2Z1HA

Crystal structure of e.coli rnase hi surface charged mutant(q4r/t92k/q105k/q113r/q115k/n143k/t145k)
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
155
structure length
155
Chain Sequence
MLKRVEIFTDGSCLGNPGPGGYGAILRYRGREKTFSAGYTRTTNNRMELMAAIVALEALKEHCEVILSTDSQYVRQGITQWIHNWKKRGWKKADKKPVKNVDLWKRLDAALGRHKIKWEWVKGHAGHPENERCDELARAAAMKPKLEDTGYQVEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Protein Thermostabilization Requires a Fine-tuned Placement of Surface-charged Residues
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Ribonuclease HI
total genus 47
structure length 155
sequence length 155
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2007-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2z1hA00
3PO5A 5DK5A 2X6NA 4CHYA 1B92A 2XY7A 4EZ9A 1VSHA 4HHTA 4H4OA 1CLQA 1S9GA 4CK1A 1RTIA 2G8KA 1ASWA 2D0BA 2W42A 4E89A 4M42A 2WOMA 4PUOA 4O55A 1KVBA 4O5BA 3SV4A 3QEXA 1WNSA 1C1CA 4DS5A 4DQQA 4DFPA 5T7BA 2E4LA 2O4GA 2G8IA 1D9DA 3PO4A 4CGJA 4OKKA 1X9MA 4FLVA 1NKEA 1RBRA 4RW9A 2ATQA 5CYQA 1VSKA 2BDPA 3AA2A 3C95A 5FROA 3SI6A 5CZ2A 1XHXA 2AJQA 1TK8A 4B9LA 3V9SA 3K5OA 3OYJA 1IKXA 1LW0A 3EY1A 4E3SA 4C8LA 2YNGA 4KHNA 1QTMA 3TI0A 1RT2A 1TKTA 1U04A 3KJVA 5JS2A 2A1RA 1VK0A 4KI6A 2G8WA 2IS3A 4CJ3A 3TAQA 4W5NA 2F8SA 1EETA 3QESA 1RT1A 4NYFA 4E1MA 1FKOA 1YT3A 2RF2A 4CERA 5HRSA 1RBUA 3OYBA 3QERA 4F4KA 4FK0A 2JGUA 4I9LA 4JRPA 3CM5A 3RWUA 3DLKA 5EU7A 2QXFA 1YTAA 3NF6A 1GOCA 5I42A 3HVTA 4AHVA 4DTUA 4C8OA 1N6QA 4RW8A 1LWFA 4M3YA 1C6VA 2XY8A 1JL2A 2Z1GA 1FK9A 3AA3A 1L3TA 1XWLA 4FK4A 2DFFA 1HPZA 4F2RA 4L8RB 2HHWA 3LWMA 2KZMA 3L2QA 3AVGA 1EP4A 3AVLA 3QIPA 1NK0A 2HHXA 1UAXA 4CJTA 5E41A 4CK2A 3QEIA 4FJXA 4KPYA 5KRSA 3NH2A 4M45A 3CQ8A 4FVMA 1WSEA 1HNVA 3AO2A 1U49A 1JLFA 3ZT2A 1S1WA 1S1XA 4MQ3A 3O3GA 3QETA 3KLHA 5C42A 3CYMA 5K14A 1NJWA 3IG1A 1J53A 1C1AA 4O0JA 3E01A 3LPUA 4IFYA 3D45A 4CJ5A 1VSEA 3ZSZA 3QNOA 1BL3A 3BGRA 1Z26A 1WSFA 4E7LA 1NK8A 4HUGA 4FW1A 4O44A 3NE6A 3NDKA 4FM1A 3VA3A 4DU3A 1NJXA 1WN7A 2XY5A 4JRQA 2KZZA 3NH0A 2HNDA 4N76A 4FLWA 3LZJA 2IOCA 3KK2A 3V9UA 1FKPA 4GW6A 4CIEA 3SPYA 1S5JA 3V6DA 4B9SA 4CCHA 1TGOA 3U3YA 1RTJA 2G8FA 1WSHA 2PYLA 4J2AA 1SL1A 4BE1A 4KHQA 3HYFA 4CJUA 4DU4A 1IKYA 1Q9XA 4FK2A 1S1VA 1TL1A 1KVCA 1TKZA 1JXEA 4CF8A 4AILC 3PV8A 3TABA 3TARA 2B6AA 2B5JA 1KRPA 1BI4A 3KK1A 4DLGA 2DFEA 1HRHA 4F8RA 3QLHA 4B8AB 3C6TA 3VQ5A 1NK5A 1VSFA 4KHUA 4DSFA 1VRTA 4KHWA 2HHTA 1KFDA 1HYZA 4HTUA 3RTVA 2D5RA 1UA0A 2VG5A 3TAPA 1X1PA 4ZTJA 1T7PA 5FRMA 3ZSOA 3EZ5A 4OLAA 4CF9A 4AH9A 1ZYQA 4BDPA 1REVA 3WNHA 1SKRA 4KTZA 2ZQBA 3L8BA 3RR7A 2F96A 3ZT1A 3OYGA 3M8RA 3RRHA 4UQGA 5D3GA 4ELUA 3ZT3A 1A5WA 1T05A 1HNIA 4FXDA 4YNQA 2HNYA 3OS0A 4DF4A 3AA5X 3NF9A 4DQRA 4FCYA 4CJWA 2OPSA 4BACA 3ZT0A 1R0AA 3V1RA 3RMBA 2FBVA 3V9ZA 4KI4A 5HRNA 4W5TA 1ITGA 3TWHA 3ZSYA 3NCIA 3V1OA 2HMIA 1GOAA 3KIOA 2WONA 3KD1E 1CXQA 1WAFA 1HMVA 2HHSA 1Z25A 3NGIA 4DTMA 3PX6A 3HVRA 1UWBA 1NJZA 3QNNA 3PX4A 3NFAA 4AHCA 1VSLA 1F21A 4DTPA 1QHTA 3SQ1A 2RKIA 1EXQA 2DTUA 2BANA 1SUQA 4E7IA 1C0TA 2IC3A 1GOBA 1KLMA 1WSGA 1HQUA 3B6PA 3VQAA 4OPKA 3HP6A 1DTTA 4ICLA 2XHBA 4FJIA 3U3GA 3DI6A 4F3TA 4OGCA 1JLEA 3KLIA 4E7KA 1KLNA 4J2BA 4B9NA 3ITHA 4FW2A 2XRIA 4CFDA 4CHPA 2QKKA 3SQ2A 3F9KA 1NKBA 4FJ7A 4W5RA 3L2UA 4DF8A 3AO5A 4CIGA 1LWEA 1I3AA 4Y1DA 4CHOA 4BWJA 3SQ0A 5J2NA 1JLAA 3UIQA 5HP1A 1C0UA 4DTNA 4CF2A 4DTJA 4OVLA 4CEAA 3K5MA 4M3UA 1CXUA 1G15A 1RILA 1VSJA 4E19A 3EYZA 3NBPA 4FLUA 3SQ4A 4IG3A 4H8KA 1TV6A 4FJLA 1L5UA 1D5AA 4CJQA 4CIFA 3HO1A 3D0PA 4FJ9A 3PY8A 4N41A 2Z1IA 2GBZA 3LP0A 1C0MA 3HPOA 4O0IA 3ZSRA 4OPJA 1BIUA 2KTQA 4CGGA 4DFJA 1Q8IA 4PY5A 3LDSA 3NF7A 1YVUA 4JS5A 3HJFA 4I2PA 2KFZA 5HLFA 4IDKA 3TAMA 1BQNA 2FBYA 4AHSA 2G8HA 2OA8A 1S9EA 4CGDA 3OYEA 5J2QA 1J5OA 1KSPA 2OPRA 5C24A 3OYLA 1JLGA 1TVRA 3DM2A 3AVAA 3M8QA 4KV8A 3ZSVA 3CG7A 3IRXA 3L2WA 3P1GA 4DS4A 4RW7A 3MEEA 2ITGA 4F3OA 1HJRA 4B9VA 2I5JA 2OYQA 4NCGA 4MFBA 3ASMA 1IH7A 3OYFA 4FLZA 3KLFA 2BGGA 1QSLA 3KKSA 3OYDA 2HB5A 3OYHA 3MAQA 4DTRA 1RDAA 3AO4A 3V4IA 1IKWA 3SJJA 2D0CA 2E6LA 3HM9A 1LWCA 4DSEA 1RBSA 4LH4A 3IAYA 1UOCA 1B9DA 3THVA 4DFKA 1BI4B 1RT5A 4BDYA 4CJEA 1W0HA 2FBTA 3NGYA 5HRRA 4Q0BA 3S3MA 3ULDA 1DTQA 2B4JA 4Y1CA 3V9XA 3F73A 2Y1IA 4FJGA 3AO1A 3RMAA 4DWIA 3OYMA 3OJUA 4W5QA 3ZCMA 1ZBUA 4B9MA 1RBVA 4PA1A 4FJKA 3LP1A 4KKOA 2X78A 4CK3A 3OS2A 1VRUA 3WNEA 4LSNA 1MU2A 4HCBA 4LD0A 4KHYA 2YNHA 1HYSA 1HQEA 4N56A 3OYIA 2JLEA 2Z1JA 4EP4A 2F8TA 3MXJA 3MECA 1K6YA 4GVMA 3SUQA 4DFMA 4BE2A 1B9FA 5HBMA 4K8XA 3L3VA 3OS1A 1TK0A 1NK9A 5JS1A 3ZSQA 3VQDA 4CEOA 4DU1A 1WLJA 1NJYA 1D8YA 2PZSA 1SKSA 1W9HA 2P51A 4CJKA 4B8CA 1BHLA 4E1NA 3OJSA 3KLEA 4Z4HA 4DSLA 2QK9A 4CEQA 1BQMA 3KK3A 3LALA 2X74A 4I9QA 4OGEA 3ISNC 3VQEA 3RR8A 2Y1JA 4DSIA 4LY7A 3I0RA 4B08A 4M41A 5C25A 1FXXA 1J9AA 3C6UA 4XIUA 3RMDA 4DLEA 4KB1A 3S3OA 3SYZA 3C94A 4FLXA 4OKJA 4N5SA 1Y97A 1DLOA 1JXBA 3L2RA 4HVJA 1XI1A 3L3UA 1NKCA 3VQ4A 2YNFA 4Z4FA 2PY5A 3AVKA 2VG7A 4O4GA 4QOZB 1EX4A 3HP9A 2NUBA 2RN2A 2YHBA 5CYMA 4B9TA 2HW3A 3DLEA 4K8ZA 1TKXA 4FLYA 1BCMA 3SZ2A 4M3XA 4Z4EA 3VQBA 4CEDA 4DMNA 1O1WA 2YV0X 3VQQA 5HRPA 3AVCA 3L2VA 2VWJA 3SV3A 5J2PA 5FRNA 2LSNA 1SKWA 3SPZA 4WE1A 2OZMA 2A1SA 1JKHA 1RCHA 3FFIA 3ZSWA 3VQCA 2O4IA 1EKEA 1U4BA 1NOYA 3K2PA 1Q9YA 1ZBIA 3OY9A 1HYVA 5HROA 3TR8A 4CEBA 4Z4CA 5SZTA 3VA0A 4FJHA 3LZIA 2EX3A 4E7HA 3DLRA 1TL3A 1RDDA 1XHZA 4CHNA 2VWKA 4CGFA 3AV9A 1C1BA 2YKMA 4CJPA 4C8KA 3QO9A 1ZBLA 4CFBA 2KW4A 2YNIA 3HPGA 4H4MA 4CEFA 4QAGA 4DQSA 4LSLA 4DSJA 3DOKA 5SWMA 4CJ4A 3AVIA 4CJLA 4FYDA 4CE9A 1UA1A 1NOZA 1KCFA 2GV9A 5KRTA 1ASVA 4CHZA 3BDPA 1QE1A 3LP3A 3O3HA 4GMJB 3S3NA 3K58A 4HCCA 4OLBA 1BCOA 1I39A 3HL8A 3ALYA 4M3RA 3LPTA 2YKNA 4FJMA 3U6FA 2ZE2A 3LWLA 1TKDA 4QCLA 4KO0A 1A5VA 4E7JA 1A5XA 4RW6A 3DRPA 3T1AA 3O4NA 4JLHA 3DLGA 4CF0A 3P83D 5J1EA 1TAQA 3NH1A 2KFNA 4B9UA 3CFRA 4DG1A 2G8VA 1BIZA 5DMRA 3OYCA 1JLQA 3VN5A 1RDCA 1T03A 1U48A 2HVHA 4EP5A 1QS4A 3V9WA 4M3TA 3MEDA 3CM6A 5KTQA 4BE0A 3ZT4A 3ZSXA 4ZTFA 4NCBA 4KREA 3HT3A 4IG0A 4CGHA 4BWMA 1S6PA 3T19A 3CFPA 5KGXA 1S1UA 3VQPA 4AHRA 4B3OA 1U47A 3I8DA 3AVNA 2FC0A 3QIOA 1KFSA 3PX0A 3P5JA 4C8NA 3HSTB 4CFAA 2DY4A 1RTHA 3JYTA 3S9HA 5CY4A 3LANA 3JSMA 4DQIA 4IFVA 1L3UA 2OPPA 3NHGA 3DRSA 1JLBA 2IAJA 3KKRA 4KTWA 1VSDA 1NK7A 3VQ6A 1L3VA 3SUNA 4KRFA 4ID1A 5J2MA 1CZ9A 3MXMA 4NYNA 2KQ2A 3IS9A 2HHUA 3TANA 1S6QA 3H08A 5KGWA 4CEEA 5I3UA 4CGIA 3G10A 2ZD1A 1XC9A 5FDLA 1WSJA 1BGXT 4G1QA 3TAFA 3QINA 3KTQA 2P1JA 3AVJA 2OPQA 3DMJA 4CECA 4HUEA 3AVBA 4FZYA 1YTUA 2E6MA 3AA4A 1RTDA 1CZBA 1KTQA 1RNHA 3HPHA 3QEWA 4KFBA 1S1TA 3K5LA 2XY6A 4FZZA 4Z4GA 4YFUA 4PQUA 4ID5A 4FJ8A 2P5OA 4M3WA 3VQ9A 4N47A 2HHQA 1WSIA 3CFOA 3DRRA 1IG9A 4DSKA 1J54A 2Z1HA 3NF8A 1ZBHA 4TSXA 3WNGA 3TAGA 1BISA 4DQPA 1LV5A 3LAMA 1SL2A 4IBNA 4CFCA 1U45A 2P5GA 4R5PA 4CF1A 3K5NA 2FBXA 3LP2A 3V81A 3M8SA 1LAWA 2YHAA 1ZBFA 2ETJA 1SL0A 4J2EA 1TAUA 4KHSA 1LAVA 4ZHRA 3PUFA 2GUIA 2DFHA 1WAJA 1KVAA 1RDBA 1NK4A 4J2DA 1RBTA 4FZXC 1VSIA 1JLCA 1RT3A 3LAKA 1TK5A 2RPIA 3KLGA 4Q5VA 4OJRA 4ELTA 4PWDA 1IKVA 3T3FA 4KAZA 4I7FA 3O3FA 2R7YA 3MEGA 3SUOA 3G0ZA 1NK6A 4M3ZA 2X6SA 3VQ8A 1SV5A 4FLTA 3OVNA 2HNZA 4I2QA 4Z0UA 1RT7A 4AHUA 3OYKA 1D9FA 1QQCA 2BE2A 4FJNA 1RT6A 4FJ5A 4CJVA 4AHTA 4CESA 4IKFA 4KTQA 4DTOA 4C8MA 3HXMA 3AVFA 3SNNA 2OZSA 4FJJA 2IGIA 2HHVA 3DLHA 2PYJA 2EHGA 1QSSA 4CHQA 1IO2A 3DOLA 3A2FA 2D0AA 3RMCA 3B6OA 4DTXA 2G8UA 3K59A 4JS4A 4HUFA 4RW4A 4KB0A 3OYAA 2Q3SA 3VQ7A 3SCXA 1N5YA 4BDZA 2XO7A 2IDOA 4CJFA 4FM2A 4EZ6A 3AVHA 3SUPA 1L3SA 4LH5A 4CJSA 3MXIA 2QKBA 4RG8A 1RT4A 4CEZA 4W5OA 3OYNA 3KD5E 5CZ1A 3O4QA 1JL1A 3NAEA 1X9SA 2VG6A 4Z4IA 3K57A 3I0SA 4OKEA 3QEPA 3QEVA 3TAEA 4ELVA 4E0DA 4CJRA 2HVIA 3AVMA 3DLBA 3DYAA 3AO3A 3M8PA 3RRGA 4DTSA 3WNFA 4NCAA 1ASUA 4FM0A 5KI6A 1VSMA 1LW2A 1T8EA 1QSYA 1X9WA 4F2SA 3HK2A 3NGZA 3V1QA
chains in the Genus database with same CATH superfamily
3I56N 2QWNA 4CHYA 1B92A 4EZ9A 4HHTA 3GDQA 1ASWA 4E89A 4PUOA 2QWLA 4BRQA 1E4GT 3VETA 4DS5A 1C1CA 4DFPA 2G8IA 2O4GA 3PO4A 3T69A 1X9MA 1NBWA 4FLVA 1NKEA 4WF9L 5CYQA 1OVQA 4FPAA 1NU0A 1VSKA 3FZKA 4CD3A 2BDPA 5FROA 2D0PA 3SI6A 1TK8A 4B9QA 3U9ZA 4E3SA 2CH5A 3CJAA 3CCLN 3CI5A 1RT2A 1TKTA 3SAFA 2A1RA 5AQQA 2ZJRL 2IS3A 2HBMA 4W5NA 1EETA 3QESA 1RT1A 1FKOA 2NRVA 1RBUA 3OYBA 4M7XA 4CBUA 5I42A 4NXMK 2HBJA 3ZEUB 1N6QA 1LWFA 2E1YA 3TPQA 4L8RB 3L2QA 2Q1NA 4GNIA 3QIPA 3RVCA 5JLHA 1UAXA 5E41A 2P9KA 3PIPL 3NH2A 4M45A 4A57A 3AO2A 5GAHP 3CYMA 4O0JA 3E01A 4IFYA 3ZSZA 1Z26A 5LY3A 4FW1A 3DXKA 3A5OC 5E84A 4DU3A 1WN7A 2XY5A 3SBTA 1ATSA 2IOCA 3KHYA 3QDKA 3V6DA 3DXKB 4C1NI 1R59O 1SL1A 2NRWA 4DU4A 1TL1A 1S3XA 1X3NA 4AILC 1VQPN 1KRPA 3CCEN 2Q0RA 1BI4A 4WCEL 1VQ8N 3CJ9A 1NK5A 1VSFA 1HYZA 1UA0A 2YHXA 1X1PA 1T7PA 5FRMA 4JI5K 3K0SA 1ZYQA 3RR7A 4IDHA 1A5WA 2O8FB 1HNIA 4FWLA 3M6GA 4DQRA 1VQ5N 4EHTA 3V1RA 4CZGA 3DXMB 2HOEA 1GOAA 1ATNA 2WONA 3PIOL 2HHSA 3NGIA 4FO0A 4IWVA 2W6KA 4JKFA 4AHCA 1VSLA 4O8KA 4DTPA 1OH8A 1QHTA 3CCSN 1EXQA 2DTUA 1SUQA 1WSGA 3HI0A 1HPMA 4BR5A 3TTFA 4FWKA 4OGCA 4DR5K 4CW7B 3ITHA 2CGJA 2XRIA 3I8BA 4CFDA 3SQ2A 3L2UA 1EWQA 1LWEA 4Y1DA 4CHOA 4OX9K 2BUPA 5GIPA 3SQ0A 3UIQA 5HP1A 4CEAA 4JK8A 1OH5A 4CJQA 4IEIA 4FJ9A 2Z1IA 3THWB 2F9WA 4CGGA 1RDWX 1YVUA 4I2PA 3LDQA 1KAYA 3ZYYX 3HZ6A 1S9EA 3OYEA 1J5OA 5C24A 1T6DA 4K41A 4RW7A 2NRHA 3ASMA 5BR9A 3ZETB 4MDBA 3KKSA 4DV7K 4BRNA 5AQNA 2HB5A 2HBKA 1IKWA 1V4TA 2D0CA 2E6LA 1LWCA 1X9WA 3THVA 1YVNA 3KWIA 3AO1A 1RBVA 4KKOA 1JJ2M 4JI6K 3AGRA 4JI3K 4LD0A 2YNHA 4MO5A 4I6MA 3OYIA 2ASOA 4BC3A 2Z1JA 2F8TA 3ENBA 4B1WB 5C2DA 5C2FA 2FF6A 1B9FA 2QM1A 3O8MA 4H5VA 3VQDA 2ZM6K 3OJSA 4E1NA 3VF6A 4Z4HA 4DSLA 4LFBK 3EKSA 3VOVA 4OGEA 1S22A 1XQSC 3TSUA 1FXXA 1YF5L 3RMDA 4DLEA 3SYZA 4FLXA 1Y97A 4LC9B 3KVGA 4Y0WA 3VQ4A 1NKCA 4Z4FA 4B1UB 3AVKA 1EX4A 2RN2A 2YHBA 1U2VA 2AA4A 4DMNA 3VQQA 3AVCA 1SKWA 3SPZA 4WE1A 1OH7A 3FLCO 3FFIA 3ZSWA 3VQCA 1EO1A 1U4BA 1Q9YA 1C0GA 3CIPA 3CERA 2ZGYA 4BR2A 3CMAN 4PL8A 4JKCA 1XHZA 3R8EA 5JVGL 3ZX3A 1SQKA 1NGIA 3W3DA 4LF6K 3P31A 5I9EB 1TUYA 4BREA 5FPNA 3DOKA 4CE9A 2QW9A 1NOZA 3QICA 1UA1A 1DEJA 1ASVA 3LP3A 4FJMA 3ALYA 3UB5A 4E7JA 3J7AP 3IKMA 3P83D 1ZC6A 5AZIB 5TKWA 3WQUA 1U6ZA 2G8VA 4B3SK 1IBKK 1RDCA 2UU9K 3B8AX 5GADP 3QMLA 3SBGA 2I7NA 3FGUA 4BE0A 3ATVA 3HT3A 1S6PA 5HOOA 3I8DA 3QIOA 3CPWM 2IVOA 4C8NA 4H0YB 4U7BA 5CY4A 3LANA 3TTDA 3JSMA 1VQKN 1ATRA 1TYQB 3NHGA 5KQ8A 4KTWA 2ZGZA 3OBYA 2O8BA 4BVOA 1E3MA 2HHUA 3TANA 2O8CB 4CGIA 1GLFO 5FDLA 3TSQA 1BGXT 3KTQA 3NVMA 2OPQA 4CECA 3AVBA 3AA4A 1RTDA 1CZBA 3R6MA 4ID5A 1GLJO 3H1QA 4FJ8A 1WSIA 3CFOA 2P9KB 1IG9A 4DSKA 4PKGA 1Z05A 3H6EA 1NMNA 4TSXA 3U8XA 1WBDA 3TAGA 2ZJPL 1LV5A 5EOYA 1YITN 3VESA 4CFCA 2P5GA 2P9NA 5AQKA 3LP2A 4DR7K 3V81A 3M8SA 2YHAA 5ADXH 2ZJQL 1LAVA 3WXJA 1WAJA 3HOSA 3LDLA 2WUSA 4JHDB 4CJ7A 1K8KB 4V19S 4OJRA 1IG8A 3O3FA 2UYTA 3PLAA 3MEGA 3SUOA 4X65K 2WTUA 2CGKA 4M3ZA 3VQ8A 4AHUA 3OYKA 4FJNA 1D9FA 4PHTX 4KTQA 4C8MA 2IGIA 4BGBA 2D1KA 1QSSA 4CHQA 3DOLA 3RMCA 3JAMO 4IO8A 3O9TA 4HUFA 3OYAA 3P4IA 3G6EN 2XO7A 2IDOA 4CJFA 4EIAA 3VEWA 3LDPA 3SUPA 1L3SA 4RG8A 1YXQA 5GAGP 3I0SA 1QQNA 4YOUA 3TAEA 4ELVA 2HVIA 4CJRA 3AVMA 3RRGA 1BG3A 3IDHA 1VSMA 3VTHA 1LW2A 1QSYA 4H5RA 2O8FA 3HK2A 3NGZA 3D0PA 3PO5A 5DK5A 4BC5A 2X6NA 4CZFA 4QS8A 2XY7A 1I94K 4BY9C 1CLQA 1S9GA 4CK1A 5CHIA 2W42A 4M42A 4O55A 4FPBA 3LM9A 4O5BA 3QEXA 3OTOK 1WNSA 1RGIA 3EO3A 4KH4A 2ATQA 1YJ9N 1XHXA 5BN8A 1IKXA 4H0XB 4HWIA 2QWMA 1ZBSA 4KHNA 1U04A 3KJVA 4LFCK 1TYQA 1ILYA 1NGEA 4NYFA 4E1MA 2RF2A 1YT3A 3QERA 4F4KA 4FK0A 2JGUA 5BRFA 4JRPA 4B1ZA 3RWUA 5EU7A 2QXFA 3NF6A 1GOCA 3HVTA 4DTUA 4RW8A 1YIJN 1Q82O 1JL2A 2Z1GA 1L3TA 4FK4A 3BF3A 2DFFA 1HPZA 2KZMA 4LF5K 3AVGA 2VGNA 3FE1A 3R9PA 5KRSA 3CQ8A 4PKIA 1JLFA 3ZT2A 1S1WA 1S1XA 5EXWA 3KLHA 5C42A 2IIRA 1NJWA 3H46O 3CJCA 3SMSA 3CC7N 4CJ5A 3MN9A 3CCQN 3BGRA 4E7LA 4JI1K 1N8RO 3NE6A 3NDKA 5AJ3K 1QZ5A 2WBNA 3S41A 2E2OA 3VPZA 4JRQA 2KZZA 4AQYK 4M63C 4FLWA 3LZJA 4GW6A 4CIEA 4B9SA 1NGFA 1RTJA 2DPNA 2WFBA 3HYFA 4CJUA 5F1XA 3M1FA 1TKZA 4YHHK 1TUUA 2B5JA 4ISFA 4YOVA 3KK1A 2A40A 4F8RA 4BRIA 2HHHK 3MN5A 3JXUA 4KHUA 4HTUA 2VG5A 3TAPA 1J5EK 2O8DB 4CF9A 4AH9A 2F7TA 1REVA 4FWSA 4KTZA 3SLCA 4FWRA 2ZQBA 2F96A 3OYGA 3RRHA 1SAZA 5D3GA 3ZT3A 3SJHA 4DF4A 3OS0A 3AA5X 3NF9A 4JI4K 3QFPA 5BPLA 4CJWA 4JEPA 4YY3K 4BACA 3RMBA 3V9ZA 1NJIO 4W5TA 3TWHA 3NCIA 2V52B 3V1OA 4BGAA 5GINA 2OTLN 4KH5A 2JWLA 4KH6A 3HSCA 3SMPA 3PX6A 4CZJA 5AZJB 1NJZA 5AQFA 3PX4A 4NLCA 5BPMA 1F21A 3WEEB 3ZETA 2RKIA 5HL7L 4CZEA 2E1ZA 3SQ1A 3OBWA 1HKGA 2P9PA 3CCMN 4OPAA 3HP6A 2XHBA 3U4LA 3BEXA 3DI6A 3KLIA 1KLNA 4B9NA 2D0OA 4FW2A 3P38A 3GE1A 3AO5A 4CIGA 1M90O 3ZLJA 1NGGA 2RE2A 1KD1O 5AQLA 5J2NA 4DTNA 4M3UA 1G15A 4E19A 1WBBA 3NBPA 4IG3A 2HBLA 4H0VB 1NG9A 5AQUA 2FSJA 3VGMA 2GBZA 4A2BA 4OPJA 1QVFM 3MK6A 1Q8IA 4DFJA 4PY5A 3LDSA 4JN4A 3NF7A 2QWOA 5H1SQ 3O4WA 4IDKA 1BQNA 5DM7L 2OA8A 4B3RK 4CGDA 2QWPA 3CXCM 2OPRA 1KSPA 2NRRA 3AVAA 5AQRA 3CG7A 3IRXA 4DS4A 3MEEA 2ITGA 3CQYA 4NCGA 5AQVA 1IH7A 4IFEA 2PFUA 1QSLA 4EAHD 4DV1K 1K9MO 3SJJA 1MA9B 3MAQA 3AO4A 3A5NC 4IXCA 3SAGA 4DSEA 3I33A 3D2FB 4MLHA 3SK3A 3ID6A 3DAWA 1W0HA 3NGYA 3CC2N 3ULDA 1DTQA 2B4JA 2Y1IA 4L3QA 4YDUC 2A5XA 3OJUA 4W5QA 4PA1A 4LF9K 3WNEA 3DJCA 5AFUA 1MU2A 5CR4A 4N56A 4LF4K 2JLEA 4FWPA 3MXJA 3CD6N 1K6YA 1NGDA 3SUQA 4DFMA 4BE2A 5JS1A 3L3VA 4CEOA 1WLJA 1SKSA 3VTIA 4WQ5A 5BPNA 3KLEA 5MLCQ 4GV6A 2O8EA 3ISNC 5C15A 4LY7A 5BREA 1WUAA 5LMNK 2QEXN 1J9AA 4QS9A 1Y64A 3C94A 4OKJA 1DLOA 1JXBA 1XI1A 3L3UA 2NZTA 2PY5A 2VG7A 4O4GA 1VQMN 3VEOA 2BH1A 2NUBA 5CYMA 1J6ZA 4K8ZA 1T3VA 1TKXA 4FLYA 3FZFA 3SZ2A 2E8AA 4BRDA 5EVZA 3L2VA 3SQ4A 1O1WA 2VWJA 5FRNA 2LSNA 1KAZA 2GELA 1JKHA 1V4SA 4BQZA 2O4IA 1EKEA 3CC4N 3K2PA 1ZBIA 4LF7K 5HROA 1OKJA 3TR8A 4Z4CA 4FJHA 4I6MB 3DLRA 5F2RA 1TL3A 2FSNA 2VWKA 1X3MA 4CGFA 2H3GX 4CJPA 4CFBA 2YNIA 4DCHA 4JKHA 4IJNA 4FOEA 2GV9A 2E5LK 3BDPA 1JCGA 4YORA 3K9JA 4HCCA 4OLBA 1I39A 1YI2N 3LPTA 5LMUK 3U6FA 1TKDA 4QCLA 1A5XA 4RW6A 3DRPA 4JLHA 3DLGA 4AF1A 5J1EA 1TAQA 2KFNA 4B9UA 3BP8A 3BY5A 3CJ7A 5AFUH 1JLQA 5DM6L 4EP5A 3M3ZA 2W40A 4YOTA 4M3TA 5KTQA 3ZT4A 3ZSXA 1NGHA 2ASMA 4PL7A 4BRHA 2P9NB 1MWMA 5AQXA 4CGHA 1S1UA 4ISGA 2FC0A 1MDUB 3HSTB 2HMPA 4YOYA 3JYTA 5FLXO 4DQIA 2KLAA 1L3UA 3L6QA 2OPPA 1JLBA 2IAJA 4JI0K 3IMXA 1VSDA 4KRFA 3HOTA 4ID1A 2Q36A 4A5BA 4NYNA 2W6LA 3IS9A 3AAPA 4CEEA 3E9PA 2YHYA 5I3UA 2ZD1A 4JI8K 3TAFA 3MCPA 3DMJA 4JYAK 2E6MA 4JKDA 4KFBA 4GV3A 3K5LA 4Z4GA 2XY6A 2VQFK 4M3WA 3VGLA 4N47A 2UUCK 4H0OA 4BRAA 4DUZK 3WNGA 5F0XA 4DQPA 4OO1J 3LAMA 4X64K 1U45A 1U2VB 5LJWA 4DV6K 4K42A 4R5PA 1GLAG 3VEXA 3K5NA 4JI7K 1GLCG 4J2EA 3VERA 3WT0A 4KHSA 3LDNA 5M1KA 2DFHA 2UXDK 3I55N 5AR0A 3M5RA 4FZXC 1TK5A 4PWDA 4Q5VA 1IKVA 1Z6RA 3T3FA 3SAHA 4BR7A 2R7YA 5AQTA 2X6SA 4WQ4C 1RT7A 4FJ5A 4JV5K 5M1NA 4FJJA 4NB4A 2OZSA 2HHVA 2EHGA 1IO2A 4DTXA 2YHWA 1SZ2A 4JS4A 3SCXA 2Q3SA 4EHUA 4FM2A 4EZ6A 4RCHA 1VQNN 3DXMA 4CJSA 4CEZA 4DR1K 4R79A 4WQ5C 3O4QA 1JL1A 5KPZA 2I7PA 3NAEA 4XH5A 3WXLA 3QEPA 3OW2M 3QEVA 4E0DA 3C7NA 3DYAA 4NCAA 3ID8A 2E88A 4FM0A 4A2AA 3V1QA 4ISEA 4CJ4A 1HUXA 1KQSM 4H4OA 4B3TK 1E4FT 1JCEA 2D0BA 4XH4A 3WUHA 2WOMA 3QBWA 4DUYK 1QVGM 4ILJA 3THXA 3R3LA 2E4LA 1D9DA 1RBRA 4RW9A 3AARA 5GIOA 3AA2A 3C95A 4DQ8A 4B9LA 3V9SA 1BWFO 3K5OA 3THXB 1LW0A 1VHXA 3EY1A 4C8LA 1QTMA 4H5NA 5E26A 2QI2A 2GX9A 2G8WA 5AQJA 4CJ3A 2F8SA 3MN7A 4DB3A 5HRSA 3U9DA 4ILHA 4I9LA 3CM5A 1EQYA 4DV0K 4NCBA 2A3ZA 4C8OA 2ASPA 2KHOA 1P8ZA 4M3YA 4QS7A 3AA3A 5C12A 1XWLA 2HHWA 3LWMA 5AQPA 3CCVN 4BRFA 1EP4A 1NNEA 2FLOA 3RSEA 4RWTA 1NK0A 3ZEUA 4CK2A 3QEIA 4FJXA 4DR6K 4FVMA 3THWA 3AGKA 3O3GA 3QETA 2J4RA 2GUPA 5K14A 4GKKK 4BRPA 1DT9A 4BROA 2P9IA 3QNOA 4BC4A 3QB0A 4HUGA 1K8KA 4CZHA 1NJXA 4JHDA 3NH0A 2HNDA 4H0PA 2P9UA 4WFAL 1GLEG 4YOXA 3CJ1A 4NO7A 3SPYA 3MX5A 4CCHA 3TU5A 1ESVA 1WSHA 4KHQA 1GLBG 4JKBA 3WEEA 3MWPA 1S1VA 1KVCA 3PV8A 3TABA 2B6AA 4CD1A 3A8YA 3CF5L 1XNRK 5GAEP 3QLHA 3FR0A 4BRGA 1HLUA 1KFDA 3RTVA 4B1YB 3EL2A 3ZSOA 4K25A 3ZT1A 4ELUA 2QA4N 4FXDA 1T05A 4YNQA 2HNYA 2OPSA 3ZT0A 1R0AA 5HRNA 2O8EB 1ITGA 3ZSYA 1YJNN 2PBDA 3KIOA 1YJWN 4IOXA 1IV0A 5EY4A 1Z25A 3K9KA 4CBWA 3HVRA 3UKUA 1UWBA 3EN9A 3QNNA 3LL3A 5JVHL 2BANA 4E7IA 1C0TA 2P9SA 4MLEA 1T44A 3B6PA 4OPKA 3VQAA 4F3TA 1WOQA 1JLEA 3VEVA 5AQGA 3T7ZA 4CHPA 2O8BB 3ZX0A 4FJ7A 4DF8A 3LM2A 4MDAA 2Q31A 4FOIA 1QQMA 4BWJA 4O5FA 5JMVA 1JLAA 1C0UA 4CF2A 4DTJA 2EWSA 3O1WA 1CXUA 4FJLA 4FLUA 4GV9A 1TV6A 5AQZA 4A59A 5C0YA 1D5AA 3N4PA 4CIFA 1VQON 5ADXA 3Q7CA 1P90A 4YDUA 3PY8A 4N41A 3LP0A 4BR4A 3C7NB 4O0IA 3ZSRA 2CGLA 1T6CA 2W41A 1M1KO 4JS5A 2NLXA 5HLFA 3TAMA 2FBYA 1ZXOA 3ZSVA 1Q7YO 3MMVA 3M8QA 4JKAA 3P1GA 1DKGD 1HJRA 4B9VA 4X66K 2I5JA 2OYQA 4MFBA 4FLZA 3KLFA 4BQLA 3OYDA 3V4IA 3VF2A 4CI6A 5AQHA 3VEYA 3HM9A 1RBSA 4LH4A 1UOCA 1RT5A 1WB9A 4Q0BA 3S3MA 3V9XA 2Q97A 4FL9A 3TSPA 3CETA 3RMAA 4DWIA 3BUZB 3CMEN 1ZBUA 1VQ7N 4B9MA 4XEIA 3KWGA 4FJKA 2X78A 4CK3A 4NLBA 2PAVA 4LSNA 3G25A 4HCBA 1HYSA 3FZHA 1HQEA 4JKEA 4EP4A 4GVMA 5KPTA 5HBMA 4X62K 1TK0A 3ZSQA 2OCEA 4YOWA 4CJKA 3BF1A 4B8CA 1BHLA 3A5LC 4DV5K 1OH6A 2V7ZA 4CEQA 1BQMA 4I9QA 3HM8A 2E2NA 1NGCA 2RHKA 3VQEA 2UXBK 3RR8A 2Y1JA 4DSIA 4B08A 2ITMA 5C25A 4KB1A 3C6UA 4XIUA 3S3OA 3KK7A 3T1HK 4K43A 3L2RA 4HVJA 3CCJN 2YNFA 4QOZB 3HP9A 4B9TA 5C10A 3DLEA 2VGMA 1BCMA 4WQ4A 4Z4EA 1XUPO 3VQBA 5HRPA 2YV0X 3SV3A 2OZMA 1RCHA 4BC2A 3A0IX 3EZWA 3OY9A 2YI1A 1HYVA 2JWKA 3D2EB 1H1VA 3VA0A 3E1YA 2EX3A 4EFHA 4E7HA 4UY8O 1RDDA 5KPRA 1HKCA 1C1BA 3QO9A 1HJOA 1O13A 1BA1A 4LSLA 1SS6A 4FSVA 4CJLA 5KRTA 1KCFA 3KZBA 4CHZA 3ULEB 3O3HA 4KHPK 3CQXA 3S3NA 4OPHA 4DR2K 1BCOA 3HL8A 4M3RA 4IOCL 3BZKA 5FPDA 4IZ9A 1GLLO 3CFRA 4DG1A 3UKRA 5DMRA 2NNWA 1GLDG 3OYCA 3VN5A 5AQWA 1T03A 1W7AA 4PKHA 1QS4A 3V9WA 1IBLK 2VYPA 4KREA 3O08A 5AZJA 4IG0A 4DHYA 3CFPA 4AHRA 3QBXA 2YJEA 1KFSA 4WFBL 3O9RA 1NGAA 1K73O 5M1OA 2DY4A 1RTHA 1QHAA 4M7YA 3S9HA 4FWQA 1N32K 4IFVA 1IJJA 1VQ6N 3KKRA 2P9IB 1NK7A 2Q0UA 1L3VA 5JICA 1CZAN 2KQ2A 3O9QA 1S6QA 3H08A 4H03B 4JNEA 2D4WA 3AVJA 3EE9A 2O8DA 3D2EA 1YTUA 4BRKA 1NM1A 3VENA 1RNHA 3QEWA 1S1TA 4PQUA 4BRCA 2HHQA 3DRRA 4JD2B 1ZBHA 3C65A 3AY9A 4CF1A 3F2KA 2FBXA 2UXCK 3D6RA 3VMFB 1LAWA 1SL0A 3CCRN 1QQOA 1W2BM 3ATUA 1FW6A 3GOIA 1KVAA 4J2DA 1RBTA 1JLCA 1RT3A 3LAKA 3KLGA 1JCFA 4H5WA 1NK6A 5BN9A 1SV5A 3OVNA 2HNZA 1EWRA 4I2QA 4Z0UA 2BE2A 3HRGA 4AHTA 4CESA 1S72N 5BRDA 4IOAL 3P39A 4DTOA 3SNNA 3HXMA 3AVFA 1RFQA 2QTDA 4BRLA 3A2FA 2D0AA 4LF8K 3K59A 4FWMA 5FPEA 1YUWA 1Q86O 1N5YA 3AVHA 1XMOK 4LH5A 2F9TA 2GWJA 3A5MC 1X9SA 3ULEA 4JD2A 5LJVA 4DTSA 1ASUA 3OYNA 4IJAA 4HTLA 1VSHA 1RTIA 2G8KA 2QWQA 3JS6A 1KVBA 2E2QA 2A42A 3SV4A 4GKJK 1NWKA 4DQQA 4GVEA 5T7BA 4XH1A 4CGJA 4OKKA 2KKZA 1HNXK 2A6AA 3OHRA 1C0FA 5CZ2A 3UKUB 2AJQA 4C1NK 3F9MA 3OYJA 3C6HA 1NGBA 2YNGA 3TI0A 1X9JA 5JS2A 1VK0A 4KI6A 2NRZA 3TAQA 5BR8K 3VEZA 4CERA 3J7YP 3MCAB 3DLKA 5CE3A 1YTAA 4AHVA 2FSKA 1C6VA 2XY8A 1FK9A 3MDQA 4F2RA 3J7ZO 2HHXA 3AVLA 4CJTA 2YX6A 4KPYA 1WSEA 1HNVA 1U49A 2UUBK 4CZMA 2E2PA 4MQ3A 3IG1A 1J53A 2VQEK 4B3MK 1C1AA 3O1BA 3LPUA 3D45A 1VSEA 4DV4K 3EEQA 4A5AA 1BL3A 1LOTB 1WSFA 1OVYA 1NK8A 5BRHA 4O44A 4FM1A 3VA3A 3F5TA 4N76A 1IBMK 5IWAK 4BR9A 3KK2A 3V9UA 1FKPA 2V7YA 1S5JA 1TGOA 3U3YA 3D2FA 3R1XA 2G8FA 5KQDA 2PYLA 4J2AA 4BE1A 3DLLL 3BZCA 1IKYA 1Q9XA 4FK2A 1JXEA 4CF8A 3TARA 3CCUN 4DLGA 2DFEA 3WXMB 1HRHA 1VQLN 4B8AB 5IT9O 3C6TA 3VQ5A 3G71N 4DSFA 1VRTA 3RSEB 2HHTA 2YJFA 2D5RA 1QZ6A 4ZTJA 4OLAA 3EZ5A 5AQSA 4C23A 4BDPA 3WNHA 1SKRA 3L8BA 3M8RA 4UQGA 1FJGK 3ENOA 4ILGB 3OA9A 4FCYA 2NRXA 3ENHA 4BR0A 1VQ4N 4JKGA 2FBVA 4KI4A 4U67L 2HMIA 3KD1E 1XNQK 1CXQA 1WAFA 1HMVA 4DTMA 1NGJA 2P9PB 1RDUA 3NFAA 3E66A 5AQYA 4BRMA 4FWOA 4G9ZA 3H1VX 4BG9A 2IC3A 1LCUA 3TTCA 1GOBA 3HTVA 1KLMA 4CBXA 1HQUA 3IUCA 5FPMA 4CVNE 2FF3B 1DTTA 2V51B 4ICLA 4FJIA 3U3GA 2IVNA 1BOTO 3VGKA 4DKWA 5AZIA 4J2BA 4E7KA 3H3NO 1BA0A 1HKBA 2QKKA 3F9KA 1NKBA 4W5RA 1I3AA 4H5TA 1YAGA 1HX1A 4AM6A 4OVLA 3K5MA 1RILA 1VSJA 3EYZA 4H8KA 2WC9A 2A41A 1L5UA 3HO1A 5LL6Z 1C0MA 3HPOA 2KTQA 1BIUA 2HSTA 3PSFA 3NVKA 3O6WA 3HJFA 1MWKA 2KFZA 2AP1A 3VF4A 4AHSA 2G8HA 4E1JA 5J2QA 3OYLA 1JLGA 1TVRA 2P9LA 3DM2A 4KV8A 3L2WA 3G4SN 4F3OA 3MWTA 1BUPA 3HBTA 3OYFA 3EE8A 3THYB 2BGGA 4WFNL 3NMUA 4K0KK 2FXUA 3OYHA 4DTRA 1RDAA 3IAYA 3L4IA 1B9DA 3WXKA 4DFKA 3QFUA 1BI4B 4O8UA 3J8AA 4BDYA 4CJEA 2FBTA 5HRRA 3UE5A 2E20A 4CZIA 4Y1CA 3F73A 4FJGA 1XMQK 3IFRA 3OYMA 3ZCMA 2F4VK 3FZLA 3LP1A 4F9OA 3OS2A 3WQTA 2VWBA 1VRUA 1W97L 4KHYA 3EKUA 4BVPA 4GY2B 4JK7A 3MECA 5JLFA 2O8CA 5ELZA 1HNZK 3C6AA 4K8XA 2HF4A 3OS1A 3E9OA 1G99A 1NK9A 3O9SA 4DU1A 2PZSA 1NJYA 1D8YA 1W9HA 2P51A 2HF3A 2QK9A 3ZX2A 3KK3A 4JKGB 3LALA 2X74A 1YHQN 3I0RA 4M41A 1NMDA 3GBTA 4B1VA 4N5SA 4LFAK 2GTDA 4CZLA 2YCHA 3T1YK 2QXLA 2HW3A 4M3XA 2P9UB 4CEDA 3PSIA 5J2PA 1HNWK 2Q2RA 3Q7BA 2P9LB 4DV2K 2A1SA 4JK9A 1NOYA 1BDGA 3N4QA 3AAQA 4CEBA 3W0LA 5SZTA 3LZIA 2NRTA 4WYBA 4CHNA 3AV9A 2YKMA 4C8KA 2CH6A 1ZBLA 2KW4A 5A2QO 3HPGA 4H4MA 4CEFA 3J80O 4QAGA 4DQSA 3GG4A 4BG8A 4DSJA 5SWMA 1VQ9N 3AVIA 1N33K 4FYDA 2GWKA 3O9UA 2ZF5O 1QE1A 4GMJB 1BU6O 1BO5O 3K58A 2YKNA 4MO4A 1Q18A 2ZE2A 3LWLA 4KO0A 1A5VA 3MN6A 3T1AA 5EX5A 3O4NA 4CF0A 2QWRA 3GL1A 3NH1A 5AQMA 1BIZA 4CZKA 4KBOA 2HVHA 1U48A 1N36K 3L0QA 3MEDA 3CM6A 4ZTFA 4BWMA 3T19A 5KGXA 3VQPA 4B3OA 1U47A 3AVNA 4B1XB 1D4XA 3PX0A 3FZMA 3P5JA 4CFAA 3CJBA 2BTFA 3WXIA 3DRSA 3FFKB 3VQ6A 4IO9L 3SUNA 5M1QA 2VCPA 5J2MA 1CZ9A 3MXMA 4AM7A 3O80A 1KC8O 3CHWA 5KGWA 3D7EO 1N34K 5AQIA 3G10A 1DGKN 1XC9A 4H0TB 1WSJA 4G1QA 4KHWA 4IEEA 3QINA 2P1JA 4HUEA 2P9SB 1KXPA 4FZYA 2UUAK 1KTQA 3HPHA 5M1FA 4JAXA 4A62A 4FZZA 4YFUA 3L4QA 2P5OA 4DV3K 3VQ9A 1NLVA 4A61A 1J54A 2Z1HA 3NF8A 4J8FA 3CPEA 1BISA 1SL2A 4IBNA 1HR0K 4FWNA 5AQOA 1ZBFA 2ETJA 3LDOA 1TAUA 3E9LA 3O5BA 3PUFA 2OANA 4ZHRA 2GUIA 5M1PA 1RDBA 1NK4A 1VSIA 5B8HA 2RPIA 4ELTA 3H3OB 3J81O 3UKRB 4KAZA 4I7FA 2IVPA 3G0ZA 4NXNK 4FLTA 1QQCA 1RT6A 1VAZA 4CJVA 4Z94A 4IKFA 2ZWHA 3DLHA 2PYJA 5TKYA 3DWLA 2G8UA 3B6OA 4RW4A 4KB0A 3VQ7A 4FVUA 4DR4K 2GEMA 4BDZA 1KAXA 3H45C 3MXIA 2QKBA 1RT4A 3KD5E 4W5OA 1XC3A 5CZ1A 2OTJN 4Z4IA 2VG6A 3MX2A 3K57A 1K8AO 4OKEA 4DR3K 1Q81O 3THYA 3DLBA 3AO3A 3M8PA 3WNFA 3C0BA 5KI6A 4F2SA 4RTFD 1T8EA 4JI2K
chains in the Genus database with same CATH topology
3PO5A 5DK5A 2X6NA 4CHYA 1B92A 2XY7A 4EZ9A 1VSHA 4HHTA 4H4OA 1CLQA 1S9GA 4CK1A 1RTIA 2G8KA 1ASWA 2D0BA 2W42A 4E89A 4M42A 2WOMA 4PUOA 4O55A 1KVBA 4O5BA 3SV4A 3QEXA 1WNSA 1C1CA 4DS5A 4DQQA 4DFPA 5T7BA 2E4LA 2O4GA 2G8IA 1D9DA 3PO4A 4CGJA 4OKKA 1X9MA 4FLVA 1NKEA 1RBRA 4RW9A 2ATQA 5CYQA 1VSKA 2BDPA 3AA2A 3C95A 5FROA 3SI6A 5CZ2A 1XHXA 2AJQA 1TK8A 4B9LA 3V9SA 3K5OA 3OYJA 1IKXA 1LW0A 3EY1A 4E3SA 4C8LA 2YNGA 4KHNA 1QTMA 3TI0A 1RT2A 1TKTA 1U04A 3KJVA 5JS2A 2A1RA 1VK0A 4KI6A 2G8WA 2IS3A 4CJ3A 3TAQA 4W5NA 2F8SA 1EETA 3QESA 1RT1A 4NYFA 4E1MA 1FKOA 1YT3A 2RF2A 4CERA 5HRSA 1RBUA 3OYBA 3QERA 4F4KA 4FK0A 2JGUA 4I9LA 4JRPA 3CM5A 3RWUA 3DLKA 5EU7A 2QXFA 1YTAA 3NF6A 1GOCA 5I42A 3HVTA 4AHVA 4DTUA 4C8OA 1N6QA 4RW8A 1LWFA 4M3YA 1C6VA 2XY8A 1JL2A 2Z1GA 1FK9A 3AA3A 1L3TA 1XWLA 4FK4A 2DFFA 1HPZA 4F2RA 4L8RB 2HHWA 3LWMA 2KZMA 3L2QA 3AVGA 1EP4A 3AVLA 3QIPA 1NK0A 2HHXA 1UAXA 4CJTA 5E41A 4CK2A 3QEIA 4FJXA 4KPYA 5KRSA 3NH2A 4M45A 3CQ8A 4FVMA 1WSEA 1HNVA 3AO2A 1U49A 1JLFA 3ZT2A 1S1WA 1S1XA 4MQ3A 3O3GA 3QETA 3KLHA 5C42A 3CYMA 5K14A 1NJWA 3IG1A 1J53A 1C1AA 4O0JA 3E01A 3LPUA 4IFYA 3D45A 4CJ5A 1VSEA 3ZSZA 3QNOA 1BL3A 3BGRA 1Z26A 1WSFA 4E7LA 1NK8A 4HUGA 4FW1A 4O44A 3NE6A 3NDKA 4FM1A 3VA3A 4DU3A 1NJXA 1WN7A 2XY5A 4JRQA 2KZZA 3NH0A 2HNDA 4N76A 4FLWA 3LZJA 2IOCA 3KK2A 3V9UA 1FKPA 4GW6A 4CIEA 3SPYA 1S5JA 3V6DA 4B9SA 4CCHA 1TGOA 3U3YA 1RTJA 2G8FA 1WSHA 2PYLA 4J2AA 1SL1A 4BE1A 4KHQA 3HYFA 4CJUA 4DU4A 1IKYA 1Q9XA 4FK2A 1S1VA 1TL1A 1KVCA 1TKZA 1JXEA 4CF8A 4AILC 3PV8A 3TABA 3TARA 2B6AA 2B5JA 1KRPA 1BI4A 3KK1A 4DLGA 2DFEA 1HRHA 4F8RA 3QLHA 4B8AB 3C6TA 3VQ5A 1NK5A 1VSFA 4KHUA 4DSFA 1VRTA 4KHWA 2HHTA 1KFDA 1HYZA 4HTUA 3RTVA 2D5RA 1UA0A 2VG5A 3TAPA 1X1PA 4ZTJA 1T7PA 5FRMA 3ZSOA 3EZ5A 4OLAA 4CF9A 4AH9A 1ZYQA 4BDPA 1REVA 3WNHA 1SKRA 4KTZA 2ZQBA 3L8BA 3RR7A 2F96A 3ZT1A 3OYGA 3M8RA 3RRHA 4UQGA 5D3GA 4ELUA 3ZT3A 1A5WA 1T05A 1HNIA 4FXDA 4YNQA 2HNYA 3OS0A 4DF4A 3AA5X 3NF9A 4DQRA 4FCYA 4CJWA 2OPSA 4BACA 3ZT0A 1R0AA 3V1RA 3RMBA 2FBVA 3V9ZA 4KI4A 5HRNA 4W5TA 1ITGA 3TWHA 3ZSYA 3NCIA 3V1OA 2HMIA 1GOAA 3KIOA 2WONA 3KD1E 1CXQA 1WAFA 1HMVA 2HHSA 1Z25A 3NGIA 4DTMA 3PX6A 3HVRA 1UWBA 1NJZA 3QNNA 3PX4A 3NFAA 4AHCA 1VSLA 1F21A 4DTPA 1QHTA 3SQ1A 2RKIA 1EXQA 2DTUA 2BANA 1SUQA 4E7IA 1C0TA 2IC3A 1GOBA 1KLMA 1WSGA 1HQUA 3B6PA 3VQAA 4OPKA 3HP6A 1DTTA 4ICLA 2XHBA 4FJIA 3U3GA 3DI6A 4F3TA 4OGCA 1JLEA 3KLIA 4E7KA 1KLNA 4J2BA 4B9NA 3ITHA 4FW2A 2XRIA 4CFDA 4CHPA 2QKKA 3SQ2A 3F9KA 1NKBA 4FJ7A 4W5RA 3L2UA 4DF8A 3AO5A 4CIGA 1LWEA 1I3AA 4Y1DA 4CHOA 4BWJA 3SQ0A 5J2NA 1JLAA 3UIQA 5HP1A 1C0UA 4DTNA 4CF2A 4DTJA 4OVLA 4CEAA 3K5MA 4M3UA 1CXUA 1G15A 1RILA 1VSJA 4E19A 3EYZA 3NBPA 4FLUA 3SQ4A 4IG3A 4H8KA 1TV6A 4FJLA 1L5UA 1D5AA 4CJQA 4CIFA 3HO1A 3D0PA 4FJ9A 3PY8A 4N41A 2Z1IA 2GBZA 3LP0A 1C0MA 3HPOA 4O0IA 3ZSRA 4OPJA 1BIUA 2KTQA 4CGGA 4DFJA 1Q8IA 4PY5A 3LDSA 3NF7A 1YVUA 4JS5A 3HJFA 4I2PA 2KFZA 5HLFA 4IDKA 3TAMA 1BQNA 2FBYA 4AHSA 2G8HA 2OA8A 1S9EA 4CGDA 3OYEA 5J2QA 1J5OA 1KSPA 2OPRA 5C24A 3OYLA 1JLGA 1TVRA 3DM2A 3AVAA 3M8QA 4KV8A 3ZSVA 3CG7A 3IRXA 3L2WA 3P1GA 4DS4A 4RW7A 3MEEA 2ITGA 4F3OA 1HJRA 4B9VA 2I5JA 2OYQA 4NCGA 4MFBA 3ASMA 1IH7A 3OYFA 4FLZA 3KLFA 2BGGA 1QSLA 3KKSA 3OYDA 2HB5A 3OYHA 3MAQA 4DTRA 1RDAA 3AO4A 3V4IA 1IKWA 3SJJA 2D0CA 2E6LA 3HM9A 1LWCA 4DSEA 1RBSA 4LH4A 3IAYA 1UOCA 1B9DA 3THVA 4DFKA 1BI4B 1RT5A 4BDYA 4CJEA 1W0HA 2FBTA 3NGYA 5HRRA 4Q0BA 3S3MA 3ULDA 1DTQA 2B4JA 4Y1CA 3V9XA 3F73A 2Y1IA 4FJGA 3AO1A 3RMAA 4DWIA 3OYMA 3OJUA 4W5QA 3ZCMA 1ZBUA 4B9MA 1RBVA 4PA1A 4FJKA 3LP1A 4KKOA 2X78A 4CK3A 3OS2A 1VRUA 3WNEA 4LSNA 1MU2A 4HCBA 4LD0A 4KHYA 2YNHA 1HYSA 1HQEA 4N56A 3OYIA 2JLEA 2Z1JA 4EP4A 2F8TA 3MXJA 3MECA 1K6YA 4GVMA 3SUQA 4DFMA 4BE2A 1B9FA 5HBMA 4K8XA 3L3VA 3OS1A 1TK0A 1NK9A 5JS1A 3ZSQA 3VQDA 4CEOA 4DU1A 1WLJA 1NJYA 1D8YA 2PZSA 1SKSA 1W9HA 2P51A 4CJKA 4B8CA 1BHLA 4E1NA 3OJSA 3KLEA 4Z4HA 4DSLA 2QK9A 4CEQA 1BQMA 3KK3A 3LALA 2X74A 4I9QA 4OGEA 3ISNC 3VQEA 3RR8A 2Y1JA 4DSIA 4LY7A 3I0RA 4B08A 4M41A 5C25A 1FXXA 1J9AA 3C6UA 4XIUA 3RMDA 4DLEA 4KB1A 3S3OA 3SYZA 3C94A 4FLXA 4OKJA 4N5SA 1Y97A 1DLOA 1JXBA 3L2RA 4HVJA 1XI1A 3L3UA 1NKCA 3VQ4A 2YNFA 4Z4FA 2PY5A 3AVKA 2VG7A 4O4GA 4QOZB 1EX4A 3HP9A 2NUBA 2RN2A 2YHBA 5CYMA 4B9TA 2HW3A 3DLEA 4K8ZA 1TKXA 4FLYA 1BCMA 3SZ2A 4M3XA 4Z4EA 3VQBA 4CEDA 4DMNA 1O1WA 2YV0X 3VQQA 5HRPA 3AVCA 3L2VA 2VWJA 3SV3A 5J2PA 5FRNA 2LSNA 1SKWA 3SPZA 4WE1A 2OZMA 2A1SA 1JKHA 1RCHA 3FFIA 3ZSWA 3VQCA 2O4IA 1EKEA 1U4BA 1NOYA 3K2PA 1Q9YA 1ZBIA 3OY9A 1HYVA 5HROA 3TR8A 4CEBA 4Z4CA 5SZTA 3VA0A 4FJHA 3LZIA 2EX3A 4E7HA 3DLRA 1TL3A 1RDDA 1XHZA 4CHNA 2VWKA 4CGFA 3AV9A 1C1BA 2YKMA 4CJPA 4C8KA 3QO9A 1ZBLA 4CFBA 2KW4A 2YNIA 3HPGA 4H4MA 4CEFA 4QAGA 4DQSA 4LSLA 4DSJA 3DOKA 5SWMA 4CJ4A 3AVIA 4CJLA 4FYDA 4CE9A 1UA1A 1NOZA 1KCFA 2GV9A 5KRTA 1ASVA 4CHZA 3BDPA 1QE1A 3LP3A 3O3HA 4GMJB 3S3NA 3K58A 4HCCA 4OLBA 1BCOA 1I39A 3HL8A 3ALYA 4M3RA 3LPTA 2YKNA 4FJMA 3U6FA 2ZE2A 3LWLA 1TKDA 4QCLA 4KO0A 1A5VA 4E7JA 1A5XA 4RW6A 3DRPA 3T1AA 3O4NA 4JLHA 3DLGA 4CF0A 3P83D 5J1EA 1TAQA 3NH1A 2KFNA 4B9UA 3CFRA 4DG1A 2G8VA 1BIZA 5DMRA 3OYCA 1JLQA 3VN5A 1RDCA 1T03A 1U48A 2HVHA 4EP5A 1QS4A 3V9WA 4M3TA 3MEDA 3CM6A 5KTQA 4BE0A 3ZT4A 3ZSXA 4ZTFA 4NCBA 4KREA 3HT3A 4IG0A 4CGHA 4BWMA 1S6PA 3T19A 3CFPA 5KGXA 1S1UA 3VQPA 4AHRA 4B3OA 1U47A 3I8DA 3AVNA 2FC0A 3QIOA 1KFSA 3PX0A 3P5JA 4C8NA 3HSTB 4CFAA 2DY4A 1RTHA 3JYTA 3S9HA 5CY4A 3LANA 3JSMA 4DQIA 4IFVA 1L3UA 2OPPA 3NHGA 3DRSA 1JLBA 2IAJA 3KKRA 4KTWA 1VSDA 1NK7A 3VQ6A 1L3VA 3SUNA 4KRFA 4ID1A 5J2MA 1CZ9A 3MXMA 4NYNA 2KQ2A 3IS9A 2HHUA 3TANA 1S6QA 3H08A 5KGWA 4CEEA 5I3UA 4CGIA 3G10A 2ZD1A 1XC9A 5FDLA 1WSJA 1BGXT 4G1QA 3TAFA 3QINA 3KTQA 2P1JA 3AVJA 2OPQA 3DMJA 4CECA 4HUEA 3AVBA 4FZYA 1YTUA 2E6MA 3AA4A 1RTDA 1CZBA 1KTQA 1RNHA 3HPHA 3QEWA 4KFBA 1S1TA 3K5LA 2XY6A 4FZZA 4Z4GA 4YFUA 4PQUA 4ID5A 4FJ8A 2P5OA 4M3WA 3VQ9A 4N47A 2HHQA 1WSIA 3CFOA 3DRRA 1IG9A 4DSKA 1J54A 2Z1HA 3NF8A 1ZBHA 4TSXA 3WNGA 3TAGA 1BISA 4DQPA 1LV5A 3LAMA 1SL2A 4IBNA 4CFCA 1U45A 2P5GA 4R5PA 4CF1A 3K5NA 2FBXA 3LP2A 3V81A 3M8SA 1LAWA 2YHAA 1ZBFA 2ETJA 1SL0A 4J2EA 1TAUA 4KHSA 1LAVA 4ZHRA 3PUFA 2GUIA 2DFHA 1WAJA 1KVAA 1RDBA 1NK4A 4J2DA 1RBTA 4FZXC 1VSIA 1JLCA 1RT3A 3LAKA 1TK5A 2RPIA 3KLGA 4Q5VA 4OJRA 4ELTA 4PWDA 1IKVA 3T3FA 4KAZA 4I7FA 3O3FA 2R7YA 3MEGA 3SUOA 3G0ZA 1NK6A 4M3ZA 2X6SA 3VQ8A 1SV5A 4FLTA 3OVNA 2HNZA 4I2QA 4Z0UA 1RT7A 4AHUA 3OYKA 1D9FA 1QQCA 2BE2A 4FJNA 1RT6A 4FJ5A 4CJVA 4AHTA 4CESA 4IKFA 4KTQA 4DTOA 4C8MA 3HXMA 3AVFA 3SNNA 2OZSA 4FJJA 2IGIA 2HHVA 3DLHA 2PYJA 2EHGA 1QSSA 4CHQA 1IO2A 3DOLA 3A2FA 2D0AA 3RMCA 3B6OA 4DTXA 2G8UA 3K59A 4JS4A 4HUFA 4RW4A 4KB0A 3OYAA 2Q3SA 3VQ7A 3SCXA 1N5YA 4BDZA 2XO7A 2IDOA 4CJFA 4FM2A 4EZ6A 3AVHA 3SUPA 1L3SA 4LH5A 4CJSA 3MXIA 2QKBA 4RG8A 1RT4A 4CEZA 4W5OA 3OYNA 3KD5E 5CZ1A 3O4QA 1JL1A 3NAEA 1X9SA 2VG6A 4Z4IA 3K57A 3I0SA 4OKEA 3QEPA 3QEVA 3TAEA 4ELVA 4E0DA 4CJRA 2HVIA 3AVMA 3DLBA 3DYAA 3AO3A 3M8PA 3RRGA 4DTSA 3WNFA 4NCAA 1ASUA 4FM0A 5KI6A 1VSMA 1LW2A 1T8EA 1QSYA 1X9WA 4F2SA 3HK2A 3NGZA 3V1QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PO5 A;  5DK5 A;  2X6N A;  4CHY A;  1B92 A;  2XY7 A;  4EZ9 A;  1VSH A;  4HHT A;  4H4O A;  1CLQ A;  1S9G A;  4CK1 A;  1RTI A;  2G8K A;  1ASW A;  2D0B A;  2W42 A;  4E89 A;  4M42 A;  2WOM A;  4PUO A;  4O55 A;  1KVB A;  4O5B A;  3SV4 A;  3QEX A;  1WNS A;  1C1C A;  4DS5 A;  4DQQ A;  4DFP A;  5T7B A;  2E4L A;  2O4G A;  2G8I A;  1D9D A;  3PO4 A;  4CGJ A;  4OKK A;  1X9M A;  4FLV A;  1NKE A;  1RBR A;  4RW9 A;  2ATQ A;  5CYQ A;  1VSK A;  2BDP A;  3AA2 A;  3C95 A;  5FRO A;  3SI6 A;  5CZ2 A;  1XHX A;  2AJQ A;  1TK8 A;  4B9L A;  3V9S A;  3K5O A;  3OYJ A;  1IKX A;  1LW0 A;  3EY1 A;  4E3S A;  4C8L A;  2YNG A;  4KHN A;  1QTM A;  3TI0 A;  1RT2 A;  1TKT A;  1U04 A;  3KJV A;  5JS2 A;  2A1R A;  1VK0 A;  4KI6 A;  2G8W A;  2IS3 A;  4CJ3 A;  3TAQ A;  4W5N A;  2F8S A;  1EET A;  3QES A;  1RT1 A;  4NYF A;  4E1M A;  1FKO A;  1YT3 A;  2RF2 A;  4CER A;  5HRS A;  1RBU A;  3OYB A;  3QER A;  4F4K A;  4FK0 A;  2JGU A;  4I9L A;  4JRP A;  3CM5 A;  3RWU A;  3DLK A;  5EU7 A;  2QXF A;  1YTA A;  3NF6 A;  1GOC A;  5I42 A;  3HVT A;  4AHV A;  4DTU A;  4C8O A;  1N6Q A;  4RW8 A;  1LWF A;  4M3Y A;  1C6V A;  2XY8 A;  1JL2 A;  2Z1G A;  1FK9 A;  3AA3 A;  1L3T A;  1XWL A;  4FK4 A;  2DFF A;  1HPZ A;  4F2R A;  4L8R B;  2HHW A;  3LWM A;  2KZM A;  3L2Q A;  3AVG A;  1EP4 A;  3AVL A;  3QIP A;  1NK0 A;  2HHX A;  1UAX A;  4CJT A;  5E41 A;  4CK2 A;  3QEI A;  4FJX A;  4KPY A;  5KRS A;  3NH2 A;  4M45 A;  3CQ8 A;  4FVM A;  1WSE A;  1HNV A;  3AO2 A;  1U49 A;  1JLF A;  3ZT2 A;  1S1W A;  1S1X A;  4MQ3 A;  3O3G A;  3QET A;  3KLH A;  5C42 A;  3CYM A;  5K14 A;  1NJW A;  3IG1 A;  1J53 A;  1C1A A;  4O0J A;  3E01 A;  3LPU A;  4IFY A;  3D45 A;  4CJ5 A;  1VSE A;  3ZSZ A;  3QNO A;  1BL3 A;  3BGR A;  1Z26 A;  1WSF A;  4E7L A;  1NK8 A;  4HUG A;  4FW1 A;  4O44 A;  3NE6 A;  3NDK A;  4FM1 A;  3VA3 A;  4DU3 A;  1NJX A;  1WN7 A;  2XY5 A;  4JRQ A;  2KZZ A;  3NH0 A;  2HND A;  4N76 A;  4FLW A;  3LZJ A;  2IOC A;  3KK2 A;  3V9U A;  1FKP A;  4GW6 A;  4CIE A;  3SPY A;  1S5J A;  3V6D A;  4B9S A;  4CCH A;  1TGO A;  3U3Y A;  1RTJ A;  2G8F A;  1WSH A;  2PYL A;  4J2A A;  1SL1 A;  4BE1 A;  4KHQ A;  3HYF A;  4CJU A;  4DU4 A;  1IKY A;  1Q9X A;  4FK2 A;  1S1V A;  1TL1 A;  1KVC A;  1TKZ A;  1JXE A;  4CF8 A;  4AIL C;  3PV8 A;  3TAB A;  3TAR A;  2B6A A;  2B5J A;  1KRP A;  1BI4 A;  3KK1 A;  4DLG A;  2DFE A;  1HRH A;  4F8R A;  3QLH A;  4B8A B;  3C6T A;  3VQ5 A;  1NK5 A;  1VSF A;  4KHU A;  4DSF A;  1VRT A;  4KHW A;  2HHT A;  1KFD A;  1HYZ A;  4HTU A;  3RTV A;  2D5R A;  1UA0 A;  2VG5 A;  3TAP A;  1X1P A;  4ZTJ A;  1T7P A;  5FRM A;  3ZSO A;  3EZ5 A;  4OLA A;  4CF9 A;  4AH9 A;  1ZYQ A;  4BDP A;  1REV A;  3WNH A;  1SKR A;  4KTZ A;  2ZQB A;  3L8B A;  3RR7 A;  2F96 A;  3ZT1 A;  3OYG A;  3M8R A;  3RRH A;  4UQG A;  5D3G A;  4ELU A;  3ZT3 A;  1A5W A;  1T05 A;  1HNI A;  4FXD A;  4YNQ A;  2HNY A;  3OS0 A;  4DF4 A;  3AA5 X;  3NF9 A;  4DQR A;  4FCY A;  4CJW A;  2OPS A;  4BAC A;  3ZT0 A;  1R0A A;  3V1R A;  3RMB A;  2FBV A;  3V9Z A;  4KI4 A;  5HRN A;  4W5T A;  1ITG A;  3TWH A;  3ZSY A;  3NCI A;  3V1O A;  2HMI A;  1GOA A;  3KIO A;  2WON A;  3KD1 E;  1CXQ A;  1WAF A;  1HMV A;  2HHS A;  1Z25 A;  3NGI A;  4DTM A;  3PX6 A;  3HVR A;  1UWB A;  1NJZ A;  3QNN A;  3PX4 A;  3NFA A;  4AHC A;  1VSL A;  1F21 A;  4DTP A;  1QHT A;  3SQ1 A;  2RKI A;  1EXQ A;  2DTU A;  2BAN A;  1SUQ A;  4E7I A;  1C0T A;  2IC3 A;  1GOB A;  1KLM A;  1WSG A;  1HQU A;  3B6P A;  3VQA A;  4OPK A;  3HP6 A;  1DTT A;  4ICL A;  2XHB A;  4FJI A;  3U3G A;  3DI6 A;  4F3T A;  4OGC A;  1JLE A;  3KLI A;  4E7K A;  1KLN A;  4J2B A;  4B9N A;  3ITH A;  4FW2 A;  2XRI A;  4CFD A;  4CHP A;  2QKK A;  3SQ2 A;  3F9K A;  1NKB A;  4FJ7 A;  4W5R A;  3L2U A;  4DF8 A;  3AO5 A;  4CIG A;  1LWE A;  1I3A A;  4Y1D A;  4CHO A;  4BWJ A;  3SQ0 A;  5J2N A;  1JLA A;  3UIQ A;  5HP1 A;  1C0U A;  4DTN A;  4CF2 A;  4DTJ A;  4OVL A;  4CEA A;  3K5M A;  4M3U A;  1CXU A;  1G15 A;  1RIL A;  1VSJ A;  4E19 A;  3EYZ A;  3NBP A;  4FLU A;  3SQ4 A;  4IG3 A;  4H8K A;  1TV6 A;  4FJL A;  1L5U A;  1D5A A;  4CJQ A;  4CIF A;  3HO1 A;  3D0P A;  4FJ9 A;  3PY8 A;  4N41 A;  2Z1I A;  2GBZ A;  3LP0 A;  1C0M A;  3HPO A;  4O0I A;  3ZSR A;  4OPJ A;  1BIU A;  2KTQ A;  4CGG A;  4DFJ A;  1Q8I A;  4PY5 A;  3LDS A;  3NF7 A;  1YVU A;  4JS5 A;  3HJF A;  4I2P A;  2KFZ A;  5HLF A;  4IDK A;  3TAM A;  1BQN A;  2FBY A;  4AHS A;  2G8H A;  2OA8 A;  1S9E A;  4CGD A;  3OYE A;  5J2Q A;  1J5O A;  1KSP A;  2OPR A;  5C24 A;  3OYL A;  1JLG A;  1TVR A;  3DM2 A;  3AVA A;  3M8Q A;  4KV8 A;  3ZSV A;  3CG7 A;  3IRX A;  3L2W A;  3P1G A;  4DS4 A;  4RW7 A;  3MEE A;  2ITG A;  4F3O A;  1HJR A;  4B9V A;  2I5J A;  2OYQ A;  4NCG A;  4MFB A;  3ASM A;  1IH7 A;  3OYF A;  4FLZ A;  3KLF A;  2BGG A;  1QSL A;  3KKS A;  3OYD A;  2HB5 A;  3OYH A;  3MAQ A;  4DTR A;  1RDA A;  3AO4 A;  3V4I A;  1IKW A;  3SJJ A;  2D0C A;  2E6L A;  3HM9 A;  1LWC A;  4DSE A;  1RBS A;  4LH4 A;  3IAY A;  1UOC A;  1B9D A;  3THV A;  4DFK A;  1BI4 B;  1RT5 A;  4BDY A;  4CJE A;  1W0H A;  2FBT A;  3NGY A;  5HRR A;  4Q0B A;  3S3M A;  3ULD A;  1DTQ A;  2B4J A;  4Y1C A;  3V9X A;  3F73 A;  2Y1I A;  4FJG A;  3AO1 A;  3RMA A;  4DWI A;  3OYM A;  3OJU A;  4W5Q A;  3ZCM A;  1ZBU A;  4B9M A;  1RBV A;  4PA1 A;  4FJK A;  3LP1 A;  4KKO A;  2X78 A;  4CK3 A;  3OS2 A;  1VRU A;  3WNE A;  4LSN A;  1MU2 A;  4HCB A;  4LD0 A;  4KHY A;  2YNH A;  1HYS A;  1HQE A;  4N56 A;  3OYI A;  2JLE A;  2Z1J A;  4EP4 A;  2F8T A;  3MXJ A;  3MEC A;  1K6Y A;  4GVM A;  3SUQ A;  4DFM A;  4BE2 A;  1B9F A;  5HBM A;  4K8X A;  3L3V A;  3OS1 A;  1TK0 A;  1NK9 A;  5JS1 A;  3ZSQ A;  3VQD A;  4CEO A;  4DU1 A;  1WLJ A;  1NJY A;  1D8Y A;  2PZS A;  1SKS A;  1W9H A;  2P51 A;  4CJK A;  4B8C A;  1BHL A;  4E1N A;  3OJS A;  3KLE A;  4Z4H A;  4DSL A;  2QK9 A;  4CEQ A;  1BQM A;  3KK3 A;  3LAL A;  2X74 A;  4I9Q A;  4OGE A;  3ISN C;  3VQE A;  3RR8 A;  2Y1J A;  4DSI A;  4LY7 A;  3I0R A;  4B08 A;  4M41 A;  5C25 A;  1FXX A;  1J9A A;  3C6U A;  4XIU A;  3RMD A;  4DLE A;  4KB1 A;  3S3O A;  3SYZ A;  3C94 A;  4FLX A;  4OKJ A;  4N5S A;  1Y97 A;  1DLO A;  1JXB A;  3L2R A;  4HVJ A;  1XI1 A;  3L3U A;  1NKC A;  3VQ4 A;  2YNF A;  4Z4F A;  2PY5 A;  3AVK A;  2VG7 A;  4O4G A;  4QOZ B;  1EX4 A;  3HP9 A;  2NUB A;  2RN2 A;  2YHB A;  5CYM A;  4B9T A;  2HW3 A;  3DLE A;  4K8Z A;  1TKX A;  4FLY A;  1BCM A;  3SZ2 A;  4M3X A;  4Z4E A;  3VQB A;  4CED A;  4DMN A;  1O1W A;  2YV0 X;  3VQQ A;  5HRP A;  3AVC A;  3L2V A;  2VWJ A;  3SV3 A;  5J2P A;  5FRN A;  2LSN A;  1SKW A;  3SPZ A;  4WE1 A;  2OZM A;  2A1S A;  1JKH A;  1RCH A;  3FFI A;  3ZSW A;  3VQC A;  2O4I A;  1EKE A;  1U4B A;  1NOY A;  3K2P A;  1Q9Y A;  1ZBI A;  3OY9 A;  1HYV A;  5HRO A;  3TR8 A;  4CEB A;  4Z4C A;  5SZT A;  3VA0 A;  4FJH A;  3LZI A;  2EX3 A;  4E7H A;  3DLR A;  1TL3 A;  1RDD A;  1XHZ A;  4CHN A;  2VWK A;  4CGF A;  3AV9 A;  1C1B A;  2YKM A;  4CJP A;  4C8K A;  3QO9 A;  1ZBL A;  4CFB A;  2KW4 A;  2YNI A;  3HPG A;  4H4M A;  4CEF A;  4QAG A;  4DQS A;  4LSL A;  4DSJ A;  3DOK A;  5SWM A;  4CJ4 A;  3AVI A;  4CJL A;  4FYD A;  4CE9 A;  1UA1 A;  1NOZ A;  1KCF A;  2GV9 A;  5KRT A;  1ASV A;  4CHZ A;  3BDP A;  1QE1 A;  3LP3 A;  3O3H A;  4GMJ B;  3S3N A;  3K58 A;  4HCC A;  4OLB A;  1BCO A;  1I39 A;  3HL8 A;  3ALY A;  4M3R A;  3LPT A;  2YKN A;  4FJM A;  3U6F A;  2ZE2 A;  3LWL A;  1TKD A;  4QCL A;  4KO0 A;  1A5V A;  4E7J A;  1A5X A;  4RW6 A;  3DRP A;  3T1A A;  3O4N A;  4JLH A;  3DLG A;  4CF0 A;  3P83 D;  5J1E A;  1TAQ A;  3NH1 A;  2KFN A;  4B9U A;  3CFR A;  4DG1 A;  2G8V A;  1BIZ A;  5DMR A;  3OYC A;  1JLQ A;  3VN5 A;  1RDC A;  1T03 A;  1U48 A;  2HVH A;  4EP5 A;  1QS4 A;  3V9W A;  4M3T A;  3MED A;  3CM6 A;  5KTQ A;  4BE0 A;  3ZT4 A;  3ZSX A;  4ZTF A;  4NCB A;  4KRE A;  3HT3 A;  4IG0 A;  4CGH A;  4BWM A;  1S6P A;  3T19 A;  3CFP A;  5KGX A;  1S1U A;  3VQP A;  4AHR A;  4B3O A;  1U47 A;  3I8D A;  3AVN A;  2FC0 A;  3QIO A;  1KFS A;  3PX0 A;  3P5J A;  4C8N A;  3HST B;  4CFA A;  2DY4 A;  1RTH A;  3JYT A;  3S9H A;  5CY4 A;  3LAN A;  3JSM A;  4DQI A;  4IFV A;  1L3U A;  2OPP A;  3NHG A;  3DRS A;  1JLB A;  2IAJ A;  3KKR A;  4KTW A;  1VSD A;  1NK7 A;  3VQ6 A;  1L3V A;  3SUN A;  4KRF A;  4ID1 A;  5J2M A;  1CZ9 A;  3MXM A;  4NYN A;  2KQ2 A;  3IS9 A;  2HHU A;  3TAN A;  1S6Q A;  3H08 A;  5KGW A;  4CEE A;  5I3U A;  4CGI A;  3G10 A;  2ZD1 A;  1XC9 A;  5FDL A;  1WSJ A;  1BGX T;  4G1Q A;  3TAF A;  3QIN A;  3KTQ A;  2P1J A;  3AVJ A;  2OPQ A;  3DMJ A;  4CEC A;  4HUE A;  3AVB A;  4FZY A;  1YTU A;  2E6M A;  3AA4 A;  1RTD A;  1CZB A;  1KTQ A;  1RNH A;  3HPH A;  3QEW A;  4KFB A;  1S1T A;  3K5L A;  2XY6 A;  4FZZ A;  4Z4G A;  4YFU A;  4PQU A;  4ID5 A;  4FJ8 A;  2P5O A;  4M3W A;  3VQ9 A;  4N47 A;  2HHQ A;  1WSI A;  3CFO A;  3DRR A;  1IG9 A;  4DSK A;  1J54 A;  2Z1H A;  3NF8 A;  1ZBH A;  4TSX A;  3WNG A;  3TAG A;  1BIS A;  4DQP A;  1LV5 A;  3LAM A;  1SL2 A;  4IBN A;  4CFC A;  1U45 A;  2P5G A;  4R5P A;  4CF1 A;  3K5N A;  2FBX A;  3LP2 A;  3V81 A;  3M8S A;  1LAW A;  2YHA A;  1ZBF A;  2ETJ A;  1SL0 A;  4J2E A;  1TAU A;  4KHS A;  1LAV A;  4ZHR A;  3PUF A;  2GUI A;  2DFH A;  1WAJ A;  1KVA A;  1RDB A;  1NK4 A;  4J2D A;  1RBT A;  4FZX C;  1VSI A;  1JLC A;  1RT3 A;  3LAK A;  1TK5 A;  2RPI A;  3KLG A;  4Q5V A;  4OJR A;  4ELT A;  4PWD A;  1IKV A;  3T3F A;  4KAZ A;  4I7F A;  3O3F A;  2R7Y A;  3MEG A;  3SUO A;  3G0Z A;  1NK6 A;  4M3Z A;  2X6S A;  3VQ8 A;  1SV5 A;  4FLT A;  3OVN A;  2HNZ A;  4I2Q A;  4Z0U A;  1RT7 A;  4AHU A;  3OYK A;  1D9F A;  1QQC A;  2BE2 A;  4FJN A;  1RT6 A;  4FJ5 A;  4CJV A;  4AHT A;  4CES A;  4IKF A;  4KTQ A;  4DTO A;  4C8M A;  3HXM A;  3AVF A;  3SNN A;  2OZS A;  4FJJ A;  2IGI A;  2HHV A;  3DLH A;  2PYJ A;  2EHG A;  1QSS A;  4CHQ A;  1IO2 A;  3DOL A;  3A2F A;  2D0A A;  3RMC A;  3B6O A;  4DTX A;  2G8U A;  3K59 A;  4JS4 A;  4HUF A;  4RW4 A;  4KB0 A;  3OYA A;  2Q3S A;  3VQ7 A;  3SCX A;  1N5Y A;  4BDZ A;  2XO7 A;  2IDO A;  4CJF A;  4FM2 A;  4EZ6 A;  3AVH A;  3SUP A;  1L3S A;  4LH5 A;  4CJS A;  3MXI A;  2QKB A;  4RG8 A;  1RT4 A;  4CEZ A;  4W5O A;  3OYN A;  3KD5 E;  5CZ1 A;  3O4Q A;  1JL1 A;  3NAE A;  1X9S A;  2VG6 A;  4Z4I A;  3K57 A;  3I0S A;  4OKE A;  3QEP A;  3QEV A;  3TAE A;  4ELV A;  4E0D A;  4CJR A;  2HVI A;  3AVM A;  3DLB A;  3DYA A;  3AO3 A;  3M8P A;  3RRG A;  4DTS A;  3WNF A;  4NCA A;  1ASU A;  4FM0 A;  5KI6 A;  1VSM A;  1LW2 A;  1T8E A;  1QSY A;  1X9W A;  4F2S A;  3HK2 A;  3NGZ A;  3V1Q A; 
#chains in the Genus database with same CATH topology
 3I56 N;  2QWN A;  4CHY A;  1B92 A;  4EZ9 A;  4HHT A;  3GDQ A;  1ASW A;  4E89 A;  4PUO A;  2QWL A;  4BRQ A;  1E4G T;  3VET A;  4DS5 A;  1C1C A;  4DFP A;  2G8I A;  2O4G A;  3PO4 A;  3T69 A;  1X9M A;  1NBW A;  4FLV A;  1NKE A;  4WF9 L;  5CYQ A;  1OVQ A;  4FPA A;  1NU0 A;  1VSK A;  3FZK A;  4CD3 A;  2BDP A;  5FRO A;  2D0P A;  3SI6 A;  1TK8 A;  4B9Q A;  3U9Z A;  4E3S A;  2CH5 A;  3CJA A;  3CCL N;  3CI5 A;  1RT2 A;  1TKT A;  3SAF A;  2A1R A;  5AQQ A;  2ZJR L;  2IS3 A;  2HBM A;  4W5N A;  1EET A;  3QES A;  1RT1 A;  1FKO A;  2NRV A;  1RBU A;  3OYB A;  4M7X A;  4CBU A;  5I42 A;  4NXM K;  2HBJ A;  3ZEU B;  1N6Q A;  1LWF A;  2E1Y A;  3TPQ A;  4L8R B;  3L2Q A;  2Q1N A;  4GNI A;  3QIP A;  3RVC A;  5JLH A;  1UAX A;  5E41 A;  2P9K A;  3PIP L;  3NH2 A;  4M45 A;  4A57 A;  3AO2 A;  5GAH P;  3CYM A;  4O0J A;  3E01 A;  4IFY A;  3ZSZ A;  1Z26 A;  5LY3 A;  4FW1 A;  3DXK A;  3A5O C;  5E84 A;  4DU3 A;  1WN7 A;  2XY5 A;  3SBT A;  1ATS A;  2IOC A;  3KHY A;  3QDK A;  3V6D A;  3DXK B;  4C1N I;  1R59 O;  1SL1 A;  2NRW A;  4DU4 A;  1TL1 A;  1S3X A;  1X3N A;  4AIL C;  1VQP N;  1KRP A;  3CCE N;  2Q0R A;  1BI4 A;  4WCE L;  1VQ8 N;  3CJ9 A;  1NK5 A;  1VSF A;  1HYZ A;  1UA0 A;  2YHX A;  1X1P A;  1T7P A;  5FRM A;  4JI5 K;  3K0S A;  1ZYQ A;  3RR7 A;  4IDH A;  1A5W A;  2O8F B;  1HNI A;  4FWL A;  3M6G A;  4DQR A;  1VQ5 N;  4EHT A;  3V1R A;  4CZG A;  3DXM B;  2HOE A;  1GOA A;  1ATN A;  2WON A;  3PIO L;  2HHS A;  3NGI A;  4FO0 A;  4IWV A;  2W6K A;  4JKF A;  4AHC A;  1VSL A;  4O8K A;  4DTP A;  1OH8 A;  1QHT A;  3CCS N;  1EXQ A;  2DTU A;  1SUQ A;  1WSG A;  3HI0 A;  1HPM A;  4BR5 A;  3TTF A;  4FWK A;  4OGC A;  4DR5 K;  4CW7 B;  3ITH A;  2CGJ A;  2XRI A;  3I8B A;  4CFD A;  3SQ2 A;  3L2U A;  1EWQ A;  1LWE A;  4Y1D A;  4CHO A;  4OX9 K;  2BUP A;  5GIP A;  3SQ0 A;  3UIQ A;  5HP1 A;  4CEA A;  4JK8 A;  1OH5 A;  4CJQ A;  4IEI A;  4FJ9 A;  2Z1I A;  3THW B;  2F9W A;  4CGG A;  1RDW X;  1YVU A;  4I2P A;  3LDQ A;  1KAY A;  3ZYY X;  3HZ6 A;  1S9E A;  3OYE A;  1J5O A;  5C24 A;  1T6D A;  4K41 A;  4RW7 A;  2NRH A;  3ASM A;  5BR9 A;  3ZET B;  4MDB A;  3KKS A;  4DV7 K;  4BRN A;  5AQN A;  2HB5 A;  2HBK A;  1IKW A;  1V4T A;  2D0C A;  2E6L A;  1LWC A;  1X9W A;  3THV A;  1YVN A;  3KWI A;  3AO1 A;  1RBV A;  4KKO A;  1JJ2 M;  4JI6 K;  3AGR A;  4JI3 K;  4LD0 A;  2YNH A;  4MO5 A;  4I6M A;  3OYI A;  2ASO A;  4BC3 A;  2Z1J A;  2F8T A;  3ENB A;  4B1W B;  5C2D A;  5C2F A;  2FF6 A;  1B9F A;  2QM1 A;  3O8M A;  4H5V A;  3VQD A;  2ZM6 K;  3OJS A;  4E1N A;  3VF6 A;  4Z4H A;  4DSL A;  4LFB K;  3EKS A;  3VOV A;  4OGE A;  1S22 A;  1XQS C;  3TSU A;  1FXX A;  1YF5 L;  3RMD A;  4DLE A;  3SYZ A;  4FLX A;  1Y97 A;  4LC9 B;  3KVG A;  4Y0W A;  3VQ4 A;  1NKC A;  4Z4F A;  4B1U B;  3AVK A;  1EX4 A;  2RN2 A;  2YHB A;  1U2V A;  2AA4 A;  4DMN A;  3VQQ A;  3AVC A;  1SKW A;  3SPZ A;  4WE1 A;  1OH7 A;  3FLC O;  3FFI A;  3ZSW A;  3VQC A;  1EO1 A;  1U4B A;  1Q9Y A;  1C0G A;  3CIP A;  3CER A;  2ZGY A;  4BR2 A;  3CMA N;  4PL8 A;  4JKC A;  1XHZ A;  3R8E A;  5JVG L;  3ZX3 A;  1SQK A;  1NGI A;  3W3D A;  4LF6 K;  3P31 A;  5I9E B;  1TUY A;  4BRE A;  5FPN A;  3DOK A;  4CE9 A;  2QW9 A;  1NOZ A;  3QIC A;  1UA1 A;  1DEJ A;  1ASV A;  3LP3 A;  4FJM A;  3ALY A;  3UB5 A;  4E7J A;  3J7A P;  3IKM A;  3P83 D;  1ZC6 A;  5AZI B;  5TKW A;  3WQU A;  1U6Z A;  2G8V A;  4B3S K;  1IBK K;  1RDC A;  2UU9 K;  3B8A X;  5GAD P;  3QML A;  3SBG A;  2I7N A;  3FGU A;  4BE0 A;  3ATV A;  3HT3 A;  1S6P A;  5HOO A;  3I8D A;  3QIO A;  3CPW M;  2IVO A;  4C8N A;  4H0Y B;  4U7B A;  5CY4 A;  3LAN A;  3TTD A;  3JSM A;  1VQK N;  1ATR A;  1TYQ B;  3NHG A;  5KQ8 A;  4KTW A;  2ZGZ A;  3OBY A;  2O8B A;  4BVO A;  1E3M A;  2HHU A;  3TAN A;  2O8C B;  4CGI A;  1GLF O;  5FDL A;  3TSQ A;  1BGX T;  3KTQ A;  3NVM A;  2OPQ A;  4CEC A;  3AVB A;  3AA4 A;  1RTD A;  1CZB A;  3R6M A;  4ID5 A;  1GLJ O;  3H1Q A;  4FJ8 A;  1WSI A;  3CFO A;  2P9K B;  1IG9 A;  4DSK A;  4PKG A;  1Z05 A;  3H6E A;  1NMN A;  4TSX A;  3U8X A;  1WBD A;  3TAG A;  2ZJP L;  1LV5 A;  5EOY A;  1YIT N;  3VES A;  4CFC A;  2P5G A;  2P9N A;  5AQK A;  3LP2 A;  4DR7 K;  3V81 A;  3M8S A;  2YHA A;  5ADX H;  2ZJQ L;  1LAV A;  3WXJ A;  1WAJ A;  3HOS A;  3LDL A;  2WUS A;  4JHD B;  4CJ7 A;  1K8K B;  4V19 S;  4OJR A;  1IG8 A;  3O3F A;  2UYT A;  3PLA A;  3MEG A;  3SUO A;  4X65 K;  2WTU A;  2CGK A;  4M3Z A;  3VQ8 A;  4AHU A;  3OYK A;  4FJN A;  1D9F A;  4PHT X;  4KTQ A;  4C8M A;  2IGI A;  4BGB A;  2D1K A;  1QSS A;  4CHQ A;  3DOL A;  3RMC A;  3JAM O;  4IO8 A;  3O9T A;  4HUF A;  3OYA A;  3P4I A;  3G6E N;  2XO7 A;  2IDO A;  4CJF A;  4EIA A;  3VEW A;  3LDP A;  3SUP A;  1L3S A;  4RG8 A;  1YXQ A;  5GAG P;  3I0S A;  1QQN A;  4YOU A;  3TAE A;  4ELV A;  2HVI A;  4CJR A;  3AVM A;  3RRG A;  1BG3 A;  3IDH A;  1VSM A;  3VTH A;  1LW2 A;  1QSY A;  4H5R A;  2O8F A;  3HK2 A;  3NGZ A;  3D0P A;  3PO5 A;  5DK5 A;  4BC5 A;  2X6N A;  4CZF A;  4QS8 A;  2XY7 A;  1I94 K;  4BY9 C;  1CLQ A;  1S9G A;  4CK1 A;  5CHI A;  2W42 A;  4M42 A;  4O55 A;  4FPB A;  3LM9 A;  4O5B A;  3QEX A;  3OTO K;  1WNS A;  1RGI A;  3EO3 A;  4KH4 A;  2ATQ A;  1YJ9 N;  1XHX A;  5BN8 A;  1IKX A;  4H0X B;  4HWI A;  2QWM A;  1ZBS A;  4KHN A;  1U04 A;  3KJV A;  4LFC K;  1TYQ A;  1ILY A;  1NGE A;  4NYF A;  4E1M A;  2RF2 A;  1YT3 A;  3QER A;  4F4K A;  4FK0 A;  2JGU A;  5BRF A;  4JRP A;  4B1Z A;  3RWU A;  5EU7 A;  2QXF A;  3NF6 A;  1GOC A;  3HVT A;  4DTU A;  4RW8 A;  1YIJ N;  1Q82 O;  1JL2 A;  2Z1G A;  1L3T A;  4FK4 A;  3BF3 A;  2DFF A;  1HPZ A;  2KZM A;  4LF5 K;  3AVG A;  2VGN A;  3FE1 A;  3R9P A;  5KRS A;  3CQ8 A;  4PKI A;  1JLF A;  3ZT2 A;  1S1W A;  1S1X A;  5EXW A;  3KLH A;  5C42 A;  2IIR A;  1NJW A;  3H46 O;  3CJC A;  3SMS A;  3CC7 N;  4CJ5 A;  3MN9 A;  3CCQ N;  3BGR A;  4E7L A;  4JI1 K;  1N8R O;  3NE6 A;  3NDK A;  5AJ3 K;  1QZ5 A;  2WBN A;  3S41 A;  2E2O A;  3VPZ A;  4JRQ A;  2KZZ A;  4AQY K;  4M63 C;  4FLW A;  3LZJ A;  4GW6 A;  4CIE A;  4B9S A;  1NGF A;  1RTJ A;  2DPN A;  2WFB A;  3HYF A;  4CJU A;  5F1X A;  3M1F A;  1TKZ A;  4YHH K;  1TUU A;  2B5J A;  4ISF A;  4YOV A;  3KK1 A;  2A40 A;  4F8R A;  4BRI A;  2HHH K;  3MN5 A;  3JXU A;  4KHU A;  4HTU A;  2VG5 A;  3TAP A;  1J5E K;  2O8D B;  4CF9 A;  4AH9 A;  2F7T A;  1REV A;  4FWS A;  4KTZ A;  3SLC A;  4FWR A;  2ZQB A;  2F96 A;  3OYG A;  3RRH A;  1SAZ A;  5D3G A;  3ZT3 A;  3SJH A;  4DF4 A;  3OS0 A;  3AA5 X;  3NF9 A;  4JI4 K;  3QFP A;  5BPL A;  4CJW A;  4JEP A;  4YY3 K;  4BAC A;  3RMB A;  3V9Z A;  1NJI O;  4W5T A;  3TWH A;  3NCI A;  2V52 B;  3V1O A;  4BGA A;  5GIN A;  2OTL N;  4KH5 A;  2JWL A;  4KH6 A;  3HSC A;  3SMP A;  3PX6 A;  4CZJ A;  5AZJ B;  1NJZ A;  5AQF A;  3PX4 A;  4NLC A;  5BPM A;  1F21 A;  3WEE B;  3ZET A;  2RKI A;  5HL7 L;  4CZE A;  2E1Z A;  3SQ1 A;  3OBW A;  1HKG A;  2P9P A;  3CCM N;  4OPA A;  3HP6 A;  2XHB A;  3U4L A;  3BEX A;  3DI6 A;  3KLI A;  1KLN A;  4B9N A;  2D0O A;  4FW2 A;  3P38 A;  3GE1 A;  3AO5 A;  4CIG A;  1M90 O;  3ZLJ A;  1NGG A;  2RE2 A;  1KD1 O;  5AQL A;  5J2N A;  4DTN A;  4M3U A;  1G15 A;  4E19 A;  1WBB A;  3NBP A;  4IG3 A;  2HBL A;  4H0V B;  1NG9 A;  5AQU A;  2FSJ A;  3VGM A;  2GBZ A;  4A2B A;  4OPJ A;  1QVF M;  3MK6 A;  1Q8I A;  4DFJ A;  4PY5 A;  3LDS A;  4JN4 A;  3NF7 A;  2QWO A;  5H1S Q;  3O4W A;  4IDK A;  1BQN A;  5DM7 L;  2OA8 A;  4B3R K;  4CGD A;  2QWP A;  3CXC M;  2OPR A;  1KSP A;  2NRR A;  3AVA A;  5AQR A;  3CG7 A;  3IRX A;  4DS4 A;  3MEE A;  2ITG A;  3CQY A;  4NCG A;  5AQV A;  1IH7 A;  4IFE A;  2PFU A;  1QSL A;  4EAH D;  4DV1 K;  1K9M O;  3SJJ A;  1MA9 B;  3MAQ A;  3AO4 A;  3A5N C;  4IXC A;  3SAG A;  4DSE A;  3I33 A;  3D2F B;  4MLH A;  3SK3 A;  3ID6 A;  3DAW A;  1W0H A;  3NGY A;  3CC2 N;  3ULD A;  1DTQ A;  2B4J A;  2Y1I A;  4L3Q A;  4YDU C;  2A5X A;  3OJU A;  4W5Q A;  4PA1 A;  4LF9 K;  3WNE A;  3DJC A;  5AFU A;  1MU2 A;  5CR4 A;  4N56 A;  4LF4 K;  2JLE A;  4FWP A;  3MXJ A;  3CD6 N;  1K6Y A;  1NGD A;  3SUQ A;  4DFM A;  4BE2 A;  5JS1 A;  3L3V A;  4CEO A;  1WLJ A;  1SKS A;  3VTI A;  4WQ5 A;  5BPN A;  3KLE A;  5MLC Q;  4GV6 A;  2O8E A;  3ISN C;  5C15 A;  4LY7 A;  5BRE A;  1WUA A;  5LMN K;  2QEX N;  1J9A A;  4QS9 A;  1Y64 A;  3C94 A;  4OKJ A;  1DLO A;  1JXB A;  1XI1 A;  3L3U A;  2NZT A;  2PY5 A;  2VG7 A;  4O4G A;  1VQM N;  3VEO A;  2BH1 A;  2NUB A;  5CYM A;  1J6Z A;  4K8Z A;  1T3V A;  1TKX A;  4FLY A;  3FZF A;  3SZ2 A;  2E8A A;  4BRD A;  5EVZ A;  3L2V A;  3SQ4 A;  1O1W A;  2VWJ A;  5FRN A;  2LSN A;  1KAZ A;  2GEL A;  1JKH A;  1V4S A;  4BQZ A;  2O4I A;  1EKE A;  3CC4 N;  3K2P A;  1ZBI A;  4LF7 K;  5HRO A;  1OKJ A;  3TR8 A;  4Z4C A;  4FJH A;  4I6M B;  3DLR A;  5F2R A;  1TL3 A;  2FSN A;  2VWK A;  1X3M A;  4CGF A;  2H3G X;  4CJP A;  4CFB A;  2YNI A;  4DCH A;  4JKH A;  4IJN A;  4FOE A;  2GV9 A;  2E5L K;  3BDP A;  1JCG A;  4YOR A;  3K9J A;  4HCC A;  4OLB A;  1I39 A;  1YI2 N;  3LPT A;  5LMU K;  3U6F A;  1TKD A;  4QCL A;  1A5X A;  4RW6 A;  3DRP A;  4JLH A;  3DLG A;  4AF1 A;  5J1E A;  1TAQ A;  2KFN A;  4B9U A;  3BP8 A;  3BY5 A;  3CJ7 A;  5AFU H;  1JLQ A;  5DM6 L;  4EP5 A;  3M3Z A;  2W40 A;  4YOT A;  4M3T A;  5KTQ A;  3ZT4 A;  3ZSX A;  1NGH A;  2ASM A;  4PL7 A;  4BRH A;  2P9N B;  1MWM A;  5AQX A;  4CGH A;  1S1U A;  4ISG A;  2FC0 A;  1MDU B;  3HST B;  2HMP A;  4YOY A;  3JYT A;  5FLX O;  4DQI A;  2KLA A;  1L3U A;  3L6Q A;  2OPP A;  1JLB A;  2IAJ A;  4JI0 K;  3IMX A;  1VSD A;  4KRF A;  3HOT A;  4ID1 A;  2Q36 A;  4A5B A;  4NYN A;  2W6L A;  3IS9 A;  3AAP A;  4CEE A;  3E9P A;  2YHY A;  5I3U A;  2ZD1 A;  4JI8 K;  3TAF A;  3MCP A;  3DMJ A;  4JYA K;  2E6M A;  4JKD A;  4KFB A;  4GV3 A;  3K5L A;  4Z4G A;  2XY6 A;  2VQF K;  4M3W A;  3VGL A;  4N47 A;  2UUC K;  4H0O A;  4BRA A;  4DUZ K;  3WNG A;  5F0X A;  4DQP A;  4OO1 J;  3LAM A;  4X64 K;  1U45 A;  1U2V B;  5LJW A;  4DV6 K;  4K42 A;  4R5P A;  1GLA G;  3VEX A;  3K5N A;  4JI7 K;  1GLC G;  4J2E A;  3VER A;  3WT0 A;  4KHS A;  3LDN A;  5M1K A;  2DFH A;  2UXD K;  3I55 N;  5AR0 A;  3M5R A;  4FZX C;  1TK5 A;  4PWD A;  4Q5V A;  1IKV A;  1Z6R A;  3T3F A;  3SAH A;  4BR7 A;  2R7Y A;  5AQT A;  2X6S A;  4WQ4 C;  1RT7 A;  4FJ5 A;  4JV5 K;  5M1N A;  4FJJ A;  4NB4 A;  2OZS A;  2HHV A;  2EHG A;  1IO2 A;  4DTX A;  2YHW A;  1SZ2 A;  4JS4 A;  3SCX A;  2Q3S A;  4EHU A;  4FM2 A;  4EZ6 A;  4RCH A;  1VQN N;  3DXM A;  4CJS A;  4CEZ A;  4DR1 K;  4R79 A;  4WQ5 C;  3O4Q A;  1JL1 A;  5KPZ A;  2I7P A;  3NAE A;  4XH5 A;  3WXL A;  3QEP A;  3OW2 M;  3QEV A;  4E0D A;  3C7N A;  3DYA A;  4NCA A;  3ID8 A;  2E88 A;  4FM0 A;  4A2A A;  3V1Q A;  4ISE A;  4CJ4 A;  1HUX A;  1KQS M;  4H4O A;  4B3T K;  1E4F T;  1JCE A;  2D0B A;  4XH4 A;  3WUH A;  2WOM A;  3QBW A;  4DUY K;  1QVG M;  4ILJ A;  3THX A;  3R3L A;  2E4L A;  1D9D A;  1RBR A;  4RW9 A;  3AAR A;  5GIO A;  3AA2 A;  3C95 A;  4DQ8 A;  4B9L A;  3V9S A;  1BWF O;  3K5O A;  3THX B;  1LW0 A;  1VHX A;  3EY1 A;  4C8L A;  1QTM A;  4H5N A;  5E26 A;  2QI2 A;  2GX9 A;  2G8W A;  5AQJ A;  4CJ3 A;  2F8S A;  3MN7 A;  4DB3 A;  5HRS A;  3U9D A;  4ILH A;  4I9L A;  3CM5 A;  1EQY A;  4DV0 K;  4NCB A;  2A3Z A;  4C8O A;  2ASP A;  2KHO A;  1P8Z A;  4M3Y A;  4QS7 A;  3AA3 A;  5C12 A;  1XWL A;  2HHW A;  3LWM A;  5AQP A;  3CCV N;  4BRF A;  1EP4 A;  1NNE A;  2FLO A;  3RSE A;  4RWT A;  1NK0 A;  3ZEU A;  4CK2 A;  3QEI A;  4FJX A;  4DR6 K;  4FVM A;  3THW A;  3AGK A;  3O3G A;  3QET A;  2J4R A;  2GUP A;  5K14 A;  4GKK K;  4BRP A;  1DT9 A;  4BRO A;  2P9I A;  3QNO A;  4BC4 A;  3QB0 A;  4HUG A;  1K8K A;  4CZH A;  1NJX A;  4JHD A;  3NH0 A;  2HND A;  4H0P A;  2P9U A;  4WFA L;  1GLE G;  4YOX A;  3CJ1 A;  4NO7 A;  3SPY A;  3MX5 A;  4CCH A;  3TU5 A;  1ESV A;  1WSH A;  4KHQ A;  1GLB G;  4JKB A;  3WEE A;  3MWP A;  1S1V A;  1KVC A;  3PV8 A;  3TAB A;  2B6A A;  4CD1 A;  3A8Y A;  3CF5 L;  1XNR K;  5GAE P;  3QLH A;  3FR0 A;  4BRG A;  1HLU A;  1KFD A;  3RTV A;  4B1Y B;  3EL2 A;  3ZSO A;  4K25 A;  3ZT1 A;  4ELU A;  2QA4 N;  4FXD A;  1T05 A;  4YNQ A;  2HNY A;  2OPS A;  3ZT0 A;  1R0A A;  5HRN A;  2O8E B;  1ITG A;  3ZSY A;  1YJN N;  2PBD A;  3KIO A;  1YJW N;  4IOX A;  1IV0 A;  5EY4 A;  1Z25 A;  3K9K A;  4CBW A;  3HVR A;  3UKU A;  1UWB A;  3EN9 A;  3QNN A;  3LL3 A;  5JVH L;  2BAN A;  4E7I A;  1C0T A;  2P9S A;  4MLE A;  1T44 A;  3B6P A;  4OPK A;  3VQA A;  4F3T A;  1WOQ A;  1JLE A;  3VEV A;  5AQG A;  3T7Z A;  4CHP A;  2O8B B;  3ZX0 A;  4FJ7 A;  4DF8 A;  3LM2 A;  4MDA A;  2Q31 A;  4FOI A;  1QQM A;  4BWJ A;  4O5F A;  5JMV A;  1JLA A;  1C0U A;  4CF2 A;  4DTJ A;  2EWS A;  3O1W A;  1CXU A;  4FJL A;  4FLU A;  4GV9 A;  1TV6 A;  5AQZ A;  4A59 A;  5C0Y A;  1D5A A;  3N4P A;  4CIF A;  1VQO N;  5ADX A;  3Q7C A;  1P90 A;  4YDU A;  3PY8 A;  4N41 A;  3LP0 A;  4BR4 A;  3C7N B;  4O0I A;  3ZSR A;  2CGL A;  1T6C A;  2W41 A;  1M1K O;  4JS5 A;  2NLX A;  5HLF A;  3TAM A;  2FBY A;  1ZXO A;  3ZSV A;  1Q7Y O;  3MMV A;  3M8Q A;  4JKA A;  3P1G A;  1DKG D;  1HJR A;  4B9V A;  4X66 K;  2I5J A;  2OYQ A;  4MFB A;  4FLZ A;  3KLF A;  4BQL A;  3OYD A;  3V4I A;  3VF2 A;  4CI6 A;  5AQH A;  3VEY A;  3HM9 A;  1RBS A;  4LH4 A;  1UOC A;  1RT5 A;  1WB9 A;  4Q0B A;  3S3M A;  3V9X A;  2Q97 A;  4FL9 A;  3TSP A;  3CET A;  3RMA A;  4DWI A;  3BUZ B;  3CME N;  1ZBU A;  1VQ7 N;  4B9M A;  4XEI A;  3KWG A;  4FJK A;  2X78 A;  4CK3 A;  4NLB A;  2PAV A;  4LSN A;  3G25 A;  4HCB A;  1HYS A;  3FZH A;  1HQE A;  4JKE A;  4EP4 A;  4GVM A;  5KPT A;  5HBM A;  4X62 K;  1TK0 A;  3ZSQ A;  2OCE A;  4YOW A;  4CJK A;  3BF1 A;  4B8C A;  1BHL A;  3A5L C;  4DV5 K;  1OH6 A;  2V7Z A;  4CEQ A;  1BQM A;  4I9Q A;  3HM8 A;  2E2N A;  1NGC A;  2RHK A;  3VQE A;  2UXB K;  3RR8 A;  2Y1J A;  4DSI A;  4B08 A;  2ITM A;  5C25 A;  4KB1 A;  3C6U A;  4XIU A;  3S3O A;  3KK7 A;  3T1H K;  4K43 A;  3L2R A;  4HVJ A;  3CCJ N;  2YNF A;  4QOZ B;  3HP9 A;  4B9T A;  5C10 A;  3DLE A;  2VGM A;  1BCM A;  4WQ4 A;  4Z4E A;  1XUP O;  3VQB A;  5HRP A;  2YV0 X;  3SV3 A;  2OZM A;  1RCH A;  4BC2 A;  3A0I X;  3EZW A;  3OY9 A;  2YI1 A;  1HYV A;  2JWK A;  3D2E B;  1H1V A;  3VA0 A;  3E1Y A;  2EX3 A;  4EFH A;  4E7H A;  4UY8 O;  1RDD A;  5KPR A;  1HKC A;  1C1B A;  3QO9 A;  1HJO A;  1O13 A;  1BA1 A;  4LSL A;  1SS6 A;  4FSV A;  4CJL A;  5KRT A;  1KCF A;  3KZB A;  4CHZ A;  3ULE B;  3O3H A;  4KHP K;  3CQX A;  3S3N A;  4OPH A;  4DR2 K;  1BCO A;  3HL8 A;  4M3R A;  4IOC L;  3BZK A;  5FPD A;  4IZ9 A;  1GLL O;  3CFR A;  4DG1 A;  3UKR A;  5DMR A;  2NNW A;  1GLD G;  3OYC A;  3VN5 A;  5AQW A;  1T03 A;  1W7A A;  4PKH A;  1QS4 A;  3V9W A;  1IBL K;  2VYP A;  4KRE A;  3O08 A;  5AZJ A;  4IG0 A;  4DHY A;  3CFP A;  4AHR A;  3QBX A;  2YJE A;  1KFS A;  4WFB L;  3O9R A;  1NGA A;  1K73 O;  5M1O A;  2DY4 A;  1RTH A;  1QHA A;  4M7Y A;  3S9H A;  4FWQ A;  1N32 K;  4IFV A;  1IJJ A;  1VQ6 N;  3KKR A;  2P9I B;  1NK7 A;  2Q0U A;  1L3V A;  5JIC A;  1CZA N;  2KQ2 A;  3O9Q A;  1S6Q A;  3H08 A;  4H03 B;  4JNE A;  2D4W A;  3AVJ A;  3EE9 A;  2O8D A;  3D2E A;  1YTU A;  4BRK A;  1NM1 A;  3VEN A;  1RNH A;  3QEW A;  1S1T A;  4PQU A;  4BRC A;  2HHQ A;  3DRR A;  4JD2 B;  1ZBH A;  3C65 A;  3AY9 A;  4CF1 A;  3F2K A;  2FBX A;  2UXC K;  3D6R A;  3VMF B;  1LAW A;  1SL0 A;  3CCR N;  1QQO A;  1W2B M;  3ATU A;  1FW6 A;  3GOI A;  1KVA A;  4J2D A;  1RBT A;  1JLC A;  1RT3 A;  3LAK A;  3KLG A;  1JCF A;  4H5W A;  1NK6 A;  5BN9 A;  1SV5 A;  3OVN A;  2HNZ A;  1EWR A;  4I2Q A;  4Z0U A;  2BE2 A;  3HRG A;  4AHT A;  4CES A;  1S72 N;  5BRD A;  4IOA L;  3P39 A;  4DTO A;  3SNN A;  3HXM A;  3AVF A;  1RFQ A;  2QTD A;  4BRL A;  3A2F A;  2D0A A;  4LF8 K;  3K59 A;  4FWM A;  5FPE A;  1YUW A;  1Q86 O;  1N5Y A;  3AVH A;  1XMO K;  4LH5 A;  2F9T A;  2GWJ A;  3A5M C;  1X9S A;  3ULE A;  4JD2 A;  5LJV A;  4DTS A;  1ASU A;  3OYN A;  4IJA A;  4HTL A;  1VSH A;  1RTI A;  2G8K A;  2QWQ A;  3JS6 A;  1KVB A;  2E2Q A;  2A42 A;  3SV4 A;  4GKJ K;  1NWK A;  4DQQ A;  4GVE A;  5T7B A;  4XH1 A;  4CGJ A;  4OKK A;  2KKZ A;  1HNX K;  2A6A A;  3OHR A;  1C0F A;  5CZ2 A;  3UKU B;  2AJQ A;  4C1N K;  3F9M A;  3OYJ A;  3C6H A;  1NGB A;  2YNG A;  3TI0 A;  1X9J A;  5JS2 A;  1VK0 A;  4KI6 A;  2NRZ A;  3TAQ A;  5BR8 K;  3VEZ A;  4CER A;  3J7Y P;  3MCA B;  3DLK A;  5CE3 A;  1YTA A;  4AHV A;  2FSK A;  1C6V A;  2XY8 A;  1FK9 A;  3MDQ A;  4F2R A;  3J7Z O;  2HHX A;  3AVL A;  4CJT A;  2YX6 A;  4KPY A;  1WSE A;  1HNV A;  1U49 A;  2UUB K;  4CZM A;  2E2P A;  4MQ3 A;  3IG1 A;  1J53 A;  2VQE K;  4B3M K;  1C1A A;  3O1B A;  3LPU A;  3D45 A;  1VSE A;  4DV4 K;  3EEQ A;  4A5A A;  1BL3 A;  1LOT B;  1WSF A;  1OVY A;  1NK8 A;  5BRH A;  4O44 A;  4FM1 A;  3VA3 A;  3F5T A;  4N76 A;  1IBM K;  5IWA K;  4BR9 A;  3KK2 A;  3V9U A;  1FKP A;  2V7Y A;  1S5J A;  1TGO A;  3U3Y A;  3D2F A;  3R1X A;  2G8F A;  5KQD A;  2PYL A;  4J2A A;  4BE1 A;  3DLL L;  3BZC A;  1IKY A;  1Q9X A;  4FK2 A;  1JXE A;  4CF8 A;  3TAR A;  3CCU N;  4DLG A;  2DFE A;  3WXM B;  1HRH A;  1VQL N;  4B8A B;  5IT9 O;  3C6T A;  3VQ5 A;  3G71 N;  4DSF A;  1VRT A;  3RSE B;  2HHT A;  2YJF A;  2D5R A;  1QZ6 A;  4ZTJ A;  4OLA A;  3EZ5 A;  5AQS A;  4C23 A;  4BDP A;  3WNH A;  1SKR A;  3L8B A;  3M8R A;  4UQG A;  1FJG K;  3ENO A;  4ILG B;  3OA9 A;  4FCY A;  2NRX A;  3ENH A;  4BR0 A;  1VQ4 N;  4JKG A;  2FBV A;  4KI4 A;  4U67 L;  2HMI A;  3KD1 E;  1XNQ K;  1CXQ A;  1WAF A;  1HMV A;  4DTM A;  1NGJ A;  2P9P B;  1RDU A;  3NFA A;  3E66 A;  5AQY A;  4BRM A;  4FWO A;  4G9Z A;  3H1V X;  4BG9 A;  2IC3 A;  1LCU A;  3TTC A;  1GOB A;  3HTV A;  1KLM A;  4CBX A;  1HQU A;  3IUC A;  5FPM A;  4CVN E;  2FF3 B;  1DTT A;  2V51 B;  4ICL A;  4FJI A;  3U3G A;  2IVN A;  1BOT O;  3VGK A;  4DKW A;  5AZI A;  4J2B A;  4E7K A;  3H3N O;  1BA0 A;  1HKB A;  2QKK A;  3F9K A;  1NKB A;  4W5R A;  1I3A A;  4H5T A;  1YAG A;  1HX1 A;  4AM6 A;  4OVL A;  3K5M A;  1RIL A;  1VSJ A;  3EYZ A;  4H8K A;  2WC9 A;  2A41 A;  1L5U A;  3HO1 A;  5LL6 Z;  1C0M A;  3HPO A;  2KTQ A;  1BIU A;  2HST A;  3PSF A;  3NVK A;  3O6W A;  3HJF A;  1MWK A;  2KFZ A;  2AP1 A;  3VF4 A;  4AHS A;  2G8H A;  4E1J A;  5J2Q A;  3OYL A;  1JLG A;  1TVR A;  2P9L A;  3DM2 A;  4KV8 A;  3L2W A;  3G4S N;  4F3O A;  3MWT A;  1BUP A;  3HBT A;  3OYF A;  3EE8 A;  3THY B;  2BGG A;  4WFN L;  3NMU A;  4K0K K;  2FXU A;  3OYH A;  4DTR A;  1RDA A;  3IAY A;  3L4I A;  1B9D A;  3WXK A;  4DFK A;  3QFU A;  1BI4 B;  4O8U A;  3J8A A;  4BDY A;  4CJE A;  2FBT A;  5HRR A;  3UE5 A;  2E20 A;  4CZI A;  4Y1C A;  3F73 A;  4FJG A;  1XMQ K;  3IFR A;  3OYM A;  3ZCM A;  2F4V K;  3FZL A;  3LP1 A;  4F9O A;  3OS2 A;  3WQT A;  2VWB A;  1VRU A;  1W97 L;  4KHY A;  3EKU A;  4BVP A;  4GY2 B;  4JK7 A;  3MEC A;  5JLF A;  2O8C A;  5ELZ A;  1HNZ K;  3C6A A;  4K8X A;  2HF4 A;  3OS1 A;  3E9O A;  1G99 A;  1NK9 A;  3O9S A;  4DU1 A;  2PZS A;  1NJY A;  1D8Y A;  1W9H A;  2P51 A;  2HF3 A;  2QK9 A;  3ZX2 A;  3KK3 A;  4JKG B;  3LAL A;  2X74 A;  1YHQ N;  3I0R A;  4M41 A;  1NMD A;  3GBT A;  4B1V A;  4N5S A;  4LFA K;  2GTD A;  4CZL A;  2YCH A;  3T1Y K;  2QXL A;  2HW3 A;  4M3X A;  2P9U B;  4CED A;  3PSI A;  5J2P A;  1HNW K;  2Q2R A;  3Q7B A;  2P9L B;  4DV2 K;  2A1S A;  4JK9 A;  1NOY A;  1BDG A;  3N4Q A;  3AAQ A;  4CEB A;  3W0L A;  5SZT A;  3LZI A;  2NRT A;  4WYB A;  4CHN A;  3AV9 A;  2YKM A;  4C8K A;  2CH6 A;  1ZBL A;  2KW4 A;  5A2Q O;  3HPG A;  4H4M A;  4CEF A;  3J80 O;  4QAG A;  4DQS A;  3GG4 A;  4BG8 A;  4DSJ A;  5SWM A;  1VQ9 N;  3AVI A;  1N33 K;  4FYD A;  2GWK A;  3O9U A;  2ZF5 O;  1QE1 A;  4GMJ B;  1BU6 O;  1BO5 O;  3K58 A;  2YKN A;  4MO4 A;  1Q18 A;  2ZE2 A;  3LWL A;  4KO0 A;  1A5V A;  3MN6 A;  3T1A A;  5EX5 A;  3O4N A;  4CF0 A;  2QWR A;  3GL1 A;  3NH1 A;  5AQM A;  1BIZ A;  4CZK A;  4KBO A;  2HVH A;  1U48 A;  1N36 K;  3L0Q A;  3MED A;  3CM6 A;  4ZTF A;  4BWM A;  3T19 A;  5KGX A;  3VQP A;  4B3O A;  1U47 A;  3AVN A;  4B1X B;  1D4X A;  3PX0 A;  3FZM A;  3P5J A;  4CFA A;  3CJB A;  2BTF A;  3WXI A;  3DRS A;  3FFK B;  3VQ6 A;  4IO9 L;  3SUN A;  5M1Q A;  2VCP A;  5J2M A;  1CZ9 A;  3MXM A;  4AM7 A;  3O80 A;  1KC8 O;  3CHW A;  5KGW A;  3D7E O;  1N34 K;  5AQI A;  3G10 A;  1DGK N;  1XC9 A;  4H0T B;  1WSJ A;  4G1Q A;  4KHW A;  4IEE A;  3QIN A;  2P1J A;  4HUE A;  2P9S B;  1KXP A;  4FZY A;  2UUA K;  1KTQ A;  3HPH A;  5M1F A;  4JAX A;  4A62 A;  4FZZ A;  4YFU A;  3L4Q A;  2P5O A;  4DV3 K;  3VQ9 A;  1NLV A;  4A61 A;  1J54 A;  2Z1H A;  3NF8 A;  4J8F A;  3CPE A;  1BIS A;  1SL2 A;  4IBN A;  1HR0 K;  4FWN A;  5AQO A;  1ZBF A;  2ETJ A;  3LDO A;  1TAU A;  3E9L A;  3O5B A;  3PUF A;  2OAN A;  4ZHR A;  2GUI A;  5M1P A;  1RDB A;  1NK4 A;  1VSI A;  5B8H A;  2RPI A;  4ELT A;  3H3O B;  3J81 O;  3UKR B;  4KAZ A;  4I7F A;  2IVP A;  3G0Z A;  4NXN K;  4FLT A;  1QQC A;  1RT6 A;  1VAZ A;  4CJV A;  4Z94 A;  4IKF A;  2ZWH A;  3DLH A;  2PYJ A;  5TKY A;  3DWL A;  2G8U A;  3B6O A;  4RW4 A;  4KB0 A;  3VQ7 A;  4FVU A;  4DR4 K;  2GEM A;  4BDZ A;  1KAX A;  3H45 C;  3MXI A;  2QKB A;  1RT4 A;  3KD5 E;  4W5O A;  1XC3 A;  5CZ1 A;  2OTJ N;  4Z4I A;  2VG6 A;  3MX2 A;  3K57 A;  1K8A O;  4OKE A;  4DR3 K;  1Q81 O;  3THY A;  3DLB A;  3AO3 A;  3M8P A;  3WNF A;  3C0B A;  5KI6 A;  4F2S A;  4RTF D;  1T8E A;  4JI2 K; 
#chains in the Genus database with same CATH homology
 3PO5 A;  5DK5 A;  2X6N A;  4CHY A;  1B92 A;  2XY7 A;  4EZ9 A;  1VSH A;  4HHT A;  4H4O A;  1CLQ A;  1S9G A;  4CK1 A;  1RTI A;  2G8K A;  1ASW A;  2D0B A;  2W42 A;  4E89 A;  4M42 A;  2WOM A;  4PUO A;  4O55 A;  1KVB A;  4O5B A;  3SV4 A;  3QEX A;  1WNS A;  1C1C A;  4DS5 A;  4DQQ A;  4DFP A;  5T7B A;  2E4L A;  2O4G A;  2G8I A;  1D9D A;  3PO4 A;  4CGJ A;  4OKK A;  1X9M A;  4FLV A;  1NKE A;  1RBR A;  4RW9 A;  2ATQ A;  5CYQ A;  1VSK A;  2BDP A;  3AA2 A;  3C95 A;  5FRO A;  3SI6 A;  5CZ2 A;  1XHX A;  2AJQ A;  1TK8 A;  4B9L A;  3V9S A;  3K5O A;  3OYJ A;  1IKX A;  1LW0 A;  3EY1 A;  4E3S A;  4C8L A;  2YNG A;  4KHN A;  1QTM A;  3TI0 A;  1RT2 A;  1TKT A;  1U04 A;  3KJV A;  5JS2 A;  2A1R A;  1VK0 A;  4KI6 A;  2G8W A;  2IS3 A;  4CJ3 A;  3TAQ A;  4W5N A;  2F8S A;  1EET A;  3QES A;  1RT1 A;  4NYF A;  4E1M A;  1FKO A;  1YT3 A;  2RF2 A;  4CER A;  5HRS A;  1RBU A;  3OYB A;  3QER A;  4F4K A;  4FK0 A;  2JGU A;  4I9L A;  4JRP A;  3CM5 A;  3RWU A;  3DLK A;  5EU7 A;  2QXF A;  1YTA A;  3NF6 A;  1GOC A;  5I42 A;  3HVT A;  4AHV A;  4DTU A;  4C8O A;  1N6Q A;  4RW8 A;  1LWF A;  4M3Y A;  1C6V A;  2XY8 A;  1JL2 A;  2Z1G A;  1FK9 A;  3AA3 A;  1L3T A;  1XWL A;  4FK4 A;  2DFF A;  1HPZ A;  4F2R A;  4L8R B;  2HHW A;  3LWM A;  2KZM A;  3L2Q A;  3AVG A;  1EP4 A;  3AVL A;  3QIP A;  1NK0 A;  2HHX A;  1UAX A;  4CJT A;  5E41 A;  4CK2 A;  3QEI A;  4FJX A;  4KPY A;  5KRS A;  3NH2 A;  4M45 A;  3CQ8 A;  4FVM A;  1WSE A;  1HNV A;  3AO2 A;  1U49 A;  1JLF A;  3ZT2 A;  1S1W A;  1S1X A;  4MQ3 A;  3O3G A;  3QET A;  3KLH A;  5C42 A;  3CYM A;  5K14 A;  1NJW A;  3IG1 A;  1J53 A;  1C1A A;  4O0J A;  3E01 A;  3LPU A;  4IFY A;  3D45 A;  4CJ5 A;  1VSE A;  3ZSZ A;  3QNO A;  1BL3 A;  3BGR A;  1Z26 A;  1WSF A;  4E7L A;  1NK8 A;  4HUG A;  4FW1 A;  4O44 A;  3NE6 A;  3NDK A;  4FM1 A;  3VA3 A;  4DU3 A;  1NJX A;  1WN7 A;  2XY5 A;  4JRQ A;  2KZZ A;  3NH0 A;  2HND A;  4N76 A;  4FLW A;  3LZJ A;  2IOC A;  3KK2 A;  3V9U A;  1FKP A;  4GW6 A;  4CIE A;  3SPY A;  1S5J A;  3V6D A;  4B9S A;  4CCH A;  1TGO A;  3U3Y A;  1RTJ A;  2G8F A;  1WSH A;  2PYL A;  4J2A A;  1SL1 A;  4BE1 A;  4KHQ A;  3HYF A;  4CJU A;  4DU4 A;  1IKY A;  1Q9X A;  4FK2 A;  1S1V A;  1TL1 A;  1KVC A;  1TKZ A;  1JXE A;  4CF8 A;  4AIL C;  3PV8 A;  3TAB A;  3TAR A;  2B6A A;  2B5J A;  1KRP A;  1BI4 A;  3KK1 A;  4DLG A;  2DFE A;  1HRH A;  4F8R A;  3QLH A;  4B8A B;  3C6T A;  3VQ5 A;  1NK5 A;  1VSF A;  4KHU A;  4DSF A;  1VRT A;  4KHW A;  2HHT A;  1KFD A;  1HYZ A;  4HTU A;  3RTV A;  2D5R A;  1UA0 A;  2VG5 A;  3TAP A;  1X1P A;  4ZTJ A;  1T7P A;  5FRM A;  3ZSO A;  3EZ5 A;  4OLA A;  4CF9 A;  4AH9 A;  1ZYQ A;  4BDP A;  1REV A;  3WNH A;  1SKR A;  4KTZ A;  2ZQB A;  3L8B A;  3RR7 A;  2F96 A;  3ZT1 A;  3OYG A;  3M8R A;  3RRH A;  4UQG A;  5D3G A;  4ELU A;  3ZT3 A;  1A5W A;  1T05 A;  1HNI A;  4FXD A;  4YNQ A;  2HNY A;  3OS0 A;  4DF4 A;  3AA5 X;  3NF9 A;  4DQR A;  4FCY A;  4CJW A;  2OPS A;  4BAC A;  3ZT0 A;  1R0A A;  3V1R A;  3RMB A;  2FBV A;  3V9Z A;  4KI4 A;  5HRN A;  4W5T A;  1ITG A;  3TWH A;  3ZSY A;  3NCI A;  3V1O A;  2HMI A;  1GOA A;  3KIO A;  2WON A;  3KD1 E;  1CXQ A;  1WAF A;  1HMV A;  2HHS A;  1Z25 A;  3NGI A;  4DTM A;  3PX6 A;  3HVR A;  1UWB A;  1NJZ A;  3QNN A;  3PX4 A;  3NFA A;  4AHC A;  1VSL A;  1F21 A;  4DTP A;  1QHT A;  3SQ1 A;  2RKI A;  1EXQ A;  2DTU A;  2BAN A;  1SUQ A;  4E7I A;  1C0T A;  2IC3 A;  1GOB A;  1KLM A;  1WSG A;  1HQU A;  3B6P A;  3VQA A;  4OPK A;  3HP6 A;  1DTT A;  4ICL A;  2XHB A;  4FJI A;  3U3G A;  3DI6 A;  4F3T A;  4OGC A;  1JLE A;  3KLI A;  4E7K A;  1KLN A;  4J2B A;  4B9N A;  3ITH A;  4FW2 A;  2XRI A;  4CFD A;  4CHP A;  2QKK A;  3SQ2 A;  3F9K A;  1NKB A;  4FJ7 A;  4W5R A;  3L2U A;  4DF8 A;  3AO5 A;  4CIG A;  1LWE A;  1I3A A;  4Y1D A;  4CHO A;  4BWJ A;  3SQ0 A;  5J2N A;  1JLA A;  3UIQ A;  5HP1 A;  1C0U A;  4DTN A;  4CF2 A;  4DTJ A;  4OVL A;  4CEA A;  3K5M A;  4M3U A;  1CXU A;  1G15 A;  1RIL A;  1VSJ A;  4E19 A;  3EYZ A;  3NBP A;  4FLU A;  3SQ4 A;  4IG3 A;  4H8K A;  1TV6 A;  4FJL A;  1L5U A;  1D5A A;  4CJQ A;  4CIF A;  3HO1 A;  3D0P A;  4FJ9 A;  3PY8 A;  4N41 A;  2Z1I A;  2GBZ A;  3LP0 A;  1C0M A;  3HPO A;  4O0I A;  3ZSR A;  4OPJ A;  1BIU A;  2KTQ A;  4CGG A;  4DFJ A;  1Q8I A;  4PY5 A;  3LDS A;  3NF7 A;  1YVU A;  4JS5 A;  3HJF A;  4I2P A;  2KFZ A;  5HLF A;  4IDK A;  3TAM A;  1BQN A;  2FBY A;  4AHS A;  2G8H A;  2OA8 A;  1S9E A;  4CGD A;  3OYE A;  5J2Q A;  1J5O A;  1KSP A;  2OPR A;  5C24 A;  3OYL A;  1JLG A;  1TVR A;  3DM2 A;  3AVA A;  3M8Q A;  4KV8 A;  3ZSV A;  3CG7 A;  3IRX A;  3L2W A;  3P1G A;  4DS4 A;  4RW7 A;  3MEE A;  2ITG A;  4F3O A;  1HJR A;  4B9V A;  2I5J A;  2OYQ A;  4NCG A;  4MFB A;  3ASM A;  1IH7 A;  3OYF A;  4FLZ A;  3KLF A;  2BGG A;  1QSL A;  3KKS A;  3OYD A;  2HB5 A;  3OYH A;  3MAQ A;  4DTR A;  1RDA A;  3AO4 A;  3V4I A;  1IKW A;  3SJJ A;  2D0C A;  2E6L A;  3HM9 A;  1LWC A;  4DSE A;  1RBS A;  4LH4 A;  3IAY A;  1UOC A;  1B9D A;  3THV A;  4DFK A;  1BI4 B;  1RT5 A;  4BDY A;  4CJE A;  1W0H A;  2FBT A;  3NGY A;  5HRR A;  4Q0B A;  3S3M A;  3ULD A;  1DTQ A;  2B4J A;  4Y1C A;  3V9X A;  3F73 A;  2Y1I A;  4FJG A;  3AO1 A;  3RMA A;  4DWI A;  3OYM A;  3OJU A;  4W5Q A;  3ZCM A;  1ZBU A;  4B9M A;  1RBV A;  4PA1 A;  4FJK A;  3LP1 A;  4KKO A;  2X78 A;  4CK3 A;  3OS2 A;  1VRU A;  3WNE A;  4LSN A;  1MU2 A;  4HCB A;  4LD0 A;  4KHY A;  2YNH A;  1HYS A;  1HQE A;  4N56 A;  3OYI A;  2JLE A;  2Z1J A;  4EP4 A;  2F8T A;  3MXJ A;  3MEC A;  1K6Y A;  4GVM A;  3SUQ A;  4DFM A;  4BE2 A;  1B9F A;  5HBM A;  4K8X A;  3L3V A;  3OS1 A;  1TK0 A;  1NK9 A;  5JS1 A;  3ZSQ A;  3VQD A;  4CEO A;  4DU1 A;  1WLJ A;  1NJY A;  1D8Y A;  2PZS A;  1SKS A;  1W9H A;  2P51 A;  4CJK A;  4B8C A;  1BHL A;  4E1N A;  3OJS A;  3KLE A;  4Z4H A;  4DSL A;  2QK9 A;  4CEQ A;  1BQM A;  3KK3 A;  3LAL A;  2X74 A;  4I9Q A;  4OGE A;  3ISN C;  3VQE A;  3RR8 A;  2Y1J A;  4DSI A;  4LY7 A;  3I0R A;  4B08 A;  4M41 A;  5C25 A;  1FXX A;  1J9A A;  3C6U A;  4XIU A;  3RMD A;  4DLE A;  4KB1 A;  3S3O A;  3SYZ A;  3C94 A;  4FLX A;  4OKJ A;  4N5S A;  1Y97 A;  1DLO A;  1JXB A;  3L2R A;  4HVJ A;  1XI1 A;  3L3U A;  1NKC A;  3VQ4 A;  2YNF A;  4Z4F A;  2PY5 A;  3AVK A;  2VG7 A;  4O4G A;  4QOZ B;  1EX4 A;  3HP9 A;  2NUB A;  2RN2 A;  2YHB A;  5CYM A;  4B9T A;  2HW3 A;  3DLE A;  4K8Z A;  1TKX A;  4FLY A;  1BCM A;  3SZ2 A;  4M3X A;  4Z4E A;  3VQB A;  4CED A;  4DMN A;  1O1W A;  2YV0 X;  3VQQ A;  5HRP A;  3AVC A;  3L2V A;  2VWJ A;  3SV3 A;  5J2P A;  5FRN A;  2LSN A;  1SKW A;  3SPZ A;  4WE1 A;  2OZM A;  2A1S A;  1JKH A;  1RCH A;  3FFI A;  3ZSW A;  3VQC A;  2O4I A;  1EKE A;  1U4B A;  1NOY A;  3K2P A;  1Q9Y A;  1ZBI A;  3OY9 A;  1HYV A;  5HRO A;  3TR8 A;  4CEB A;  4Z4C A;  5SZT A;  3VA0 A;  4FJH A;  3LZI A;  2EX3 A;  4E7H A;  3DLR A;  1TL3 A;  1RDD A;  1XHZ A;  4CHN A;  2VWK A;  4CGF A;  3AV9 A;  1C1B A;  2YKM A;  4CJP A;  4C8K A;  3QO9 A;  1ZBL A;  4CFB A;  2KW4 A;  2YNI A;  3HPG A;  4H4M A;  4CEF A;  4QAG A;  4DQS A;  4LSL A;  4DSJ A;  3DOK A;  5SWM A;  4CJ4 A;  3AVI A;  4CJL A;  4FYD A;  4CE9 A;  1UA1 A;  1NOZ A;  1KCF A;  2GV9 A;  5KRT A;  1ASV A;  4CHZ A;  3BDP A;  1QE1 A;  3LP3 A;  3O3H A;  4GMJ B;  3S3N A;  3K58 A;  4HCC A;  4OLB A;  1BCO A;  1I39 A;  3HL8 A;  3ALY A;  4M3R A;  3LPT A;  2YKN A;  4FJM A;  3U6F A;  2ZE2 A;  3LWL A;  1TKD A;  4QCL A;  4KO0 A;  1A5V A;  4E7J A;  1A5X A;  4RW6 A;  3DRP A;  3T1A A;  3O4N A;  4JLH A;  3DLG A;  4CF0 A;  3P83 D;  5J1E A;  1TAQ A;  3NH1 A;  2KFN A;  4B9U A;  3CFR A;  4DG1 A;  2G8V A;  1BIZ A;  5DMR A;  3OYC A;  1JLQ A;  3VN5 A;  1RDC A;  1T03 A;  1U48 A;  2HVH A;  4EP5 A;  1QS4 A;  3V9W A;  4M3T A;  3MED A;  3CM6 A;  5KTQ A;  4BE0 A;  3ZT4 A;  3ZSX A;  4ZTF A;  4NCB A;  4KRE A;  3HT3 A;  4IG0 A;  4CGH A;  4BWM A;  1S6P A;  3T19 A;  3CFP A;  5KGX A;  1S1U A;  3VQP A;  4AHR A;  4B3O A;  1U47 A;  3I8D A;  3AVN A;  2FC0 A;  3QIO A;  1KFS A;  3PX0 A;  3P5J A;  4C8N A;  3HST B;  4CFA A;  2DY4 A;  1RTH A;  3JYT A;  3S9H A;  5CY4 A;  3LAN A;  3JSM A;  4DQI A;  4IFV A;  1L3U A;  2OPP A;  3NHG A;  3DRS A;  1JLB A;  2IAJ A;  3KKR A;  4KTW A;  1VSD A;  1NK7 A;  3VQ6 A;  1L3V A;  3SUN A;  4KRF A;  4ID1 A;  5J2M A;  1CZ9 A;  3MXM A;  4NYN A;  2KQ2 A;  3IS9 A;  2HHU A;  3TAN A;  1S6Q A;  3H08 A;  5KGW A;  4CEE A;  5I3U A;  4CGI A;  3G10 A;  2ZD1 A;  1XC9 A;  5FDL A;  1WSJ A;  1BGX T;  4G1Q A;  3TAF A;  3QIN A;  3KTQ A;  2P1J A;  3AVJ A;  2OPQ A;  3DMJ A;  4CEC A;  4HUE A;  3AVB A;  4FZY A;  1YTU A;  2E6M A;  3AA4 A;  1RTD A;  1CZB A;  1KTQ A;  1RNH A;  3HPH A;  3QEW A;  4KFB A;  1S1T A;  3K5L A;  2XY6 A;  4FZZ A;  4Z4G A;  4YFU A;  4PQU A;  4ID5 A;  4FJ8 A;  2P5O A;  4M3W A;  3VQ9 A;  4N47 A;  2HHQ A;  1WSI A;  3CFO A;  3DRR A;  1IG9 A;  4DSK A;  1J54 A;  2Z1H A;  3NF8 A;  1ZBH A;  4TSX A;  3WNG A;  3TAG A;  1BIS A;  4DQP A;  1LV5 A;  3LAM A;  1SL2 A;  4IBN A;  4CFC A;  1U45 A;  2P5G A;  4R5P A;  4CF1 A;  3K5N A;  2FBX A;  3LP2 A;  3V81 A;  3M8S A;  1LAW A;  2YHA A;  1ZBF A;  2ETJ A;  1SL0 A;  4J2E A;  1TAU A;  4KHS A;  1LAV A;  4ZHR A;  3PUF A;  2GUI A;  2DFH A;  1WAJ A;  1KVA A;  1RDB A;  1NK4 A;  4J2D A;  1RBT A;  4FZX C;  1VSI A;  1JLC A;  1RT3 A;  3LAK A;  1TK5 A;  2RPI A;  3KLG A;  4Q5V A;  4OJR A;  4ELT A;  4PWD A;  1IKV A;  3T3F A;  4KAZ A;  4I7F A;  3O3F A;  2R7Y A;  3MEG A;  3SUO A;  3G0Z A;  1NK6 A;  4M3Z A;  2X6S A;  3VQ8 A;  1SV5 A;  4FLT A;  3OVN A;  2HNZ A;  4I2Q A;  4Z0U A;  1RT7 A;  4AHU A;  3OYK A;  1D9F A;  1QQC A;  2BE2 A;  4FJN A;  1RT6 A;  4FJ5 A;  4CJV A;  4AHT A;  4CES A;  4IKF A;  4KTQ A;  4DTO A;  4C8M A;  3HXM A;  3AVF A;  3SNN A;  2OZS A;  4FJJ A;  2IGI A;  2HHV A;  3DLH A;  2PYJ A;  2EHG A;  1QSS A;  4CHQ A;  1IO2 A;  3DOL A;  3A2F A;  2D0A A;  3RMC A;  3B6O A;  4DTX A;  2G8U A;  3K59 A;  4JS4 A;  4HUF A;  4RW4 A;  4KB0 A;  3OYA A;  2Q3S A;  3VQ7 A;  3SCX A;  1N5Y A;  4BDZ A;  2XO7 A;  2IDO A;  4CJF A;  4FM2 A;  4EZ6 A;  3AVH A;  3SUP A;  1L3S A;  4LH5 A;  4CJS A;  3MXI A;  2QKB A;  4RG8 A;  1RT4 A;  4CEZ A;  4W5O A;  3OYN A;  3KD5 E;  5CZ1 A;  3O4Q A;  1JL1 A;  3NAE A;  1X9S A;  2VG6 A;  4Z4I A;  3K57 A;  3I0S A;  4OKE A;  3QEP A;  3QEV A;  3TAE A;  4ELV A;  4E0D A;  4CJR A;  2HVI A;  3AVM A;  3DLB A;  3DYA A;  3AO3 A;  3M8P A;  3RRG A;  4DTS A;  3WNF A;  4NCA A;  1ASU A;  4FM0 A;  5KI6 A;  1VSM A;  1LW2 A;  1T8E A;  1QSY A;  1X9W A;  4F2S A;  3HK2 A;  3NGZ A;  3V1Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...