV8 A;  3VN5 A;  4E7K A;  3AVA A;  3PO4 A;  4BDY A;  2LSN A;  3AVB A;  3LZJ A;  3V9S A;  4FLY A;  1HYZ A;  4FLZ A;  3M8P A;  2OPR A;  4CJE A;  4BDP A;  1L3S A;  2HHV A;  4I2P A;  5E41 A;  1BGX T;  2B4J A;  3RRG A;  4KKO A;  3LP1 A;  1B9F A;  4CJU A;  4N76 A;  2YNI A;  2XO7 A;  4DF8 A;  5KI6 A;  3NH1 A;  3MAQ A;  4DQQ A;  4I9L A;  4E7I A;  5HRO A;  3AA3 A;  2EX3 A;  3HM9 A;  4FVM A;  3NF6 A;  4DSK A;  3VQ9 A;  3ZSY A;  3QEW A;  4XIU A;  3M8S A;  1IH7 A;  4CK3 A;  3K57 A;  3L8B A;  3WNE A;  3OVN A;  3P1G A;  1WSE A;  1MU2 A;  2BE2 A;  3OJU A;  3SV4 A;  3OYB A;  3O4N A;  4JRP A;  1X1P A;  4QAG A;  1YT3 A;  1Z25 A;  2XRI A;  4CJ3 A;  1U48 A;  4J2E A;  1RT4 A;  4B8C A;  4W5T A;  4CGF A;  4NCA A;  2Y1I A;  4FK2 A;  4RG8 A;  4HTU A;  4FXD A;  4CEC A;  3AO4 A;  2D0C A;  4KHN A;  4DSI A;  1JXE A;  1VSK A;  1WSF A;  4FZY A;  3WNF A;  1RT1 A;  1A5V A;  3AVL A;  3OY9 A;  1QQC A;  1TK0 A;  1NJX A;  3B6P A;  4KTW A;  1XHZ A;  2DFF A;  2XY8 A;  4KRE A;  1A5W A;  2YNG A;  3BGR A;  2Y1J A;  3CM6 A;  3DLG A;  3VQD A;  4RW6 A;  1WAJ A;  5CZ1 A;  2HHS A;  1WSH A;  1RTH A;  2YKN A;  2G8W A;  1QHT A;  1VSI A;  3DRR A;  4CJW A;  3DLH A;  3OYJ A;  3NCI A;  4KHQ A;  1A5X A;  1NKB A;  3UIQ A;  4RW7 A;  2VWK A;  3CM5 A;  1TL3 A;  1UAX A;  4CEF A;  2HHW A;  1JL2 A;  1REV A;  4FJG A;  1NOY A;  3S3N A;  2JGU A;  1T05 A;  3HVR A;  3DOK A;  3LP0 A;  1LV5 A;  4HUF A;  1KVC A;  4AHT A;  3KK3 A;  1HJR A;  4C8K A;  3NDK A;  4MQ3 A;  2P51 A;  1X9S A;  4B3O A;  2DY4 A;  2GV9 A;  1L3U A;  3D45 A;  3AO1 A;  2ETJ A;  2KZM A;  2RPI A;  4EZ9 A;  2EHG A;  1JLF A;  4EP5 A;  5FRN A;  3CQ8 A;  1RBS A;  1RDA A;  1JKH A;  3VQ4 A;  4G1Q A;  3TWH A;  4CF0 A;  3V9Z A;  4KHY A;  2WON A;  3CYM A;  4CJ5 A;  4E19 A;  1J5O A;  3S9H A;  4ID5 A;  4PUO A;  4I2Q A;  3DYA A;  3I0R A;  3ZSW A;  1ZBU A;  3QES A;  1NK8 A;  4NCG A;  3AA4 A;  1TKX A;  5I42 A;  1SL0 A;  5J1E A;  4FM1 A;  3TAQ A;  4R5P A;  3KD1 E;  4N56 A;  2Z1H A;  5HBM A;  3TAM A;  3EY1 A;  4Z4E A;  4HCB A;  1UA0 A;  1RDC A;  1D9F A;  4CGI A;  1XHX A;  4OLB A;  3KLG A;  4LH5 A;  4CGG A;  1TV6 A;  1SKR A;  2D0B A;  4B9M A;  4FLW A;  1RBV A;  2VWJ A;  1X9W A;  4Z4G A;  1S6Q A;  1VRU A;  4LH4 A;  3L3V A;  2VG6 A;  4FLU A;  4PA1 A;  3ZT2 A;  3QEP A;  1S9G A;  3NF7 A;  4CJR A;  3AVF A;  3V81 A;  1NK9 A;  3LAM A;  4CE9 A;  2BGG A;  1JLC A;  3ASM A;  4CHQ A;  4KRF A;  4AHU A;  3EYZ A;  4KHS A;  4DF4 A;  1J53 A;  3BDP A;  1VSD A;  1LWC A;  1U04 A;  4TSX A;  1TAQ A;  3LWL A;  4KHU A;  1LW2 A;  2Z1J A;  3U6F A;  3T1A A;  3VQ7 A;  1VSL A;  1RT7 A;  1GOB A;  3C95 A;  3U3G A;  3K5O A;  3HT3 A;  3HO1 A;  1QSS A;  3TI0 A;  3RMA A;  4WE1 A;  2KTQ A;  4Z4H A;  4Z4C A;  1WNS A;  4AHV A;  3HPH A;  4DQI A;  4FJ5 A;  3NGI A;  3CG7 A;  3NGZ A;  4DTN A;  3MXM A;  1VSH A;  4Z4F A;  3K5N A;  4PWD A;  1LW0 A;  1C1C A;  4FLV A;  3ZSR A;  4DFJ A;  2PZS A;  4DS4 A;  3QEV A;  3PO5 A;  3JYT A;  1Q9Y A;  4LSN A;  4DTR A;  5J2P A;  4DFK A;  3ULD A;  3AVK A;  3ALY A;  2G8V A;  4Q0B A;  4ID1 A;  4QCL A;  1SUQ A;  5T7B A;  4JRQ A;  3TAR A;  4F2R A;  2IAJ A;  4O5B A;  4YNQ A;  1S6P A;  3FFI A;  1IO2 A;  1C0T A;  1CZB A;  3DLR A;  4RW8 A;  4CFD A;  4W5R A;  3OYG A;  4DS5 A;  1WAF A;  3LPU A;  1G15 A;  4KTZ A;  4OKJ A;  3SQ0 A;  3TAF A;  1RTD A;  4ELT A;  4CEA A;  4I7F A;  3QIP A;  3PUF A;  4F3T A;  4BE1 A;  4PQU A;  1RBR A;  4IDK A;  2QKK A;  3DLK A;  3WNH A;  3AVG A;  4OPK A;  4DSF A;  3LAL A;  2HHQ A;  4DSJ A;  3VQE A;  3OYH A;  2XY6 A;  3TAP A;  2ZQB A;  4DU3 A;  4FJK A;  5KRT A;  1ASW A;  4N5S A;  3RR7 A;  1S1W A;  1EP4 A;  4PY5 A;  3KJV A;  4F2S A;  2G8F A;  3MEG A;  4DLG A;  4AIL C;  3SCX A;  4J2D A;  1WSI A;  1XWL A;  3IRX A;  4CGD A;  4B08 A;  4BDZ A;  4ZTJ A;  1F21 A;  3IS9 A;  4CEZ A;  4CCH A;  1S1X A;  3IG1 A;  2E6L A;  4CHZ A;  2IOC A;  3TR8 A;  1L5U A;  2HVH A;  1ZYQ A;  3PV8 A;  2G8U A;  3SUO A;  3V1Q A;  1X9M A;  2W42 A;  4CJL A;  3CFR A;  1Q9X A;  3AV9 A;  1JLB A;  2X6S A;  1CZ9 A;  4J2A A;  1ASV A;  4H4O A; 
#chains in the Genus database with same CATH topology
 1NGD A;  1DGK N;  3ZSV A;  1ASU A;  1YUW A;  4JD2 A;  2FBY A;  3QBX A;  4B9L A;  1GLA G;  2OYQ A;  2ATQ A;  3TTF A;  4GKK K;  3V9W A;  1BUP A;  3CET A;  4FWR A;  3C6A A;  3SUP A;  4L3Q A;  3HJF A;  3SI6 A;  2AJQ A;  1LAW A;  1JLQ A;  3RWU A;  3VF4 A;  3HBT A;  4A59 A;  1HPZ A;  4CES A;  2NRR A;  3SQ1 A;  1ILY A;  4JI7 K;  2KLA A;  2F4V K;  1IKW A;  2D1K A;  2X78 A;  3OS2 A;  2HW3 A;  4I9Q A;  3KTQ A;  1NK0 A;  5AQU A;  4Z4I A;  4OPJ A;  2GUI A;  4OKE A;  4OKK A;  4CGH A;  3D2F A;  1KXP A;  1O13 A;  1WLJ A;  3CC2 N;  4FJ9 A;  4Y1D A;  1BU6 O;  3QEX A;  5ELZ A;  1GLB G;  1HKC A;  1RT5 A;  3H3O B;  1TK8 A;  3K9J A;  4I6M B;  4KB1 A;  1L3T A;  3OYA A;  2O8E B;  4AH9 A;  4YFU A;  3UKU B;  2FSJ A;  2KFZ A;  4KO0 A;  3O80 A;  5SZT A;  2CH5 A;  2P9I B;  2KQ2 A;  4IOX A;  3D6R A;  2BH1 A;  1IKV A;  1RDD A;  5GAG P;  4FPB A;  4WFN L;  4YOT A;  4BRE A;  2OPS A;  5AQK A;  5KQD A;  1XNR K;  2HB5 A;  5FRO A;  3T3F A;  3IAY A;  4DR7 K;  4JI8 K;  4JD2 B;  1VQO N;  5JLF A;  3ENB A;  3L4Q A;  5ADX H;  5CY4 A;  2CH6 A;  4MLE A;  5J2M A;  3CQX A;  1HRH A;  2KW4 A;  4EZ6 A;  3CMA N;  1FKP A;  3EN9 A;  4PL8 A;  3I0S A;  2DFE A;  4ILG B;  3H1V X;  1D8Y A;  4DQP A;  3WT0 A;  3MMV A;  4BGB A;  5HLF A;  3ZT0 A;  4CHO A;  3NAE A;  1YHQ N;  1NWK A;  3FFK B;  5JS2 A;  3V1R A;  2XY5 A;  3ID8 A;  2OPP A;  4AHS A;  2O8D B;  3LWM A;  2D0O A;  3ZET A;  4PKI A;  3H6E A;  2NRH A;  2GEM A;  1MWM A;  3CD6 N;  4CD3 A;  4AF1 A;  2BTF A;  4K8Z A;  2E2P A;  4JK7 A;  1VQ4 N;  3TAN A;  4IG0 A;  3SPY A;  4DLE A;  3PX6 A;  2P5O A;  4K25 A;  1Q82 O;  4DCH A;  3ZCM A;  2HF4 A;  4E7L A;  4BR7 A;  4Y1C A;  3QIN A;  2WC9 A;  4BWM A;  1XUP O;  4FJN A;  4B8A B;  4F4K A;  1IBM K;  2BAN A;  4E1J A;  1RTI A;  3RVC A;  1NJZ A;  2GEL A;  5MLC Q;  1OVY A;  4BWJ A;  1C0U A;  3HPO A;  3ENH A;  1TYQ A;  4WCE L;  1VQ8 N;  1NGB A;  4HUE A;  1HQE A;  3NF9 A;  4LF6 K;  2VWB A;  2HHH K;  1YVU A;  3OS0 A;  3AVJ A;  3IFR A;  3EKS A;  4JI5 K;  3NH2 A;  3AVC A;  4FWO A;  4IO8 A;  1BG3 A;  3T19 A;  3ZET B;  4DR6 K;  3QDK A;  2E4L A;  5C42 A;  1BO5 O;  1Q18 A;  4M3X A;  4K8X A;  1WBD A;  4FJM A;  5GIP A;  3F5T A;  4CZE A;  3ULE B;  4CZM A;  1T6D A;  3VGM A;  3MN7 A;  1SV5 A;  3DM2 A;  1S1U A;  4HTL A;  2EWS A;  1BHL A;  1EWR A;  4U67 L;  1BA0 A;  4YOV A;  1GLF O;  4F3O A;  2WTU A;  4FK4 A;  1DTT A;  1M90 O;  3AY9 A;  3WNG A;  1HX1 A;  3IMX A;  1RCH A;  1NJW A;  4M42 A;  2Z1G A;  1I39 A;  3CJC A;  2QK9 A;  3O3F A;  4J2B A;  1EX4 A;  1YIT N;  4CHY A;  1Y97 A;  3PIP L;  4ELV A;  1GLD G;  4JHD B;  4BAC A;  2GBZ A;  5CYQ A;  1QE1 A;  5AZI A;  4A5A A;  2RHK A;  3RSE B;  4YHH K;  1NK6 A;  2IDO A;  2D4W A;  3HRG A;  3R3L A;  4NLC A;  5AQS A;  3NVK A;  5DMR A;  4GV9 A;  4M3W A;  4FWS A;  5FRM A;  1KLM A;  3PSF A;  1ATS A;  2Q31 A;  1GOC A;  3P39 A;  3SYZ A;  5FPE A;  1L3V A;  3BEX A;  2IC3 A;  1C0M A;  4EP4 A;  2E6M A;  5GAH P;  2YHY A;  2PAV A;  4R79 A;  1U4B A;  3K2P A;  1SKW A;  2BGG A;  2F8S A;  4O8K A;  4BR9 A;  3SUN A;  4M3U A;  4M45 A;  5C24 A;  2NRV A;  3LPT A;  4B1X B;  1NM1 A;  4FJH A;  4FM0 A;  3VA3 A;  4JK9 A;  3NF8 A;  4JKE A;  3L6Q A;  1XC3 A;  2OTJ N;  3LP3 A;  5HP1 A;  1N6Q A;  4JV5 K;  4M7X A;  1YAG A;  2QM1 A;  4NB4 A;  5BRH A;  4IEI A;  4OPH A;  3F9M A;  3CI5 A;  4BRO A;  4AHC A;  4JI2 K;  2FF6 A;  1NBW A;  4FW2 A;  1XMO K;  4E7K A;  3AVA A;  4YDU C;  2LSN A;  3AVB A;  4BRI A;  3V9S A;  3M8P A;  1T3V A;  4CJE A;  5C0Y A;  3GG4 A;  1L3S A;  5F0X A;  3NVM A;  5BN8 A;  4I2P A;  1BGX T;  2B4J A;  2UU9 K;  3R6M A;  3RRG A;  5AR0 A;  2YNI A;  3BUZ B;  4H5R A;  5KI6 A;  3AA3 A;  4B3M K;  2EX3 A;  2W6L A;  3NF6 A;  3EEQ A;  3CJ7 A;  1IH7 A;  4CK3 A;  3MCP A;  3L8B A;  3P1G A;  3K0S A;  4B3S K;  1NNE A;  2BE2 A;  3OJU A;  3OYB A;  1X1P A;  4LFA K;  1Z25 A;  2FSK A;  4CJ3 A;  1U48 A;  4B8C A;  4J2E A;  4CGF A;  3OW2 M;  1Z6R A;  1YVN A;  2D0C A;  4KHN A;  3WNF A;  1RT1 A;  3B6P A;  2PFU A;  1H1V A;  3LDL A;  4DR5 K;  4KTW A;  3VEV A;  3LM2 A;  5BPL A;  3CM6 A;  2HBL A;  4YOU A;  4B1Z A;  1WAJ A;  2NRZ A;  4BRP A;  1WSH A;  1RTH A;  2YKN A;  1N36 K;  1X3M A;  3OYJ A;  5AQF A;  4RW7 A;  2HHW A;  1JL2 A;  3VEO A;  3S3N A;  4CZK A;  5KQ8 A;  1T05 A;  1LV5 A;  4HUF A;  3N4Q A;  3VOV A;  3ZX0 A;  1X9S A;  2QA4 N;  1L3U A;  4AM7 A;  5AFU A;  4EZ9 A;  2EHG A;  3G6E N;  3CQ8 A;  4CF0 A;  2WON A;  4E19 A;  3O9Q A;  4PUO A;  3ZSW A;  2Q0R A;  4NCG A;  1TKX A;  3DXM B;  4FM1 A;  1SL0 A;  2AA4 A;  1D9F A;  4CGI A;  3A5N C;  4K42 A;  1RBV A;  1X9W A;  4Z4G A;  1S6Q A;  1VRU A;  3JS6 A;  4LH4 A;  3DAW A;  2VG6 A;  4PA1 A;  3QEP A;  4CJR A;  4MO5 A;  3LAM A;  4H0Y B;  1NK9 A;  4AHU A;  4DR3 K;  2H3G X;  1LW2 A;  3C95 A;  4O5F A;  3O9U A;  2CGJ A;  3HPH A;  5JVG L;  3VGL A;  4FJ5 A;  3E66 A;  3NGZ A;  3MXM A;  3J8A A;  2O8C B;  4Z4F A;  4C1N K;  3K5N A;  1C1C A;  4FLV A;  1KAX A;  4JKC A;  1NJI O;  3PO5 A;  5LJV A;  4LSN A;  4CZG A;  4Q0B A;  3AVK A;  4JKH A;  1SUQ A;  2W41 A;  4LF4 K;  3TAR A;  2IAJ A;  4YNQ A;  3CIP A;  4BR0 A;  2P9L A;  1CZB A;  4H0O A;  1WAF A;  4KTZ A;  4OKJ A;  3SQ0 A;  3TAF A;  5AQM A;  2QWM A;  3QIP A;  2YHW A;  2ITM A;  3CER A;  2Q2R A;  4OPK A;  3LAL A;  3VQE A;  3OYH A;  2ZQB A;  4DU3 A;  3WXL A;  4BRD A;  5M1F A;  4N5S A;  1EP4 A;  4PKH A;  5JLH A;  3IS9 A;  4CEZ A;  2IOC A;  4DB3 A;  3B8A X;  3EKU A;  1ZYQ A;  3BF1 A;  2ASM A;  5FLX O;  4HWI A;  4CJL A;  4EHU A;  3O9S A;  5AQN A;  1CZA N;  4OLA A;  4JYA K;  1Q81 O;  4WFB L;  3Q7B A;  3VQP A;  3WXJ A;  3RMD A;  4OGC A;  4KH4 A;  1YTA A;  5AQT A;  2NRX A;  4CFB A;  2CGL A;  1JCF A;  3N4P A;  4M3R A;  4FJ7 A;  1FJG K;  3UB5 A;  3KLE A;  5FPM A;  4B9S A;  3UKR A;  4H5N A;  4JS4 A;  3OYK A;  1NJY A;  4CJQ A;  1CXQ A;  4M63 C;  2XHB A;  5AQY A;  3VGK A;  4AHR A;  2P9L B;  4YOX A;  4E3S A;  5M1O A;  3OJS A;  4CEB A;  1KVB A;  1RBT A;  1U45 A;  3M8R A;  3MXJ A;  2YHB A;  4DV5 K;  3J7Z O;  3QFU A;  3LAN A;  3OYC A;  1XMQ K;  3U3Y A;  4FW1 A;  1ZBI A;  3ZT4 A;  1KFD A;  4CER A;  2UUB K;  4LY7 A;  3CCJ N;  4FWK A;  3CFO A;  4CIG A;  2IS3 A;  4YDU A;  3TSP A;  5AQP A;  1U2V A;  4CEO A;  3FZL A;  1ZBF A;  3IDH A;  4CIE A;  4H4M A;  4B9N A;  3DRS A;  3OYE A;  4B9T A;  4DV7 K;  2YI1 A;  2HVI A;  4BRH A;  4IO9 L;  2P9K A;  4KFB A;  5BPM A;  1N34 K;  3K9K A;  4YY3 K;  4DFP A;  4FJL A;  4LC9 B;  5JS1 A;  3QO9 A;  1BI4 A;  4H5V A;  3KLF A;  1U47 A;  4IKF A;  3KLH A;  4A2A A;  3UKR B;  4J8F A;  2HHX A;  3LAK A;  3V4I A;  1C1A A;  4CZJ A;  4KPY A;  3CJ1 A;  3ZT1 A;  3F2K A;  2R7Y A;  1KCF A;  3KLI A;  3L2R A;  1HNX K;  2E1Z A;  3EZ5 A;  4B9U A;  5C12 A;  4E7J A;  3PX0 A;  3V9U A;  4M41 A;  2QKB A;  3LDN A;  4QOZ B;  4O8U A;  4HHT A;  4HUG A;  2YX6 A;  1FW6 A;  2QWR A;  3VQQ A;  3O08 A;  4MDA A;  4XH1 A;  3CCE N;  2UUA K;  4E89 A;  4FJ8 A;  1TAU A;  3P5J A;  1HNZ K;  3AGR A;  3ATU A;  4BRN A;  4A62 A;  4YOW A;  2P9N A;  1IKX A;  5CYM A;  4I6M A;  4H0X B;  3O3H A;  1U6Z A;  4JEP A;  2O8E A;  1RT3 A;  1U2V B;  2Q1N A;  3G25 A;  3HM8 A;  5CR4 A;  4FCY A;  3UKU A;  1W0H A;  1NMN A;  3VQ8 A;  2P9I A;  5TKW A;  4MLH A;  3ZT3 A;  4FO0 A;  1SQK A;  2P9K B;  5LJW A;  3GL1 A;  3OYL A;  1VRT A;  1T8E A;  1VK0 A;  3SMS A;  3MWP A;  1BI4 B;  4BRK A;  1WN7 A;  3P83 D;  1JLA A;  4AQY K;  4JS5 A;  1NGI A;  4RWT A;  4Y0W A;  2WOM A;  5JMV A;  3WQT A;  1S5J A;  5EOY A;  3CC7 N;  4FWM A;  2YKM A;  4IFY A;  4DMN A;  4ISE A;  5LMN K;  3ZSO A;  1IG9 A;  1RGI A;  2P9P B;  3OYF A;  4A61 A;  3HST B;  1ZXO A;  3S41 A;  4DTO A;  4YOR A;  4CZH A;  2FF3 B;  5BPN A;  2F96 A;  2O8D A;  3D0P A;  3AAR A;  2P9N B;  3MEC A;  3KHY A;  3MXI A;  1V4S A;  1S9E A;  1CLQ A;  3AA5 X;  3WUH A;  3QNO A;  1T7P A;  3AO3 A;  4FWQ A;  1YJW N;  1HQU A;  1X9J A;  1CXU A;  1HJO A;  2D0A A;  3VMF B;  2FXU A;  4GVM A;  3ZSQ A;  3MCA B;  1TKZ A;  3TPQ A;  3VEY A;  2VYP A;  5CZ2 A;  4IOC L;  5HRS A;  5BN9 A;  2G8K A;  3CPW M;  1YI2 N;  3DLB A;  4B9V A;  1RBU A;  5ADX A;  1QQN A;  3O9T A;  4JLH A;  3DWL A;  4JKD A;  4W5O A;  1NK7 A;  4LF7 K;  2YNF A;  3CJA A;  5AQO A;  3SBG A;  1J5E K;  3SPZ A;  4E0D A;  4ISF A;  2F7T A;  3S3M A;  2JLE A;  4RCH A;  3VQ5 A;  1BQN A;  4CGJ A;  1U49 A;  4LF9 K;  2OPQ A;  1RIL A;  4CK2 A;  1RT6 A;  3VER A;  3LL3 A;  1QZ5 A;  1W9H A;  3THV A;  3HPG A;  1TL1 A;  4M3T A;  1VQP N;  4NYF A;  4X66 K;  1IBK K;  4BE0 A;  1LWE A;  2AP1 A;  3KKR A;  4WQ5 C;  5AQJ A;  4CFC A;  2F8T A;  3ULE A;  2V51 B;  4DSL A;  5FPD A;  1K8K B;  2V7Y A;  2W6K A;  2Z1I A;  4FYD A;  5E26 A;  3GDQ A;  3QLH A;  4ISG A;  2QI2 A;  1NKE A;  4CJ4 A;  3HYF A;  4CBU A;  2PYL A;  4DUZ K;  2B5J A;  1NOZ A;  4H03 B;  3C94 A;  3C0B A;  1S22 A;  4DHY A;  3E9L A;  3I55 N;  3BF3 A;  3LDQ A;  2RE2 A;  4H5W A;  2OPR A;  3ZX3 A;  4IZ9 A;  1WB9 A;  4KKO A;  1B9F A;  4MDB A;  4FVU A;  4JHD A;  4DF8 A;  3NH1 A;  1DT9 A;  4I9L A;  3RSE A;  3HM9 A;  2IVO A;  4XIU A;  3OVN A;  1WSE A;  3WEE B;  3O4N A;  4FWN A;  3KWG A;  3MX5 A;  2XRI A;  2OTL N;  1RT4 A;  2Y1I A;  4HTU A;  4CEC A;  1GLJ O;  5GIN A;  3ZLJ A;  4DSI A;  1VSK A;  4NO7 A;  1VAZ A;  3AVL A;  1QQC A;  1TK0 A;  2DFF A;  2XY8 A;  3VQD A;  2ASP A;  4RW6 A;  3CXC M;  1QHT A;  3DRR A;  3DLH A;  3BY5 A;  2VWK A;  1N8R O;  4A57 A;  1VQ5 N;  4AM6 A;  3DOK A;  3LP0 A;  4AHT A;  3KK3 A;  4B3O A;  3HSC A;  5AQZ A;  2DY4 A;  3HOS A;  4BVO A;  3AO1 A;  4B1V A;  2KZM A;  1JLF A;  5FRN A;  1RDW X;  1RBS A;  3V9Z A;  3TWH A;  4G1Q A;  4LFB K;  4CJ5 A;  2FLO A;  3S9H A;  4I2Q A;  3PSI A;  3DYA A;  1ZBU A;  4A2B A;  1QVG M;  4X65 K;  5AQV A;  4R5P A;  3KD1 E;  4X64 K;  2Z1H A;  2HBK A;  3QB0 A;  3EY1 A;  1JCG A;  4HCB A;  2QXL A;  3OBW A;  1UA0 A;  4CZF A;  1OKJ A;  1XHX A;  4OLB A;  4GY2 B;  3KLG A;  1TV6 A;  2D0B A;  3H3N O;  1EO1 A;  1KAZ A;  2ZGY A;  4BG8 A;  3AVF A;  3V81 A;  4KRF A;  4CE9 A;  1JLC A;  4CHQ A;  5KPZ A;  4DF4 A;  1J53 A;  4DV6 K;  1LWC A;  4TSX A;  3LWL A;  1BOT O;  2P9S B;  1VSL A;  1RT7 A;  1GOB A;  3K5O A;  3TI0 A;  3RMA A;  4Z4C A;  3NGI A;  3CG7 A;  3H1Q A;  4DTN A;  1QZ6 A;  1HLU A;  2D0P A;  3QEV A;  1Q9Y A;  4DFK A;  3ULD A;  3TSQ A;  2G8V A;  1VQ7 N;  2BUP A;  4NXN K;  1S6P A;  3FFI A;  3VES A;  3DLR A;  3VF6 A;  4DS5 A;  3OYG A;  3LPU A;  1G15 A;  2OCE A;  4BRM A;  3QBW A;  2GUP A;  4K43 A;  4BC5 A;  1T44 A;  4I7F A;  3PUF A;  4BE1 A;  4PQU A;  2FSN A;  3AVG A;  4DSJ A;  2XY6 A;  4JI0 K;  3TAP A;  3ENO A;  4PY5 A;  4DLG A;  1XWL A;  3IRX A;  3GE1 A;  4B08 A;  4CCH A;  3Q7C A;  1L5U A;  2HVH A;  3DXM A;  4CVN E;  3SUO A;  1X9M A;  2O8B A;  2W42 A;  2V7Z A;  3DXK A;  1JLB A;  2QWP A;  4QS8 A;  4C1N I;  3BZC A;  5EU7 A;  3CCV N;  4BRC A;  3HTV A;  4BC3 A;  3NBP A;  3L0Q A;  3KWI A;  4BY9 C;  3D2E A;  2ZD1 A;  2YJF A;  2O8F B;  5D3G A;  2OAN A;  1KLN A;  1R0A A;  4LSL A;  2O8C A;  3DRP A;  3O4W A;  4JAX A;  3OYN A;  4NCB A;  1IG8 A;  2KKZ A;  2FBX A;  4NXM K;  4U7B A;  5F1X A;  1HMV A;  4WQ5 A;  1QS4 A;  3SZ2 A;  5EY4 A;  3QEI A;  2RF2 A;  4IDH A;  4K41 A;  3M8Q A;  1YXQ A;  3ZSZ A;  3V6D A;  4BRL A;  3A2F A;  3VQC A;  2E8A A;  4CHN A;  1NU0 A;  4BRQ A;  3J81 O;  2F9T A;  4LD0 A;  4GMJ B;  4BC2 A;  1TVR A;  2O8B B;  5KRS A;  2PY5 A;  1VQ6 N;  1KTQ A;  3DXK B;  2IIR A;  4GNI A;  5KTQ A;  4C8M A;  2V52 B;  1BA1 A;  4CHP A;  3KIO A;  1DTQ A;  2HHT A;  3DLE A;  3TAB A;  3CCM N;  4B3R K;  5M1K A;  2NUB A;  1BWF O;  4XH4 A;  3TTC A;  2P9U A;  4H0V B;  2VQF K;  3D2E B;  3THY B;  2YV0 X;  4C8O A;  2PYJ A;  1B92 A;  4GW6 A;  4NLB A;  1XNQ K;  2G8H A;  1IBL K;  1VQ9 N;  2VGM A;  4GKJ K;  4GV6 A;  5IWA K;  4DV0 K;  4CI6 A;  2GTD A;  1S1T A;  4H5T A;  3TAE A;  1Y64 A;  3CFP A;  3SAG A;  1ZBS A;  5LY3 A;  1J54 A;  2Q0U A;  2ZE2 A;  2FBT A;  4H0P A;  1MDU B;  1QSL A;  4L8R B;  4CJF A;  3SJJ A;  4DTM A;  1I94 K;  4FOI A;  4RW4 A;  4ZHR A;  2ZWH A;  4CJK A;  1KFS A;  3RRH A;  1EET A;  4B9Q A;  4PKG A;  1BCO A;  3MEE A;  4DR2 K;  1NLV A;  2QWL A;  4DV4 K;  4O0J A;  1EKE A;  2P1J A;  3NE6 A;  4DSK A;  2RN2 A;  5DK5 A;  3VA0 A;  4E7H A;  2FBV A;  3K5M A;  5B8H A;  1N5Y A;  4DKW A;  2Q36 A;  1S1V A;  5LMU K;  2P9U B;  5AQQ A;  4DV2 K;  1JCE A;  3U4L A;  3OYD A;  1C1B A;  4DFM A;  1YTU A;  2A1R A;  1E4F T;  3I8B A;  4CJT A;  3AA2 A;  5KGX A;  2A1S A;  4DQS A;  2RKI A;  2VGN A;  2F9W A;  4ELU A;  2JWL A;  3L2U A;  3P31 A;  1CZ9 A;  3QET A;  3D7E O;  2E5L K;  3HI0 A;  3KK1 A;  3HP9 A;  1XQS C;  1RDB A;  1P90 A;  1N33 K;  4CD1 A;  3KK7 A;  5KGW A;  3MX2 A;  3HP6 A;  3QER A;  3AVI A;  4M3Y A;  2DTU A;  3ZEU B;  1W97 L;  2HND A;  4E1M A;  1UOC A;  3A0I X;  1KSP A;  2KFN A;  4V19 S;  4DU1 A;  1S3X A;  1TGO A;  1E3M A;  4DSE A;  1T03 A;  3VQ6 A;  1MWK A;  3VET A;  3OYI A;  1IKY A;  1IJJ A;  1TK5 A;  3HXM A;  4DU4 A;  1WSJ A;  3E01 A;  3RTV A;  1DKG D;  2YNH A;  3K59 A;  1QTM A;  1FK9 A;  2UYT A;  3SUQ A;  3FGU A;  1ATN A;  3MDQ A;  4PL7 A;  5GIO A;  1FXX A;  3BP8 A;  2OA8 A;  3SQ2 A;  1HKG A;  2KZZ A;  1GLE G;  4IFV A;  3B6O A;  4BR5 A;  4WQ4 C;  4FJJ A;  4Q5V A;  1C6V A;  2A40 A;  4CBW A;  3C6U A;  4DTU A;  3L2V A;  3NHG A;  4RW9 A;  1KQS M;  3I33 A;  2HNZ A;  2Q97 A;  5AZJ B;  4IWV A;  3EE8 A;  3M5R A;  5EVZ A;  4ILJ A;  3J7Y P;  4FZX C;  2G8I A;  4FLX A;  3O1B A;  3AAQ A;  4WF9 L;  3PY8 A;  3QIO A;  1WBB A;  1Q7Y O;  1C0G A;  2BDP A;  2P9P A;  2D5R A;  2B6A A;  1J9A A;  1JLG A;  4KTQ A;  4UQG A;  2OZM A;  5C25 A;  4BE2 A;  4FXD A;  1BIS A;  3LDO A;  4DTX A;  3ID6 A;  3C7N A;  4M3Z A;  3AO2 A;  2ASO A;  1GLC G;  4C8L A;  3R8E A;  3IKM A;  1DLO A;  4CED A;  3J80 O;  1JLE A;  4BQZ A;  3UE5 A;  4IFE A;  3FR0 A;  4HVJ A;  1UA1 A;  1NK4 A;  3VTI A;  5C2D A;  4CJP A;  3ITH A;  3EO3 A;  4CJV A;  1LWF A;  3FLC O;  3LM9 A;  1VSE A;  3T69 A;  1WSG A;  5KPT A;  3PO4 A;  3SAH A;  3VN5 A;  4WYB A;  4BRA A;  2IVN A;  5C10 A;  3LZJ A;  4FLY A;  1HYZ A;  2GWK A;  4WFA L;  4A5B A;  4GV3 A;  4JK8 A;  4OPA A;  2HHV A;  5I9E B;  4EFH A;  1V4T A;  4QS7 A;  3ZX2 A;  4DQQ A;  4E7I A;  4BG9 A;  3VQ9 A;  3QEW A;  1NG9 A;  3P4I A;  3M8S A;  3WNE A;  3U9D A;  2UXB K;  1NGA A;  1MU2 A;  3SV4 A;  4JRP A;  3OTO K;  4G9Z A;  1HUX A;  4FK2 A;  1OH8 A;  4NCA A;  4RG8 A;  3C7N B;  3AO4 A;  1JXE A;  1WSF A;  1A5V A;  1NJX A;  3QML A;  3MN6 A;  4JI6 K;  1XHZ A;  4KRE A;  1A5W A;  3A5L C;  2YNG A;  3BGR A;  2Y1J A;  1TUU A;  5BRF A;  2G8W A;  1VSI A;  4CJW A;  3WXM B;  4KHQ A;  3O9R A;  1NKB A;  3UIQ A;  1TL3 A;  1UAX A;  3PIO L;  1REV A;  1K8K A;  2HOE A;  1SZ2 A;  1EWQ A;  4GVE A;  1KVC A;  2UXD K;  1HJR A;  4IJA A;  1LOT B;  3C6H A;  3D45 A;  1MA9 B;  5LL6 Z;  5GAD P;  5H1S Q;  3CF5 L;  4KHY A;  3CYM A;  5M1N A;  1J5O A;  5EXW A;  4ID5 A;  1OH5 A;  2NZT A;  2WFB A;  3WXI A;  3TAM A;  5JVH L;  4OX9 K;  3WXK A;  3E9P A;  4B9M A;  4FLW A;  2VWJ A;  3L3V A;  4FLU A;  1S9G A;  3A5O C;  3NF7 A;  3ASM A;  3PLA A;  3JAM O;  1VSD A;  3BDP A;  3WEE A;  3U6F A;  4FWL A;  3U3G A;  3HT3 A;  3HO1 A;  3E1Y A;  1WNS A;  4AHV A;  4DQI A;  1WOQ A;  1Z05 A;  3GBT A;  1VSH A;  1LW0 A;  3ZSR A;  4H0T B;  4DS4 A;  2ZJP L;  1WUA A;  1QVF M;  4QS9 A;  2ZJR L;  3D2F B;  4OO1 J;  4JRQ A;  2A3Z A;  4F2R A;  1DEJ A;  1IO2 A;  1C0T A;  1NGC A;  4W5R A;  5JIC A;  4CBX A;  3VEX A;  4ELT A;  1BDG A;  1NGJ A;  4CEA A;  1RBR A;  4IDK A;  2QKK A;  4X62 K;  3DLK A;  3WNH A;  4DSF A;  2HHQ A;  3THW A;  3EE9 A;  3O5B A;  2E2Q A;  1QHA A;  5KRT A;  4FJK A;  1ASW A;  3AAP A;  1S1W A;  5DM7 L;  3KJV A;  1HR0 K;  4AIL C;  3VF2 A;  5C15 A;  4F2S A;  4J2D A;  4BDZ A;  2E20 A;  1P8Z A;  3PV8 A;  1HPM A;  1HKB A;  4WQ4 A;  4FOE A;  2UUC K;  2X6S A;  4J2A A;  5IT9 O;  1ASV A;  2WBN A;  4H4O A;  4DV3 K;  5AQR A;  4EAH D;  4C8N A;  5HL7 L;  1TKT A;  1VHX A;  3C65 A;  5K14 A;  2GWJ A;  5DM6 L;  5HOO A;  3DLL L;  1BIZ A;  2HBM A;  3SLC A;  2QWQ A;  1SL2 A;  1NKC A;  3ZSX A;  3NH0 A;  2P9S A;  4O44 A;  3LDS A;  3K58 A;  1KRP A;  1ZBL A;  3MN5 A;  3P38 A;  4XH5 A;  3SAF A;  1NGH A;  3J7A P;  3G0Z A;  3O8M A;  4MFB A;  3KKS A;  4N41 A;  2VG5 A;  4LF5 K;  1J6Z A;  4N47 A;  1QQM A;  3A8Y A;  4YOY A;  1E4G T;  4BGA A;  1HNV A;  4CEQ A;  1BIU A;  2IGI A;  1HNW K;  4NYN A;  3DI6 A;  2DPN A;  2KHO A;  3LZI A;  3R1X A;  3THW B;  1KC8 O;  1VSM A;  4DR4 K;  1G99 A;  3FZK A;  2I5J A;  3HL8 A;  4E1N A;  3W3D A;  4B1Y B;  2HMI A;  3F9K A;  2X74 A;  1NK5 A;  2P5G A;  3ZYY X;  2HF3 A;  1K6Y A;  4RTF D;  3K5L A;  3SNN A;  2QTD A;  1NGF A;  1OH6 A;  3CC4 N;  5BRD A;  4O55 A;  3F73 A;  1JL1 A;  4JI3 K;  1LAV A;  2FC0 A;  4JI1 K;  3VQA A;  3JXU A;  1TYQ B;  1ZBH A;  3AVN A;  3AGK A;  1D9D A;  3L2W A;  3S3O A;  2HBJ A;  2ZJQ L;  2GX9 A;  3KZB A;  1HYS A;  1VSJ A;  3QIC A;  1BQM A;  4O0I A;  1TKD A;  4FK0 A;  5AQL A;  1SKS A;  4B1W B;  3VTH A;  4KI6 A;  5GAE P;  5A2Q O;  5TKY A;  4CF9 A;  1ATR A;  2O8F A;  1EXQ A;  4CF2 A;  1RTJ A;  2HNY A;  3A5M C;  4KI4 A;  4F8R A;  2E88 A;  3IUC A;  4CK1 A;  4JNE A;  4KBO A;  4Z0U A;  4FM2 A;  3QFP A;  5I3U A;  2XY7 A;  2X6N A;  3DOL A;  4IXC A;  4JN4 A;  1M1K O;  4OJR A;  3AVH A;  4K0K K;  1KD1 O;  3QNN A;  1NGE A;  3V9X A;  5FDL A;  4CF8 A;  4CZL A;  4DQ8 A;  5HRP A;  2WUS A;  2ZM6 K;  2HST A;  1ITG A;  4DV1 K;  4BR4 A;  3O4Q A;  3DMJ A;  3OHR A;  1VSF A;  3FZM A;  4DG1 A;  4FJI A;  5HRR A;  1VQN N;  2ITG A;  3HK2 A;  1NGG A;  4JKG A;  3CCS N;  5AJ3 K;  4KH5 A;  1BL3 A;  5J2N A;  4CZI A;  2OZS A;  2DFH A;  3CJ9 A;  4OGE A;  2YCH A;  5J2Q A;  1T6C A;  3OBY A;  1OH7 A;  5AZI B;  5FPN A;  4KAZ A;  2QXF A;  4W5N A;  2VG7 A;  4FL9 A;  3I56 N;  3JSM A;  3PX4 A;  3BZK A;  2J4R A;  3M3Z A;  3NFA A;  1QSY A;  4DTJ A;  4DQR A;  3THY A;  1RFQ A;  4FZZ A;  3DJC A;  5SWM A;  1FKO A;  3KK2 A;  4DTS A;  4BQL A;  1OVQ A;  1D5A A;  3KD5 E;  4IBN A;  5M1Q A;  4DUY K;  4W5Q A;  4O4G A;  1KVA A;  3V1O A;  5HRN A;  2NRT A;  4EHT A;  4CJS A;  2Q3S A;  3OYM A;  3O6W A;  3O1W A;  4CW7 B;  1O1W A;  5KPR A;  3G10 A;  1XI1 A;  1QQO A;  1Z26 A;  4DWI A;  1YF5 L;  3VEN A;  4JKG B;  5BR9 A;  3CPE A;  3AO5 A;  3C6T A;  1HNI A;  4CIF A;  1XC9 A;  1SL1 A;  1GLL O;  3OS1 A;  3G71 N;  3O3G A;  3HVT A;  3EZW A;  1TUY A;  2VQE K;  3RMC A;  3L3U A;  5AFU H;  1R59 O;  3MWT A;  1LCU A;  3RR8 A;  4KHW A;  3H08 A;  4FJX A;  1Q8I A;  4LF8 K;  2YJE A;  3T1Y K;  1I3A A;  3VQB A;  4HCC A;  5CE3 A;  5AQG A;  4Z94 A;  3ISN C;  4ZTF A;  4C23 A;  1YIJ N;  3GOI A;  5AQH A;  4KB0 A;  1YJN N;  5CHI A;  4IG3 A;  3MED A;  1RNH A;  3TAG A;  3RMB A;  3FZH A;  4JKA A;  4EIA A;  2O4I A;  4CEE A;  4DTP A;  4DR1 K;  1X3N A;  4BC4 A;  1JXB A;  1HYV A;  2QWN A;  4CFA A;  2I7N A;  3VPZ A;  1BCM A;  2HHU A;  4BRF A;  3AVM A;  3U8X A;  3NGY A;  1B9D A;  4OVL A;  1Q86 O;  2YHX A;  3SV3 A;  1ESV A;  3T1H K;  3SQ4 A;  4JKF A;  1UWB A;  3WQU A;  4F9O A;  4ICL A;  4CF1 A;  4JKB A;  3ZEU A;  4FLT A;  5F2R A;  4H8K A;  3NMU A;  3I8D A;  3CCQ N;  1GOA A;  1SAZ A;  2YHA A;  3LP2 A;  1RT2 A;  5AQI A;  3M1F A;  1D4X A;  3KVG A;  2O4G A;  3L2Q A;  2ZF5 O;  4BRG A;  4KV8 A;  3EL2 A;  1VQL N;  4BDY A;  3MN9 A;  2NLX A;  4FLZ A;  1K8A O;  2NNW A;  4BDP A;  3SMP A;  1W7A A;  1W2B M;  2E2N A;  3U9Z A;  5E41 A;  1S72 N;  4N76 A;  3LP1 A;  4CJU A;  3VEZ A;  4KHP K;  1K9M O;  2IVP A;  1VQK N;  5AQX A;  2XO7 A;  3LDP A;  3MAQ A;  2A41 A;  5HRO A;  1SS6 A;  3H45 C;  5AQW A;  4FVM A;  3ZSY A;  4FSV A;  2I7P A;  3MK6 A;  3K57 A;  3THX A;  2CGK A;  4MO4 A;  2HMP A;  3HOT A;  2VCP A;  5AZJ A;  5E84 A;  4CJ7 A;  4BR2 A;  4QAG A;  1YT3 A;  4W5T A;  3M6G A;  3TTD A;  4FZY A;  4BVP A;  3OY9 A;  1VQM N;  3CCL N;  4B1U B;  3VEW A;  5BRE A;  3DLG A;  5CZ1 A;  2HHS A;  3FZF A;  3NCI A;  1A5X A;  3CM5 A;  4CEF A;  2W40 A;  4FJG A;  1NOY A;  2JGU A;  3HVR A;  4XEI A;  4C8K A;  3NDK A;  4MQ3 A;  2P51 A;  2ZGZ A;  2GV9 A;  3CJB A;  2ETJ A;  3R9P A;  5C2F A;  2RPI A;  4KH6 A;  2QWO A;  4EP5 A;  1RDA A;  1JKH A;  3VQ4 A;  3W0L A;  3CQY A;  3I0R A;  3QES A;  1NK8 A;  3SK3 A;  3AA4 A;  5I42 A;  5J1E A;  3TAQ A;  3FE1 A;  5HBM A;  4N56 A;  3THX B;  4Z4E A;  2QEX N;  2QW9 A;  1RDC A;  5M1P A;  2A5X A;  4LH5 A;  3T7Z A;  4CGG A;  1SKR A;  3CCU N;  4JI4 K;  3TU5 A;  3ZT2 A;  4IJN A;  3CHW A;  3EYZ A;  3CCR N;  4KHS A;  4UY8 O;  4ILH A;  1U04 A;  1TAQ A;  4KHU A;  2Z1J A;  3T1A A;  3VQ7 A;  3CME N;  4IOA L;  1QSS A;  4WE1 A;  2KTQ A;  4Z4H A;  3G4S N;  3TSU A;  4PHT X;  2PBD A;  3HZ6 A;  4PWD A;  1EQY A;  1N32 K;  2PZS A;  4DFJ A;  3OA9 A;  3JYT A;  2A42 A;  4DTR A;  5J2P A;  1C0F A;  3ALY A;  1RDU A;  4ID1 A;  4QCL A;  2UXC K;  1K73 O;  5T7B A;  3ATV A;  4O5B A;  5EX5 A;  2A6A A;  4RW8 A;  4CFD A;  1RTD A;  2NRW A;  1NMD A;  4F3T A;  4IEE A;  3SJH A;  3E9O A;  2JWK A;  1KAY A;  3H46 O;  1IV0 A;  5BR8 K;  3RR7 A;  4M7Y A;  2E1Y A;  4LFC K;  1JJ2 M;  2G8F A;  3MEG A;  3SCX A;  1YJ9 N;  1WSI A;  4CGD A;  4B3T K;  4ZTJ A;  1F21 A;  1S1X A;  3IG1 A;  2E6L A;  4CHZ A;  3TR8 A;  4FWP A;  3L4I A;  2G8U A;  3V1Q A;  3CFR A;  1Q9X A;  1ZC6 A;  3AV9 A;  2E2O A;  4FPA A;  3SBT A; 
#chains in the Genus database with same CATH homology
 4OLA A;  4C8N A;  5EU7 A;  3ZSV A;  1ASU A;  1TKT A;  2FBY A;  5K14 A;  3VQP A;  4B9L A;  2OYQ A;  2ATQ A;  1BIZ A;  3V9W A;  3RMD A;  4OGC A;  1YTA A;  3SUP A;  3NBP A;  1SL2 A;  4CFB A;  3HJF A;  3SI6 A;  2AJQ A;  4M3R A;  1LAW A;  1NKC A;  1JLQ A;  3ZSX A;  4FJ7 A;  3NH0 A;  4O44 A;  3LDS A;  3K58 A;  1KRP A;  1ZBL A;  2ZD1 A;  3RWU A;  1HPZ A;  4CES A;  3SQ1 A;  3KLE A;  4B9S A;  5D3G A;  1IKW A;  2X78 A;  3OS2 A;  1KLN A;  3G0Z A;  4MFB A;  4JS4 A;  1R0A A;  4I9Q A;  4LSL A;  2HW3 A;  3OYK A;  1NJY A;  3KKS A;  4CJQ A;  1CXQ A;  3KTQ A;  4N41 A;  3DRP A;  1NK0 A;  2VG5 A;  2XHB A;  4N47 A;  4Z4I A;  4OPJ A;  4AHR A;  2GUI A;  4OKE A;  3OYN A;  4E3S A;  4NCB A;  3OJS A;  4OKK A;  4CGH A;  1HNV A;  4CEB A;  4CEQ A;  1KVB A;  1BIU A;  1RBT A;  2FBX A;  2IGI A;  1WLJ A;  3M8R A;  1U45 A;  4NYN A;  3DI6 A;  4FJ9 A;  4Y1D A;  1HMV A;  3MXJ A;  3LZI A;  1QS4 A;  2YHB A;  3QEX A;  3SZ2 A;  1RT5 A;  3LAN A;  3OYC A;  3QEI A;  1VSM A;  2RF2 A;  3U3Y A;  1TK8 A;  4FW1 A;  3M8Q A;  1ZBI A;  3ZT4 A;  1KFD A;  3ZSZ A;  2I5J A;  3HL8 A;  4KB1 A;  4CER A;  4E1N A;  3V6D A;  3OYA A;  1L3T A;  3A2F A;  3VQC A;  4CHN A;  4AH9 A;  4LY7 A;  4YFU A;  3CFO A;  2KFZ A;  4KO0 A;  3F9K A;  2X74 A;  2IS3 A;  4CIG A;  1NK5 A;  2HMI A;  2P5G A;  5SZT A;  4LD0 A;  1K6Y A;  4GMJ B;  2KQ2 A;  1TVR A;  3K5L A;  3SNN A;  1IKV A;  1RDD A;  5KRS A;  2PY5 A;  1KTQ A;  4O55 A;  4CEO A;  5KTQ A;  1ZBF A;  3F73 A;  2OPS A;  4CIE A;  1JL1 A;  4H4M A;  4C8M A;  4B9N A;  2HB5 A;  3DRS A;  5FRO A;  3T3F A;  3IAY A;  4CHP A;  3OYE A;  1LAV A;  3KIO A;  4B9T A;  1DTQ A;  2FC0 A;  2HVI A;  2HHT A;  3DLE A;  3TAB A;  3VQA A;  4KFB A;  1ZBH A;  5CY4 A;  2NUB A;  4DFP A;  4FJL A;  5J2M A;  5JS1 A;  3AVN A;  1HRH A;  3QO9 A;  1D9D A;  1BI4 A;  3L2W A;  2KW4 A;  3KLF A;  4EZ6 A;  3S3O A;  1U47 A;  4IKF A;  1FKP A;  2YV0 X;  4C8O A;  2PYJ A;  3KLH A;  1HYS A;  3I0S A;  2DFE A;  3LAK A;  3V4I A;  1B92 A;  4F8R A;  2HHX A;  1VSJ A;  1C1A A;  1D8Y A;  4GW6 A;  4DQP A;  1BQM A;  4O0I A;  1TKD A;  4KPY A;  3ZT1 A;  1SKS A;  4FK0 A;  4KI6 A;  2R7Y A;  2G8H A;  1KCF A;  3KLI A;  3L2R A;  3EZ5 A;  5HLF A;  4CF9 A;  4B9U A;  1EXQ A;  3ZT0 A;  4CHO A;  4CF2 A;  3NAE A;  1RTJ A;  2HNY A;  4E7J A;  4KI4 A;  1S1T A;  3TAE A;  3PX0 A;  5JS2 A;  3V9U A;  3V1R A;  2XY5 A;  3CFP A;  4M41 A;  4AHS A;  2OPP A;  4CK1 A;  2QKB A;  4QOZ B;  4HHT A;  4Z0U A;  4HUG A;  4FM2 A;  3LWM A;  5I3U A;  2XY7 A;  3VQQ A;  1J54 A;  2X6N A;  3DOL A;  2F8S A;  2ZE2 A;  2FBT A;  3AVH A;  4OJR A;  4E89 A;  4FJ8 A;  1QSL A;  4L8R B;  1TAU A;  3P5J A;  4CJF A;  3QNN A;  3V9X A;  5FDL A;  4CF8 A;  3SJJ A;  4K8Z A;  4DTM A;  5HRP A;  3TAN A;  4IG0 A;  3SPY A;  4RW4 A;  4DLE A;  4ZHR A;  3PX6 A;  4CJK A;  1KFS A;  1ITG A;  2P5O A;  1IKX A;  3RRH A;  3O4Q A;  3DMJ A;  1EET A;  1VSF A;  5CYM A;  4DG1 A;  4FJI A;  3O3H A;  1BCO A;  5HRR A;  3MEE A;  2ITG A;  3HK2 A;  1RT3 A;  4O0J A;  4FCY A;  1EKE A;  2P1J A;  1BL3 A;  3ZCM A;  1W0H A;  5J2N A;  4E7L A;  2OZS A;  2DFH A;  4Y1C A;  3QIN A;  3VQ8 A;  2RN2 A;  4OGE A;  5DK5 A;  4BWM A;  3NE6 A;  3VA0 A;  2FBV A;  3K5M A;  4B8A B;  4E7H A;  5J2Q A;  4FJN A;  3ZT3 A;  4F4K A;  1N5Y A;  2BAN A;  1S1V A;  1RTI A;  3OYL A;  1VRT A;  1T8E A;  1VK0 A;  4KAZ A;  1NJZ A;  1BI4 B;  2QXF A;  3OYD A;  1C1B A;  4W5N A;  2VG7 A;  1WN7 A;  4DFM A;  1YTU A;  2A1R A;  4BWJ A;  3P83 D;  1C0U A;  3HPO A;  3JSM A;  4CJT A;  1JLA A;  3PX4 A;  3AA2 A;  5KGX A;  2A1S A;  4DQS A;  4JS5 A;  2RKI A;  4ELU A;  4HUE A;  1HQE A;  3NFA A;  3NF9 A;  4DTJ A;  1QSY A;  2WOM A;  3L2U A;  4DQR A;  1YVU A;  1S5J A;  3OS0 A;  3QET A;  4FZZ A;  2YKM A;  3AVJ A;  4IFY A;  4DMN A;  3HP9 A;  5SWM A;  3KK1 A;  1IG9 A;  3ZSO A;  1RDB A;  1FKO A;  3KK2 A;  4DTS A;  3NH2 A;  3AVC A;  3OYF A;  3T19 A;  1D5A A;  3HST B;  3KD5 E;  4IBN A;  4W5Q A;  4DTO A;  5KGW A;  4O4G A;  1KVA A;  2E4L A;  3V1O A;  5HRN A;  3HP6 A;  5C42 A;  2F96 A;  4CJS A;  3AVI A;  2Q3S A;  3OYM A;  3QER A;  4M3Y A;  2DTU A;  4M3X A;  4K8X A;  2HND A;  4E1M A;  1O1W A;  1UOC A;  4FJM A;  1KSP A;  3D0P A;  2KFN A;  3MEC A;  4DU1 A;  3MXI A;  1TGO A;  3G10 A;  1XI1 A;  4DSE A;  1T03 A;  3VQ6 A;  1Z26 A;  3OYI A;  1SV5 A;  3DM2 A;  4DWI A;  1IKY A;  1S1U A;  1S9E A;  1CLQ A;  3AA5 X;  3HXM A;  1TK5 A;  4DU4 A;  3QNO A;  1BHL A;  1WSJ A;  3AO5 A;  3C6T A;  1HNI A;  3E01 A;  4CIF A;  3RTV A;  1XC9 A;  1T7P A;  3AO3 A;  2YNH A;  1SL1 A;  3OS1 A;  3O3G A;  3K59 A;  1HQU A;  4F3O A;  3HVT A;  4FK4 A;  1CXU A;  1DTT A;  1QTM A;  3RMC A;  1FK9 A;  3SUQ A;  3L3U A;  2D0A A;  3WNG A;  4M42 A;  1RCH A;  1NJW A;  4GVM A;  2Z1G A;  1I39 A;  3ZSQ A;  1FXX A;  3RR8 A;  1TKZ A;  3H08 A;  2OA8 A;  4FJX A;  3O3F A;  4J2B A;  4KHW A;  2QK9 A;  1EX4 A;  1Q8I A;  5CZ2 A;  4CHY A;  5HRS A;  1Y97 A;  3SQ2 A;  1I3A A;  2G8K A;  4ELV A;  2KZZ A;  4IFV A;  3VQB A;  4BAC A;  4HCC A;  3B6O A;  2GBZ A;  5CYQ A;  4FJJ A;  1QE1 A;  1C6V A;  3ISN C;  4Q5V A;  4ZTF A;  3DLB A;  4B9V A;  1NK6 A;  1RBU A;  2IDO A;  3C6U A;  4DTU A;  4KB0 A;  3L2V A;  4JLH A;  4IG3 A;  3NHG A;  4RW9 A;  3MED A;  4W5O A;  1RNH A;  2HNZ A;  3TAG A;  1NK7 A;  5DMR A;  3RMB A;  4M3W A;  5FRM A;  1KLM A;  2YNF A;  1GOC A;  2G8I A;  4FZX C;  2O4I A;  4CEE A;  4FLX A;  3SYZ A;  3SPZ A;  4E0D A;  4DTP A;  3S3M A;  2JLE A;  1L3V A;  1JXB A;  2IC3 A;  1C0M A;  1HYV A;  3QIO A;  2E6M A;  3VQ5 A;  4CFA A;  1BQN A;  4EP4 A;  1BCM A;  3PY8 A;  2HHU A;  4CGJ A;  2BDP A;  1U49 A;  3AVM A;  2D5R A;  3K2P A;  1U4B A;  2B6A A;  3NGY A;  1J9A A;  1JLG A;  1SKW A;  4KTQ A;  1B9D A;  2OPQ A;  4OVL A;  4UQG A;  5C25 A;  3SUN A;  1RIL A;  4BE2 A;  2OZM A;  1BIS A;  4M3U A;  4M45 A;  4DTX A;  3SV3 A;  5C24 A;  3LPT A;  4CK2 A;  4FJH A;  4M3Z A;  4FM0 A;  3SQ4 A;  1RT6 A;  3AO2 A;  1UWB A;  3VA3 A;  1W9H A;  4ICL A;  3HPG A;  4CF1 A;  3THV A;  1TL1 A;  4FLT A;  4C8L A;  4M3T A;  4NYF A;  3NF8 A;  4BE0 A;  4H8K A;  1DLO A;  1LWE A;  4CED A;  3I8D A;  1JLE A;  3KKR A;  1GOA A;  3LP3 A;  4CFC A;  2F8T A;  2YHA A;  4DSL A;  5HP1 A;  1N6Q A;  4HVJ A;  3LP2 A;  2Z1I A;  1RT2 A;  1UA1 A;  4FYD A;  3QLH A;  1NK4 A;  2O4G A;  4CJP A;  3ITH A;  4CJV A;  1NKE A;  1LWF A;  4CJ4 A;  3HYF A;  4AHC A;  1VSE A;  3L2Q A;  2PYL A;  1WSG A;  2B5J A;  1NOZ A;  4FW2 A;  3C94 A;  4KV8 A;  3VN5 A;  4E7K A;  3AVA A;  3PO4 A;  4BDY A;  2LSN A;  3AVB A;  3LZJ A;  3V9S A;  4FLY A;  1HYZ A;  4FLZ A;  3M8P A;  2OPR A;  4CJE A;  4BDP A;  1L3S A;  2HHV A;  4I2P A;  5E41 A;  1BGX T;  2B4J A;  3RRG A;  4KKO A;  3LP1 A;  1B9F A;  4CJU A;  4N76 A;  2YNI A;  2XO7 A;  4DF8 A;  5KI6 A;  3NH1 A;  3MAQ A;  4DQQ A;  4I9L A;  4E7I A;  5HRO A;  3AA3 A;  2EX3 A;  3HM9 A;  4FVM A;  3NF6 A;  4DSK A;  3VQ9 A;  3ZSY A;  3QEW A;  4XIU A;  3M8S A;  1IH7 A;  4CK3 A;  3K57 A;  3L8B A;  3WNE A;  3OVN A;  3P1G A;  1WSE A;  1MU2 A;  2BE2 A;  3OJU A;  3SV4 A;  3OYB A;  3O4N A;  4JRP A;  1X1P A;  4QAG A;  1YT3 A;  1Z25 A;  2XRI A;  4CJ3 A;  1U48 A;  4J2E A;  1RT4 A;  4B8C A;  4W5T A;  4CGF A;  4NCA A;  2Y1I A;  4FK2 A;  4RG8 A;  4HTU A;  4FXD A;  4CEC A;  3AO4 A;  2D0C A;  4KHN A;  4DSI A;  1JXE A;  1VSK A;  1WSF A;  4FZY A;  3WNF A;  1RT1 A;  1A5V A;  3AVL A;  3OY9 A;  1QQC A;  1TK0 A;  1NJX A;  3B6P A;  4KTW A;  1XHZ A;  2DFF A;  2XY8 A;  4KRE A;  1A5W A;  2YNG A;  3BGR A;  2Y1J A;  3CM6 A;  3DLG A;  3VQD A;  4RW6 A;  1WAJ A;  5CZ1 A;  2HHS A;  1WSH A;  1RTH A;  2YKN A;  2G8W A;  1QHT A;  1VSI A;  3DRR A;  4CJW A;  3DLH A;  3OYJ A;  3NCI A;  4KHQ A;  1A5X A;  1NKB A;  3UIQ A;  4RW7 A;  2VWK A;  3CM5 A;  1TL3 A;  1UAX A;  4CEF A;  2HHW A;  1JL2 A;  1REV A;  4FJG A;  1NOY A;  3S3N A;  2JGU A;  1T05 A;  3HVR A;  3DOK A;  3LP0 A;  1LV5 A;  4HUF A;  1KVC A;  4AHT A;  3KK3 A;  1HJR A;  4C8K A;  3NDK A;  4MQ3 A;  2P51 A;  1X9S A;  4B3O A;  2DY4 A;  2GV9 A;  1L3U A;  3D45 A;  3AO1 A;  2ETJ A;  2KZM A;  2RPI A;  4EZ9 A;  2EHG A;  1JLF A;  4EP5 A;  5FRN A;  3CQ8 A;  1RBS A;  1RDA A;  1JKH A;  3VQ4 A;  4G1Q A;  3TWH A;  4CF0 A;  3V9Z A;  4KHY A;  2WON A;  3CYM A;  4CJ5 A;  4E19 A;  1J5O A;  3S9H A;  4ID5 A;  4PUO A;  4I2Q A;  3DYA A;  3I0R A;  3ZSW A;  1ZBU A;  3QES A;  1NK8 A;  4NCG A;  3AA4 A;  1TKX A;  5I42 A;  1SL0 A;  5J1E A;  4FM1 A;  3TAQ A;  4R5P A;  3KD1 E;  4N56 A;  2Z1H A;  5HBM A;  3TAM A;  3EY1 A;  4Z4E A;  4HCB A;  1UA0 A;  1RDC A;  1D9F A;  4CGI A;  1XHX A;  4OLB A;  3KLG A;  4LH5 A;  4CGG A;  1TV6 A;  1SKR A;  2D0B A;  4B9M A;  4FLW A;  1RBV A;  2VWJ A;  1X9W A;  4Z4G A;  1S6Q A;  1VRU A;  4LH4 A;  3L3V A;  2VG6 A;  4FLU A;  4PA1 A;  3ZT2 A;  3QEP A;  1S9G A;  3NF7 A;  4CJR A;  3AVF A;  3V81 A;  1NK9 A;  3LAM A;  4CE9 A;  2BGG A;  1JLC A;  3ASM A;  4CHQ A;  4KRF A;  4AHU A;  3EYZ A;  4KHS A;  4DF4 A;  1J53 A;  3BDP A;  1VSD A;  1LWC A;  1U04 A;  4TSX A;  1TAQ A;  3LWL A;  4KHU A;  1LW2 A;  2Z1J A;  3U6F A;  3T1A A;  3VQ7 A;  1VSL A;  1RT7 A;  1GOB A;  3C95 A;  3U3G A;  3K5O A;  3HT3 A;  3HO1 A;  1QSS A;  3TI0 A;  3RMA A;  4WE1 A;  2KTQ A;  4Z4H A;  4Z4C A;  1WNS A;  4AHV A;  3HPH A;  4DQI A;  4FJ5 A;  3NGI A;  3CG7 A;  3NGZ A;  4DTN A;  3MXM A;  1VSH A;  4Z4F A;  3K5N A;  4PWD A;  1LW0 A;  1C1C A;  4FLV A;  3ZSR A;  4DFJ A;  2PZS A;  4DS4 A;  3QEV A;  3PO5 A;  3JYT A;  1Q9Y A;  4LSN A;  4DTR A;  5J2P A;  4DFK A;  3ULD A;  3AVK A;  3ALY A;  2G8V A;  4Q0B A;  4ID1 A;  4QCL A;  1SUQ A;  5T7B A;  4JRQ A;  3TAR A;  4F2R A;  2IAJ A;  4O5B A;  4YNQ A;  1S6P A;  3FFI A;  1IO2 A;  1C0T A;  1CZB A;  3DLR A;  4RW8 A;  4CFD A;  4W5R A;  3OYG A;  4DS5 A;  1WAF A;  3LPU A;  1G15 A;  4KTZ A;  4OKJ A;  3SQ0 A;  3TAF A;  1RTD A;  4ELT A;  4CEA A;  4I7F A;  3QIP A;  3PUF A;  4F3T A;  4BE1 A;  4PQU A;  1RBR A;  4IDK A;  2QKK A;  3DLK A;  3WNH A;  3AVG A;  4OPK A;  4DSF A;  3LAL A;  2HHQ A;  4DSJ A;  3VQE A;  3OYH A;  2XY6 A;  3TAP A;  2ZQB A;  4DU3 A;  4FJK A;  5KRT A;  1ASW A;  4N5S A;  3RR7 A;  1S1W A;  1EP4 A;  4PY5 A;  3KJV A;  4F2S A;  2G8F A;  3MEG A;  4DLG A;  4AIL C;  3SCX A;  4J2D A;  1WSI A;  1XWL A;  3IRX A;  4CGD A;  4B08 A;  4BDZ A;  4ZTJ A;  1F21 A;  3IS9 A;  4CEZ A;  4CCH A;  1S1X A;  3IG1 A;  2E6L A;  4CHZ A;  2IOC A;  3TR8 A;  1L5U A;  2HVH A;  1ZYQ A;  3PV8 A;  2G8U A;  3SUO A;  3V1Q A;  1X9M A;  2W42 A;  4CJL A;  3CFR A;  1Q9X A;  3AV9 A;  1JLB A;  2X6S A;  1CZ9 A;  4J2A A;  1ASV A;  4H4O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...