2Z1HA

Crystal structure of e.coli rnase hi surface charged mutant(q4r/t92k/q105k/q113r/q115k/n143k/t145k)
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
155
structure length
155
Chain Sequence
MLKRVEIFTDGSCLGNPGPGGYGAILRYRGREKTFSAGYTRTTNNRMELMAAIVALEALKEHCEVILSTDSQYVRQGITQWIHNWKKRGWKKADKKPVKNVDLWKRLDAALGRHKIKWEWVKGHAGHPENERCDELARAAAMKPKLEDTGYQVEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease HI
publication title Protein Thermostabilization Requires a Fine-tuned Placement of Surface-charged Residues
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 47
structure length 155
sequence length 155
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2007-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2z1hA00
4CK2A 3MEEA 4FLTA 2KFNA 1BIZA 3OJSA 3OS1A 1ZBLA 1GOCA 5JS2A 4B8CA 4ZHRA 4DTSA 1RNHA 2QKKA 1RDAA 2ATQA 1EETA 3MXMA 3CFRA 3QETA 1JLEA 1L3VA 4CESA 1QTMA 4CFCA 3A2FA 1NJXA 4DSLA 4OGCA 1BHLA 4EP5A 3QEWA 4I9QA 5HBMA 4ID5A 1D9FA 3QINA 2PZSA 4KKOA 1FKOA 1JXBA 4GMJB 4BDPA 1C0UA 3V1QA 4BWJA 1SL1A 4W5OA 4IG3A 4QAGA 2G8WA 1JXEA 4Z4FA 1WNSA 4DTPA 3F9KA 3KLFA 2XRIA 4DS4A 1REVA 4ICLA 3DRRA 3P83D 3TAMA 4CEOA 4CGFA 4FK4A 4ID1A 4CFBA 3KLGA 4Z4HA 1QHTA 4KTZA 4Q0BA 4FM0A 5SWMA 1JLGA 4E19A 1BIUA 3NFAA 2YKNA 1RT5A 3KLEA 1W9HA 5FDLA 1T05A 1SKWA 1SL0A 1Q9XA 3K57A 3KLHA 3S9HA 3M8PA 2VG6A 3AA4A 4CF1A 3MXIA 4CEDA 1ZBFA 4CEFA 3G0ZA 2ZD1A 1TK0A 1A5VA 3L3VA 2KTQA 2HHXA 4WE1A 1TAQA 1C0MA 3DRPA 4AHVA 3JYTA 2EX3A 5J2PA 1LW0A 1BGXT 4FLZA 3ZSYA 2FBXA 3CG7A 4PUOA 4LSLA 3QNNA 4KB0A 1YTAA 1ASVA 1Z26A 1J54A 3VQ4A 3ZSZA 3O3FA 3O4NA 4CIGA 2YNGA 4RW6A 2D0AA 1KCFA 3C94A 1S1XA 1VRTA 3LP1A 4GW6A 2IOCA 2FBYA 1XC9A 1X9SA 4B9UA 1NKCA 4FXDA 4OKKA 4H4OA 4DFMA 5D3GA 1ITGA 1JL2A 3NF7A 3NE6A 3WNGA 4E7HA 5KGXA 1RBSA 3RMCA 3C95A 1KTQA 2HHTA 1BCMA 2FBVA 3MXJA 4CJWA 4CJTA 3HPOA 3TAPA 4ZTFA 1ASUA 3V81A 3QIOA 4B9MA 4OGEA 4BDZA 3AVAA 1CZBA 2Q3SA 4HUFA 4E7JA 3LAKA 3PX6A 2G8HA 1SKSA 4DTOA 3SQ2A 2IS3A 4DMNA 2BANA 4PY5A 4CGHA 1ZBIA 1VSMA 4CIFA 3TAFA 3TAEA 3RRHA 4K8ZA 1GOAA 5DMRA 3TI0A 3JSMA 1WAFA 2GV9A 1A5XA 3HT3A 4JRPA 5C25A 1TL1A 4FJNA 1HJRA 5HRRA 2B4JA 4CHZA 2YNFA 1RTHA 5J2MA 3B6OA 4FJLA 2DTUA 2BDPA 1C1BA 3C6UA 1RDBA 3DLRA 3VQ8A 1TV6A 1WAJA 5CYQA 1SKRA 4O0IA 4Z4GA 3UIQA 1HQUA 2HW3A 5T7BA 1TGOA 1C1AA 5CY4A 1TL3A 4HVJA 1UOCA 3D0PA 2Z1IA 4LSNA 3ZCMA 4DU4A 4EP4A 4KFBA 1Z25A 3NCIA 3SI6A 1NK9A 2WOMA 1BCOA 4IFVA 3SYZA 4DTRA 4DTJA 3RWUA 1A5WA 1TKZA 4IFYA 4CJKA 4NCGA 3I0RA 4CK3A 1FXXA 4M3RA 4FLXA 4CEQA 3RMDA 3QERA 3LP2A 3PUFA 3T1AA 2G8VA 2GUIA 4LD0A 3V9UA 4CHPA 3DLHA 4KTQA 4RW7A 4KB1A 1LWCA 2F8SA 1DLOA 4FYDA 1VSLA 1VSEA 2LSNA 4CF2A 4KO0A 4YNQA 1HPZA 4E89A 4DLGA 4DTXA 2PYLA 2VWKA 1BQMA 4CHQA 3PV8A 4BDYA 3AO4A 2YKMA 4QCLA 3S3NA 3HYFA 1NKBA 3LPUA 1NK6A 4CEBA 4DQQA 3AVNA 3AO5A 3K2PA 1EXQA 2HVIA 1C1CA 2X6NA 4I2PA 2IAJA 4CJPA 3SCXA 3AVLA 4CEAA 4AILC 3SPZA 3ZSWA 4FLWA 3HM9A 4XIUA 3OYCA 1VSIA 3LALA 4KTWA 2P5OA 2XY5A 4I2QA 4FW1A 1RILA 3LP3A 1I39A 3HJFA 3QEPA 4N41A 4KI6A 3QO9A 1VK0A 4KI4A 4HTUA 1WSEA 1I3AA 3KJVA 4OPJA 4DTMA 3S3MA 4CF8A 1SL2A 2BE2A 2OZSA 2HNDA 5K14A 4TSXA 4CIEA 3LZIA 4BE1A 4DU3A 3SQ1A 2HHUA 1J53A 5KI6A 4DG1A 3VQPA 1LWEA 1T03A 4B9LA 4CF0A 1RTDA 4NYNA 4B9TA 1Q9YA 4FCYA 3MECA 4O5BA 4DTNA 3LWLA 3NF6A 2I5JA 3K5NA 4CHNA 1JKHA 4N5SA 4W5QA 2JGUA 3QEIA 4L8RB 4BWMA 4FJ7A 4CEZA 4FK2A 3V1OA 3SZ2A 2XHBA 4CJLA 3CFPA 4DQPA 1G15A 2B6AA 3PO4A 4K8XA 3P1GA 4B8AB 3OJUA 4E3SA 3PX0A 3BDPA 4DQIA 4FJMA 4B9NA 2IC3A 1S1TA 3WNHA 1RTJA 4KHQA 3DMJA 5J1EA 1KFDA 1RBTA 3RMAA 3KKSA 2HNZA 3TAQA 3RTVA 3TAGA 1LAWA 3ASMA 3TABA 3VA0A 3AV9A 1IH7A 3AO2A 3B6PA 4KPYA 2Z1JA 4W5TA 1U49A 1T7PA 3OYKA 1CXQA 3AVGA 2G8KA 2QXFA 3V9SA 3CM6A 1CZ9A 1J9AA 2VG5A 1X9MA 3NH0A 2OPPA 4M41A 4M3WA 3AA5X 1HMVA 3DOLA 1BISA 4ELTA 1BL3A 3DOKA 4DQRA 4FJ8A 1RT2A 4NCAA 1NK5A 3AVCA 1L3UA 4CCHA 5KRSA 3OYHA 4UQGA 4AHSA 4EZ9A 3K5LA 2VG7A 4CERA 3QIPA 4HCCA 2KZZA 3L2UA 3L8BA 1FKPA 2A1SA 4J2EA 4C8NA 4DQSA 1JLAA 5HRSA 4OJRA 4OLAA 3IAYA 4FVMA 1YVUA 4O55A 2ITGA 3QEVA 3OYAA 5HLFA 3ZT0A 4KHSA 3TWHA 2BGGA 1T8EA 2HHVA 4QOZB 3U3YA 2KZMA 1HNVA 1IKYA 1S6QA 4N76A 1EX4A 1RT7A 1Y97A 1YTUA 1RBRA 1C6VA 1EKEA 1HRHA 1LW2A 1ZBUA 2FBTA 3SJJA 1B9DA 4DU1A 4F8RA 4DSFA 1TKDA 1LV5A 3P5JA 1NJZA 4FZXC 4W5NA 1WN7A 1W0HA 2B5JA 5SZTA 3VQDA 2OPQA 4CECA 4B9VA 1ZBHA 4R5PA 1RT1A 1ASWA 1JLBA 3L2QA 3AVBA 3DM2A 4CGDA 2Y1JA 4CJQA 4C8MA 4FJIA 3V9WA 3CM5A 3HSTB 4M3YA 4AH9A 1VRUA 3ZT1A 4GVMA 3IS9A 3E01A 3SV4A 5J2QA 3EZ5A 2E6MA 1IG9A 4LH4A 1JLQA 2XY8A 2X74A 3OYFA 4CGJA 1NKEA 3ZT2A 1WSHA 4RW8A 1IKVA 2HB5A 3ITHA 3MEDA 1WSIA 4FJHA 4FZZA 1HYVA 1RT3A 3QLHA 3VQ9A 1NOZA 4RG8A 3OS0A 1F21A 3K59A 5HROA 2RF2A 1HNIA 1L5UA 4CEEA 2YNHA 2RN2A 3C6TA 3I0SA 2G8UA 4DSIA 2F8TA 3OVNA 2XY6A 3HP6A 4FJXA 1KVAA 2DY4A 2DFEA 3IRXA 3K5MA 1QSLA 3VQ5A 1S6PA 2AJQA 4KV8A 1NJYA 2RPIA 3HL8A 4CJUA 1UAXA 4ELVA 1N5YA 2ZE2A 3AVMA 3NF8A 3LPTA 2R7YA 1JLFA 4FM2A 1NK0A 4Z0UA 3VQEA 4DF4A 1WSJA 1KVBA 4OKJA 1UA0A 3VQCA 4DSKA 4KRFA 2O4IA 4N47A 2DFHA 2E6LA 3V9ZA 3G10A 1HQEA 2D0BA 1HYZA 2YHBA 1RDDA 3KK2A 1R0AA 3RR8A 1CXUA 3ZSVA 1QSSA 5FRNA 4FLYA 4MFBA 4F2RA 3ALYA 3EYZA 3L3UA 1TVRA 2NUBA 4JLHA 3NH2A 3NGZA 3HP9A 3NH1A 5HP1A 1VSKA 3KTQA 2IGIA 3H08A 4CJVA 3SUNA 4DFJA 1RCHA 4FW2A 4EZ6A 4J2BA 1O1WA 3HPGA 3HPHA 5KRTA 5CZ1A 3V4IA 4F4KA 3NF9A 1KSPA 1KFSA 2OYQA 4CJ4A 4HCBA 3O3HA 3RMBA 2QKBA 3HO1A 4DF8A 2ETJA 2X6SA 3KLIA 4F3TA 3U6FA 3AVIA 5CZ2A 2XY7A 1NJWA 4AHUA 3L2WA 1K6YA 4FM1A 4KHYA 4M3XA 3SUPA 1KVCA 2G8IA 3S3OA 1NK7A 2X78A 3VQ6A 4Z4IA 2E4LA 1U4BA 4Y1DA 4DLEA 4DS5A 2OPSA 2HNYA 4Q5VA 1N6QA 5E41A 4IDKA 4O44A 3CYMA 1QSYA 2GBZA 1J5OA 4BE0A 3DLBA 1JL1A 5J2NA 5HRPA 5KGWA 3M8RA 3AO3A 1GOBA 3ISNC 3HVRA 2OZMA 3OYMA 3NAEA 2P5GA 3VQBA 3EY1A 1EP4A 4ELUA 3ZSOA 3VN5A 1TKTA 3ZSRA 4W5RA 4O0JA 4OVLA 3OYBA 3CQ8A 3MEGA 1VSFA 1NK8A 4AHTA 4FJ5A 4J2DA 2Z1HA 4KAZA 4PWDA 2D0CA 3VQ7A 4B3OA 2VWJA 3HXMA 3SPYA 1UA1A 4FJ9A 4F3OA 3LANA 2G8FA 5FRMA 5DK5A 4Y1CA 2DFFA 5HRNA 2HVHA 3OY9A 4CK1A 3O4QA 2O4GA 1QE1A 4AHRA 3NGIA 4JRQA 2YHAA 4F2SA 2HHQA 2FC0A 3K58A 1D8YA 4DFKA 4FLVA 1U47A 4DSJA 4NYFA 4CJ3A 1WSFA 3ZT4A 4Z4CA 1L3TA 3RRGA 3CFOA 5C24A 4NCBA 3AVFA 5FROA 3TR8A 4OLBA 3K5OA 1U45A 2KQ2A 4FLUA 3LWMA 4H4MA 3KK1A 3DRSA 4E1MA 5I42A 3VQAA 3VA3A 1S9GA 2RKIA 4HUEA 4DTUA 3QESA 1RT6A 5I3UA 1NK4A 3BGRA 4B9SA 4FK0A 3HVTA 3RR7A 2YNIA 3LZJA 4BACA 3SNNA 1ZYQA 1X1PA 2IDOA 3LAMA 4DFPA 3TANA 1NOYA 4RW4A 4N56A 4PQUA 3PX4A 4FJKA 4JS4A 3DLGA 2HHWA 3U3GA 4E7LA 4RW9A 1RBUA 1U04A 4IG0A 4OPKA 1TK8A 1BI4A 1RT4A 1DTTA 2A1RA 3NDKA 1RDCA 1KLMA 3SV3A 2XO7A 3OS2A 3SUQA 1KRPA 1VSDA 3ZSQA 1BQNA 1S1UA 3T3FA 4H8KA 1S1WA 3SQ4A 1TK5A 4AHCA 3NBPA 4OKEA 4E7IA 3LDSA 3D45A 2ZQBA 3AVKA 4JS5A 4KHWA 3PY8A 2QK9A 1LAVA 4M45A 4CJEA 1KLNA 4LH5A 1QS4A 1XI1A 4E0DA 1JLCA 3O3GA 1XWLA 3IG1A 5EU7A 1VSHA 3V9XA 4KHNA 3L2RA 1IKXA 5C42A 4M3TA 4B08A 3QNOA 4FJGA 2YV0X 4MQ3A 3THVA 2OPRA 4C8OA 3DLKA 4IKFA 1D5AA 1IO2A 2Z1GA 1S9EA 4CJ5A 3WNFA 1S5JA 3V6DA 4CGIA 4C8KA 1YT3A 1QQCA 2OA8A 1RTIA 2KFZA 3OYNA 4E7KA 1D9DA 4C8LA 1FK9A 3DYAA 4LY7A 2P1JA 3TARA 3OYGA 2PYJA 4G1QA 1HYSA 1RBVA 1Q8IA 3KD1E 3AVHA 1C0TA 1IKWA 4CF9A 3HK2A 2HMIA 2PY5A 1TKXA 3AVJA 3WNEA 4KHUA 1MU2A 3FFIA 1L3SA 4M3UA 3M8SA 4I7FA 4CJFA 2P51A 3SUOA 3KD5E 5KTQA 3OYLA 1DTQA 3LP0A 2EHGA 3NGYA 3AA3A 2W42A 4DSEA 4FZYA 4Z4EA 4O4GA 1CLQA 4IBNA 3QEXA 2JLEA 3KKRA 4I9LA 4CJRA 1U48A 3T19A 3M8QA 3VQQA 3OYIA 4KREA 4ZTJA 3PO5A 4CFDA 4HHTA 3L2VA 4HUGA 1UWBA 4BE2A 4PA1A 4YFUA 2F96A 3I8DA 3SQ0A 1TAUA 1B9FA 4CGGA 1S1VA 3ZSXA 4CHYA 1VSJA 5JS1A 3AO1A 4J2AA 4FJJA 1SUQA 1SV5A 4M3ZA 3NHGA 3F73A 3DI6A 4M42A 3ZT3A 1WLJA 1B92A 3MAQA 1XHZA 3KK3A 3KIOA 3DLEA 4CFAA 3ULDA 4DWIA 3OYEA 4CJSA 1BI4B 5CYMA 1LWFA 2KW4A 4CE9A 2HHSA 1WSGA 3V1RA 1XHXA 2D5RA 2Y1IA 3OYJA 4CHOA 4E1NA 2WONA 3OYDA 1X9WA 3AA2A
chains in the Genus database with same CATH superfamily
1Q7YO 4BREA 3RVCA 2KFNA 3MWTA 4DR7K 1GOCA 5JS2A 2QKKA 4A5BA 1OH6A 4IEIA 2QWPA 4EP5A 4LFBK 1VQNN 5HBMA 3QINA 1FKOA 1JXBA 4GMJB 4BDPA 1C0UA 3V1QA 3P31A 4DCHA 4W5OA 1LOTB 1WNSA 4DTPA 3AGRA 2PFUA 3P83D 3ZX0A 4CEOA 4FK4A 4CFBA 4BQLA 3N4QA 4Q0BA 1JLGA 4E19A 1BIUA 3NFAA 2YKNA 1W97L 3QBWA 1SL0A 3KLHA 4CF1A 1SZ2A 3AA4A 1L3UA 1A5VA 1XMQK 2HOEA 4PL7A 4AM7A 1BGXT 4FLZA 3MN5A 5LY3A 2YHWA 4PUOA 4LFCK 2HMPA 4KH4A 4CBXA 5IWAK 1WB9A 1VQ6N 1QHAA 3O4NA 1QQNA 2D0AA 4CJ7A 1S3XA 4DV4K 4H0OA 3LP1A 4I6MB 4GW6A 5AQLA 1HKCA 2IOCA 4CD1A 4JI0K 1XC9A 2E88A 4FXDA 5AQIA 2NRRA 1ITGA 1JL2A 3NE6A 3NMUA 3IDHA 3QICA 3CJAA 3RMCA 4DB3A 1BCMA 2P9NB 2E2QA 2GELA 5CHIA 3HPOA 1ASUA 1E4FT 3QIOA 4OGEA 3PX6A 3CIPA 5KPZA 4DTOA 3SQ2A 2IS3A 4PY5A 3EO3A 4CGHA 1ZBIA 5JVHL 4RTFD 3VEOA 4JK8A 1BUPA 3TI0A 3HT3A 1GLFO 4C23A 2BDPA 5AQQA 1C1BA 3DLRA 1RDBA 1SKRA 3WXMB 3FE1A 3UIQA 2I7NA 1TGOA 4AM6A 2Z1IA 3SI6A 4EP4A 4KFBA 3NCIA 2CGKA 1BCOA 4DTJA 4JI3K 1HPMA 2YHXA 1A5WA 1TKZA 3I0RA 1YJ9N 3RMDA 3SLCA 3QERA 3T1AA 3OBWA 3V9UA 3DLHA 4KB1A 3CJ1A 1SAZA 1MWMA 3O9SA 4DLGA 4IJNA 4DTXA 2PYLA 3PV8A 4QCLA 3S3NA 1NKBA 3CCUN 4DQQA 2JWKA 2ZF5O 3AVNA 3AO5A 2GX9A 2IAJA 2FF6A 3ZSWA 4FLWA 3HM9A 2P9UA 2XY5A 3VEWA 1RILA 3LP3A 3OTOK 4HTUA 4FVUA 1I3AA 2F4VK 4KH6A 1ATSA 3LZIA 4BE1A 3BZCA 1T03A 4LF9K 2NRVA 1WOQA 4B9LA 2Q0RA 4B9TA 1Q9YA 2FSNA 3QEIA 4JKDA 3CCEN 3V1OA 4DQPA 4K8XA 1G15A 4B8AB 4BRGA 4B9NA 2IC3A 1S1TA 3WNHA 4H0TB 4DV5K 1LAWA 3EKSA 2QXLA 2Z1JA 4W5TA 4BRFA 3CM6A 2VG5A 3FZFA 4PKHA 2KFZA 4M41A 5C2FA 4H5TA 3AA5X 3KWIA 3FR0A 3WQUA 4BRDA 4DQRA 1X3MA 1N32K 5KRSA 4M7XA 4JHDA 4HCCA 3L2UA 4CZEA 2VCPA 4C8NA 3WXIA 4H5NA 1HNVA 1S6QA 1RT7A 2QWOA 1YTUA 1QZ6A 1RBRA 2NZTA 3SPZA 4A61A 1LW2A 2P9UB 3O4WA 4DU1A 4JAXA 4A57A 4DSFA 1TKDA 1LCUA 3P5JA 5TKYA 1HNWK 4W5NA 3CQYA 3TTCA 3DLLL 4FWKA 4B9VA 1ZBHA 4R5PA 1JLBA 2NLXA 3DM2A 3OHRA 5CE3A 3V9WA 3CM5A 2ZWHA 5GADP 3A5NC 4AH9A 3ZT1A 4YY3K 4GVMA 3IS9A 3E01A 4LF7K 5J2QA 2E6MA 1K8AO 4FZZA 4FJHA 1IKVA 1WSIA 1BWFO 4B1VA 3VQ9A 2W6KA 2O8DA 1HNIA 3BZKA 3I0SA 2Q97A 1P90A 4EIAA 1KVAA 2DY4A 4BG9A 3K5MA 4B1UB 3MCAB 1TUYA 5AZJA 2AJQA 4KV8A 4DQ8A 2UUBK 1UAXA 3AVMA 3NF8A 3LPTA 2NRZA 3VQEA 4OKJA 4AQYK 2E6LA 2ASMA 3OBYA 1TUUA 3GE1A 3KK2A 1R0AA 3RR8A 1CXUA 4F2RA 4JLHA 2NUBA 3HP9A 3VEZA 1GLJO 3H08A 5AQJA 4FW2A 4EZ6A 5CR4A 5KRTA 4JHDB 4BRMA 4F4KA 4HCBA 2OYQA 1RDUA 3O5BA 4F3TA 3U6FA 2XY7A 1SS6A 5IT9O 5BPLA 2G8IA 5F2RA 3AY9A 1BA1A 2X78A 2E4LA 5BREA 3BY5A 1U4BA 4DLEA 4DS5A 1N6QA 5E41A 1J5OA 1DKGD 2QWLA 3HVRA 3NAEA 3KK7A 4BGAA 1EP4A 3ZSOA 1TKTA 3DXMA 3OYBA 4BRLA 3CCVN 1ILYA 2D0CA 1HKBA 2OTLN 5FRMA 5HRNA 2O8DB 3OY9A 3RSEB 3CERA 4KBOA 4DKWA 4CJ3A 1L3TA 5AZJB 1VQMN 3F2KA 2YJEA 2Q31A 4NLBA 4GV3A 3LWMA 4H4MA 4B1XB 3CD6N 3C0BA 4E1MA 2A41A 1NK4A 4FK0A 2YNIA 1ZYQA 1X1PA 1CZAN 3A0IX 3I33A 3O08A 3TANA 1OKJA 3QFUA 4K25A 2ZJQL 3PX4A 4BROA 4RW9A 1KAZA 3SV3A 2XO7A 4FSVA 1EQYA 1G99A 4JI2K 5JICA 3MX2A 4B1YB 1TK5A 3O9QA 3NBPA 1E4GT 4GY2B 4JS5A 2QK9A 4M45A 4LH5A 1QS4A 4DUYK 1JCGA 4E0DA 1JLCA 1D4XA 1VSHA 3V9XA 4KHNA 4EHUA 4FJGA 4IKFA 2OPRA 4BRAA 4CZFA 1IO2A 2OCEA 3WNFA 3DXMB 4O8UA 4CGIA 1YT3A 4WYBA 4BR7A 3C65A 1HJOA 5ADXA 1HYSA 3CHWA 3UKUA 1RBVA 5BN8A 4RCHA 2GWJA 1P8ZA 3HK2A 4B3MK 4LF6K 1TKXA 1MU2A 4M3UA 3KD5E 2P51A 3L0QA 4H5VA 1NGJA 3W0LA 5KTQA 1DTQA 2E2OA 1IBKK 3NGYA 3AA3A 4FZYA 4DSEA 3KKRA 3AAPA 4KREA 1NMNA 4CFDA 3L6QA 4CZIA 1MA9B 3PLAA 3M5RA 1TAUA 1Q82O 4ILGB 3A5MC 3NHGA 3ZT3A 1WLJA 4IOCL 4DV6K 3KK3A 3CETA 3KIOA 4CFAA 4NB4A 4QS7A 2HF4A 3VETA 4CJSA 5MLCQ 3VTHA 3PIOL 3OYJA 3OYDA 4PKGA 3AGKA 4U7BA 1YHQN 1NGFA 4B8CA 4ZHRA 1NNEA 1JLEA 1L3VA 3ZX3A 4OGCA 3QEWA 5FPNA 5GAHP 4I9QA 4ID5A 2QEXN 4G9ZA 3MN7A 4KKOA 1QVFM 4IG3A 4QAGA 2G8WA 4Z4FA 4BRIA 2O8EA 4DS4A 4X64K 4ICLA 3ATUA 3TAMA 4X66K 1ZBSA 4CGFA 2GTDA 4Z4HA 4KTZA 4H0YB 5SWMA 5E26A 4FWRA 3UKUB 3SBTA 1RT5A 3WT0A 1SKWA 4IEEA 3H3NO 2Q36A 3NVKA 2VG6A 3MXIA 1ZBFA 3H46O 3L3VA 2A3ZA 1K9MO 4DR3K 3PSIA 1TAQA 3DRPA 4AHVA 3JYTA 5J2PA 1OH8A 1LW0A 3THWA 2CH5A 5GAEP 5ADXH 3EZWA 4H5RA 3ZSZA 3M6GA 4CIGA 3KZBA 3QBXA 4JKBA 1KCFA 1VRTA 5LMNK 2I7PA 4B9UA 2QWQA 3VGLA 4DFMA 4GV6A 4A62A 1BG3A 1IV0A 4KHPK 1C0GA 5KGXA 1RBSA 3C95A 1KTQA 2HHTA 5EVZA 3MXJA 4ZTFA 1CZBA 4HUFA 3LAKA 3J7AP 2P9IA 2G8HA 2BANA 3RRHA 3E66A 2FXUA 1TL1A 4FJNA 1RTHA 3B6OA 3EE8A 1WAJA 1ATRA 4CZMA 2HW3A 5T7BA 3RTVA 1TL3A 1KXPA 4BC3A 1NK9A 2WOMA 4DTRA 3SYZA 1KD1O 2O8EB 2YJFA 5AJ3K 1I94K 4NCGA 3VERA 3LM2A 1DGKN 5AFUA 2E20A 2UYTA 4LD0A 4RW7A 1LWCA 3FLCO 1DLOA 3HZ6A 2LSNA 4CF2A 2VWKA 4A59A 4R79A 5KQ8A 2YKMA 3D6RA 4E1JA 4BRHA 3THWB 3A5OC 4B1ZA 4DR2K 4I2PA 4CJPA 1R59O 5C0YA 1GLBG 2F9TA 3FZLA 4I2QA 4FW1A 4N41A 4KI6A 4KI4A 4H0VB 3S41A 4CF8A 1SL2A 2BE2A 3IUCA 5LL6Z 3VMFB 2HHUA 4HTLA 3GG4A 3VQPA 1LWEA 2P9PA 3O9RA 4CF0A 2Q0UA 3KVGA 2H3GX 2VWBA 4O5FA 4FCYA 3MECA 4WFBL 3LWLA 4N5SA 1JKHA 2P9IB 4W5QA 4L8RB 3SZ2A 1RGIA 3P1GA 3IKMA 3OJUA 3PX0A 3BDPA 4FJMA 4BVPA 4WQ4A 1OH5A 4XH4A 1RTJA 4BC2A 3RMAA 1NGGA 3KKSA 1T6DA 2D4WA 3ASMA 4LF5K 4KPYA 1T7PA 1CXQA 2QTDA 3AVGA 2G8KA 2EWSA 5AR0A 3NH0A 1HMVA 3DOLA 1BL3A 3G4SN 1RT2A 2ZM6K 2V7ZA 4JNEA 3P39A 5AQYA 3K5LA 5JLHA 3I56N 5DM6L 2CH6A 3LDOA 4OJRA 1RDWX 3IAYA 4FVMA 1YVUA 3OYAA 5AFUH 4H5WA 3U3YA 2KZMA 1IKYA 4FO0A 3ZETA 3IFRA 3U9DA 1C6VA 1MWKA 4YOTA 1LV5A 1BA0A 1NJZA 1W0HA 5I9EB 3U4LA 3VQDA 2OPQA 1RT1A 3L2QA 3T7ZA 3HSTB 4M3YA 4DR1K 3ZEUA 1VRUA 3SV4A 1BO5O 3BEXA 3EZ5A 2P9PB 2XY8A 4YHHK 3OYFA 1NKEA 4FWNA 4CGJA 3ZT2A 4RW8A 2HB5A 3MEDA 1RT3A 3OS0A 3MN9A 5HROA 3ZYYX 2RF2A 3O80A 1YIJN 2NRXA 3CPWM 2G8UA 2YNHA 4FL9A 1QSLA 2RHKA 1S6PA 4JD2A 2RPIA 4CJUA 4ELVA 4JI1K 1JLFA 4Z0UA 3VQCA 4Z94A 1J6ZA 1ZXOA 4V19S 2IVPA 3G10A 2HBJA 4WQ4C 1XQSC 5BRDA 4FLYA 2QWMA 1QQMA 1XNQK 3NH1A 2HBMA 1VSKA 5HL7L 1NGDA 1Z05A 4CJVA 3HPGA 3H1QA 4CJ4A 2W40A 4DR5K 1IJJA 3L2WA 4KHYA 4M3XA 3SUPA 1KVCA 1NK7A 4ILJA 3ZETB 2OPSA 2HNYA 3JXUA 1QSYA 2GBZA 2FF3B 3ZX2A 1JL1A 5KGWA 3M8RA 3T69A 1GOBA 3JS6A 3T1YK 3OYMA 4JI8K 2P5GA 4ELUA 4W5RA 4O0JA 1NK8A 3CQ8A 1OVYA 5FPEA 4FJ5A 4BRNA 1MDUB 3EL2A 2P9SA 3ZEUB 3VQ7A 4B3OA 3E9PA 3LANA 4KH5A 4CK1A 2YHAA 1KAYA 3K0SA 4FLVA 3J7ZO 3ZT4A 3CCQN 4JD2B 3AVFA 1HUXA 4OLBA 1TYQA 1U45A 2P9LA 4DTUA 1S9GA 3EEQA 5AQVA 5I3UA 4B9SA 1NU0A 4H0PA 4BACA 4NXNK 1OH7A 3GBTA 3LAMA 4RW4A 3DLGA 3U3GA 1HNZK 1RBUA 4OPKA 2KKZA 1KLMA 1NGBA 2GEMA 3R3LA 3OS2A 1BDGA 3SUQA 1VSDA 3ZSQA 1YVNA 3FZMA 4H8KA 1S1WA 2W41A 2HF3A 4A2AA 3LDSA 3AVKA 1V4SA 3UKRA 4FWPA 1KQSM 4KHWA 3GOIA 1HLUA 4IO8A 1KLNA 1XI1A 1XC3A 4DV7K 3O3GA 4CZHA 3IG1A 4YDUA 4JKCA 4C8OA 1D5AA 1BOTO 1QZ5A 3C6AA 1S5JA 3TTFA 4FPBA 3V6DA 3VPZA 4FPAA 2VQEK 3OYNA 2P9SB 4E7KA 5GAGP 4IOAL 4PHTX 5AQMA 5BN9A 3VESA 3KD1E 1C0TA 1IKWA 4CF9A 2HMIA 2V7YA 5F1XA 4XEIA 3CF5L 3M8SA 3LP0A 5C12A 3GL1A 5EXWA 2W42A 4Z4EA 4O4GA 4IBNA 5AQUA 1TYQB 2P9LB 1M1KO 3E9OA 3L2VA 4BE2A 2F96A 3I8DA 4CHYA 4J2AA 1SUQA 1SV5A 4WFAL 3DI6A 4YOXA 1B92A 5HOOA 3ULDA 2OTJN 4DWIA 3OA9A 5C15A 5CYMA 2O8BA 1LWFA 2KW4A 2HHSA 4CHOA 4E1NA 4CK2A 3H1VX 3MEEA 3OJSA 3HRGA 4DTSA 1RDAA 1U2VA 1EETA 1VHXA 3UKRB 3QETA 4CESA 4CFCA 3A2FA 1NJXA 5ELZA 3ZLJA 1SL1A 3FZKA 1E3MA 4K0KK 1JXEA 4EHTA 3KLFA 5AQNA 3DRRA 3CJBA 3KHYA 1QHTA 4FM0A 1X3NA 4YDUC 2ITMA 3KLEA 1W9HA 5FDLA 3VGMA 1T05A 3K57A 3QB0A 3S9HA 1YUWA 1N8RO 3MMVA 1TK0A 2A6AA 3UE5A 4CEDA 3G0ZA 3MK6A 4WE1A 3HOSA 5AQPA 3ATVA 4K42A 3QFPA 3CG7A 4MO4A 3QNNA 4KB0A 1ASVA 1Z26A 1J54A 2DPNA 2BUPA 3MN6A 3MX5A 2NRTA 2YNGA 3M1FA 4RW6A 4MDAA 4JV5K 3C7NA 1X9SA 5GIOA 1HR0K 4H4OA 5D3GA 4B9QA 3NF7A 5KQDA 3WNGA 4E7HA 1EWQA 4BR5A 2YCHA 1VQLN 2IVOA 2FSKA 4CJWA 3TAPA 2O8BB 3D2FA 4BDZA 3N4PA 4E7JA 2Q3SA 3TTDA 4CZKA 4DMNA 4CIFA 4DV0K 3TAFA 3TAEA 4K8ZA 1GOAA 4CZLA 5DMRA 2HSTA 1WAFA 2GV9A 1U2VB 3D2EA 1V4TA 4JRPA 3SMPA 2WUSA 4CI6A 4CHZA 2YNFA 4A2BA 5J2MA 4FJLA 2DTUA 3C6UA 4JKAA 4JI4K 3VQ8A 3E9LA 3VF6A 4O0IA 4Z4GA 1HQUA 4HVJA 1C1AA 4LF4K 1U6ZA 1UOCA 4CD3A 3LDPA 3SJHA 3ZCMA 1Z25A 4WFNL 3RWUA 4BQZA 1HNXK 5LJVA 4BRQA 4CEQA 4H0XB 4YOYA 2G8VA 2GUIA 5BPMA 4KTQA 1JCEA 4FYDA 3AARA 1VSLA 1VSEA 4KO0A 3MCPA 1HPZA 4E89A 4YNQA 4CHQA 3CC4N 4BDYA 3AO4A 3HYFA 1NK6A 4CEBA 3CCMN 1EXQA 2HVIA 4JN4A 2QWRA 3SCXA 1N36K 4CEAA 3VGKA 3CCJN 4FWQA 4XIUA 1VSIA 3LALA 4KTWA 1C0FA 3EKUA 2P5OA 3QEPA 3QO9A 1VK0A 4MDBA 2V51B 1DEJA 3C7NB 3KJVA 2ZGZA 2OZSA 2HNDA 4JI6K 3ULEA 4CIEA 3BF3A 2RE2A 4DU3A 3SQ1A 4DG1A 3R9PA 3CC7N 2GUPA 2WC9A 1RTDA 4NYNA 4X65K 3D2FB 4O5BA 4DTNA 1W2BM 3NF6A 3K5NA 2IVNA 4CHNA 3GDQA 4IWVA 4BWMA 4FJ7A 4CEZA 4FK2A 3H45C 4DV3K 2XHBA 4CJLA 3CFPA 1BU6O 3D2EB 4DQIA 4KHQA 3LDLA 1KFDA 3MWPA 2HNZA 3VF4A 3TAQA 3TAGA 3TABA 3TPQA 5M1PA 3SAFA 3VA0A 5AQFA 3QDKA 4B3SK 1NWKA 4CBUA 2QXFA 4FWOA 5JLFA 4YOVA 4M3WA 3J8AA 4ELTA 2HBLA 3DOKA 4FJ8A 3WXKA 3OYHA 3BF1A 4EZ9A 2Q2RA 2VG7A 4BR2A 4A5AA 1NG9A 2KZZA 1FKPA 3VENA 4J2EA 5HRSA 4OLAA 4CZJA 2D0PA 4WF9L 3QEVA 1T44A 4O55A 5HLFA 3ZT0A 3TWHA 2WTUA 2A40A 1JJ2M 4BRKA 4N76A 1EX4A 1K8KA 5BR8K 2E1YA 3SJJA 2FBTA 2O8FA 1B9DA 5A2QO 4F8RA 5E84A 1EWRA 1WN7A 2O8CA 4M7YA 5SZTA 3VTIA 1NGAA 1ASWA 3NVMA 3WXLA 4CGDA 2Y1JA 3ULEB 1Z6RA 4CJQA 1EO1A 4C8MA 1HX1A 4JK9A 1JLQA 4M42A 3ITHA 5AQZA 5BPNA 1HYVA 4B3TK 3QLHA 4ILHA 1F21A 3K59A 2AP1A 4CZGA 1L5UA 4CEEA 2V52B 3K9JA 3HP6A 1YF5L 3VQ5A 2QI2A 5KPTA 2ZE2A 3TU5A 1NK0A 4DF4A 1WSJA 1KVBA 1UA0A 2DFHA 2IIRA 1HQEA 2D0BA 4XH1A 1RDDA 1QSSA 4NO7A 2WBNA 4MFBA 4OX9K 3EYZA 3L3UA 3NH2A 1IBLK 5C2DA 3KTQA 4DFJA 1HKGA 5M1KA 3HPHA 2VGNA 3NF9A 1KSPA 3HO1A 3BUZB 4LF8K 3O3HA 3RMBA 3CJ9A 4DF8A 2J4RA 3AVIA 2PAVA 1NJWA 4AHUA 1K6YA 4BC5A 4DV1K 4MLHA 3D7EO 1IG8A 3S3OA 2ZGYA 4JK7A 1O13A 2JWLA 4Q5VA 1K8KB 2O8FB 3CYMA 3SAGA 2ASOA 1Q18A 5HRPA 3AO3A 3ISNC 3SMSA 2O8CB 2D0OA 4F9OA 1NGCA 3EY1A 4JI5K 3MEGA 1VSFA 2BH1A 1QQOA 4J2DA 4PWDA 4GKJK 3MDQA 3CC2N 2VWJA 4BG8A 3HXMA 3SPYA 1RFQA 1VAZA 2P9KA 4BR0A 1UA1A 4FJ9A 4F3OA 1YAGA 5DK5A 3TSPA 3O4QA 4AHRA 2UXBK 3NGIA 4F2SA 2HHQA 3K58A 5JVGL 1D8YA 4DSJA 1WSFA 4Z4CA 3RRGA 3CFOA 4IFEA 3CJ7A 4DUZK 4NCBA 5FROA 3G25A 3DRSA 3VQAA 2RKIA 4HUEA 3SNNA 3H6EA 4K43A 2IDOA 3U8XA 2PBDA 4N56A 4JS4A 4E7LA 4O8KA 1RT4A 1DTTA 5AQRA 1KRPA 1BQNA 3EN9A 3VEXA 3WUHA 4OPHA 4AHCA 4E7IA 3D45A 1ATNA 1J5EK 1IBMK 1LAVA 5EY4A 4CJEA 2E2PA 5AQSA 5EU7A 2UUAK 1YJNN 4WCEL 1VQKN 3QNOA 2QKBA 3R1XA 2KLAA 4MQ3A 3THVA 2Z1GA 1S9EA 3J81O 1XNRK 4C8KA 2OA8A 5AQGA 1RTIA 1D9DA 3LL3A 3R6MA 1FK9A 4LY7A 2AA4A 2P1JA 3OYGA 2PYJA 4G1QA 4ISEA 2P9KB 3K9KA 3U9ZA 4MLEA 3FFKB 3CCRN 2PY5A 3AVJA 3LM9A 1NGIA 3R8EA 3SBGA 3FFIA 4KHUA 1KC8O 1CLQA 3QEXA 5C10A 4I9LA 4DR4K 3A8YA 3T19A 3OYIA 5LMUK 3CPEA 3PO5A 1Q86O 2UUCK 4PA1A 4YFUA 3THXA 1B9FA 4ISGA 1VSJA 1S72N 5JS1A 3AO1A 4FJJA 3L4QA 4M3ZA 3F73A 2UXCK 3J80O 3P4IA 2QW9A 4DHYA 3OYEA 4CE9A 1WSGA 4FM2A 4DSKA 3M8PA 3AA2A 4FLTA 1BIZA 4IOXA 3OS1A 2BTFA 1ZBLA 4J8FA 4BGBA 1RNHA 2ATQA 5M1OA 3MXMA 3CFRA 4GVEA 1QTMA 4DSLA 1BHLA 1D9FA 2PZSA 5EOYA 3CMEN 4BWJA 3QMLA 3F9KA 1VQ8N 2XRIA 4HWIA 5BRFA 1REVA 3B8AX 3F5TA 4ID1A 3KLGA 3JAMO 4EAHD 3AAQA 5GINA 1Y64A 3HTVA 4EFHA 1Q81O 1Q9XA 2HHXA 4CEFA 2ZD1A 5JMVA 2KTQA 1C0MA 3F9MA 2EX3A 3O9TA 3ZSYA 4AF1A 2FBXA 5F0XA 3LDQA 4B3RK 4LSLA 2A42A 1YTAA 3VQ4A 1SQKA 5AZIA 3O3FA 3DAWA 3C94A 1S1XA 4B1WB 2FBYA 4YOUA 1NKCA 4FWMA 3THXB 2VGMA 4OKKA 2YX6A 2WFBA 1K73O 4YORA 2FBVA 4CJTA 3V81A 4B9MA 3CQXA 3AVAA 1SKSA 5GIPA 3FGUA 1VSMA 4RWTA 4DV2K 3JSMA 2D1KA 1A5XA 5AQOA 3PIPL 4IO9L 5C25A 1VQ9N 1HJRA 5HRRA 4K41A 2B4JA 3SK3A 1WBBA 1TV6A 5CYQA 5CY4A 3D0PA 4BY9C 3O9UA 4LSNA 3TSUA 4DU4A 3RSEA 4IFVA 3HI0A 3Q7CA 2QWNA 4CJKA 2NRHA 4IFYA 4CK3A 1FXXA 4M3RA 4X62K 4FLXA 4FOEA 3LP2A 3PUFA 4FWLA 3I55N 4C1NK 4CHPA 4QS9A 2F8SA 3WEEA 4C1NI 1WBDA 5M1QA 5KPRA 1BQMA 2E1ZA 1KAXA 5M1NA 4U67L 2HHHK 3LPUA 5EX5A 4GKKK 1H1VA 3K2PA 3ENBA 1C1CA 2X6NA 3AVLA 4AILC 5AQHA 1VQ7N 4BR4A 3OYCA 4ISFA 5AZIB 1GLDG 1I39A 3HJFA 1M90O 1WSEA 1FJGK 4LC9B 4OPJA 4DTMA 3S3MA 1VQ5N 1GLAG 5K14A 4TSXA 1XMOK 3OW2M 1J53A 5KI6A 1GLCG 3EE9A 3O8MA 3CXCM 4QS8A 1GLLO 2I5JA 2JGUA 3PO4A 2B6AA 3C6HA 4E3SA 3G6EN 4BC4A 3ENOA 3DMJA 5J1EA 3CMAN 1RBTA 3CI5A 2ASPA 3AV9A 1IH7A 3AO2A 3B6PA 1U49A 3L4IA 3OYKA 3V9SA 4H03B 1X9MA 1CZ9A 1J9AA 2OPPA 4FOIA 2Q1NA 1BISA 5B8HA 4NCAA 1NK5A 3AVCA 4MO5A 4CCHA 3WEEB 4L3QA 4AHSA 4UQGA 4CERA 3QIPA 1NLVA 3L8BA 2A1SA 4DQSA 1JLAA 3FZHA 4KHSA 2ITGA 2BGGA 2HHVA 3DXKA 1T8EA 4OPAA 4QOZB 5BRHA 5AQKA 1Y97A 1JCFA 1ZBUA 1EKEA 1HRHA 3ENHA 2VQFK 2FSJA 1VQ4N 4FZXC 3H3OB 4PL8A 2B5JA 2FLOA 1YXQA 2NNWA 4CECA 3HBTA 3AVBA 2QA4N 3O1BA 4FJIA 4IXCA 2CGLA 3VEVA 1IG9A 4LH4A 5FPMA 4OO1J 2F7TA 2X74A 3O1WA 1WSHA 1NOZA 2KHOA 4RG8A 2F8TA 2RN2A 2E8AA 3C6TA 4IDHA 4DSIA 4Y0WA 3OVNA 2XY6A 2E2NA 4FJXA 4DR6K 3WXJA 4JKGA 4CBWA 2DFEA 3IRXA 3E1YA 1NJYA 2CGJA 3HL8A 1ZC6A 5FPDA 1N5YA 1OVQA 2R7YA 4CVNE 2YHYA 2O4IA 4KRFA 4N47A 4CW7B 2E5LK 3V9ZA 1HYZA 2W6LA 2YHBA 4WQ5A 1T6CA 4BRCA 2UU9K 3ZSVA 5FRNA 4UY8O 3ALYA 3VF2A 1TVRA 3NGZA 1WUAA 5HP1A 2IGIA 1NMDA 1YITN 5LJWA 3SUNA 1RCHA 4BVOA 3SAHA 4J2BA 1O1WA 5CZ1A 3V4IA 4JEPA 1KFSA 2YI1A 2ETJA 2X6SA 3KLIA 5CZ2A 3O6WA 4FM1A 3DJCA 3DXKB 3VQ6A 2NRWA 5BR9A 4Z4IA 3CCSN 4Y1DA 3HSCA 4IDKA 4O44A 5TKWA 4BR9A 4BE0A 3DLBA 1NGHA 5J2NA 2OZMA 3ID6A 2VYPA 3UB5A 3VQBA 1QVGM 3VN5A 2HBKA 3ZSRA 4BRPA 4OVLA 1X9JA 4AHTA 4FWSA 5FLXO 2Z1HA 4KAZA 5DM7L 2F9WA 3THYA 3A5LC 5AQWA 4NXMK 2G8FA 3WQTA 4Y1CA 2DFFA 2HVHA 1NBWA 5M1FA 2O4GA 1QE1A 4JRQA 1N33K 2FC0A 4DFKA 4JKGB 1U47A 4NYFA 4YOWA 1YJWN 5C24A 5H1SQ 5AQTA 3IMXA 3TR8A 3K5OA 2KQ2A 4FLUA 4JI7K 4JKEA 3KK1A 3I8BA 5I42A 3KWGA 4JKFA 3VA3A 3QESA 1RT6A 3BGRA 5AQXA 3HVTA 3RR7A 1N34K 3LZJA 2OANA 4DFPA 1NOYA 3PSFA 3Q7BA 4PQUA 4IJAA 4FJKA 2HHWA 1U04A 4IG0A 1YI2N 3TSQA 1TK8A 1BI4A 1S22A 4PKIA 2A1RA 3NDKA 1RDCA 4WQ5C 3CCLN 3T3FA 1S1UA 3SQ4A 3CJCA 2QM1A 4OKEA 3ID8A 4JYAK 2ZQBA 4GNIA 3J7YP 3PY8A 1XWLA 3L2RA 1IKXA 3T1HK 1T3VA 5C42A 1NGEA 4M3TA 4B08A 2YV0X 3G71N 1XUPO 4M63C 3DLKA 3BP8A 4CJ5A 1GLEG 1NM1A 1QQCA 3VOVA 1ESVA 3DWLA 4IZ9A 4C8LA 3DYAA 3LDNA 3THYB 3TARA 2GWKA 1Q8IA 1DT9A 2ZJPL 3AVHA 4GV9A 3WNEA 2ZJRL 1L3SA 4I7FA 4CJFA 3SUOA 1VQPN 3OYLA 2EHGA 4LFAK 2JLEA 4NLCA 4CJRA 3HM8A 1U48A 4XH5A 3M8QA 3VQQA 4ZTJA 1NJIO 4HHTA 3W3DA 4I6MA 4HUGA 3M3ZA 3HOTA 1UWBA 3SQ0A 4CGGA 1S1VA 3ZSXA 2A5XA 3VEYA 2UXDK 4JKHA 3P38A 3MAQA 1XHZA 1W7AA 2P9NA 1VQON 3DLEA 1BI4B 3V1RA 1XHXA 2D5RA 1FW6A 2WONA 1X9WA 2Y1IA
chains in the Genus database with same CATH topology
4CK2A 3MEEA 4FLTA 2KFNA 1BIZA 3OJSA 3OS1A 1ZBLA 1GOCA 5JS2A 4B8CA 4ZHRA 4DTSA 1RNHA 2QKKA 1RDAA 2ATQA 1EETA 3MXMA 3CFRA 3QETA 1JLEA 1L3VA 4CESA 1QTMA 4CFCA 3A2FA 1NJXA 4DSLA 4OGCA 1BHLA 4EP5A 3QEWA 4I9QA 5HBMA 4ID5A 1D9FA 3QINA 2PZSA 4KKOA 1FKOA 1JXBA 4GMJB 4BDPA 1C0UA 3V1QA 4BWJA 1SL1A 4W5OA 4IG3A 4QAGA 2G8WA 1JXEA 4Z4FA 1WNSA 4DTPA 3F9KA 3KLFA 2XRIA 4DS4A 1REVA 4ICLA 3DRRA 3P83D 3TAMA 4CEOA 4CGFA 4FK4A 4ID1A 4CFBA 3KLGA 4Z4HA 1QHTA 4KTZA 4Q0BA 4FM0A 5SWMA 1JLGA 4E19A 1BIUA 3NFAA 2YKNA 1RT5A 3KLEA 1W9HA 5FDLA 1T05A 1SKWA 1SL0A 1Q9XA 3K57A 3KLHA 3S9HA 3M8PA 2VG6A 3AA4A 4CF1A 3MXIA 4CEDA 1ZBFA 4CEFA 3G0ZA 2ZD1A 1TK0A 1A5VA 3L3VA 2KTQA 2HHXA 4WE1A 1TAQA 1C0MA 3DRPA 4AHVA 3JYTA 2EX3A 5J2PA 1LW0A 1BGXT 4FLZA 3ZSYA 2FBXA 3CG7A 4PUOA 4LSLA 3QNNA 4KB0A 1YTAA 1ASVA 1Z26A 1J54A 3VQ4A 3ZSZA 3O3FA 3O4NA 4CIGA 2YNGA 4RW6A 2D0AA 1KCFA 3C94A 1S1XA 1VRTA 3LP1A 4GW6A 2IOCA 2FBYA 1XC9A 1X9SA 4B9UA 1NKCA 4FXDA 4OKKA 4H4OA 4DFMA 5D3GA 1ITGA 1JL2A 3NF7A 3NE6A 3WNGA 4E7HA 5KGXA 1RBSA 3RMCA 3C95A 1KTQA 2HHTA 1BCMA 2FBVA 3MXJA 4CJWA 4CJTA 3HPOA 3TAPA 4ZTFA 1ASUA 3V81A 3QIOA 4B9MA 4OGEA 4BDZA 3AVAA 1CZBA 2Q3SA 4HUFA 4E7JA 3LAKA 3PX6A 2G8HA 1SKSA 4DTOA 3SQ2A 2IS3A 4DMNA 2BANA 4PY5A 4CGHA 1ZBIA 1VSMA 4CIFA 3TAFA 3TAEA 3RRHA 4K8ZA 1GOAA 5DMRA 3TI0A 3JSMA 1WAFA 2GV9A 1A5XA 3HT3A 4JRPA 5C25A 1TL1A 4FJNA 1HJRA 5HRRA 2B4JA 4CHZA 2YNFA 1RTHA 5J2MA 3B6OA 4FJLA 2DTUA 2BDPA 1C1BA 3C6UA 1RDBA 3DLRA 3VQ8A 1TV6A 1WAJA 5CYQA 1SKRA 4O0IA 4Z4GA 3UIQA 1HQUA 2HW3A 5T7BA 1TGOA 1C1AA 5CY4A 1TL3A 4HVJA 1UOCA 3D0PA 2Z1IA 4LSNA 3ZCMA 4DU4A 4EP4A 4KFBA 1Z25A 3NCIA 3SI6A 1NK9A 2WOMA 1BCOA 4IFVA 3SYZA 4DTRA 4DTJA 3RWUA 1A5WA 1TKZA 4IFYA 4CJKA 4NCGA 3I0RA 4CK3A 1FXXA 4M3RA 4FLXA 4CEQA 3RMDA 3QERA 3LP2A 3PUFA 3T1AA 2G8VA 2GUIA 4LD0A 3V9UA 4CHPA 3DLHA 4KTQA 4RW7A 4KB1A 1LWCA 2F8SA 1DLOA 4FYDA 1VSLA 1VSEA 2LSNA 4CF2A 4KO0A 4YNQA 1HPZA 4E89A 4DLGA 4DTXA 2PYLA 2VWKA 1BQMA 4CHQA 3PV8A 4BDYA 3AO4A 2YKMA 4QCLA 3S3NA 3HYFA 1NKBA 3LPUA 1NK6A 4CEBA 4DQQA 3AVNA 3AO5A 3K2PA 1EXQA 2HVIA 1C1CA 2X6NA 4I2PA 2IAJA 4CJPA 3SCXA 3AVLA 4CEAA 4AILC 3SPZA 3ZSWA 4FLWA 3HM9A 4XIUA 3OYCA 1VSIA 3LALA 4KTWA 2P5OA 2XY5A 4I2QA 4FW1A 1RILA 3LP3A 1I39A 3HJFA 3QEPA 4N41A 4KI6A 3QO9A 1VK0A 4KI4A 4HTUA 1WSEA 1I3AA 3KJVA 4OPJA 4DTMA 3S3MA 4CF8A 1SL2A 2BE2A 2OZSA 2HNDA 5K14A 4TSXA 4CIEA 3LZIA 4BE1A 4DU3A 3SQ1A 2HHUA 1J53A 5KI6A 4DG1A 3VQPA 1LWEA 1T03A 4B9LA 4CF0A 1RTDA 4NYNA 4B9TA 1Q9YA 4FCYA 3MECA 4O5BA 4DTNA 3LWLA 3NF6A 2I5JA 3K5NA 4CHNA 1JKHA 4N5SA 4W5QA 2JGUA 3QEIA 4L8RB 4BWMA 4FJ7A 4CEZA 4FK2A 3V1OA 3SZ2A 2XHBA 4CJLA 3CFPA 4DQPA 1G15A 2B6AA 3PO4A 4K8XA 3P1GA 4B8AB 3OJUA 4E3SA 3PX0A 3BDPA 4DQIA 4FJMA 4B9NA 2IC3A 1S1TA 3WNHA 1RTJA 4KHQA 3DMJA 5J1EA 1KFDA 1RBTA 3RMAA 3KKSA 2HNZA 3TAQA 3RTVA 3TAGA 1LAWA 3ASMA 3TABA 3VA0A 3AV9A 1IH7A 3AO2A 3B6PA 4KPYA 2Z1JA 4W5TA 1U49A 1T7PA 3OYKA 1CXQA 3AVGA 2G8KA 2QXFA 3V9SA 3CM6A 1CZ9A 1J9AA 2VG5A 1X9MA 3NH0A 2OPPA 4M41A 4M3WA 3AA5X 1HMVA 3DOLA 1BISA 4ELTA 1BL3A 3DOKA 4DQRA 4FJ8A 1RT2A 4NCAA 1NK5A 3AVCA 1L3UA 4CCHA 5KRSA 3OYHA 4UQGA 4AHSA 4EZ9A 3K5LA 2VG7A 4CERA 3QIPA 4HCCA 2KZZA 3L2UA 3L8BA 1FKPA 2A1SA 4J2EA 4C8NA 4DQSA 1JLAA 5HRSA 4OJRA 4OLAA 3IAYA 4FVMA 1YVUA 4O55A 2ITGA 3QEVA 3OYAA 5HLFA 3ZT0A 4KHSA 3TWHA 2BGGA 1T8EA 2HHVA 4QOZB 3U3YA 2KZMA 1HNVA 1IKYA 1S6QA 4N76A 1EX4A 1RT7A 1Y97A 1YTUA 1RBRA 1C6VA 1EKEA 1HRHA 1LW2A 1ZBUA 2FBTA 3SJJA 1B9DA 4DU1A 4F8RA 4DSFA 1TKDA 1LV5A 3P5JA 1NJZA 4FZXC 4W5NA 1WN7A 1W0HA 2B5JA 5SZTA 3VQDA 2OPQA 4CECA 4B9VA 1ZBHA 4R5PA 1RT1A 1ASWA 1JLBA 3L2QA 3AVBA 3DM2A 4CGDA 2Y1JA 4CJQA 4C8MA 4FJIA 3V9WA 3CM5A 3HSTB 4M3YA 4AH9A 1VRUA 3ZT1A 4GVMA 3IS9A 3E01A 3SV4A 5J2QA 3EZ5A 2E6MA 1IG9A 4LH4A 1JLQA 2XY8A 2X74A 3OYFA 4CGJA 1NKEA 3ZT2A 1WSHA 4RW8A 1IKVA 2HB5A 3ITHA 3MEDA 1WSIA 4FJHA 4FZZA 1HYVA 1RT3A 3QLHA 3VQ9A 1NOZA 4RG8A 3OS0A 1F21A 3K59A 5HROA 2RF2A 1HNIA 1L5UA 4CEEA 2YNHA 2RN2A 3C6TA 3I0SA 2G8UA 4DSIA 2F8TA 3OVNA 2XY6A 3HP6A 4FJXA 1KVAA 2DY4A 2DFEA 3IRXA 3K5MA 1QSLA 3VQ5A 1S6PA 2AJQA 4KV8A 1NJYA 2RPIA 3HL8A 4CJUA 1UAXA 4ELVA 1N5YA 2ZE2A 3AVMA 3NF8A 3LPTA 2R7YA 1JLFA 4FM2A 1NK0A 4Z0UA 3VQEA 4DF4A 1WSJA 1KVBA 4OKJA 1UA0A 3VQCA 4DSKA 4KRFA 2O4IA 4N47A 2DFHA 2E6LA 3V9ZA 3G10A 1HQEA 2D0BA 1HYZA 2YHBA 1RDDA 3KK2A 1R0AA 3RR8A 1CXUA 3ZSVA 1QSSA 5FRNA 4FLYA 4MFBA 4F2RA 3ALYA 3EYZA 3L3UA 1TVRA 2NUBA 4JLHA 3NH2A 3NGZA 3HP9A 3NH1A 5HP1A 1VSKA 3KTQA 2IGIA 3H08A 4CJVA 3SUNA 4DFJA 1RCHA 4FW2A 4EZ6A 4J2BA 1O1WA 3HPGA 3HPHA 5KRTA 5CZ1A 3V4IA 4F4KA 3NF9A 1KSPA 1KFSA 2OYQA 4CJ4A 4HCBA 3O3HA 3RMBA 2QKBA 3HO1A 4DF8A 2ETJA 2X6SA 3KLIA 4F3TA 3U6FA 3AVIA 5CZ2A 2XY7A 1NJWA 4AHUA 3L2WA 1K6YA 4FM1A 4KHYA 4M3XA 3SUPA 1KVCA 2G8IA 3S3OA 1NK7A 2X78A 3VQ6A 4Z4IA 2E4LA 1U4BA 4Y1DA 4DLEA 4DS5A 2OPSA 2HNYA 4Q5VA 1N6QA 5E41A 4IDKA 4O44A 3CYMA 1QSYA 2GBZA 1J5OA 4BE0A 3DLBA 1JL1A 5J2NA 5HRPA 5KGWA 3M8RA 3AO3A 1GOBA 3ISNC 3HVRA 2OZMA 3OYMA 3NAEA 2P5GA 3VQBA 3EY1A 1EP4A 4ELUA 3ZSOA 3VN5A 1TKTA 3ZSRA 4W5RA 4O0JA 4OVLA 3OYBA 3CQ8A 3MEGA 1VSFA 1NK8A 4AHTA 4FJ5A 4J2DA 2Z1HA 4KAZA 4PWDA 2D0CA 3VQ7A 4B3OA 2VWJA 3HXMA 3SPYA 1UA1A 4FJ9A 4F3OA 3LANA 2G8FA 5FRMA 5DK5A 4Y1CA 2DFFA 5HRNA 2HVHA 3OY9A 4CK1A 3O4QA 2O4GA 1QE1A 4AHRA 3NGIA 4JRQA 2YHAA 4F2SA 2HHQA 2FC0A 3K58A 1D8YA 4DFKA 4FLVA 1U47A 4DSJA 4NYFA 4CJ3A 1WSFA 3ZT4A 4Z4CA 1L3TA 3RRGA 3CFOA 5C24A 4NCBA 3AVFA 5FROA 3TR8A 4OLBA 3K5OA 1U45A 2KQ2A 4FLUA 3LWMA 4H4MA 3KK1A 3DRSA 4E1MA 5I42A 3VQAA 3VA3A 1S9GA 2RKIA 4HUEA 4DTUA 3QESA 1RT6A 5I3UA 1NK4A 3BGRA 4B9SA 4FK0A 3HVTA 3RR7A 2YNIA 3LZJA 4BACA 3SNNA 1ZYQA 1X1PA 2IDOA 3LAMA 4DFPA 3TANA 1NOYA 4RW4A 4N56A 4PQUA 3PX4A 4FJKA 4JS4A 3DLGA 2HHWA 3U3GA 4E7LA 4RW9A 1RBUA 1U04A 4IG0A 4OPKA 1TK8A 1BI4A 1RT4A 1DTTA 2A1RA 3NDKA 1RDCA 1KLMA 3SV3A 2XO7A 3OS2A 3SUQA 1KRPA 1VSDA 3ZSQA 1BQNA 1S1UA 3T3FA 4H8KA 1S1WA 3SQ4A 1TK5A 4AHCA 3NBPA 4OKEA 4E7IA 3LDSA 3D45A 2ZQBA 3AVKA 4JS5A 4KHWA 3PY8A 2QK9A 1LAVA 4M45A 4CJEA 1KLNA 4LH5A 1QS4A 1XI1A 4E0DA 1JLCA 3O3GA 1XWLA 3IG1A 5EU7A 1VSHA 3V9XA 4KHNA 3L2RA 1IKXA 5C42A 4M3TA 4B08A 3QNOA 4FJGA 2YV0X 4MQ3A 3THVA 2OPRA 4C8OA 3DLKA 4IKFA 1D5AA 1IO2A 2Z1GA 1S9EA 4CJ5A 3WNFA 1S5JA 3V6DA 4CGIA 4C8KA 1YT3A 1QQCA 2OA8A 1RTIA 2KFZA 3OYNA 4E7KA 1D9DA 4C8LA 1FK9A 3DYAA 4LY7A 2P1JA 3TARA 3OYGA 2PYJA 4G1QA 1HYSA 1RBVA 1Q8IA 3KD1E 3AVHA 1C0TA 1IKWA 4CF9A 3HK2A 2HMIA 2PY5A 1TKXA 3AVJA 3WNEA 4KHUA 1MU2A 3FFIA 1L3SA 4M3UA 3M8SA 4I7FA 4CJFA 2P51A 3SUOA 3KD5E 5KTQA 3OYLA 1DTQA 3LP0A 2EHGA 3NGYA 3AA3A 2W42A 4DSEA 4FZYA 4Z4EA 4O4GA 1CLQA 4IBNA 3QEXA 2JLEA 3KKRA 4I9LA 4CJRA 1U48A 3T19A 3M8QA 3VQQA 3OYIA 4KREA 4ZTJA 3PO5A 4CFDA 4HHTA 3L2VA 4HUGA 1UWBA 4BE2A 4PA1A 4YFUA 2F96A 3I8DA 3SQ0A 1TAUA 1B9FA 4CGGA 1S1VA 3ZSXA 4CHYA 1VSJA 5JS1A 3AO1A 4J2AA 4FJJA 1SUQA 1SV5A 4M3ZA 3NHGA 3F73A 3DI6A 4M42A 3ZT3A 1WLJA 1B92A 3MAQA 1XHZA 3KK3A 3KIOA 3DLEA 4CFAA 3ULDA 4DWIA 3OYEA 4CJSA 1BI4B 5CYMA 1LWFA 2KW4A 4CE9A 2HHSA 1WSGA 3V1RA 1XHXA 2D5RA 2Y1IA 3OYJA 4CHOA 4E1NA 2WONA 3OYDA 1X9WA 3AA2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CK2 A;  3MEE A;  4FLT A;  2KFN A;  1BIZ A;  3OJS A;  3OS1 A;  1ZBL A;  1GOC A;  5JS2 A;  4B8C A;  4ZHR A;  4DTS A;  1RNH A;  2QKK A;  1RDA A;  2ATQ A;  1EET A;  3MXM A;  3CFR A;  3QET A;  1JLE A;  1L3V A;  4CES A;  1QTM A;  4CFC A;  3A2F A;  1NJX A;  4DSL A;  4OGC A;  1BHL A;  4EP5 A;  3QEW A;  4I9Q A;  5HBM A;  4ID5 A;  1D9F A;  3QIN A;  2PZS A;  4KKO A;  1FKO A;  1JXB A;  4GMJ B;  4BDP A;  1C0U A;  3V1Q A;  4BWJ A;  1SL1 A;  4W5O A;  4IG3 A;  4QAG A;  2G8W A;  1JXE A;  4Z4F A;  1WNS A;  4DTP A;  3F9K A;  3KLF A;  2XRI A;  4DS4 A;  1REV A;  4ICL A;  3DRR A;  3P83 D;  3TAM A;  4CEO A;  4CGF A;  4FK4 A;  4ID1 A;  4CFB A;  3KLG A;  4Z4H A;  1QHT A;  4KTZ A;  4Q0B A;  4FM0 A;  5SWM A;  1JLG A;  4E19 A;  1BIU A;  3NFA A;  2YKN A;  1RT5 A;  3KLE A;  1W9H A;  5FDL A;  1T05 A;  1SKW A;  1SL0 A;  1Q9X A;  3K57 A;  3KLH A;  3S9H A;  3M8P A;  2VG6 A;  3AA4 A;  4CF1 A;  3MXI A;  4CED A;  1ZBF A;  4CEF A;  3G0Z A;  2ZD1 A;  1TK0 A;  1A5V A;  3L3V A;  2KTQ A;  2HHX A;  4WE1 A;  1TAQ A;  1C0M A;  3DRP A;  4AHV A;  3JYT A;  2EX3 A;  5J2P A;  1LW0 A;  1BGX T;  4FLZ A;  3ZSY A;  2FBX A;  3CG7 A;  4PUO A;  4LSL A;  3QNN A;  4KB0 A;  1YTA A;  1ASV A;  1Z26 A;  1J54 A;  3VQ4 A;  3ZSZ A;  3O3F A;  3O4N A;  4CIG A;  2YNG A;  4RW6 A;  2D0A A;  1KCF A;  3C94 A;  1S1X A;  1VRT A;  3LP1 A;  4GW6 A;  2IOC A;  2FBY A;  1XC9 A;  1X9S A;  4B9U A;  1NKC A;  4FXD A;  4OKK A;  4H4O A;  4DFM A;  5D3G A;  1ITG A;  1JL2 A;  3NF7 A;  3NE6 A;  3WNG A;  4E7H A;  5KGX A;  1RBS A;  3RMC A;  3C95 A;  1KTQ A;  2HHT A;  1BCM A;  2FBV A;  3MXJ A;  4CJW A;  4CJT A;  3HPO A;  3TAP A;  4ZTF A;  1ASU A;  3V81 A;  3QIO A;  4B9M A;  4OGE A;  4BDZ A;  3AVA A;  1CZB A;  2Q3S A;  4HUF A;  4E7J A;  3LAK A;  3PX6 A;  2G8H A;  1SKS A;  4DTO A;  3SQ2 A;  2IS3 A;  4DMN A;  2BAN A;  4PY5 A;  4CGH A;  1ZBI A;  1VSM A;  4CIF A;  3TAF A;  3TAE A;  3RRH A;  4K8Z A;  1GOA A;  5DMR A;  3TI0 A;  3JSM A;  1WAF A;  2GV9 A;  1A5X A;  3HT3 A;  4JRP A;  5C25 A;  1TL1 A;  4FJN A;  1HJR A;  5HRR A;  2B4J A;  4CHZ A;  2YNF A;  1RTH A;  5J2M A;  3B6O A;  4FJL A;  2DTU A;  2BDP A;  1C1B A;  3C6U A;  1RDB A;  3DLR A;  3VQ8 A;  1TV6 A;  1WAJ A;  5CYQ A;  1SKR A;  4O0I A;  4Z4G A;  3UIQ A;  1HQU A;  2HW3 A;  5T7B A;  1TGO A;  1C1A A;  5CY4 A;  1TL3 A;  4HVJ A;  1UOC A;  3D0P A;  2Z1I A;  4LSN A;  3ZCM A;  4DU4 A;  4EP4 A;  4KFB A;  1Z25 A;  3NCI A;  3SI6 A;  1NK9 A;  2WOM A;  1BCO A;  4IFV A;  3SYZ A;  4DTR A;  4DTJ A;  3RWU A;  1A5W A;  1TKZ A;  4IFY A;  4CJK A;  4NCG A;  3I0R A;  4CK3 A;  1FXX A;  4M3R A;  4FLX A;  4CEQ A;  3RMD A;  3QER A;  3LP2 A;  3PUF A;  3T1A A;  2G8V A;  2GUI A;  4LD0 A;  3V9U A;  4CHP A;  3DLH A;  4KTQ A;  4RW7 A;  4KB1 A;  1LWC A;  2F8S A;  1DLO A;  4FYD A;  1VSL A;  1VSE A;  2LSN A;  4CF2 A;  4KO0 A;  4YNQ A;  1HPZ A;  4E89 A;  4DLG A;  4DTX A;  2PYL A;  2VWK A;  1BQM A;  4CHQ A;  3PV8 A;  4BDY A;  3AO4 A;  2YKM A;  4QCL A;  3S3N A;  3HYF A;  1NKB A;  3LPU A;  1NK6 A;  4CEB A;  4DQQ A;  3AVN A;  3AO5 A;  3K2P A;  1EXQ A;  2HVI A;  1C1C A;  2X6N A;  4I2P A;  2IAJ A;  4CJP A;  3SCX A;  3AVL A;  4CEA A;  4AIL C;  3SPZ A;  3ZSW A;  4FLW A;  3HM9 A;  4XIU A;  3OYC A;  1VSI A;  3LAL A;  4KTW A;  2P5O A;  2XY5 A;  4I2Q A;  4FW1 A;  1RIL A;  3LP3 A;  1I39 A;  3HJF A;  3QEP A;  4N41 A;  4KI6 A;  3QO9 A;  1VK0 A;  4KI4 A;  4HTU A;  1WSE A;  1I3A A;  3KJV A;  4OPJ A;  4DTM A;  3S3M A;  4CF8 A;  1SL2 A;  2BE2 A;  2OZS A;  2HND A;  5K14 A;  4TSX A;  4CIE A;  3LZI A;  4BE1 A;  4DU3 A;  3SQ1 A;  2HHU A;  1J53 A;  5KI6 A;  4DG1 A;  3VQP A;  1LWE A;  1T03 A;  4B9L A;  4CF0 A;  1RTD A;  4NYN A;  4B9T A;  1Q9Y A;  4FCY A;  3MEC A;  4O5B A;  4DTN A;  3LWL A;  3NF6 A;  2I5J A;  3K5N A;  4CHN A;  1JKH A;  4N5S A;  4W5Q A;  2JGU A;  3QEI A;  4L8R B;  4BWM A;  4FJ7 A;  4CEZ A;  4FK2 A;  3V1O A;  3SZ2 A;  2XHB A;  4CJL A;  3CFP A;  4DQP A;  1G15 A;  2B6A A;  3PO4 A;  4K8X A;  3P1G A;  4B8A B;  3OJU A;  4E3S A;  3PX0 A;  3BDP A;  4DQI A;  4FJM A;  4B9N A;  2IC3 A;  1S1T A;  3WNH A;  1RTJ A;  4KHQ A;  3DMJ A;  5J1E A;  1KFD A;  1RBT A;  3RMA A;  3KKS A;  2HNZ A;  3TAQ A;  3RTV A;  3TAG A;  1LAW A;  3ASM A;  3TAB A;  3VA0 A;  3AV9 A;  1IH7 A;  3AO2 A;  3B6P A;  4KPY A;  2Z1J A;  4W5T A;  1U49 A;  1T7P A;  3OYK A;  1CXQ A;  3AVG A;  2G8K A;  2QXF A;  3V9S A;  3CM6 A;  1CZ9 A;  1J9A A;  2VG5 A;  1X9M A;  3NH0 A;  2OPP A;  4M41 A;  4M3W A;  3AA5 X;  1HMV A;  3DOL A;  1BIS A;  4ELT A;  1BL3 A;  3DOK A;  4DQR A;  4FJ8 A;  1RT2 A;  4NCA A;  1NK5 A;  3AVC A;  1L3U A;  4CCH A;  5KRS A;  3OYH A;  4UQG A;  4AHS A;  4EZ9 A;  3K5L A;  2VG7 A;  4CER A;  3QIP A;  4HCC A;  2KZZ A;  3L2U A;  3L8B A;  1FKP A;  2A1S A;  4J2E A;  4C8N A;  4DQS A;  1JLA A;  5HRS A;  4OJR A;  4OLA A;  3IAY A;  4FVM A;  1YVU A;  4O55 A;  2ITG A;  3QEV A;  3OYA A;  5HLF A;  3ZT0 A;  4KHS A;  3TWH A;  2BGG A;  1T8E A;  2HHV A;  4QOZ B;  3U3Y A;  2KZM A;  1HNV A;  1IKY A;  1S6Q A;  4N76 A;  1EX4 A;  1RT7 A;  1Y97 A;  1YTU A;  1RBR A;  1C6V A;  1EKE A;  1HRH A;  1LW2 A;  1ZBU A;  2FBT A;  3SJJ A;  1B9D A;  4DU1 A;  4F8R A;  4DSF A;  1TKD A;  1LV5 A;  3P5J A;  1NJZ A;  4FZX C;  4W5N A;  1WN7 A;  1W0H A;  2B5J A;  5SZT A;  3VQD A;  2OPQ A;  4CEC A;  4B9V A;  1ZBH A;  4R5P A;  1RT1 A;  1ASW A;  1JLB A;  3L2Q A;  3AVB A;  3DM2 A;  4CGD A;  2Y1J A;  4CJQ A;  4C8M A;  4FJI A;  3V9W A;  3CM5 A;  3HST B;  4M3Y A;  4AH9 A;  1VRU A;  3ZT1 A;  4GVM A;  3IS9 A;  3E01 A;  3SV4 A;  5J2Q A;  3EZ5 A;  2E6M A;  1IG9 A;  4LH4 A;  1JLQ A;  2XY8 A;  2X74 A;  3OYF A;  4CGJ A;  1NKE A;  3ZT2 A;  1WSH A;  4RW8 A;  1IKV A;  2HB5 A;  3ITH A;  3MED A;  1WSI A;  4FJH A;  4FZZ A;  1HYV A;  1RT3 A;  3QLH A;  3VQ9 A;  1NOZ A;  4RG8 A;  3OS0 A;  1F21 A;  3K59 A;  5HRO A;  2RF2 A;  1HNI A;  1L5U A;  4CEE A;  2YNH A;  2RN2 A;  3C6T A;  3I0S A;  2G8U A;  4DSI A;  2F8T A;  3OVN A;  2XY6 A;  3HP6 A;  4FJX A;  1KVA A;  2DY4 A;  2DFE A;  3IRX A;  3K5M A;  1QSL A;  3VQ5 A;  1S6P A;  2AJQ A;  4KV8 A;  1NJY A;  2RPI A;  3HL8 A;  4CJU A;  1UAX A;  4ELV A;  1N5Y A;  2ZE2 A;  3AVM A;  3NF8 A;  3LPT A;  2R7Y A;  1JLF A;  4FM2 A;  1NK0 A;  4Z0U A;  3VQE A;  4DF4 A;  1WSJ A;  1KVB A;  4OKJ A;  1UA0 A;  3VQC A;  4DSK A;  4KRF A;  2O4I A;  4N47 A;  2DFH A;  2E6L A;  3V9Z A;  3G10 A;  1HQE A;  2D0B A;  1HYZ A;  2YHB A;  1RDD A;  3KK2 A;  1R0A A;  3RR8 A;  1CXU A;  3ZSV A;  1QSS A;  5FRN A;  4FLY A;  4MFB A;  4F2R A;  3ALY A;  3EYZ A;  3L3U A;  1TVR A;  2NUB A;  4JLH A;  3NH2 A;  3NGZ A;  3HP9 A;  3NH1 A;  5HP1 A;  1VSK A;  3KTQ A;  2IGI A;  3H08 A;  4CJV A;  3SUN A;  4DFJ A;  1RCH A;  4FW2 A;  4EZ6 A;  4J2B A;  1O1W A;  3HPG A;  3HPH A;  5KRT A;  5CZ1 A;  3V4I A;  4F4K A;  3NF9 A;  1KSP A;  1KFS A;  2OYQ A;  4CJ4 A;  4HCB A;  3O3H A;  3RMB A;  2QKB A;  3HO1 A;  4DF8 A;  2ETJ A;  2X6S A;  3KLI A;  4F3T A;  3U6F A;  3AVI A;  5CZ2 A;  2XY7 A;  1NJW A;  4AHU A;  3L2W A;  1K6Y A;  4FM1 A;  4KHY A;  4M3X A;  3SUP A;  1KVC A;  2G8I A;  3S3O A;  1NK7 A;  2X78 A;  3VQ6 A;  4Z4I A;  2E4L A;  1U4B A;  4Y1D A;  4DLE A;  4DS5 A;  2OPS A;  2HNY A;  4Q5V A;  1N6Q A;  5E41 A;  4IDK A;  4O44 A;  3CYM A;  1QSY A;  2GBZ A;  1J5O A;  4BE0 A;  3DLB A;  1JL1 A;  5J2N A;  5HRP A;  5KGW A;  3M8R A;  3AO3 A;  1GOB A;  3ISN C;  3HVR A;  2OZM A;  3OYM A;  3NAE A;  2P5G A;  3VQB A;  3EY1 A;  1EP4 A;  4ELU A;  3ZSO A;  3VN5 A;  1TKT A;  3ZSR A;  4W5R A;  4O0J A;  4OVL A;  3OYB A;  3CQ8 A;  3MEG A;  1VSF A;  1NK8 A;  4AHT A;  4FJ5 A;  4J2D A;  2Z1H A;  4KAZ A;  4PWD A;  2D0C A;  3VQ7 A;  4B3O A;  2VWJ A;  3HXM A;  3SPY A;  1UA1 A;  4FJ9 A;  4F3O A;  3LAN A;  2G8F A;  5FRM A;  5DK5 A;  4Y1C A;  2DFF A;  5HRN A;  2HVH A;  3OY9 A;  4CK1 A;  3O4Q A;  2O4G A;  1QE1 A;  4AHR A;  3NGI A;  4JRQ A;  2YHA A;  4F2S A;  2HHQ A;  2FC0 A;  3K58 A;  1D8Y A;  4DFK A;  4FLV A;  1U47 A;  4DSJ A;  4NYF A;  4CJ3 A;  1WSF A;  3ZT4 A;  4Z4C A;  1L3T A;  3RRG A;  3CFO A;  5C24 A;  4NCB A;  3AVF A;  5FRO A;  3TR8 A;  4OLB A;  3K5O A;  1U45 A;  2KQ2 A;  4FLU A;  3LWM A;  4H4M A;  3KK1 A;  3DRS A;  4E1M A;  5I42 A;  3VQA A;  3VA3 A;  1S9G A;  2RKI A;  4HUE A;  4DTU A;  3QES A;  1RT6 A;  5I3U A;  1NK4 A;  3BGR A;  4B9S A;  4FK0 A;  3HVT A;  3RR7 A;  2YNI A;  3LZJ A;  4BAC A;  3SNN A;  1ZYQ A;  1X1P A;  2IDO A;  3LAM A;  4DFP A;  3TAN A;  1NOY A;  4RW4 A;  4N56 A;  4PQU A;  3PX4 A;  4FJK A;  4JS4 A;  3DLG A;  2HHW A;  3U3G A;  4E7L A;  4RW9 A;  1RBU A;  1U04 A;  4IG0 A;  4OPK A;  1TK8 A;  1BI4 A;  1RT4 A;  1DTT A;  2A1R A;  3NDK A;  1RDC A;  1KLM A;  3SV3 A;  2XO7 A;  3OS2 A;  3SUQ A;  1KRP A;  1VSD A;  3ZSQ A;  1BQN A;  1S1U A;  3T3F A;  4H8K A;  1S1W A;  3SQ4 A;  1TK5 A;  4AHC A;  3NBP A;  4OKE A;  4E7I A;  3LDS A;  3D45 A;  2ZQB A;  3AVK A;  4JS5 A;  4KHW A;  3PY8 A;  2QK9 A;  1LAV A;  4M45 A;  4CJE A;  1KLN A;  4LH5 A;  1QS4 A;  1XI1 A;  4E0D A;  1JLC A;  3O3G A;  1XWL A;  3IG1 A;  5EU7 A;  1VSH A;  3V9X A;  4KHN A;  3L2R A;  1IKX A;  5C42 A;  4M3T A;  4B08 A;  3QNO A;  4FJG A;  2YV0 X;  4MQ3 A;  3THV A;  2OPR A;  4C8O A;  3DLK A;  4IKF A;  1D5A A;  1IO2 A;  2Z1G A;  1S9E A;  4CJ5 A;  3WNF A;  1S5J A;  3V6D A;  4CGI A;  4C8K A;  1YT3 A;  1QQC A;  2OA8 A;  1RTI A;  2KFZ A;  3OYN A;  4E7K A;  1D9D A;  4C8L A;  1FK9 A;  3DYA A;  4LY7 A;  2P1J A;  3TAR A;  3OYG A;  2PYJ A;  4G1Q A;  1HYS A;  1RBV A;  1Q8I A;  3KD1 E;  3AVH A;  1C0T A;  1IKW A;  4CF9 A;  3HK2 A;  2HMI A;  2PY5 A;  1TKX A;  3AVJ A;  3WNE A;  4KHU A;  1MU2 A;  3FFI A;  1L3S A;  4M3U A;  3M8S A;  4I7F A;  4CJF A;  2P51 A;  3SUO A;  3KD5 E;  5KTQ A;  3OYL A;  1DTQ A;  3LP0 A;  2EHG A;  3NGY A;  3AA3 A;  2W42 A;  4DSE A;  4FZY A;  4Z4E A;  4O4G A;  1CLQ A;  4IBN A;  3QEX A;  2JLE A;  3KKR A;  4I9L A;  4CJR A;  1U48 A;  3T19 A;  3M8Q A;  3VQQ A;  3OYI A;  4KRE A;  4ZTJ A;  3PO5 A;  4CFD A;  4HHT A;  3L2V A;  4HUG A;  1UWB A;  4BE2 A;  4PA1 A;  4YFU A;  2F96 A;  3I8D A;  3SQ0 A;  1TAU A;  1B9F A;  4CGG A;  1S1V A;  3ZSX A;  4CHY A;  1VSJ A;  5JS1 A;  3AO1 A;  4J2A A;  4FJJ A;  1SUQ A;  1SV5 A;  4M3Z A;  3NHG A;  3F73 A;  3DI6 A;  4M42 A;  3ZT3 A;  1WLJ A;  1B92 A;  3MAQ A;  1XHZ A;  3KK3 A;  3KIO A;  3DLE A;  4CFA A;  3ULD A;  4DWI A;  3OYE A;  4CJS A;  1BI4 B;  5CYM A;  1LWF A;  2KW4 A;  4CE9 A;  2HHS A;  1WSG A;  3V1R A;  1XHX A;  2D5R A;  2Y1I A;  3OYJ A;  4CHO A;  4E1N A;  2WON A;  3OYD A;  1X9W A;  3AA2 A; 
#chains in the Genus database with same CATH topology
 1Q7Y O;  4BRE A;  3RVC A;  2KFN A;  3MWT A;  4DR7 K;  1GOC A;  5JS2 A;  2QKK A;  4A5B A;  1OH6 A;  4IEI A;  2QWP A;  4EP5 A;  4LFB K;  1VQN N;  5HBM A;  3QIN A;  1FKO A;  1JXB A;  4GMJ B;  4BDP A;  1C0U A;  3V1Q A;  3P31 A;  4DCH A;  4W5O A;  1LOT B;  1WNS A;  4DTP A;  3AGR A;  2PFU A;  3P83 D;  3ZX0 A;  4CEO A;  4FK4 A;  4CFB A;  4BQL A;  3N4Q A;  4Q0B A;  1JLG A;  4E19 A;  1BIU A;  3NFA A;  2YKN A;  1W97 L;  3QBW A;  1SL0 A;  3KLH A;  4CF1 A;  1SZ2 A;  3AA4 A;  1L3U A;  1A5V A;  1XMQ K;  2HOE A;  4PL7 A;  4AM7 A;  1BGX T;  4FLZ A;  3MN5 A;  5LY3 A;  2YHW A;  4PUO A;  4LFC K;  2HMP A;  4KH4 A;  4CBX A;  5IWA K;  1WB9 A;  1VQ6 N;  1QHA A;  3O4N A;  1QQN A;  2D0A A;  4CJ7 A;  1S3X A;  4DV4 K;  4H0O A;  3LP1 A;  4I6M B;  4GW6 A;  5AQL A;  1HKC A;  2IOC A;  4CD1 A;  4JI0 K;  1XC9 A;  2E88 A;  4FXD A;  5AQI A;  2NRR A;  1ITG A;  1JL2 A;  3NE6 A;  3NMU A;  3IDH A;  3QIC A;  3CJA A;  3RMC A;  4DB3 A;  1BCM A;  2P9N B;  2E2Q A;  2GEL A;  5CHI A;  3HPO A;  1ASU A;  1E4F T;  3QIO A;  4OGE A;  3PX6 A;  3CIP A;  5KPZ A;  4DTO A;  3SQ2 A;  2IS3 A;  4PY5 A;  3EO3 A;  4CGH A;  1ZBI A;  5JVH L;  4RTF D;  3VEO A;  4JK8 A;  1BUP A;  3TI0 A;  3HT3 A;  1GLF O;  4C23 A;  2BDP A;  5AQQ A;  1C1B A;  3DLR A;  1RDB A;  1SKR A;  3WXM B;  3FE1 A;  3UIQ A;  2I7N A;  1TGO A;  4AM6 A;  2Z1I A;  3SI6 A;  4EP4 A;  4KFB A;  3NCI A;  2CGK A;  1BCO A;  4DTJ A;  4JI3 K;  1HPM A;  2YHX A;  1A5W A;  1TKZ A;  3I0R A;  1YJ9 N;  3RMD A;  3SLC A;  3QER A;  3T1A A;  3OBW A;  3V9U A;  3DLH A;  4KB1 A;  3CJ1 A;  1SAZ A;  1MWM A;  3O9S A;  4DLG A;  4IJN A;  4DTX A;  2PYL A;  3PV8 A;  4QCL A;  3S3N A;  1NKB A;  3CCU N;  4DQQ A;  2JWK A;  2ZF5 O;  3AVN A;  3AO5 A;  2GX9 A;  2IAJ A;  2FF6 A;  3ZSW A;  4FLW A;  3HM9 A;  2P9U A;  2XY5 A;  3VEW A;  1RIL A;  3LP3 A;  3OTO K;  4HTU A;  4FVU A;  1I3A A;  2F4V K;  4KH6 A;  1ATS A;  3LZI A;  4BE1 A;  3BZC A;  1T03 A;  4LF9 K;  2NRV A;  1WOQ A;  4B9L A;  2Q0R A;  4B9T A;  1Q9Y A;  2FSN A;  3QEI A;  4JKD A;  3CCE N;  3V1O A;  4DQP A;  4K8X A;  1G15 A;  4B8A B;  4BRG A;  4B9N A;  2IC3 A;  1S1T A;  3WNH A;  4H0T B;  4DV5 K;  1LAW A;  3EKS A;  2QXL A;  2Z1J A;  4W5T A;  4BRF A;  3CM6 A;  2VG5 A;  3FZF A;  4PKH A;  2KFZ A;  4M41 A;  5C2F A;  4H5T A;  3AA5 X;  3KWI A;  3FR0 A;  3WQU A;  4BRD A;  4DQR A;  1X3M A;  1N32 K;  5KRS A;  4M7X A;  4JHD A;  4HCC A;  3L2U A;  4CZE A;  2VCP A;  4C8N A;  3WXI A;  4H5N A;  1HNV A;  1S6Q A;  1RT7 A;  2QWO A;  1YTU A;  1QZ6 A;  1RBR A;  2NZT A;  3SPZ A;  4A61 A;  1LW2 A;  2P9U B;  3O4W A;  4DU1 A;  4JAX A;  4A57 A;  4DSF A;  1TKD A;  1LCU A;  3P5J A;  5TKY A;  1HNW K;  4W5N A;  3CQY A;  3TTC A;  3DLL L;  4FWK A;  4B9V A;  1ZBH A;  4R5P A;  1JLB A;  2NLX A;  3DM2 A;  3OHR A;  5CE3 A;  3V9W A;  3CM5 A;  2ZWH A;  5GAD P;  3A5N C;  4AH9 A;  3ZT1 A;  4YY3 K;  4GVM A;  3IS9 A;  3E01 A;  4LF7 K;  5J2Q A;  2E6M A;  1K8A O;  4FZZ A;  4FJH A;  1IKV A;  1WSI A;  1BWF O;  4B1V A;  3VQ9 A;  2W6K A;  2O8D A;  1HNI A;  3BZK A;  3I0S A;  2Q97 A;  1P90 A;  4EIA A;  1KVA A;  2DY4 A;  4BG9 A;  3K5M A;  4B1U B;  3MCA B;  1TUY A;  5AZJ A;  2AJQ A;  4KV8 A;  4DQ8 A;  2UUB K;  1UAX A;  3AVM A;  3NF8 A;  3LPT A;  2NRZ A;  3VQE A;  4OKJ A;  4AQY K;  2E6L A;  2ASM A;  3OBY A;  1TUU A;  3GE1 A;  3KK2 A;  1R0A A;  3RR8 A;  1CXU A;  4F2R A;  4JLH A;  2NUB A;  3HP9 A;  3VEZ A;  1GLJ O;  3H08 A;  5AQJ A;  4FW2 A;  4EZ6 A;  5CR4 A;  5KRT A;  4JHD B;  4BRM A;  4F4K A;  4HCB A;  2OYQ A;  1RDU A;  3O5B A;  4F3T A;  3U6F A;  2XY7 A;  1SS6 A;  5IT9 O;  5BPL A;  2G8I A;  5F2R A;  3AY9 A;  1BA1 A;  2X78 A;  2E4L A;  5BRE A;  3BY5 A;  1U4B A;  4DLE A;  4DS5 A;  1N6Q A;  5E41 A;  1J5O A;  1DKG D;  2QWL A;  3HVR A;  3NAE A;  3KK7 A;  4BGA A;  1EP4 A;  3ZSO A;  1TKT A;  3DXM A;  3OYB A;  4BRL A;  3CCV N;  1ILY A;  2D0C A;  1HKB A;  2OTL N;  5FRM A;  5HRN A;  2O8D B;  3OY9 A;  3RSE B;  3CER A;  4KBO A;  4DKW A;  4CJ3 A;  1L3T A;  5AZJ B;  1VQM N;  3F2K A;  2YJE A;  2Q31 A;  4NLB A;  4GV3 A;  3LWM A;  4H4M A;  4B1X B;  3CD6 N;  3C0B A;  4E1M A;  2A41 A;  1NK4 A;  4FK0 A;  2YNI A;  1ZYQ A;  1X1P A;  1CZA N;  3A0I X;  3I33 A;  3O08 A;  3TAN A;  1OKJ A;  3QFU A;  4K25 A;  2ZJQ L;  3PX4 A;  4BRO A;  4RW9 A;  1KAZ A;  3SV3 A;  2XO7 A;  4FSV A;  1EQY A;  1G99 A;  4JI2 K;  5JIC A;  3MX2 A;  4B1Y B;  1TK5 A;  3O9Q A;  3NBP A;  1E4G T;  4GY2 B;  4JS5 A;  2QK9 A;  4M45 A;  4LH5 A;  1QS4 A;  4DUY K;  1JCG A;  4E0D A;  1JLC A;  1D4X A;  1VSH A;  3V9X A;  4KHN A;  4EHU A;  4FJG A;  4IKF A;  2OPR A;  4BRA A;  4CZF A;  1IO2 A;  2OCE A;  3WNF A;  3DXM B;  4O8U A;  4CGI A;  1YT3 A;  4WYB A;  4BR7 A;  3C65 A;  1HJO A;  5ADX A;  1HYS A;  3CHW A;  3UKU A;  1RBV A;  5BN8 A;  4RCH A;  2GWJ A;  1P8Z A;  3HK2 A;  4B3M K;  4LF6 K;  1TKX A;  1MU2 A;  4M3U A;  3KD5 E;  2P51 A;  3L0Q A;  4H5V A;  1NGJ A;  3W0L A;  5KTQ A;  1DTQ A;  2E2O A;  1IBK K;  3NGY A;  3AA3 A;  4FZY A;  4DSE A;  3KKR A;  3AAP A;  4KRE A;  1NMN A;  4CFD A;  3L6Q A;  4CZI A;  1MA9 B;  3PLA A;  3M5R A;  1TAU A;  1Q82 O;  4ILG B;  3A5M C;  3NHG A;  3ZT3 A;  1WLJ A;  4IOC L;  4DV6 K;  3KK3 A;  3CET A;  3KIO A;  4CFA A;  4NB4 A;  4QS7 A;  2HF4 A;  3VET A;  4CJS A;  5MLC Q;  3VTH A;  3PIO L;  3OYJ A;  3OYD A;  4PKG A;  3AGK A;  4U7B A;  1YHQ N;  1NGF A;  4B8C A;  4ZHR A;  1NNE A;  1JLE A;  1L3V A;  3ZX3 A;  4OGC A;  3QEW A;  5FPN A;  5GAH P;  4I9Q A;  4ID5 A;  2QEX N;  4G9Z A;  3MN7 A;  4KKO A;  1QVF M;  4IG3 A;  4QAG A;  2G8W A;  4Z4F A;  4BRI A;  2O8E A;  4DS4 A;  4X64 K;  4ICL A;  3ATU A;  3TAM A;  4X66 K;  1ZBS A;  4CGF A;  2GTD A;  4Z4H A;  4KTZ A;  4H0Y B;  5SWM A;  5E26 A;  4FWR A;  3UKU B;  3SBT A;  1RT5 A;  3WT0 A;  1SKW A;  4IEE A;  3H3N O;  2Q36 A;  3NVK A;  2VG6 A;  3MXI A;  1ZBF A;  3H46 O;  3L3V A;  2A3Z A;  1K9M O;  4DR3 K;  3PSI A;  1TAQ A;  3DRP A;  4AHV A;  3JYT A;  5J2P A;  1OH8 A;  1LW0 A;  3THW A;  2CH5 A;  5GAE P;  5ADX H;  3EZW A;  4H5R A;  3ZSZ A;  3M6G A;  4CIG A;  3KZB A;  3QBX A;  4JKB A;  1KCF A;  1VRT A;  5LMN K;  2I7P A;  4B9U A;  2QWQ A;  3VGL A;  4DFM A;  4GV6 A;  4A62 A;  1BG3 A;  1IV0 A;  4KHP K;  1C0G A;  5KGX A;  1RBS A;  3C95 A;  1KTQ A;  2HHT A;  5EVZ A;  3MXJ A;  4ZTF A;  1CZB A;  4HUF A;  3LAK A;  3J7A P;  2P9I A;  2G8H A;  2BAN A;  3RRH A;  3E66 A;  2FXU A;  1TL1 A;  4FJN A;  1RTH A;  3B6O A;  3EE8 A;  1WAJ A;  1ATR A;  4CZM A;  2HW3 A;  5T7B A;  3RTV A;  1TL3 A;  1KXP A;  4BC3 A;  1NK9 A;  2WOM A;  4DTR A;  3SYZ A;  1KD1 O;  2O8E B;  2YJF A;  5AJ3 K;  1I94 K;  4NCG A;  3VER A;  3LM2 A;  1DGK N;  5AFU A;  2E20 A;  2UYT A;  4LD0 A;  4RW7 A;  1LWC A;  3FLC O;  1DLO A;  3HZ6 A;  2LSN A;  4CF2 A;  2VWK A;  4A59 A;  4R79 A;  5KQ8 A;  2YKM A;  3D6R A;  4E1J A;  4BRH A;  3THW B;  3A5O C;  4B1Z A;  4DR2 K;  4I2P A;  4CJP A;  1R59 O;  5C0Y A;  1GLB G;  2F9T A;  3FZL A;  4I2Q A;  4FW1 A;  4N41 A;  4KI6 A;  4KI4 A;  4H0V B;  3S41 A;  4CF8 A;  1SL2 A;  2BE2 A;  3IUC A;  5LL6 Z;  3VMF B;  2HHU A;  4HTL A;  3GG4 A;  3VQP A;  1LWE A;  2P9P A;  3O9R A;  4CF0 A;  2Q0U A;  3KVG A;  2H3G X;  2VWB A;  4O5F A;  4FCY A;  3MEC A;  4WFB L;  3LWL A;  4N5S A;  1JKH A;  2P9I B;  4W5Q A;  4L8R B;  3SZ2 A;  1RGI A;  3P1G A;  3IKM A;  3OJU A;  3PX0 A;  3BDP A;  4FJM A;  4BVP A;  4WQ4 A;  1OH5 A;  4XH4 A;  1RTJ A;  4BC2 A;  3RMA A;  1NGG A;  3KKS A;  1T6D A;  2D4W A;  3ASM A;  4LF5 K;  4KPY A;  1T7P A;  1CXQ A;  2QTD A;  3AVG A;  2G8K A;  2EWS A;  5AR0 A;  3NH0 A;  1HMV A;  3DOL A;  1BL3 A;  3G4S N;  1RT2 A;  2ZM6 K;  2V7Z A;  4JNE A;  3P39 A;  5AQY A;  3K5L A;  5JLH A;  3I56 N;  5DM6 L;  2CH6 A;  3LDO A;  4OJR A;  1RDW X;  3IAY A;  4FVM A;  1YVU A;  3OYA A;  5AFU H;  4H5W A;  3U3Y A;  2KZM A;  1IKY A;  4FO0 A;  3ZET A;  3IFR A;  3U9D A;  1C6V A;  1MWK A;  4YOT A;  1LV5 A;  1BA0 A;  1NJZ A;  1W0H A;  5I9E B;  3U4L A;  3VQD A;  2OPQ A;  1RT1 A;  3L2Q A;  3T7Z A;  3HST B;  4M3Y A;  4DR1 K;  3ZEU A;  1VRU A;  3SV4 A;  1BO5 O;  3BEX A;  3EZ5 A;  2P9P B;  2XY8 A;  4YHH K;  3OYF A;  1NKE A;  4FWN A;  4CGJ A;  3ZT2 A;  4RW8 A;  2HB5 A;  3MED A;  1RT3 A;  3OS0 A;  3MN9 A;  5HRO A;  3ZYY X;  2RF2 A;  3O80 A;  1YIJ N;  2NRX A;  3CPW M;  2G8U A;  2YNH A;  4FL9 A;  1QSL A;  2RHK A;  1S6P A;  4JD2 A;  2RPI A;  4CJU A;  4ELV A;  4JI1 K;  1JLF A;  4Z0U A;  3VQC A;  4Z94 A;  1J6Z A;  1ZXO A;  4V19 S;  2IVP A;  3G10 A;  2HBJ A;  4WQ4 C;  1XQS C;  5BRD A;  4FLY A;  2QWM A;  1QQM A;  1XNQ K;  3NH1 A;  2HBM A;  1VSK A;  5HL7 L;  1NGD A;  1Z05 A;  4CJV A;  3HPG A;  3H1Q A;  4CJ4 A;  2W40 A;  4DR5 K;  1IJJ A;  3L2W A;  4KHY A;  4M3X A;  3SUP A;  1KVC A;  1NK7 A;  4ILJ A;  3ZET B;  2OPS A;  2HNY A;  3JXU A;  1QSY A;  2GBZ A;  2FF3 B;  3ZX2 A;  1JL1 A;  5KGW A;  3M8R A;  3T69 A;  1GOB A;  3JS6 A;  3T1Y K;  3OYM A;  4JI8 K;  2P5G A;  4ELU A;  4W5R A;  4O0J A;  1NK8 A;  3CQ8 A;  1OVY A;  5FPE A;  4FJ5 A;  4BRN A;  1MDU B;  3EL2 A;  2P9S A;  3ZEU B;  3VQ7 A;  4B3O A;  3E9P A;  3LAN A;  4KH5 A;  4CK1 A;  2YHA A;  1KAY A;  3K0S A;  4FLV A;  3J7Z O;  3ZT4 A;  3CCQ N;  4JD2 B;  3AVF A;  1HUX A;  4OLB A;  1TYQ A;  1U45 A;  2P9L A;  4DTU A;  1S9G A;  3EEQ A;  5AQV A;  5I3U A;  4B9S A;  1NU0 A;  4H0P A;  4BAC A;  4NXN K;  1OH7 A;  3GBT A;  3LAM A;  4RW4 A;  3DLG A;  3U3G A;  1HNZ K;  1RBU A;  4OPK A;  2KKZ A;  1KLM A;  1NGB A;  2GEM A;  3R3L A;  3OS2 A;  1BDG A;  3SUQ A;  1VSD A;  3ZSQ A;  1YVN A;  3FZM A;  4H8K A;  1S1W A;  2W41 A;  2HF3 A;  4A2A A;  3LDS A;  3AVK A;  1V4S A;  3UKR A;  4FWP A;  1KQS M;  4KHW A;  3GOI A;  1HLU A;  4IO8 A;  1KLN A;  1XI1 A;  1XC3 A;  4DV7 K;  3O3G A;  4CZH A;  3IG1 A;  4YDU A;  4JKC A;  4C8O A;  1D5A A;  1BOT O;  1QZ5 A;  3C6A A;  1S5J A;  3TTF A;  4FPB A;  3V6D A;  3VPZ A;  4FPA A;  2VQE K;  3OYN A;  2P9S B;  4E7K A;  5GAG P;  4IOA L;  4PHT X;  5AQM A;  5BN9 A;  3VES A;  3KD1 E;  1C0T A;  1IKW A;  4CF9 A;  2HMI A;  2V7Y A;  5F1X A;  4XEI A;  3CF5 L;  3M8S A;  3LP0 A;  5C12 A;  3GL1 A;  5EXW A;  2W42 A;  4Z4E A;  4O4G A;  4IBN A;  5AQU A;  1TYQ B;  2P9L B;  1M1K O;  3E9O A;  3L2V A;  4BE2 A;  2F96 A;  3I8D A;  4CHY A;  4J2A A;  1SUQ A;  1SV5 A;  4WFA L;  3DI6 A;  4YOX A;  1B92 A;  5HOO A;  3ULD A;  2OTJ N;  4DWI A;  3OA9 A;  5C15 A;  5CYM A;  2O8B A;  1LWF A;  2KW4 A;  2HHS A;  4CHO A;  4E1N A;  4CK2 A;  3H1V X;  3MEE A;  3OJS A;  3HRG A;  4DTS A;  1RDA A;  1U2V A;  1EET A;  1VHX A;  3UKR B;  3QET A;  4CES A;  4CFC A;  3A2F A;  1NJX A;  5ELZ A;  3ZLJ A;  1SL1 A;  3FZK A;  1E3M A;  4K0K K;  1JXE A;  4EHT A;  3KLF A;  5AQN A;  3DRR A;  3CJB A;  3KHY A;  1QHT A;  4FM0 A;  1X3N A;  4YDU C;  2ITM A;  3KLE A;  1W9H A;  5FDL A;  3VGM A;  1T05 A;  3K57 A;  3QB0 A;  3S9H A;  1YUW A;  1N8R O;  3MMV A;  1TK0 A;  2A6A A;  3UE5 A;  4CED A;  3G0Z A;  3MK6 A;  4WE1 A;  3HOS A;  5AQP A;  3ATV A;  4K42 A;  3QFP A;  3CG7 A;  4MO4 A;  3QNN A;  4KB0 A;  1ASV A;  1Z26 A;  1J54 A;  2DPN A;  2BUP A;  3MN6 A;  3MX5 A;  2NRT A;  2YNG A;  3M1F A;  4RW6 A;  4MDA A;  4JV5 K;  3C7N A;  1X9S A;  5GIO A;  1HR0 K;  4H4O A;  5D3G A;  4B9Q A;  3NF7 A;  5KQD A;  3WNG A;  4E7H A;  1EWQ A;  4BR5 A;  2YCH A;  1VQL N;  2IVO A;  2FSK A;  4CJW A;  3TAP A;  2O8B B;  3D2F A;  4BDZ A;  3N4P A;  4E7J A;  2Q3S A;  3TTD A;  4CZK A;  4DMN A;  4CIF A;  4DV0 K;  3TAF A;  3TAE A;  4K8Z A;  1GOA A;  4CZL A;  5DMR A;  2HST A;  1WAF A;  2GV9 A;  1U2V B;  3D2E A;  1V4T A;  4JRP A;  3SMP A;  2WUS A;  4CI6 A;  4CHZ A;  2YNF A;  4A2B A;  5J2M A;  4FJL A;  2DTU A;  3C6U A;  4JKA A;  4JI4 K;  3VQ8 A;  3E9L A;  3VF6 A;  4O0I A;  4Z4G A;  1HQU A;  4HVJ A;  1C1A A;  4LF4 K;  1U6Z A;  1UOC A;  4CD3 A;  3LDP A;  3SJH A;  3ZCM A;  1Z25 A;  4WFN L;  3RWU A;  4BQZ A;  1HNX K;  5LJV A;  4BRQ A;  4CEQ A;  4H0X B;  4YOY A;  2G8V A;  2GUI A;  5BPM A;  4KTQ A;  1JCE A;  4FYD A;  3AAR A;  1VSL A;  1VSE A;  4KO0 A;  3MCP A;  1HPZ A;  4E89 A;  4YNQ A;  4CHQ A;  3CC4 N;  4BDY A;  3AO4 A;  3HYF A;  1NK6 A;  4CEB A;  3CCM N;  1EXQ A;  2HVI A;  4JN4 A;  2QWR A;  3SCX A;  1N36 K;  4CEA A;  3VGK A;  3CCJ N;  4FWQ A;  4XIU A;  1VSI A;  3LAL A;  4KTW A;  1C0F A;  3EKU A;  2P5O A;  3QEP A;  3QO9 A;  1VK0 A;  4MDB A;  2V51 B;  1DEJ A;  3C7N B;  3KJV A;  2ZGZ A;  2OZS A;  2HND A;  4JI6 K;  3ULE A;  4CIE A;  3BF3 A;  2RE2 A;  4DU3 A;  3SQ1 A;  4DG1 A;  3R9P A;  3CC7 N;  2GUP A;  2WC9 A;  1RTD A;  4NYN A;  4X65 K;  3D2F B;  4O5B A;  4DTN A;  1W2B M;  3NF6 A;  3K5N A;  2IVN A;  4CHN A;  3GDQ A;  4IWV A;  4BWM A;  4FJ7 A;  4CEZ A;  4FK2 A;  3H45 C;  4DV3 K;  2XHB A;  4CJL A;  3CFP A;  1BU6 O;  3D2E B;  4DQI A;  4KHQ A;  3LDL A;  1KFD A;  3MWP A;  2HNZ A;  3VF4 A;  3TAQ A;  3TAG A;  3TAB A;  3TPQ A;  5M1P A;  3SAF A;  3VA0 A;  5AQF A;  3QDK A;  4B3S K;  1NWK A;  4CBU A;  2QXF A;  4FWO A;  5JLF A;  4YOV A;  4M3W A;  3J8A A;  4ELT A;  2HBL A;  3DOK A;  4FJ8 A;  3WXK A;  3OYH A;  3BF1 A;  4EZ9 A;  2Q2R A;  2VG7 A;  4BR2 A;  4A5A A;  1NG9 A;  2KZZ A;  1FKP A;  3VEN A;  4J2E A;  5HRS A;  4OLA A;  4CZJ A;  2D0P A;  4WF9 L;  3QEV A;  1T44 A;  4O55 A;  5HLF A;  3ZT0 A;  3TWH A;  2WTU A;  2A40 A;  1JJ2 M;  4BRK A;  4N76 A;  1EX4 A;  1K8K A;  5BR8 K;  2E1Y A;  3SJJ A;  2FBT A;  2O8F A;  1B9D A;  5A2Q O;  4F8R A;  5E84 A;  1EWR A;  1WN7 A;  2O8C A;  4M7Y A;  5SZT A;  3VTI A;  1NGA A;  1ASW A;  3NVM A;  3WXL A;  4CGD A;  2Y1J A;  3ULE B;  1Z6R A;  4CJQ A;  1EO1 A;  4C8M A;  1HX1 A;  4JK9 A;  1JLQ A;  4M42 A;  3ITH A;  5AQZ A;  5BPN A;  1HYV A;  4B3T K;  3QLH A;  4ILH A;  1F21 A;  3K59 A;  2AP1 A;  4CZG A;  1L5U A;  4CEE A;  2V52 B;  3K9J A;  3HP6 A;  1YF5 L;  3VQ5 A;  2QI2 A;  5KPT A;  2ZE2 A;  3TU5 A;  1NK0 A;  4DF4 A;  1WSJ A;  1KVB A;  1UA0 A;  2DFH A;  2IIR A;  1HQE A;  2D0B A;  4XH1 A;  1RDD A;  1QSS A;  4NO7 A;  2WBN A;  4MFB A;  4OX9 K;  3EYZ A;  3L3U A;  3NH2 A;  1IBL K;  5C2D A;  3KTQ A;  4DFJ A;  1HKG A;  5M1K A;  3HPH A;  2VGN A;  3NF9 A;  1KSP A;  3HO1 A;  3BUZ B;  4LF8 K;  3O3H A;  3RMB A;  3CJ9 A;  4DF8 A;  2J4R A;  3AVI A;  2PAV A;  1NJW A;  4AHU A;  1K6Y A;  4BC5 A;  4DV1 K;  4MLH A;  3D7E O;  1IG8 A;  3S3O A;  2ZGY A;  4JK7 A;  1O13 A;  2JWL A;  4Q5V A;  1K8K B;  2O8F B;  3CYM A;  3SAG A;  2ASO A;  1Q18 A;  5HRP A;  3AO3 A;  3ISN C;  3SMS A;  2O8C B;  2D0O A;  4F9O A;  1NGC A;  3EY1 A;  4JI5 K;  3MEG A;  1VSF A;  2BH1 A;  1QQO A;  4J2D A;  4PWD A;  4GKJ K;  3MDQ A;  3CC2 N;  2VWJ A;  4BG8 A;  3HXM A;  3SPY A;  1RFQ A;  1VAZ A;  2P9K A;  4BR0 A;  1UA1 A;  4FJ9 A;  4F3O A;  1YAG A;  5DK5 A;  3TSP A;  3O4Q A;  4AHR A;  2UXB K;  3NGI A;  4F2S A;  2HHQ A;  3K58 A;  5JVG L;  1D8Y A;  4DSJ A;  1WSF A;  4Z4C A;  3RRG A;  3CFO A;  4IFE A;  3CJ7 A;  4DUZ K;  4NCB A;  5FRO A;  3G25 A;  3DRS A;  3VQA A;  2RKI A;  4HUE A;  3SNN A;  3H6E A;  4K43 A;  2IDO A;  3U8X A;  2PBD A;  4N56 A;  4JS4 A;  4E7L A;  4O8K A;  1RT4 A;  1DTT A;  5AQR A;  1KRP A;  1BQN A;  3EN9 A;  3VEX A;  3WUH A;  4OPH A;  4AHC A;  4E7I A;  3D45 A;  1ATN A;  1J5E K;  1IBM K;  1LAV A;  5EY4 A;  4CJE A;  2E2P A;  5AQS A;  5EU7 A;  2UUA K;  1YJN N;  4WCE L;  1VQK N;  3QNO A;  2QKB A;  3R1X A;  2KLA A;  4MQ3 A;  3THV A;  2Z1G A;  1S9E A;  3J81 O;  1XNR K;  4C8K A;  2OA8 A;  5AQG A;  1RTI A;  1D9D A;  3LL3 A;  3R6M A;  1FK9 A;  4LY7 A;  2AA4 A;  2P1J A;  3OYG A;  2PYJ A;  4G1Q A;  4ISE A;  2P9K B;  3K9K A;  3U9Z A;  4MLE A;  3FFK B;  3CCR N;  2PY5 A;  3AVJ A;  3LM9 A;  1NGI A;  3R8E A;  3SBG A;  3FFI A;  4KHU A;  1KC8 O;  1CLQ A;  3QEX A;  5C10 A;  4I9L A;  4DR4 K;  3A8Y A;  3T19 A;  3OYI A;  5LMU K;  3CPE A;  3PO5 A;  1Q86 O;  2UUC K;  4PA1 A;  4YFU A;  3THX A;  1B9F A;  4ISG A;  1VSJ A;  1S72 N;  5JS1 A;  3AO1 A;  4FJJ A;  3L4Q A;  4M3Z A;  3F73 A;  2UXC K;  3J80 O;  3P4I A;  2QW9 A;  4DHY A;  3OYE A;  4CE9 A;  1WSG A;  4FM2 A;  4DSK A;  3M8P A;  3AA2 A;  4FLT A;  1BIZ A;  4IOX A;  3OS1 A;  2BTF A;  1ZBL A;  4J8F A;  4BGB A;  1RNH A;  2ATQ A;  5M1O A;  3MXM A;  3CFR A;  4GVE A;  1QTM A;  4DSL A;  1BHL A;  1D9F A;  2PZS A;  5EOY A;  3CME N;  4BWJ A;  3QML A;  3F9K A;  1VQ8 N;  2XRI A;  4HWI A;  5BRF A;  1REV A;  3B8A X;  3F5T A;  4ID1 A;  3KLG A;  3JAM O;  4EAH D;  3AAQ A;  5GIN A;  1Y64 A;  3HTV A;  4EFH A;  1Q81 O;  1Q9X A;  2HHX A;  4CEF A;  2ZD1 A;  5JMV A;  2KTQ A;  1C0M A;  3F9M A;  2EX3 A;  3O9T A;  3ZSY A;  4AF1 A;  2FBX A;  5F0X A;  3LDQ A;  4B3R K;  4LSL A;  2A42 A;  1YTA A;  3VQ4 A;  1SQK A;  5AZI A;  3O3F A;  3DAW A;  3C94 A;  1S1X A;  4B1W B;  2FBY A;  4YOU A;  1NKC A;  4FWM A;  3THX B;  2VGM A;  4OKK A;  2YX6 A;  2WFB A;  1K73 O;  4YOR A;  2FBV A;  4CJT A;  3V81 A;  4B9M A;  3CQX A;  3AVA A;  1SKS A;  5GIP A;  3FGU A;  1VSM A;  4RWT A;  4DV2 K;  3JSM A;  2D1K A;  1A5X A;  5AQO A;  3PIP L;  4IO9 L;  5C25 A;  1VQ9 N;  1HJR A;  5HRR A;  4K41 A;  2B4J A;  3SK3 A;  1WBB A;  1TV6 A;  5CYQ A;  5CY4 A;  3D0P A;  4BY9 C;  3O9U A;  4LSN A;  3TSU A;  4DU4 A;  3RSE A;  4IFV A;  3HI0 A;  3Q7C A;  2QWN A;  4CJK A;  2NRH A;  4IFY A;  4CK3 A;  1FXX A;  4M3R A;  4X62 K;  4FLX A;  4FOE A;  3LP2 A;  3PUF A;  4FWL A;  3I55 N;  4C1N K;  4CHP A;  4QS9 A;  2F8S A;  3WEE A;  4C1N I;  1WBD A;  5M1Q A;  5KPR A;  1BQM A;  2E1Z A;  1KAX A;  5M1N A;  4U67 L;  2HHH K;  3LPU A;  5EX5 A;  4GKK K;  1H1V A;  3K2P A;  3ENB A;  1C1C A;  2X6N A;  3AVL A;  4AIL C;  5AQH A;  1VQ7 N;  4BR4 A;  3OYC A;  4ISF A;  5AZI B;  1GLD G;  1I39 A;  3HJF A;  1M90 O;  1WSE A;  1FJG K;  4LC9 B;  4OPJ A;  4DTM A;  3S3M A;  1VQ5 N;  1GLA G;  5K14 A;  4TSX A;  1XMO K;  3OW2 M;  1J53 A;  5KI6 A;  1GLC G;  3EE9 A;  3O8M A;  3CXC M;  4QS8 A;  1GLL O;  2I5J A;  2JGU A;  3PO4 A;  2B6A A;  3C6H A;  4E3S A;  3G6E N;  4BC4 A;  3ENO A;  3DMJ A;  5J1E A;  3CMA N;  1RBT A;  3CI5 A;  2ASP A;  3AV9 A;  1IH7 A;  3AO2 A;  3B6P A;  1U49 A;  3L4I A;  3OYK A;  3V9S A;  4H03 B;  1X9M A;  1CZ9 A;  1J9A A;  2OPP A;  4FOI A;  2Q1N A;  1BIS A;  5B8H A;  4NCA A;  1NK5 A;  3AVC A;  4MO5 A;  4CCH A;  3WEE B;  4L3Q A;  4AHS A;  4UQG A;  4CER A;  3QIP A;  1NLV A;  3L8B A;  2A1S A;  4DQS A;  1JLA A;  3FZH A;  4KHS A;  2ITG A;  2BGG A;  2HHV A;  3DXK A;  1T8E A;  4OPA A;  4QOZ B;  5BRH A;  5AQK A;  1Y97 A;  1JCF A;  1ZBU A;  1EKE A;  1HRH A;  3ENH A;  2VQF K;  2FSJ A;  1VQ4 N;  4FZX C;  3H3O B;  4PL8 A;  2B5J A;  2FLO A;  1YXQ A;  2NNW A;  4CEC A;  3HBT A;  3AVB A;  2QA4 N;  3O1B A;  4FJI A;  4IXC A;  2CGL A;  3VEV A;  1IG9 A;  4LH4 A;  5FPM A;  4OO1 J;  2F7T A;  2X74 A;  3O1W A;  1WSH A;  1NOZ A;  2KHO A;  4RG8 A;  2F8T A;  2RN2 A;  2E8A A;  3C6T A;  4IDH A;  4DSI A;  4Y0W A;  3OVN A;  2XY6 A;  2E2N A;  4FJX A;  4DR6 K;  3WXJ A;  4JKG A;  4CBW A;  2DFE A;  3IRX A;  3E1Y A;  1NJY A;  2CGJ A;  3HL8 A;  1ZC6 A;  5FPD A;  1N5Y A;  1OVQ A;  2R7Y A;  4CVN E;  2YHY A;  2O4I A;  4KRF A;  4N47 A;  4CW7 B;  2E5L K;  3V9Z A;  1HYZ A;  2W6L A;  2YHB A;  4WQ5 A;  1T6C A;  4BRC A;  2UU9 K;  3ZSV A;  5FRN A;  4UY8 O;  3ALY A;  3VF2 A;  1TVR A;  3NGZ A;  1WUA A;  5HP1 A;  2IGI A;  1NMD A;  1YIT N;  5LJW A;  3SUN A;  1RCH A;  4BVO A;  3SAH A;  4J2B A;  1O1W A;  5CZ1 A;  3V4I A;  4JEP A;  1KFS A;  2YI1 A;  2ETJ A;  2X6S A;  3KLI A;  5CZ2 A;  3O6W A;  4FM1 A;  3DJC A;  3DXK B;  3VQ6 A;  2NRW A;  5BR9 A;  4Z4I A;  3CCS N;  4Y1D A;  3HSC A;  4IDK A;  4O44 A;  5TKW A;  4BR9 A;  4BE0 A;  3DLB A;  1NGH A;  5J2N A;  2OZM A;  3ID6 A;  2VYP A;  3UB5 A;  3VQB A;  1QVG M;  3VN5 A;  2HBK A;  3ZSR A;  4BRP A;  4OVL A;  1X9J A;  4AHT A;  4FWS A;  5FLX O;  2Z1H A;  4KAZ A;  5DM7 L;  2F9W A;  3THY A;  3A5L C;  5AQW A;  4NXM K;  2G8F A;  3WQT A;  4Y1C A;  2DFF A;  2HVH A;  1NBW A;  5M1F A;  2O4G A;  1QE1 A;  4JRQ A;  1N33 K;  2FC0 A;  4DFK A;  4JKG B;  1U47 A;  4NYF A;  4YOW A;  1YJW N;  5C24 A;  5H1S Q;  5AQT A;  3IMX A;  3TR8 A;  3K5O A;  2KQ2 A;  4FLU A;  4JI7 K;  4JKE A;  3KK1 A;  3I8B A;  5I42 A;  3KWG A;  4JKF A;  3VA3 A;  3QES A;  1RT6 A;  3BGR A;  5AQX A;  3HVT A;  3RR7 A;  1N34 K;  3LZJ A;  2OAN A;  4DFP A;  1NOY A;  3PSF A;  3Q7B A;  4PQU A;  4IJA A;  4FJK A;  2HHW A;  1U04 A;  4IG0 A;  1YI2 N;  3TSQ A;  1TK8 A;  1BI4 A;  1S22 A;  4PKI A;  2A1R A;  3NDK A;  1RDC A;  4WQ5 C;  3CCL N;  3T3F A;  1S1U A;  3SQ4 A;  3CJC A;  2QM1 A;  4OKE A;  3ID8 A;  4JYA K;  2ZQB A;  4GNI A;  3J7Y P;  3PY8 A;  1XWL A;  3L2R A;  1IKX A;  3T1H K;  1T3V A;  5C42 A;  1NGE A;  4M3T A;  4B08 A;  2YV0 X;  3G71 N;  1XUP O;  4M63 C;  3DLK A;  3BP8 A;  4CJ5 A;  1GLE G;  1NM1 A;  1QQC A;  3VOV A;  1ESV A;  3DWL A;  4IZ9 A;  4C8L A;  3DYA A;  3LDN A;  3THY B;  3TAR A;  2GWK A;  1Q8I A;  1DT9 A;  2ZJP L;  3AVH A;  4GV9 A;  3WNE A;  2ZJR L;  1L3S A;  4I7F A;  4CJF A;  3SUO A;  1VQP N;  3OYL A;  2EHG A;  4LFA K;  2JLE A;  4NLC A;  4CJR A;  3HM8 A;  1U48 A;  4XH5 A;  3M8Q A;  3VQQ A;  4ZTJ A;  1NJI O;  4HHT A;  3W3D A;  4I6M A;  4HUG A;  3M3Z A;  3HOT A;  1UWB A;  3SQ0 A;  4CGG A;  1S1V A;  3ZSX A;  2A5X A;  3VEY A;  2UXD K;  4JKH A;  3P38 A;  3MAQ A;  1XHZ A;  1W7A A;  2P9N A;  1VQO N;  3DLE A;  1BI4 B;  3V1R A;  1XHX A;  2D5R A;  1FW6 A;  2WON A;  1X9W A;  2Y1I A; 
#chains in the Genus database with same CATH homology
 4CK2 A;  3MEE A;  4FLT A;  2KFN A;  1BIZ A;  3OJS A;  3OS1 A;  1ZBL A;  1GOC A;  5JS2 A;  4B8C A;  4ZHR A;  4DTS A;  1RNH A;  2QKK A;  1RDA A;  2ATQ A;  1EET A;  3MXM A;  3CFR A;  3QET A;  1JLE A;  1L3V A;  4CES A;  1QTM A;  4CFC A;  3A2F A;  1NJX A;  4DSL A;  4OGC A;  1BHL A;  4EP5 A;  3QEW A;  4I9Q A;  5HBM A;  4ID5 A;  1D9F A;  3QIN A;  2PZS A;  4KKO A;  1FKO A;  1JXB A;  4GMJ B;  4BDP A;  1C0U A;  3V1Q A;  4BWJ A;  1SL1 A;  4W5O A;  4IG3 A;  4QAG A;  2G8W A;  1JXE A;  4Z4F A;  1WNS A;  4DTP A;  3F9K A;  3KLF A;  2XRI A;  4DS4 A;  1REV A;  4ICL A;  3DRR A;  3P83 D;  3TAM A;  4CEO A;  4CGF A;  4FK4 A;  4ID1 A;  4CFB A;  3KLG A;  4Z4H A;  1QHT A;  4KTZ A;  4Q0B A;  4FM0 A;  5SWM A;  1JLG A;  4E19 A;  1BIU A;  3NFA A;  2YKN A;  1RT5 A;  3KLE A;  1W9H A;  5FDL A;  1T05 A;  1SKW A;  1SL0 A;  1Q9X A;  3K57 A;  3KLH A;  3S9H A;  3M8P A;  2VG6 A;  3AA4 A;  4CF1 A;  3MXI A;  4CED A;  1ZBF A;  4CEF A;  3G0Z A;  2ZD1 A;  1TK0 A;  1A5V A;  3L3V A;  2KTQ A;  2HHX A;  4WE1 A;  1TAQ A;  1C0M A;  3DRP A;  4AHV A;  3JYT A;  2EX3 A;  5J2P A;  1LW0 A;  1BGX T;  4FLZ A;  3ZSY A;  2FBX A;  3CG7 A;  4PUO A;  4LSL A;  3QNN A;  4KB0 A;  1YTA A;  1ASV A;  1Z26 A;  1J54 A;  3VQ4 A;  3ZSZ A;  3O3F A;  3O4N A;  4CIG A;  2YNG A;  4RW6 A;  2D0A A;  1KCF A;  3C94 A;  1S1X A;  1VRT A;  3LP1 A;  4GW6 A;  2IOC A;  2FBY A;  1XC9 A;  1X9S A;  4B9U A;  1NKC A;  4FXD A;  4OKK A;  4H4O A;  4DFM A;  5D3G A;  1ITG A;  1JL2 A;  3NF7 A;  3NE6 A;  3WNG A;  4E7H A;  5KGX A;  1RBS A;  3RMC A;  3C95 A;  1KTQ A;  2HHT A;  1BCM A;  2FBV A;  3MXJ A;  4CJW A;  4CJT A;  3HPO A;  3TAP A;  4ZTF A;  1ASU A;  3V81 A;  3QIO A;  4B9M A;  4OGE A;  4BDZ A;  3AVA A;  1CZB A;  2Q3S A;  4HUF A;  4E7J A;  3LAK A;  3PX6 A;  2G8H A;  1SKS A;  4DTO A;  3SQ2 A;  2IS3 A;  4DMN A;  2BAN A;  4PY5 A;  4CGH A;  1ZBI A;  1VSM A;  4CIF A;  3TAF A;  3TAE A;  3RRH A;  4K8Z A;  1GOA A;  5DMR A;  3TI0 A;  3JSM A;  1WAF A;  2GV9 A;  1A5X A;  3HT3 A;  4JRP A;  5C25 A;  1TL1 A;  4FJN A;  1HJR A;  5HRR A;  2B4J A;  4CHZ A;  2YNF A;  1RTH A;  5J2M A;  3B6O A;  4FJL A;  2DTU A;  2BDP A;  1C1B A;  3C6U A;  1RDB A;  3DLR A;  3VQ8 A;  1TV6 A;  1WAJ A;  5CYQ A;  1SKR A;  4O0I A;  4Z4G A;  3UIQ A;  1HQU A;  2HW3 A;  5T7B A;  1TGO A;  1C1A A;  5CY4 A;  1TL3 A;  4HVJ A;  1UOC A;  3D0P A;  2Z1I A;  4LSN A;  3ZCM A;  4DU4 A;  4EP4 A;  4KFB A;  1Z25 A;  3NCI A;  3SI6 A;  1NK9 A;  2WOM A;  1BCO A;  4IFV A;  3SYZ A;  4DTR A;  4DTJ A;  3RWU A;  1A5W A;  1TKZ A;  4IFY A;  4CJK A;  4NCG A;  3I0R A;  4CK3 A;  1FXX A;  4M3R A;  4FLX A;  4CEQ A;  3RMD A;  3QER A;  3LP2 A;  3PUF A;  3T1A A;  2G8V A;  2GUI A;  4LD0 A;  3V9U A;  4CHP A;  3DLH A;  4KTQ A;  4RW7 A;  4KB1 A;  1LWC A;  2F8S A;  1DLO A;  4FYD A;  1VSL A;  1VSE A;  2LSN A;  4CF2 A;  4KO0 A;  4YNQ A;  1HPZ A;  4E89 A;  4DLG A;  4DTX A;  2PYL A;  2VWK A;  1BQM A;  4CHQ A;  3PV8 A;  4BDY A;  3AO4 A;  2YKM A;  4QCL A;  3S3N A;  3HYF A;  1NKB A;  3LPU A;  1NK6 A;  4CEB A;  4DQQ A;  3AVN A;  3AO5 A;  3K2P A;  1EXQ A;  2HVI A;  1C1C A;  2X6N A;  4I2P A;  2IAJ A;  4CJP A;  3SCX A;  3AVL A;  4CEA A;  4AIL C;  3SPZ A;  3ZSW A;  4FLW A;  3HM9 A;  4XIU A;  3OYC A;  1VSI A;  3LAL A;  4KTW A;  2P5O A;  2XY5 A;  4I2Q A;  4FW1 A;  1RIL A;  3LP3 A;  1I39 A;  3HJF A;  3QEP A;  4N41 A;  4KI6 A;  3QO9 A;  1VK0 A;  4KI4 A;  4HTU A;  1WSE A;  1I3A A;  3KJV A;  4OPJ A;  4DTM A;  3S3M A;  4CF8 A;  1SL2 A;  2BE2 A;  2OZS A;  2HND A;  5K14 A;  4TSX A;  4CIE A;  3LZI A;  4BE1 A;  4DU3 A;  3SQ1 A;  2HHU A;  1J53 A;  5KI6 A;  4DG1 A;  3VQP A;  1LWE A;  1T03 A;  4B9L A;  4CF0 A;  1RTD A;  4NYN A;  4B9T A;  1Q9Y A;  4FCY A;  3MEC A;  4O5B A;  4DTN A;  3LWL A;  3NF6 A;  2I5J A;  3K5N A;  4CHN A;  1JKH A;  4N5S A;  4W5Q A;  2JGU A;  3QEI A;  4L8R B;  4BWM A;  4FJ7 A;  4CEZ A;  4FK2 A;  3V1O A;  3SZ2 A;  2XHB A;  4CJL A;  3CFP A;  4DQP A;  1G15 A;  2B6A A;  3PO4 A;  4K8X A;  3P1G A;  4B8A B;  3OJU A;  4E3S A;  3PX0 A;  3BDP A;  4DQI A;  4FJM A;  4B9N A;  2IC3 A;  1S1T A;  3WNH A;  1RTJ A;  4KHQ A;  3DMJ A;  5J1E A;  1KFD A;  1RBT A;  3RMA A;  3KKS A;  2HNZ A;  3TAQ A;  3RTV A;  3TAG A;  1LAW A;  3ASM A;  3TAB A;  3VA0 A;  3AV9 A;  1IH7 A;  3AO2 A;  3B6P A;  4KPY A;  2Z1J A;  4W5T A;  1U49 A;  1T7P A;  3OYK A;  1CXQ A;  3AVG A;  2G8K A;  2QXF A;  3V9S A;  3CM6 A;  1CZ9 A;  1J9A A;  2VG5 A;  1X9M A;  3NH0 A;  2OPP A;  4M41 A;  4M3W A;  3AA5 X;  1HMV A;  3DOL A;  1BIS A;  4ELT A;  1BL3 A;  3DOK A;  4DQR A;  4FJ8 A;  1RT2 A;  4NCA A;  1NK5 A;  3AVC A;  1L3U A;  4CCH A;  5KRS A;  3OYH A;  4UQG A;  4AHS A;  4EZ9 A;  3K5L A;  2VG7 A;  4CER A;  3QIP A;  4HCC A;  2KZZ A;  3L2U A;  3L8B A;  1FKP A;  2A1S A;  4J2E A;  4C8N A;  4DQS A;  1JLA A;  5HRS A;  4OJR A;  4OLA A;  3IAY A;  4FVM A;  1YVU A;  4O55 A;  2ITG A;  3QEV A;  3OYA A;  5HLF A;  3ZT0 A;  4KHS A;  3TWH A;  2BGG A;  1T8E A;  2HHV A;  4QOZ B;  3U3Y A;  2KZM A;  1HNV A;  1IKY A;  1S6Q A;  4N76 A;  1EX4 A;  1RT7 A;  1Y97 A;  1YTU A;  1RBR A;  1C6V A;  1EKE A;  1HRH A;  1LW2 A;  1ZBU A;  2FBT A;  3SJJ A;  1B9D A;  4DU1 A;  4F8R A;  4DSF A;  1TKD A;  1LV5 A;  3P5J A;  1NJZ A;  4FZX C;  4W5N A;  1WN7 A;  1W0H A;  2B5J A;  5SZT A;  3VQD A;  2OPQ A;  4CEC A;  4B9V A;  1ZBH A;  4R5P A;  1RT1 A;  1ASW A;  1JLB A;  3L2Q A;  3AVB A;  3DM2 A;  4CGD A;  2Y1J A;  4CJQ A;  4C8M A;  4FJI A;  3V9W A;  3CM5 A;  3HST B;  4M3Y A;  4AH9 A;  1VRU A;  3ZT1 A;  4GVM A;  3IS9 A;  3E01 A;  3SV4 A;  5J2Q A;  3EZ5 A;  2E6M A;  1IG9 A;  4LH4 A;  1JLQ A;  2XY8 A;  2X74 A;  3OYF A;  4CGJ A;  1NKE A;  3ZT2 A;  1WSH A;  4RW8 A;  1IKV A;  2HB5 A;  3ITH A;  3MED A;  1WSI A;  4FJH A;  4FZZ A;  1HYV A;  1RT3 A;  3QLH A;  3VQ9 A;  1NOZ A;  4RG8 A;  3OS0 A;  1F21 A;  3K59 A;  5HRO A;  2RF2 A;  1HNI A;  1L5U A;  4CEE A;  2YNH A;  2RN2 A;  3C6T A;  3I0S A;  2G8U A;  4DSI A;  2F8T A;  3OVN A;  2XY6 A;  3HP6 A;  4FJX A;  1KVA A;  2DY4 A;  2DFE A;  3IRX A;  3K5M A;  1QSL A;  3VQ5 A;  1S6P A;  2AJQ A;  4KV8 A;  1NJY A;  2RPI A;  3HL8 A;  4CJU A;  1UAX A;  4ELV A;  1N5Y A;  2ZE2 A;  3AVM A;  3NF8 A;  3LPT A;  2R7Y A;  1JLF A;  4FM2 A;  1NK0 A;  4Z0U A;  3VQE A;  4DF4 A;  1WSJ A;  1KVB A;  4OKJ A;  1UA0 A;  3VQC A;  4DSK A;  4KRF A;  2O4I A;  4N47 A;  2DFH A;  2E6L A;  3V9Z A;  3G10 A;  1HQE A;  2D0B A;  1HYZ A;  2YHB A;  1RDD A;  3KK2 A;  1R0A A;  3RR8 A;  1CXU A;  3ZSV A;  1QSS A;  5FRN A;  4FLY A;  4MFB A;  4F2R A;  3ALY A;  3EYZ A;  3L3U A;  1TVR A;  2NUB A;  4JLH A;  3NH2 A;  3NGZ A;  3HP9 A;  3NH1 A;  5HP1 A;  1VSK A;  3KTQ A;  2IGI A;  3H08 A;  4CJV A;  3SUN A;  4DFJ A;  1RCH A;  4FW2 A;  4EZ6 A;  4J2B A;  1O1W A;  3HPG A;  3HPH A;  5KRT A;  5CZ1 A;  3V4I A;  4F4K A;  3NF9 A;  1KSP A;  1KFS A;  2OYQ A;  4CJ4 A;  4HCB A;  3O3H A;  3RMB A;  2QKB A;  3HO1 A;  4DF8 A;  2ETJ A;  2X6S A;  3KLI A;  4F3T A;  3U6F A;  3AVI A;  5CZ2 A;  2XY7 A;  1NJW A;  4AHU A;  3L2W A;  1K6Y A;  4FM1 A;  4KHY A;  4M3X A;  3SUP A;  1KVC A;  2G8I A;  3S3O A;  1NK7 A;  2X78 A;  3VQ6 A;  4Z4I A;  2E4L A;  1U4B A;  4Y1D A;  4DLE A;  4DS5 A;  2OPS A;  2HNY A;  4Q5V A;  1N6Q A;  5E41 A;  4IDK A;  4O44 A;  3CYM A;  1QSY A;  2GBZ A;  1J5O A;  4BE0 A;  3DLB A;  1JL1 A;  5J2N A;  5HRP A;  5KGW A;  3M8R A;  3AO3 A;  1GOB A;  3ISN C;  3HVR A;  2OZM A;  3OYM A;  3NAE A;  2P5G A;  3VQB A;  3EY1 A;  1EP4 A;  4ELU A;  3ZSO A;  3VN5 A;  1TKT A;  3ZSR A;  4W5R A;  4O0J A;  4OVL A;  3OYB A;  3CQ8 A;  3MEG A;  1VSF A;  1NK8 A;  4AHT A;  4FJ5 A;  4J2D A;  2Z1H A;  4KAZ A;  4PWD A;  2D0C A;  3VQ7 A;  4B3O A;  2VWJ A;  3HXM A;  3SPY A;  1UA1 A;  4FJ9 A;  4F3O A;  3LAN A;  2G8F A;  5FRM A;  5DK5 A;  4Y1C A;  2DFF A;  5HRN A;  2HVH A;  3OY9 A;  4CK1 A;  3O4Q A;  2O4G A;  1QE1 A;  4AHR A;  3NGI A;  4JRQ A;  2YHA A;  4F2S A;  2HHQ A;  2FC0 A;  3K58 A;  1D8Y A;  4DFK A;  4FLV A;  1U47 A;  4DSJ A;  4NYF A;  4CJ3 A;  1WSF A;  3ZT4 A;  4Z4C A;  1L3T A;  3RRG A;  3CFO A;  5C24 A;  4NCB A;  3AVF A;  5FRO A;  3TR8 A;  4OLB A;  3K5O A;  1U45 A;  2KQ2 A;  4FLU A;  3LWM A;  4H4M A;  3KK1 A;  3DRS A;  4E1M A;  5I42 A;  3VQA A;  3VA3 A;  1S9G A;  2RKI A;  4HUE A;  4DTU A;  3QES A;  1RT6 A;  5I3U A;  1NK4 A;  3BGR A;  4B9S A;  4FK0 A;  3HVT A;  3RR7 A;  2YNI A;  3LZJ A;  4BAC A;  3SNN A;  1ZYQ A;  1X1P A;  2IDO A;  3LAM A;  4DFP A;  3TAN A;  1NOY A;  4RW4 A;  4N56 A;  4PQU A;  3PX4 A;  4FJK A;  4JS4 A;  3DLG A;  2HHW A;  3U3G A;  4E7L A;  4RW9 A;  1RBU A;  1U04 A;  4IG0 A;  4OPK A;  1TK8 A;  1BI4 A;  1RT4 A;  1DTT A;  2A1R A;  3NDK A;  1RDC A;  1KLM A;  3SV3 A;  2XO7 A;  3OS2 A;  3SUQ A;  1KRP A;  1VSD A;  3ZSQ A;  1BQN A;  1S1U A;  3T3F A;  4H8K A;  1S1W A;  3SQ4 A;  1TK5 A;  4AHC A;  3NBP A;  4OKE A;  4E7I A;  3LDS A;  3D45 A;  2ZQB A;  3AVK A;  4JS5 A;  4KHW A;  3PY8 A;  2QK9 A;  1LAV A;  4M45 A;  4CJE A;  1KLN A;  4LH5 A;  1QS4 A;  1XI1 A;  4E0D A;  1JLC A;  3O3G A;  1XWL A;  3IG1 A;  5EU7 A;  1VSH A;  3V9X A;  4KHN A;  3L2R A;  1IKX A;  5C42 A;  4M3T A;  4B08 A;  3QNO A;  4FJG A;  2YV0 X;  4MQ3 A;  3THV A;  2OPR A;  4C8O A;  3DLK A;  4IKF A;  1D5A A;  1IO2 A;  2Z1G A;  1S9E A;  4CJ5 A;  3WNF A;  1S5J A;  3V6D A;  4CGI A;  4C8K A;  1YT3 A;  1QQC A;  2OA8 A;  1RTI A;  2KFZ A;  3OYN A;  4E7K A;  1D9D A;  4C8L A;  1FK9 A;  3DYA A;  4LY7 A;  2P1J A;  3TAR A;  3OYG A;  2PYJ A;  4G1Q A;  1HYS A;  1RBV A;  1Q8I A;  3KD1 E;  3AVH A;  1C0T A;  1IKW A;  4CF9 A;  3HK2 A;  2HMI A;  2PY5 A;  1TKX A;  3AVJ A;  3WNE A;  4KHU A;  1MU2 A;  3FFI A;  1L3S A;  4M3U A;  3M8S A;  4I7F A;  4CJF A;  2P51 A;  3SUO A;  3KD5 E;  5KTQ A;  3OYL A;  1DTQ A;  3LP0 A;  2EHG A;  3NGY A;  3AA3 A;  2W42 A;  4DSE A;  4FZY A;  4Z4E A;  4O4G A;  1CLQ A;  4IBN A;  3QEX A;  2JLE A;  3KKR A;  4I9L A;  4CJR A;  1U48 A;  3T19 A;  3M8Q A;  3VQQ A;  3OYI A;  4KRE A;  4ZTJ A;  3PO5 A;  4CFD A;  4HHT A;  3L2V A;  4HUG A;  1UWB A;  4BE2 A;  4PA1 A;  4YFU A;  2F96 A;  3I8D A;  3SQ0 A;  1TAU A;  1B9F A;  4CGG A;  1S1V A;  3ZSX A;  4CHY A;  1VSJ A;  5JS1 A;  3AO1 A;  4J2A A;  4FJJ A;  1SUQ A;  1SV5 A;  4M3Z A;  3NHG A;  3F73 A;  3DI6 A;  4M42 A;  3ZT3 A;  1WLJ A;  1B92 A;  3MAQ A;  1XHZ A;  3KK3 A;  3KIO A;  3DLE A;  4CFA A;  3ULD A;  4DWI A;  3OYE A;  4CJS A;  1BI4 B;  5CYM A;  1LWF A;  2KW4 A;  4CE9 A;  2HHS A;  1WSG A;  3V1R A;  1XHX A;  2D5R A;  2Y1I A;  3OYJ A;  4CHO A;  4E1N A;  2WON A;  3OYD A;  1X9W A;  3AA2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...