2Z1NA

Crystal structure of ape0912 from aeropyrum pernix k1
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
260
structure length
237
Chain Sequence
MDLGIQGKLAVVTAGSSGLGFASALELARNGARLLLFSRNREKLEAAASRIASLVSGAQVDIVAGDIREPGDIDRLFEKARDLGGADILVYSTGGPRPGRFMELGVEDWDESYRLLARSAVWVGRRAAEQMVEKGWGRMVYIGSVTLLRPWQDLALSNIMRLPVIGVVRTLALELAPHGVTVNAVLPSLILTDRVRRIPMGRVGKPEELASVVAFLASEKASFITGAVIPVDGGAHI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A unique catalytic triad revealed by the crystal structure of APE0912, a short-chain dehydrogenase/reductase family protein from Aeropyrum pernix K1
pubmed doi rcsb
source organism Aeropyrum pernix
molecule tags Oxidoreductase
molecule keywords dehydrogenase
total genus 89
structure length 237
sequence length 260
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2z1nA00
1PL6A 5JC8A 4CV1A 2NVBA 2PY6A 3H5RA 4G81A 1HDRA 1BXKA 1XWFA 3C7AA 4WLEA 3COSA 3H8VA 5ES3A 1KEUA 5CDYA 4CQMD 4E32A 1AGNA 2I3AA 3WWZA 1XA0A 2Y1DA 2Y66A 4S3MA 2P2SA 2UUOA 2NUAA 2Y99A 2YQ4A 4U0JA 4C4OA 4ID9A 4Y6PA 4J90A 1TA4A 1CQJA 3C1OA 1PGPA 4RO0A 1OC2A 4O1MA 4BO7A 2JCXA 3I83A 1AHIA 4CMHA 1A7AA 3KEQA 1ENOA 2RCYA 5TT0A 4CR8A 2B35A 2YJZA 1BDMA 4Q3AA 3CPSA 3FNGA 1CQIA 4NFSA 1KVQA 3WMXA 4IY1A 4NH4A 5IZ4A 3GR6A 3OEWA 3L77A 1DRWA 1P1RA 1V0JA 3GGOA 4TQGA 4FSHA 3KBOA 1AE1A 1JKFA 1EMDA 3MTJA 3PJEA 1DFHA 4RDIA 4XA8A 5BNFA 1VSUA 3WTBA 3WGTA 3AY7A 4IDEA 4ND5A 1XQ6A 1C0LA 2E37A 2PKQP 4W6ZA 4YT2A 1NP3A 5A4DA 3IJPA 1YQDA 4LGVA 4A27A 1T4BA 5JYEA 3Q0EA 4E13A 3AY3A 3X2EA 3GVIA 3IDSA 1E3LA 1R4MB 5KVVA 2VWQA 4Y9DA 5AVOA 1NTOA 4TKMA 5C5IA 2P68A 1CRWG 1DFIA 3FCOA 5H83A 3BYZA 3EHEA 2EIHA 3WBFA 1GYRA 3TPCA 3RC9A 4DC1A 2HU2A 4H7PA 4W4TA 1VJ0A 2EGGA 2V6BA 4XX0A 3ZGYA 4B4WA 3ANNA 5CAEA 5JC1A 1HWYA 3PWKA 1HZJA 4XYEA 3ZWAA 1K6XA 1GUYA 2GPTA 4X54A 1XYGA 3AI3A 4KDFA 3LLSA 2HK7A 2JL1A 4WASA 4DMLA 2HJRA 2EJVA 4U5QA 2QRKA 4XD2A 2YQ5A 1XIVA 4D0RA 1GPJA 1G0OA 4R01A 1NHGA 4R41A 2EP7A 2IEDA 3BMQA 2ZTLA 5TJHA 2VWPA 1UXKA 5TIIA 3EVTA 4BMNA 3QQPA 3VPXA 3FSRA 1XDWA 3DOOA 5MGBA 1U9JA 2PH3A 3FD8A 4R9SA 1ML3A 1VE9A 2GRAA 2XAAA 1C0IA 1N9GB 4FFMA 4H16A 4XQGA 2B4QA 1OOEA 3QP9A 4NZ9A 4QEDA 1YS4A 3UAGA 1ONNA 4YT4A 1P77A 2PTGA 4AJPA 1YO6A 4M1QA 4YAKA 4XYBA 1KEWA 2C59A 3VZSA 3WWYA 4B7UA 1E6WA 2GN8A 3G1UA 3TQHA 5G4LA 3A06A 5I7EA 1Q0LA 1VJ1A 4J4TA 2NQTA 3NGXA 2I3GA 5MDHA 2O50A 3WIDA 4WCFB 4AJ1A 4CR7A 3JD0A 2ZQZA 3K30A 1MLDA 2EG9A 3E9QA 4XCVA 4Y8VA 4JK3A 2NVWA 1MG0A 4B4VA 4RJTA 4PZDA 4PLGA 1LX6A 3IMFA 3PHJA 3UW3A 1K2WA 2CDBA 5H82A 3V1TC 4HFMA 4R9RA 3F3SA 3HFSA 3NJ4A 3RQSA 2XF8A 3TL3A 4DBZA 2VYND 2D4AA 4RF2A 4YCAA 1IPEA 1PJ2A 1VI2A 4M55A 1YL5A 3W4KA 4DLAA 1YWGO 1WZEA 2AEJA 1JU9A 1YDEA 3FF4A 5IN5A 1PSDA 1UXIA 3GG9A 3NT4A 5A04A 3WGYA 4CLOB 3F1LA 5JW6A 3IUSA 3VH1A 4OM8A 1YB5A 1YBVA 3DBRB 5L4NA 3ENKA 1G1AA 2YFHA 1KY5A 4Z6KA 4UVEA 5KJCA 5A1TA 2FSSA 3PPIA 3RSHA 2PFGA 4ALLA 2A92A 1PJCA 2DTDA 4BV9A 1JKJA 1QKIA 4TZKA 4XIJA 4Z9FA 1GD1O 3AJRA 1EDOA 3I9MA 2CSUA 3CE6A 4EUFA 3L6EA 1DAPA 3HE3A 4XGNA 3D4PA 5ER6A 3ON5A 3D1LA 2Y67A 4GVXA 4OXNA 3WGHA 4MVJG 1EQ2A 3A4VA 1I10A 4J1SA 2H6EA 4E2WA 4E5MA 1D4FA 3D64A 2ZYDA 4CM6A 4R4JA 3U0BA 4O59O 1PR9A 3ZWBA 2JD0A 4ZRMA 1N1GA 4WLFA 4ALJA 2VZ0A 3GNQA 4E12A 4UUNA 4II3A 3U9LA 1W6UA 3U09A 2PZLA 1BTOA 1YVEI 3NX4A 1F8FA 3H9UA 1ZMOA 2DBZA 1D8AA 3AUSA 2V7PA 5EESA 4JXKA 2Q46A 3KEOA 3K92A 1RM4A 2ZTVA 1OAAA 2HMWA 5T8KA 3TZCA 3TZ6A 4G65A 2VYVA 1SOWA 3D3EA 1YKFA 1DAOA 1VM6A 2VWHA 2DPHA 3WQRA 4AJHA 4IJWA 3JD4A 4M49A 2I6TA 1ZZEA 4BKOA 1H6BA 2OP0A 2GZ3A 4CM7A 3E03A 1ZH8A 4MVJD 4OSOA 2BKAA 3ZHBA 2NU9A 2FZWA 4CLXA 3QRWA 3D0OA 4CV2A 3JQFC 1UZMA 1SNYA 1W0CA 1JWBB 2O3TA 1EFKA 5COBA 3RU9A 3OJEA 4LMPA 5EINA 2FPIA 1GFSA 3LC7O 4J2HA 3OETA 4KP7A 1DC5A 4RPKA 5KKAA 4J7XA 1KVSA 3B1JA 5B1YA 4YJHB 1Q7GA 2BH9A 1P1KA 3FBGA 1PZGA 4CM9D 4DIFA 1ZJYA 2Y93A 3RFVA 1RM5A 2HQ1A 1DIHA 3DDNA 4BL5A 3OF2A 3DL2A 1NQAO 3ZV3A 4LMRA 3TZKA 1ZUD1 1A5ZA 4L4SA 4HFNA 3PJGA 1LC3A 4WPGA 3UHAA 3GHYA 3OQ6A 3U62A 4HFRA 4RORA 2QW8A 4YJGB 4L0QA 4WLUA 3VPSA 1Q0QA 1PX0A 2ZIZA 1ISIA 2X86A 4LN1A 2SCUA 5G0WA 5TQVA 5BSFA 5JDIC 5EJ2A 5ICMA 4CV0A 4GVLA 5JMPA 5IZCA 3OQBA 3SJ7A 4MIOA 1BXZA 3RCBA 3D3WA 4Y98A 1T1RA 4D3SA 1GV1A 3BTOA 3PIDA 4RZIA 3C85A 2Q2VA 2D2IA 5KIAA 4R54A 1Z75A 1PTJA 1PZEA 4AJ4A 2Q1TA 2UYYA 1X7DA 4M89A 1ONOA 2OBNA 5HTOA 4QSMA 3CZRA 5AXAA 3GUYA 4PFJA 1U3TA 2NV6A 4P22A 4RGBA 4NNJA 2HUNA 3DBVO 2H63A 1PIWA 3L6DA 4GX5A 1L1FA 3AI2A 2V6MA 4DLBA 4FC6A 3BMCB 4FQ8A 4WUVA 4KUGA 4MVJE 3DZIA 2OUIA 4D0SA 5JAMA 4IGFA 1PGOA 1FDTA 4MIEA 2YHIA 4HXYA 2DM6A 4S1VA 1HE5A 1GAEO 2WM3A 4TVOA 5CG2A 4N7RA 3DMYA 3CXRA 1KC3A 4BNYA 3WJ7A 4PLTA 3JD1A 3F47A 3RBVA 1JA9A 1H94A 1TT5A 3GDGA 5TSDA 4Z3KA 1EDZA 5KJ1A 2X9NA 4N5MA 2B4RO 3FWZA 3E18A 2NNLD 4CM3A 3WGQA 2O3UA 4M54A 2CDAA 5L7YA 3DHEA 2GSDA 2O7QA 4J3FA 2NVUB 2NWQA 2F1KA 3I4CA 2NU6A 4FD3A 3O4RA 1EE2A 2Q3EA 1M76A 1QYCA 1P45A 1SB9A 1SEPA 2Q2WA 3C1AA 3JD3A 3MCVA 4FFPA 4FGSA 5F1KA 3ZWMA 1NYTA 3WQQA 4R1SA 5C3MA 2PD4A 2AG5A 4Q3BA 3GGGA 1LLDA 3INGA 3QSGA 4WOKA 2FY8A 3HN2A 4OMUA 4PLZA 1N2SA 1B15A 1NPYA 2J3HA 3BMNA 4IDBA 4OO3A 4XQEA 1OBFO 1E6UA 4CQLA 4FN4A 3ZW8A 5JAZA 1ZCJA 1ZKMA 4GX2A 3GEMA 2P5UA 2VZ8A 3NDIA 1PGQA 2PZKA 3DZHA 3UXYA 4AG3A 4IQ0A 4A7PA 1M66A 1V3TA 1EFLA 4CLOA 2PZJA 1ORRA 4CUJA 3SC6A 1GTMA 1F17A 2B5WA 2F00A 1IB6A 2Q1SA 3WTCA 3KB6A 4MPDA 2DBVO 4RZHA 1YL6A 2FWMX 4RPGA 3Q9UA 1ZK0A 2HK8A 5KTKA 5FI5A 1ADCA 2R6JA 3JQFA 4R1UA 5CG1A 1WP4A 4EW6A 5G0TA 1NNUA 3KV3O 3ZHYA 4AJEA 2NSDA 4XGKA 3WDSA 1M6WA 1U1IA 2DAPA 2X6TA 3LF1A 3PLRA 1PWXA 1EK5A 4QQRA 5CDSA 1NR7A 2GN6A 1KC1A 3PJFA 3GC6A 3OIDA 1R0LA 5CP8A 2X9VA 4DQXA 4DTIA 1X13A 3R0IA 1FDVA 1RWBA 4D3DA 2AE1A 1TT5B 4UVGA 3A14A 3IP1A 1LLCA 5L4LA 3K9QO 1ULSA 2IZ1A 1D1SA 2PK3A 3BTVA 3DZJA 4CMIB 3JYPA 1O94A 2CDCA 4XGIA 2YDYA 4DMMA 5ILOA 4A26A 5IN4A 2J5QA 4EZBA 1R15A 1MC4A 4RVHA 3EGOA 3STHA 4KQWA 2XOXA 1NQ5A 3D5TA 9LDTA 2JHGA 5BT9A 3K8ZA 1KVUA 5DBIA 3RUIA 3ORFA 1ISMA 8LDHA 2NTVA 4DQUA 4BNLA 1E92A 1BGVA 4CM9A 1U28A 4XJSA 1SEVA 4QX6A 4ZQGA 2E82A 3GY0A 5L7TA 4JBHA 1GCOA 3F5SA 2BI8A 3KVOA 2AEMA 4EEZA 3RAJA 4BO6A 1HTBA 2BGLA 1C1XB 4GSLA 3EC7A 2DC1A 4I5FA 1Y8QA 3GRKA 5HWSA 1IYZA 4PVDA 1C1DA 2IYOA 3QWIA 3R3JA 4LRTB 4E5PA 2CFCA 1Z7EA 4NFYA 4WEQA 3QHAA 5J23A 4ND1A 3KSUA 2DU8A 3PYMA 4ND4A 4PLCA 4BNMA 2VCYA 4D45A 5U1PA 3PVZA 1CF2O 3HSKA 4PCVA 3T4EA 2O23A 1P31A 1HRDA 1D3AA 2ZJ1A 2Q1WA 4WLOA 5COAA 3UN1A 1ZO8A 1G6KA 2FR0A 1UDCA 1XKQA 3GZNB 2QZ9A 4I5EA 3ZU5A 1MFZA 1LDGA 3WG9A 1BMDA 1X14A 3WSWA 1YJQA 3ZCXA 1VLLA 2X8LA 3MWDB 1J5PA 3WX0A 1UP4A 1NQOA 2AMFA 5G0UA 4BUCA 3L9WA 3FNHA 3JQ9A 4NJOA 4MVJF 4ESOA 5JFOA 4YJGA 4U8GA 3I9OA 1DC3A 1H5QA 5DULA 5AXCA 2FN7A 5G4KA 1RKXA 2C2XA 2VHWA 1FDSA 2WYUA 1H2BA 3GK3A 4P8RA 1I30A 2Q50A 3M6IA 2PWZA 4FS3A 1O6ZA 3KYBA 1X0VA 4L73A 3PXXA 1XSEA 2WE8A 3S2FA 4L4RA 4J49A 3ZV4A 4Z3DA 2ZYGA 3FI9A 1AXEA 2JCVA 2IE0A 3CH6A 4B7XA 5L40A 3K73O 4RVDA 2VN8A 1NVMB 5F5NA 3JQ7B 1NFRA 3CEAA 5DOVA 1SB8A 5L9AA 1Q0HA 1PGNA 3LQFA 1DC4A 2POQX 4J9VA 1MUUA 3EAGA 3EUWA 2P9CA 4A03A 3ASUA 3I4FA 2EV9A 3GAFA 2BGMA 2H1SA 4HBGA 1Z7BA 3B70A 3GGPA 1PL7A 3W1VA 2ZB8A 3BXXA 3PRJA 4KUEA 5HM8A 2A94A 1BRMA 1GZ3A 2W8ZA 2HCTA 9LDBA 2G17A 1LXCA 3BIOA 3LC2O 1R0SA 3GHHA 2JFFA 2FOIA 4J0EA 3WYEA 2GCGA 2YUTA 3AUAA 1NBOA 3GAZA 2FP4A 2EERA 1I32A 4ZJUA 3GG2A 3PGXA 4WCFA 5A05A 3IUPA 1T2FA 4EGFA 4IJKA 1ISFA 1H6AA 2PNFA 3LSYA 2Q4EA 2X5OA 1DLJA 2CVZA 3E5RA 1O95A 3WQSB 5KVQA 5FYDA 4O6VA 4PLFA 5TRTA 5A5EA 4XR9A 4GBJA 3JQCA 4QFCA 3ROQA 1PZHA 4PLPA 1DEHA 2QIOA 4AJLA 1AN9A 4I8XA 4BS9A 1P0FA 3I9JA 4E6PA 3ADPA 1P1IA 1YQXA 3IP3A 1X0XA 3ICPA 4JX8A 1DO8A 2DTXA 5HA5A 1AUPA 2ZATA 1CEQA 4IZIA 3MOGA 5TC4A 1CYDA 4YQYA 1DB3A 3ETEA 4IIUA 3O8QB 4PLVA 4RQTA 2PD6A 4IQGA 1LQTA 1TT7A 3ZWYA 3H5NA 1T26A 4BQRA 3I6QA 4PLYA 2BD0A 2G82A 4GLLA 2VWGA 3QVTA 2P4HX 4B4OA 1VRWA 4GQAA 1A27A 2P4QA 4EJ0A 3VZRA 4JCOA 3FR8A 4W9NA 3VHRA 1NAIA 1VJTA 3DFUA 4QXMA 4YRDA 5LDGA 3INRA 3PGJA 4KTTE 1C14A 1EUZA 3HB4X 2B83A 3LK7A 2C5EA 7ADHA 1SCUA 1QLHA 1LSSA 3ZH2A 1ZSYA 4D3FA 4IS3A 3RFXA 3QV1A 3DZGA 4UULA 3BMCA 4KWHA 1I36A 4DC0A 1WZIA 4EBFA 3RJ5A 4PZCA 1ZFNA 2LDBA 2XPCA 3C8MA 5JYDA 1R4NB 2RH8A 1KBZA 4K6CA 4RLHA 2AE2A 3HG7A 3MZ0A 5JBIA 3QY9A 1I3LA 3JSAA 1B3BA 1U2DA 3WS7A 3FN4A 4O0LA 5TJ9A 5BSEA 3AOEA 1RPNA 3AU8A 3RUFA 1UP7A 3RVDA 4GX0A 4OXYA 1QLJA 4QO8A 4CMBA 4FJ0A 3K31A 1X7HA 3W4JA 1I01A 4I5GA 4NQZA 1OMOA 5A3VA 3BMOA 3C3XA 2W2LD 1TEHA 1FMCA 3MJSA 4CMEA 4E31A 3OJOA 2GZ1A 3DOJA 3VH3A 1XLTA 2P9GA 1MC5A 1MA0A 3JQ8A 1JTVA 3LDHA 3GN2A 5A5FA 3Q1LA 3OJLA 1O9BA 1PWZA 2V6FA 1EUDA 1PS9A 4ZD6A 1U4OA 3QVWA 3GPIA 4Z9XA 1G0NA 1YOVA 1Y5MA 2X9GA 1LLQA 1J0XO 2BI7A 3JQ9C 4MINA 4RPHA 4L74A 4WCFC 3RU7A 3QW2A 4OKNA 3M1LA 5KCZA 4XDZA 4NBTA 4FBGA 3LZ6A 4PLHA 4A2CA 5THKA 1PQPA 4E21A 1E3IA 3GVXA 4R5MA 4BNIA 2GUGA 4CL8A 2W2KA 3VPFA 1YQGA 2CF6A 4TRMA 4DYVA 2RIRA 4NHEA 3ASVA 4CMCA 3TWOA 4CM4A 1P1HA 4OOFA 1WVGA 1K6JA 1PS8A 1R4NA 2IYPA 1E7MA 1KIFA 3V8BA 3NDRA 3IKTA 2BFPA 1LU9A 2GZ2A 3RWBA 3NTRA 3ONFA 2TMGA 3TFQA 2VNSA 4FFNA 3H9EO 3OMLA 4FW8A 4J4HA 1B0AA 1HDYA 4YAJA 4J0FA 4GMFA 2CUKA 1E0DA 3GEDA 1DPGA 3EMKA 4HV4A 4IJVA 1YL7A 1YDWA 4DPMA 4DIOA 4L9RA 1ZNQO 5I7FA 4ZQHA 3AWDA 3BTUA 1BVUA 1CETA 3VAZA 4URFA 3VVBA 3KZVA 5F1OA 1DHRA 5G2OA 4ZU3A 3ZWOA 2WD7A 4EYEA 3SVTA 1CWUA 4YJDA 3WGOA 3V1YA 3VOSA 2DUWA 1U8XX 1XR3A 1PJLA 1TLTA 2XXJA 5BSGA 3L4BA 5G0VA 2RAFA 2VHVA 2GNAA 1UZLA 4I9UA 3LT0A 3ICCA 4ITUA 5ICSA 5JCXA 2OHXA 4UUPA 4P4NA 3RUAA 3ZHXA 5U4QA 4RVSA 4C7KA 2I76A 3LU1A 2J3JA 2Q2QA 2OZPA 4FJ1A 1PZFA 3ZHZA 4E0BA 2VUSA 5IDXA 2Y0EA 3CINA 5F1PA 4E3ZA 4PG8A 4MJLA 3PHGA 4GWGA 3PQEA 4QFDA 1Y5RA 2FSVA 2GYYA 4WLVA 2I67A 4BO0A 1YOVB 1EBUA 1W8DA 5JO9A 1KEPA 2W2KB 2QRJA 4HX5A 3RROA 3ONEA 1JKIA 1LRJA 1Y9EA 4YT5A 5TX7A 4CMGA 3MEQA 3PEFA 4FGWA 1ZXLA 1A9ZA 4OL9A 3RC1A 4TSKA 4UUMA 2NTJA 3GFGA 5T5QA 1WMAA 3PQDA 5B4VA 1MB4A 2EHDA 2A35A 5GMOA 2WJPA 3INTA 1B2LA 5CPFA 4WNCA 5ENDA 1DBVO 1N9GA 1Y8RB 3ANMA 5KVSA 2V65A 4G2NA 2WDZA 4XYGA 1NHWA 2W2LA 3AM5A 2A4KA 4PLWA 3UGKA 3GUCA 3IC5A 4ZQEA 3G49A 4K26A 3JD2A 4CLEA 1FDUA 1E6EA 2GD1O 1F12A 2HRZA 3ROPA 5I9LA 1UXHA 2JKVA 4ALNA 2PGDA 1LRLA 3E6AA 2GO1A 3DB2A 3HDHA 3DQPA 3IJRA 3NRCA 3S1LA 2BFAA 3AFNA 3CTMA 3ETDA 4JQCA 3E9MA 1DRVA 2EGHA 2HMSA 5TGDA 3ANLA 1XU7A 1ZSVA 4MVJI 3RUDA 3DMTA 1ZEJA 4CR6A 3HADA 4HUJA 4MVJH 3IIEA 5KOIA 1HXHA 1HYGA 4TRNA 3BA1A 4YVFA 4C7JA 1ENZA 3FRJA 2O48X 3FNFA 4BNZA 1KY4A 3R6DA 4KMSA 4XDYA 1LEHA 1MX3A 3OIGA 4CM1A 5JDIA 2DT5A 3JQBA 4XB1A 3FR7A 1EUCA 1T2CA 3C1TA 1U4SA 1LI4A 2Y1CA 5CPBA 4I1IA 4ALIA 2B5VA 3GZ4A 5DNAA 2GN4A 3LC1O 3W4IA 4BO4A 3FNEA 4MO2A 1PL8A 3E48A 3AI1A 4U0KA 1FDWA 5CEFA 2OMEA 1F14A 1IUKA 5GZ6A 4XZ3A 3GQVA 4L8VA 2W4QA 1UDAA 4HY3A 3NKLA 1F06A 3PDJA 2VZ9A 1JN0A 2PGJA 4GH5A 1LBEA 4J91A 4RPLA 3ZV5A 1T2AA 3DHNA 4TROA 4BNJA 3I6IA 4ONEA 1M6HA 3K6JA 4RVFA 4CM8B 2LDXA 3QWBA 1E7SA 3CMCO 1R6DA 2IZZA 5JNLA 4GKBA 1PU2A 4AVYA 4JNKA 4E5NA 1JW9B 2OO5A 2Q4BA 1H9BA 5A9RA 5IAAA 1XCBA 2YW9A 2C5AA 1I2ZA 3MJ4A 4E2XA 2ZCUA 4JN6B 1IY8A 5TLSA 3C7DB 4W7HA 3I3OA 4B4UA 4RCVA 2G5CA 4GSKA 4J9UE 3GOHA 1Q1NA 3ETGA 4J1TA 4MKZA 2VUUA 3OHSX 4DPKA 4YPOA 2AA3A 5FF9A 4BGIA 3SEFA 3ST7A 3D4OA 4XRRA 3FBTA 1E7QA 3B1FA 1T25A 3A28A 4J43A 3GA0A 4PIVA 1DIAA 3JCZA 3P7MA 2WTBA 1BXGA 2D5CA 1A72A 4OSPA 4ND2A 3DWFA 5TT1A 1E3WA 4BNTA 5CFZA 3Q11A 3ZU4A 4AL4A 1NFQA 3K2EA 3MJEA 1V8BA 4B8ZA 4CQMB 4CMEC 4R5HA 1NQTA 2DFDA 4EITA 1LDEA 4CMJA 1DLIA 3H9GA 5A02A 1IE3A 4J4BA 1XELA 1IOLA 1DJQA 1PEDA 3EYWA 7MDHA 2BGKA 2VHZA 3VVCA 3SLGA 3WSVA 2HK9A 2VHXA 4CV3A 5BR7A 3ITKA 3PDUA 1HF3A 4PRKA 4NBVA 1JWAB 2JFHA 1O89A 2GERA 5KJEA 3RC7A 3S2GA 5L53A 2B0JA 2X4GA 3TL2A 3LVFO 2IDZA 2DPGA 3WB9A 3JYNA 4CUZA 1PJQA 5K6AC 4R69A 3GVHA 4M8SA 1ADBA 3PHLA 1VL0A 3AOGA 2BHLA 3RI3A 2JAHA 3GEGA 3WXBA 2Y0CA 4UEKA 3EY4A 3H3FA 3MJTA 2R00C 2BELA 3QWFA 1DSSG 1EK6A 4ROSA 4CLHA 3UCFA 4CQMA 4FR5A 5IF3A 2IEBA 3I52A 2FR8A 3NYWA 3BHMA 4IUYA 4W82A 2YHIB 5ENVA 1T2DA 3H65A 1EVJA 4N5NA 4NU5A 3WFIA 3PTZA 4IXTA 3TF5A 5AQ1A 4HFJA 5B4TA 4NFHA 3FPLA 3GFBA 4IQ8A 4CLRB 3VKUA 4B79A 4MP3A 5C7LO 3R1IA 1HDXA 2WWRA 1I8TA 1V3UA 3ADOA 4O63O 4OJNA 1LA2A 1HE2A 5B12A 1DFGA 1OC4A 3GDFA 4JJIA 3AY6A 4XQCA 1ADGA 3F9IA 3V2HA 2O2SA 1ENPA 5EL0A 1ZJZA 2FHSA 2VTDA 3AU9A 3F46A 4FCCA 4ZN6A 4Z0PA 3JQEA 4RF3A 4BKPA 3X2FA 3NUGA 4DLLA 3NAQA 1H2HA 5CHEA 3RBZA 2D1YA 3AUTA 5EIOA 1OZAA 1WMBA 5KNLA 3P2YA 1CJCA 4INAA 2TMDA 4OQZA 5DCYA 1O8CA 1WLYA 2RHCA 1Z6ZA 3OJFA 3B1KA 3VTZA 2D5AA 2GR9A 3Q2KA 3H6KA 1WAMA 3AW9A 3A9WA 1JVBA 3RD5A 4EJMA 2CNBA 3QJ5A 2QX7A 2Q49A 1N7GA 2R00A 4BB5A 5TF4A 4P4GA 4IDFA 1HEUA 4XB2A 2PH5A 1I5RA 1KOLA 4MKRA 3ROKA 4CLRA 3PYXA 2EKQA 4R51A 4XKJA 1X1EA 3OSUA 3ZU3A 4F45A 3KXDA 5JY6A 3M2PA 4BNNA 1LSUA 1DIBA 3TN7A 3PZRA 3DZKA 1H9AA 1PJSA 1E5LA 3SJUA 3AK4A 1Y9AA 4OQYA 3BZUA 1I0ZA 4YA6A 1KERA 3WGGA 1T2EA 1BDBA 1T1SA 2RHRA 1LTHR 2YV1A 1NX6A 4DUPA 3WNQA 5DZSA 3ZNPA 4UVIA 1C1XA 3LLVA 1Y81A 2W90A 1T24A 5HS4A 2E48A 1VL6A 3PHIA 1PJ3A 1RYDA 1FXSA 1HZZA 3IQDB 2Y1EA 3NJ8A 1UR5A 4IMPA 1KVTA 1MP0A 3BMNB 1R12A 2DTEA 2G1UA 3CMMA 3GH3A 4R3NA 5HRUA 3O8QA 1GUFA 1QR6A 3OICA 5EMHA 3A1NA 1CIVA 2H5LA 1NVGA 2JFGA 3NT5A 4WOJA 4BVAA 8ADHA 1Y8RA 4YRBA 4KDEA 4YBZA 3NTOA 5T57A 3NT2A 1K3TA 3NTQA 3R3SA 4GLOA 1ISJA 3HDYA 3V2UA 4B3HA 2J3IA 1GR0A 4TVBA 4DQVA 1OFGA 4BGEA 2OORA 1ZK4A 3RKRA 1YBMA 1BG6A 1PR3A 4H3VA 2YYYA 3LF2A 1TB4A 3H2ZA 4OXKA 5EN4A 4L76A 4XR4A 2HAEA 1BW9A 1VKOA 2OXIA 4QECA 3UICA 2Y68A 4BO2A 5CEEA 1UAGA 2QYTA 3ZU2A 1ZMTA 5DDIP 4A73A 3KHUA 2HMVA 3EVNA 3Q6IA 1GDHA 4BMSA 4KZPA 4DIBA 1EBFA 2JD1A 3WLFA 5GZ3A 5TNXA 4J7CA 2B69A 4I9NA 4YAEA 1UZNA 2GDZA 5FWNA 4L75A 4NJMA 4OGWA 4JGBA 5DBGA 3KYCB 5K9ZA 3O38A 1S6YA 1U2GA 3P2OA 2ZK7A 3QE3A 3QWAA 2Q45A 2PGLA 1B8VA 2P5YA 4XJTA 3ZI0A 2NADA 2D8AA 1B8PA 3BHIA 2UAGA 2HSDA 1C3VA 1LUAA 3AOEC 3WBBA 4BQPA 3PWZA 5GZ1A 3HWRA 3E8XA 4BNVA 4BIIA 5A06A 3CUKA 1IL0A 4OKIA 1K89A 1VPDA 3HDQA 5T67A 4BNUA 4E2YA 3PQFA 3KUXA 3CZMA 4JJFA 4RPJA 3H5AA 2W98A 5G0SA 4BKQA 5HS6A 3SBOA 2PA3A 1Y8QB 5ILGA 5B4UA 5A9SB 5I9MA 5L4SA 5U9CA 5FFFA 3OJ0A 3DMTC 1YGYA 4K28A 1GQ2A 1PS0A 1V35A 4TRJA 2X5KO 1LLUA 2VT2A 1U3VA 3TFOA 4JLWA 4BNFA 3M2TA 4CPDA 2Z95A 3GN1A 1WDMA 2X0RA 4BHTA 4XIYA 4PG7A 5ITVA 4PG6A 5JMWA 1GZ6A 4DA9A 1DDOA 4BNXA 4FIZA 3OA0A 5LDHA 1YRLA 4LCJA 5DBFA 4EI2A 4AFNA 2YZ7A 4IBOA 1PJBA 3MWEB 1X7GA 4Q9NA 1Z73A 4JBIA 2DLDA 2VQ3A 3JQDA 4W7IA 3RUHA 4MP8A 2E6UX 2NVUA 5JCJD 1LC0A 1B14A 3RC2A 2QG4A 1HDCA 2CVQA 4GGPA 4OIMA 3DR3A 4IS2A 5AYVA 5AXBA 1LDYA 1ZBQA 3WICA 4FB5A 3KSDO 3VDQA 1EZ4A 3JTMA 5JAIA 5T6BA 3IKVA 1LRKA 3U4IA 2UVDA 3U4CA 1K6IA 1SC6A 3ZWXA 4DGSA 3NEPX 1JDJA 4BKRA 4J1NA 4NJMB 5EPOA 2ZB3A 1C0KA 3ZW9A 1R66A 4ZRNA 4YJFA 3L9XA 4KQXA 4CMAA 2YFQA 3F6YA 3O03A 2GLXA 2X0NA 3VPHA 2ZQYA 1E3WB 4FC7A 1S7CA 2WEKA 1GADO 3I1JA 1XG5A 1EVIA 2Y1OA 1M2WA 2AEFA 3ZWNA 1L7EA 2AG8A 3Q2IA 4H15A 3QIVA 3HFGA 3PFFA 1GQQA 5JO0A 3MOIA 2QZZA 4MVJP 1BHSA 2RH4A 3I5MA 2YV2A 5BNIA 4GI2A 1QV7A 5GY7A 2ZCVA 4MVJA 1NPTO 1ZK1A 4RLSA 4DYDA 1SPXA 5L51A 1NM5A 3L6OO 4BO3A 4CMIA 5CDUA 5IG2A 1NASA 2JCYA 2WSBA 4GKVA 4Q3DA 3DTYA 1TI7A 4ZQFA 2JAPA 2ZJ0A 3C24A 5IJZA 3D3WB 4NK5A 4B3JA 4B7CA 5KVCA 1V6AA 5IDWA 3TZQA 3MJCA 1U8FO 1UXGA 4NDNE 3VZQA 1DIGA 1VL8A 4MDHA 4ND3A 2Y0DA 3HJAA 4K6FA 3ZNOA 1N7HA 5DOZA 3QVXA 5T8KC 4YT8A 2H9IA 2VHYA 1B3RA 1ZW1A 3OP4A 1GCUA 3BTSA 4TKLA 3JV7A 4I9HA 1TXGA 5DN9A 2Y1GA 1YBAA 2YY7A 1ADFA 4BNGA 1H0KA 3TJRA 3OQ1A 4G5HA 3EDMA 5A9SA 3TOXA 5KJFA 4Q3NA 4Z0HO 3DONA 2GGSA 1YONA 2C82A 3VH4A 5IXYA 2QQ5A 4UEJA 1LJ8A 3S2IA 2C54A 2B4TO 4ILKA 3AUUA 2AQKA 2C2YA 2JJYA 3GDOA 4F6LA 4BO8A 4QT0A 2DBQA 4YQZA 1M75A 1SOVA 4BV8A 2WD8A 4YJFB 4AJJA 3TDKA 1B7GO 1HSOA 5JLAA 2IRWA 3AM3A 3GLQA 3PI7A 2WE7A 5L45A 1ISHA 2C07A 5CDTA 1MXFA 3ENNA 2VYNA 3GZNA 2EWMA 2VOEA 1LDBA 3WR5A 1RM3A 2D0IA 1BVRA 2OBYA 1QORA 4TWRA 5JXWA 1NXQA 1NWHA 4EEXA 3ZWPA 2BLLA 3H4VA 1C1DB 1ZEMA 1M67A 2HO5A 3KM0A 4IDAA 5C7OO 4YRAA 2NLOA 2J5RA 3U4DA 2PKRA 5LC1A 3GMSA 1H6CA 3D5QA 2Y1FA 1WDLA 2FR1A 5I8WA 3DAGA 1I24A 1E1MA 4A5OA 3JQAB 1HKUA 4AJKA 4I08A 3DTTA 1U5AA 3JQ6A 5A03A 1LQUA 3L4BC 3JQGA 2NU8A 5C37A 3E1KA 5IXSA 2FPGA 1LDMA 4LCEA 2UV8A 2EW2A 3TZHA 3OA2A 4XRGA 2YHUA 5C7IO 4BMVA 4HNGA 5K0ZA 3U5TA 1ULUA 3IS3A 4NU6A 1BXGB 3DBLA 3F4BA 3GRPA 1HETA 1A71A 2CZCA 2WD7B 3AFMA 3B6ZA 2BMAA 3P19A 4IJUA 4OYRA 4F6CA 3JYOA 2PKQO 2HJSA 2A9FA 1ZXBA 3TOZA 3KRTA 4DRYA 1MFPA 5B37A 4E30A 1I3NA 5KJ6A 2GASA 3CIFA 3D7LA 4RF5A 4CQLB 1U5CA 5DT9A 3G3EA 3OH8A 3VC7A 1EEHA 2C7GA 4TRRA 3RUCA 4IZHA 2VNAA 5EQDA 5ADHA 1QYVA 3LT1A 3FPCA 4IDDA 4R3WA 5FI3A 1HE4A 4NIMA 3EZYA 3RUEA 4PVCA 3L4SO 5G4KB 4RF4A 3JQAD 1I2BA 4J6FA 1LSOA 3E9NA 4LSMA 5L7WA 2DBRA 5JPIA 3GF4A 4MOWA 1B16A 2QRLA 1Z74A 1EQUA 2X5JO 1IPFA 2E49A 1F0YA 3HZZA 3LT4A 3PFWO 3WOHA 5JSFA 3D4NA 3ONDA 1MGOA 4GMGA 4F3YA 1GQYA 4BO1A 3KYCA 3C7CB 4WJZA 2QHXA 3JQGB 1GZ4A 1B8UA 3WYBA 1PJ4A 4BOYA 3N7UA 4YR9A 1J49A 1P74A 1UXJA 2UUPA 3ULKA 3I9LA 1AHHA 3WGZA 5I9NA 4JBGA 5A9TA 3RKUA 3E82A 4PZEA 1I2CA 2UDPA 4QTZA 2ZKLA 4NBWA 1Y7TA 1E7WA 4QUKA 3ZDFA 2O7SA 1X1TA 4K9DA 1EVYA 1NR1A 3UVEA 2I65A 4Y6RA 5JS6A 2X58A 1GYPA 3H3JA 4ZHSA 3SC4A 3SLKA 2EW8A 1ONPA 1QV6A 5EQFA 1U7HA 1WNTA 2ZTMA 5BSHA 5LCXA 2PZMA 3OIFA 3W8EA 4DWVA 1PQWA 1I33A 3HQ4O 3DAPA 2Q1UA 1TVEA 2CMDA 1DXYA 2AQ8A 4PG5A 4EUEA 2VT3A 3T7EA 1DIRA 4IINA 1HYHA 1P9LA 2VTEA 3H2SA 4LSWA 4AJ2A 2YDXA 3QVSA 1E3SA 3RFTA 1BWSA 4HP8A 3WNVA 3DC2A 3KETA 1Y1PA 4WLNA 5JE8A 3ZNQA 4RV9A 3JQAA 2ZB7A 4HNHA 2X7HA 2YV3A 3HB5X 2WYVA 4UAGA 3NDJA 3O26A 3IOYA 3U49A 1A4UA 4II2A 2C7VA 2JHFA 2PD3A 5COQA 3UFXA 2VOJA 3SX2A 2C0CA 1E1LA 1Q7CA 2C29D 2OP1A 4YB8A 4E5YA 2X1HA 3ROMA 1JQBA 4FFOA 4MKXA 1VC2A 2HKIA 4Q3CA 4GL4A 5AOVA 3WYCA 2WYWA 2X0JA 1LSJA 4R1NA 3DBHA 1ENYA 4WEOA 2XXBA 1P33A 3UOGA 2FMUA 4FPXA 4YWJA 3H9QA 3WLEA 4YXFA 3WIEA 2O4UX 5BNTA 3S55A 1HLDA 1E77A 2CVOA 3PWSA 2AQIA 3KOUA 2OFPA 5EERA 3O9ZA 4DPLA 1GU7A 3HDJA 3K96A 1DC6A 2IODA 3EZLA 5HBRA 2BFOA 2HDHA 1RM0A 1XQ1A 1N8KA 1HLPA 4YJHA 3CSDA 3W6ZA 4HADA 4NG5A 2EXXA 1QG6A 1ZIDA 3BMOB 4AJOA 2EF1A 2AXQA 3RJ9A 3GNSA 2IXAA 4P38A 1KEVA 3TNLA 6ADHA 3FTNA 4Z0TA 4CM4B 5CEJA 4OAQA 4LVUA 2NM0A 4J7UA 3EW7A 5IDQA 3QVOA 1O5IA 4IPTA 1XU9A 1R37A 1D7OA 2QYSA 2D3TA 4MIYA 4YACA 4YEDA 4YAIA 4N54A 3MJVA 3H7AA 1QMGA 4WCDA 1BSVA 2EP5A 3VPGA 3U3XA 4IIVA 4D42A 1J4AA 1P3DA 2VUTA 4FJ2A 4NBRA 2CY0A 4R1TA 5DP1A 4Z9YA 1SBYA 2HMTA 3F4LA 5JY1A 4UVDA 1HL3A 4AJIA 3RBXA 1PQUA 2EKPA 3QA9A 1IHYA 2ZB4A 3KYDB 1AXGA 4NI5A 1DOHA 2E4AA 2VYVD 4ZVVA 1ZK2A 3DAFA 4NBUA 6LDHA 4MP6A 1WPQA 4BB6A 3W8FA 2B37A 2V6GA 4NR0A 3ZWWA 1WW8A 4FDAA 3JQ7A 4EUHA 5DF1A 1H6DA 5T64A 2PR2A 1QYXA 4BGUA 4O5OA 3WMWA 3V2GA 1V3VA 4B3IA 3I9KA 3TSCA 3UKOA 1ID1A 2ZTUA 1GPDG 2VRCD 4I5DA 3SXPA 3N74A 4BNKA 1UAYA 5KWEA 4YYZA 3K5PA 4CUKA 4GPD1 3ABIA 2G0TA 2GF2A 5KKCA 1B26A 3IAHA 1MG5A 5TS3A 4RL6A 1FK8A 3UF0A 1A9YA 3JYQA 4DBVO 3HHPA 5L95A 4RVGA 4YTEA 1GL3A 2I66A 1E7RA 5JDCA 2O3RA 1BW9B 4FOOA 3VDRA 4CM8A 2ILTA 1W4ZA 4CLDA 4Q3EA 4UUOA 2OOSA 2AHRA 4A10A 5H81A 5DCUA 2HLPA 4FFLA 1HDGO 2DVMA 1QRRA 3EK2A 1A4IA 1RYEA 3HUDA 1R4MA 4F46A 2I99A 4PN3A 3ZNNA 4GX1A 2PV7A 3KTDA 3DZFA 3G0OA 1YE3A 5JAQA 4YDRA 2R2GA 3AM4A 1VSVA 4IMRA 4NPCA 4U7WA 3PJDA 3FHLA 4MVJM 2I9PA 1GY8A 1KVRA 2ZYAA 3JYLA 4NMHA 1P1JA 1JVSA 3IL2A 2Z5LA 3VZPA 3KYDA 5IDYA 3ZZNA 1WWKA 4UEOA 1R16A 3P5SA 3Q3CA 4UVHA 1HE3A 3OBBA 3OEYA 2OL4A 4NK4A 2EEZA 1E1KA 2O3QA 4XYMA 4BNWA 4LK3A 3TRIA 1MV8A 5JCJA 4LISA 1FJHA 3BMQB 3K2BA 4LRSB 1F8GA 3M1AA 2ET6A 1JAYA 1K0UA 2HRBA 3QLJA 3L07A 3MTGA 1DHTA 3UCEA 1A7KA 1Z82A 3S8MA 3KO8A 4B8WA 1FF9A 4Y67A 4A0SA 1UJMA 3GVCA 2O3JA 2X23A 3KSZO 4HWKA 4BO9A 3ZN2A 3RIHA 1IZ9A 5I7VA 1QP8A 4ZA2A 2DFVA 3GT0A 2I5PO 1SMKA 2Y05A 3OECA 1L7DA 1C0PA 3WFJA 1YH3A 1E1NA 5BQFA 1GEEA 3GMDA 1XHLA 1WXDA 3DEYX 3N58A 4J1QA 1KS9A 4TZTA 5F5LA 1WDKA 3PZBA 3FWNA 3DZBA 1GEGA 3DFZA 2FPPA 2Z1MA 1R0KA 3VTFA 1JAXA 3G17A 3DBLB 1GUZA 2Z1NA 4N5LA 1U3UA 3DHYA 4TMFA 3ZWCA 4ZGWA 2OGUA 3BAZA 2DKNA 4W99A 2IZ0A 4KOAA 3KLMX 4J2OA 1DJNA 4Q39A 3VKVA 2EKLA 1GV0A 1UDBA 1RJWA 1HDOA 2G76A 2Q99A 4CL3A 2J6IA 4E2ZA 3S2EA 4WK6A 2BF7A 4K1LA 4FOSA 4JP2A 1N1EA 3PLNA 3NGLA 1I3KA 5THQA 3WJAA 2X0IA 2GN9A 4AICA 1ZVMA 1NVTA 4LVCA 4WE3A 1J6UA 5F21A 1N92A 3GPDG 2X22A 4GWKA 4D7AA 1IULA 4D79A 1V9LA 1NFFA 4Y6SA 1ZSNA 3PP8A 5AXDA 2DUUA 2J3KA 2NTNA 4IDCA 4WECA 2C20A 1HSZA 2HMUA 3L0DA 2VRBA 3UCXA 1UP6A 3OM9A 4KUHA 1Z45A 5DCWA 1LDNA 2J8ZA 4WKGA 2J5KA 1E5QA 1NPDA 1QYDA 2JD2A 1O0SA 4W9NC 2NU7A 1U3WA 2P91A 3PHHA 4XWYA 4CMKA 1IHXA 1PGJA 2NQ8A 4DXHA 3UH1A 1YB4A 4AJNA 1X15A 2FRDA 4M87A 1GYQA 1LNQA 4LW8A 4ALMA 2DQ4A 5F3RA 1PJTA 3T7CA 4JJGA 4KTVE 4DREA 1OI7A 3F5QA 5DP2A 3GVPA 3JQ8B 1HDZA 5ER9A 5A3JA 2AQHA 3PK0A 1VKNA 4BKUA 3HNPA 4OHUA 4P4LA 4E33A 3I9NA 2O3SA 1XGKA 4N18A 4PRLA 1HT0A 1Q7BA 2PLAA 3JQBC 3ITDA 1QSGA 3BHJA 1H93A 2D59A 3DBHB 2O4CA 4OH1A 4WNIA 3QWHA 4CM5A 4ZICA 4PGFA 1ISGA 4IM7A 4DL9A 4ZQBA 1ZK3A 4BGVA 2EJWA 3F1KA 1Y6JA 1P44A 4U6QA 3WGIA 3VH2A 2VRCA 1CDOA 1SAYA 4EJ6A 2RBEA 4YAGA 1NAHA 3OFSA 1NWCA 2O2YA 5CDGA 4BNHA 1YXMA 3LT2A 1UH5A 3PIIA 4IDGA 2CD9A 1E3EA 4BO5A 4IGEA 2FZEA 1N5DA 4JROA 4PG4A 2BFMA 3RASA 3Q9NA 4E4YA 4ALKA 1CERA 4UREA 3G1TA 1ARZA 3DXFA 4JIGA 2BRUA 3DO5A 1Q2XA 1U7TA 2NACA 2WMDA 4JP3A 4RDHA 5FEUA 1EVZA 4L4XA 5I7SA 1KETA 5K6AA 4QO7A 2P9EA 3V1UA 1P0CA 1D1TA 2IXBA 3E5MA 4IXWA 1E7YA 3B20A 2AW5A 3DBRA 5I8ZA 3W6UA 1SZJG 1YB1A 1E3JA 3FTPA 4CODB 4D43A 4WGGA 3U4HA 1MXHA 1XEAA 1IZ0A 1EE9A 1K5HA 4RQUA 5JDCC 1QYWA 4GGOA 3CKYA 4D41A 5ITWA 3KLPX 4E5KA 3V5NA 3LYLA 4CJXA 4EDFA 1DRUA 3I23A 4FFRA 1HYEA 4GAEA 2B36A 4DVJA 4U6SA 3DOCA 1P1FA 4KWIA 3W8DA 3ZV6A 2CF5A 4RVUA 5IZCC 3G79A 3H9JA 1I3MA 4M86A 4R68A 4XQ9A 4J16A 4D44A 4D46A 1KYQA 4XEHA 3ZWVA 5L3ZA 1UUFA 3GNTA 4XYLA 3HN7A 3NV9A 3T4XA 3UUWA 1QXSA 1T4DA 1YJ8A 3PYLA 4HKTA 4R16A 1W73A 1SO8A 5IFLA 1JLLA 4OOEA
chains in the Genus database with same CATH superfamily
1G7SA 1II8B 3CWCA 4JT8A 3DVLA 1GU0A 3OPYB 2NVBA 2VQDA 1TYZA 3H5RA 3Q7TA 3SHFA 2A5JA 1FNNA 4MTCA 4YP1A 3P26A 1W2WB 2ZXFA 4FHDA 4DJ5X 2BE7A 2XI4A 3SR4A 4A23A 2GPJA 4WLEA 3KK0A 4Q4JB 1KEUA 4ZRDA 1GCIA 1RC8A 2GKGA 2R79A 1CHDA 2Y1DA 2Y66A 4RVOA 3A9CA 2P40A 1Z4NA 3A10A 2DLCX 5FPTA 4NH0A 3G2HA 5ALPA 1O9GA 4DWJA 4H4EA 2IP2A 2ES4A 2VP0A 2FK7A 2JCXA 3CNLA 3F2VA 4JVNA 4JUFA 5CLGA 4BN0A 2YWFA 4E94A 3UJCA 3ZE0B 5EKUA 4R2WA 4EZIA 1UXOA 5E7QA 4ZVNA 3CPSA 3FNGA 1KVQA 4L5IA 4WBNB 2G70A 3O31A 5IZ4A 4UM9B 2ABWA 3L77A 3OEWA 1DRWA 1P1RA 5CB4F 3GGOA 4WFJA 3BPSA 3FPGA 3IVMA 1JIJA 3ORRA 1AE1A 2VHQA 5AK4A 1E1YA 3MTJA 1QV9A 1IUNA 5EE1A 4N3BA 5ALJA 2HHJA 3QNMA 3GROA 4PFKA 5CNKA 4IDEA 3MTEA 1MZPA 1KOJA 4RZUA 5BN5B 3E58A 3WDLA 1NP3A 4F0JA 1OWNA 3BWEA 4C0WA 3OTHA 4B6FA 4BATA 4EF4A 4NZMA 3C5HA 2Z5FA 1RACA 2FFRA 5KTRA 3OTIA 4YWHA 2AIRA 4JLJA 5LLSA 2HQSA 2RGNA 4DHWA 2AYXA 4P86A 3TINA 1TCBA 3ZLVA 4E13A 4HX2A 1X7WA 5C81A 1E3LA 1R4MB 3D81A 2VHTA 4RABA 5I4BA 3JAKA 5SYMA 5KVVA 4M4SA 1NTOA 3R4VA 1W93A 5SICE 1CRWG 4EG0A 2B21A 3HJTA 1DFIA 4J7AA 2VQ6A 4POAA 4E5DA 3HVKA 2EIHA 1GYRA 2PQ0A 3LX5A 1SVNA 2HU2A 2X5XA 1IQPA 4GBED 4W4TA 4X84A 5AW0A 5I3ZA 5JC1A 2GA8A 3TUJC 1C4XA 1PV1A 5J2UB 4EA6A 4NQRA 4Q9AA 4EECA 1KFKB 3V6MA 4KQKA 3WQHA 5AM2A 5HW0A 3A3YA 1GUYA 4P4SB 3CRVA 5IT5A 4XASA 4DTCA 3IP7A 2X0FA 1YZUA 4KDFA 1TW2A 2E89A 1A8QA 1CUIA 1B0PA 3HEAA 5FBRB 2JL1A 1DAFA 2IEGA 5I45A 3UG7A 2XB9A 3H3XA 3PF8A 1XIVA 2RBKA 3RWMB 4N40A 3K71B 3AVYA 2OD9A 1G0OA 4R01A 4R41A 5DHRA 4DCOA 3B2EA 1XRPA 2R44A 1ZJ5A 4RMGA 2QTVA 2ZTLA 1Y48E 4PPGA 1FRNA 4LHWA 4QNMA 1VIDA 3EVTA 2VEDA 3QQPA 3FJ1A 1FY2A 3VPXA 3WYAA 4BMNA 1BFUA 4AIRA 4QRIA 2PH3A 4PR3A 2PZGA 4R9SA 5CT8A 1VE9A 2ADFA 4H16A 4RFSA 5EGSA 4C6TB 5TPZD 1OA1A 4KH0A 4QOHA 4GI1A 4EB3A 1C5KA 3TLYA 1R8QA 4D9KA 4LHXA 2P0YA 3LLMA 1T9HA 4GKJB 3ZGZA 2ZJ3A 3WJ1A 5JZSA 5A5VA 2HPAA 3I2KA 2PTGA 2GF0A 4UUAA 2GBFA 4J1TC 3TVYA 1K97A 3Q6NA 1C8BA 4MR7A 2NUBA 2DUJA 3OD5A 4XYBA 4M9CA 2ZUSA 1I4TD 1WXXA 4L85A 4IVPA 2CNNA 2F43B 3WGLA 4B4DA 4B3CA 3TQHA 2I8AA 3N2ZB 3A06A 4O0MA 4EF6A 3MGCA 1G8PA 5C31A 5FIUA 5C8DA 2GCPA 2W42A 3P2KA 5MDHA 2Q5OA 2O50A 3CNNA 1SJ9A 1UIRA 4WCFB 1XPJA 4PYLA 4AJ1A 1EVLA 5DI3B 2GJAA 3KKZA 5HQTA 1NDQA 1H8ED 2YHAA 4H7KA 1MLDA 2EG9A 4M60A 1O6GA 3RSGA 1RCFA 1CV2A 4X20B 3DNPA 1YZHA 1N6IA 1W4AA 2MSNA 3MERA 3MUOA 4JK3A 3M4YA 1BA3A 4LTDA 4QL3A 4QTTB 4RJTA 2LV8A 3IMFA 3UW3A 4EHFA 3W5HA 3B51X 1K2WA 1T2NA 3NYRA 4X8MA 3V1TC 4EY6A 3NJ4A 3QU4A 3RQSA 3CEPB 4MLPA 5FPKA 4OK5A 5BSMA 2VYND 1UBTS 3EZ6A 2D4AA 4RA9B 2HDOA 1IPEA 4P0TA 4RF2A 3N8HA 1XZ8A 3DC7A 1J22A 2P67A 3LCMA 5AVWA 3E9DA 1YS6A 1YL5A 4M55A 3K6SA 3NYQA 1YWGO 1WZEA 2AEJA 3WHPA 3EXHB 1BDJA 4F60A 1PLLA 1P2GA 5IN5A 1PSDA 4XVCA 2OHVA 3PB3A 2OLEA 5E6RB 4OB6A 1UXIA 3GG9A 1QE5A 3HPRA 3NT4A 4QREA 5EZYB 1JJBA 3ZXSA 1NXVA 3VH1A 3KZMA 4G86A 3DBRB 1IBRA 2GPNA 2AVDA 4JJ7A 4B3RB 1J90A 2PUVA 2P1DA 2WJWA 3R41A 4LXIA 5HFNA 3UT5B 3ZDRA 5KJCA 3PPIA 4MPTA 4W5QA 2XE8A 1Y1KE 2PAFA 3QKSB 4ALLA 1IBCA 3KT0A 1B1AA 3H2IA 5JCZA 3WLOA 2EAUA 2V7EA 4JOCA 1U1FA 3STUA 1GD1O 3AJRA 4ZVSA 3SS8A 2CSUA 1BMTA 2Q4OA 1CY8A 3L6EA 4EUFA 3EULA 1DAPA 4Q1FA 4R8MA 3YASA 1S9HA 4Z7QB 1GKIA 2I1LA 2Y67A 3DVRX 3ON5A 4GR4A 3LFUA 4NJEB 1Y7IA 4UEQA 1UBFA 1L4BA 5HQ3B 2FFQA 2HFJA 4GM1A 1I10A 3A0UA 3A4VA 4LTMA 1WJGA 4XWKA 3SOPA 1D4FA 1L5RA 1WE2A 1I1NA 2ZYDA 3E2IA 3GIWA 4JLKA 4R4JA 4CM6A 5J43A 5DNEA 1PR9A 3NG1A 5BQ5A 2EKBA 2ZPUA 4ZRMA 1UEJA 4ALJA 3Q4GA 1QRDA 2AK2A 2SNIE 2VZ0A 2WWXA 3GNQA 4ZEXA 1F60A 2G4VA 3TNFA 2DETA 4K9KA 5ADUS 2XBLA 3NX4A 5IUNC 3IXMA 3OQIB 3H9UA 3EXG1 3KKOA 3AUSA 1ULAA 2H5IA 3HWWA 1R27A 3ZTYA 4NG4A 2O7RA 1C8KA 2XCIA 3ER9A 1QTRA 1Y89A 3EE6A 4C0KA 3TZ6A 2QTHA 4G65A 4PBTA 1VM6A 4U39A 3BL8A 3WAKA 2IUUA 1N25A 1XNQB 3E2PA 3H9BA 5D7NA 2D2EA 2JIZD 3UUEA 4BKOA 3LQQA 4AIIA 1H6BA 3TR6A 4CKEA 2EJCA 4E88A 5C1OA 1FDOA 3E03A 3OO0A 3AESA 4KFRA 4ZZ1A 5CA0B 4RA6A 4HAZA 4CLXA 4MUFA 3S2YA 2WT9A 1M34B 1OCEA 2C2KA 3GLTA 2QVGA 2XYQA 3JQFC 4MX8A 4CV2A 2ONCA 3IQGX 3VKHA 3RGWS 1JEOA 5IJXA 1UZMA 3VO8A 1W0CA 2VDNB 2I0FA 2HIAA 1GPMA 4G1EB 1FMJA 1UM9A 1XDGA 5LL6P 1NI4B 2MINB 1WBBA 4NBNA 1KAHA 4LMPA 5LPNA 4YK7A 3S8YA 1SXPA 1ZWLA 4LF5B 4J2HA 1DC5A 4G8CA 2FH5B 3NBKA 3HN6A 1QGUB 4RPKA 4DADA 1SBHA 3A3OA 3BILA 4OCZA 3WQBA 1CB7A 1Q7GA 3WMGA 3ORSA 5IF9A 1XJ0A 3FBGA 1PZGA 4F5DA 3E4DA 4DIFA 1ZJYA 2BM0A 2ODQA 1Y3DE 3LOUA 5IBQA 3RFVA 1YK1A 1DIHA 3WIOA 5H4HA 3UBTA 2P77A 1ECGA 3AO0B 2Z8YM 1P1BA 3IP6A 4R6XA 2VBIA 4HDMA 3F8SA 2X6QA 1TOAA 5EYPB 5FPYA 1GG2A 4LMRA 1C80A 3CHYA 1A5ZA 4IF4A 3UHAA 3UJ8A 1WNFA 1XZQA 4S1OA 4ACBA 4H0CA 4URWR 4DQKA 3U7QB 1XA4A 1H2RS 2H59A 4HFRA 4MDFA 2QW8A 3A4YA 4UBJA 3CGWA 4UBLA 1JZTA 1NA5A 4AP9A 2O1WA 3B8EA 4G5OA 4NHOA 3WO1A 4ER5A 5JSZB 1Q0QA 5J58A 3UGJA 4JWTA 2EIXA 5K2OA 4HWTA 3JAKB 3MIZA 1I0IA 1U9IC 2JH8A 3PDIA 4MQLA 4LN1A 4WZAB 5JD3A 3TLMA 5BSFA 2CXXA 2ZSIA 3TE6A 1MDBA 5DSZA 4X1YA 2Q1YA 1NLFA 2O20A 4HS4A 2BF4A 5JMPA 2GM5A 1ID8A 5G1PA 1Z16A 3SJ7A 5KHLB 3F6PA 3KSMA 1DTEA 4GOJA 5K0BA 4H6PA 5TARA 4HG2A 3SXUA 3VDXA 3GRAA 3D3WA 3P2EA 4M2LA 5E4YA 3IT0A 3ZY5A 4N82A 2RB5A 1OI4A 1BNCA 4MRPA 2QPTA 2GAOA 2BKVA 5FR2A 3GYGA 2NUTA 5AK6A 5EXDA 1YDFA 2V9CA 2IPXA 3COWA 3DV0A 4D8UA 2ETXA 4DAEA 1V8OA 4DQDA 1G5FA 1QGYA 4DQLA 1PTJA 5JFGA 2JPDA 3G9ZA 1YQTA 4AJ4A 1TDJA 5HTOA 1Q0PA 3QVUA 4ZZ3A 1JHQA 1JAHA 3I5XA 4PFJA 1EH5A 1J2RA 1QHHA 1G7CA 2NV6A 4IXMA 2RKOA 3PRYA 4NNJA 4LYAA 4COKA 4HEJA 4BVLA 1YHNA 3L6DA 3RHFA 2WIFA 3K5WA 2PJZA 1L1FA 4HTFB 2GBLC 3BMCB 3VVLA 4LV5B 3H1TA 2OUIA 3EQ7A 4GI5A 2UKDA 4IX9A 2ICAA 3CLHA 2PMFA 3H5WA 4D98A 1NU8A 1FDTA 1Z38A 1D6SA 2B2XA 2A5FA 2YHIA 4HXYA 1EKXA 2L17A 2JGRA 1U0HC 2WM3A 3IFSA 4GP6A 4LC9A 1YV9A 2PSDA 4N7RA 3GLFA 1MT0A 5DYTA 3VNRA 4BNYA 3WJ7A 3OPYI 2ALJA 3JD1A 4LNUB 4MUXA 1Q1GA 4BQSA 3DF9A 1H94A 4O8CA 4XTCS 4F7WA 5JQGA 3CQ9A 5JS2A 5KJ1A 1QGUA 4OP3A 1U3DA 4HGNA 3QTBA 1PYDA 1W52X 2CDAA 4HWSA 3DHEA 4DLPA 1O7JA 2HU8A 2O7QA 2F48A 2QSJA 1SRQA 4J3FA 3SZGA 2EL7A 2NWQA 1AKYA 4W8HA 3WL3A 5IK2D 2OV3A 1C7RA 5FUXA 4J8PA 4L7VA 5DYYA 2R6AA 3DYVA 5GONB 4QVIA 5H16A 1IN5A 4CU2A 3UK1A 1QYCA 3AZQA 1M1NB 2Q2WA 4GPZA 4MV0A 3F0TA 1HQKA 5DHUA 3WSTA 1DTWB 1JSXA 4R1SA 5F73A 5C3MA 1W44A 2VSFA 1ZPDA 1RQXA 4TT8A 3ELBA 3LBFA 3GRUA 1O03A 3I8XA 1WXQA 3MUFA 1FSFA 4QBGB 4RUKA 5BURA 1U2TA 4J76A 2C9YA 3Q0IA 1SPBS 5DH9A 1PBTA 3RO7A 2JLVA 2Q5HA 1W6RA 3RF6A 4ZVKA 4Q7KA 1XV5A 3GEMA 2VZ8A 4UBMA 1PGQA 1QS0B 5C8XA 5JZVA 2QTMA 2ZIEA 4RV5A 2XKJE 3O8RA 1DKPA 1IN8A 2YWEA 4KXVA 2W6JD 4UBIA 1P19A 1M66A 3EIUA 1DOZA 2BSXA 4MW6A 3SXUB 2PZJA 4PZZA 1KI1A 1JPNA 1ORRA 3V8VA 3KHKA 3UHFA 2HSJA 1E96A 2Q1SA 3G82C 3FHTA 1L5FA 1YB2A 3KB6A 5C5DA 4FFVA 1P7PA 2DBVO 3H4TA 1EWTA 3EMDA 2FWMX 1IQ0A 1BX1A 4MPDA 4RZHA 1MAVA 1ZK0A 4JASB 4AY3A 2QV0A 1T9BA 4LF8B 2FETA 2R6JA 4R1UA 1JXMA 4OBBA 4X91A 1WP4A 3EODA 4EW6A 2IX3A 3W5AA 4EO4A 3MINB 4XGKA 4E2FA 3DYBA 3RHTA 3OPNA 2W6ZA 4HTFA 2H4HA 1ZGHA 3LTEA 3RYIA 4YHHB 3FROA 1YKGA 3MAAC 5CDSA 1KR2A 1NR7A 3K1YA 4G63A 2GN6A 1KC1A 2HSGA 3HBLA 3IIJA 4RLFA 3OIDA 1R0LA 4K05A 4XXHA 4WN9B 3V8EA 3B6KA 5LQNA 1J00A 1X13A 3F8TA 4LE2A 1FDVA 3V4FA 3F3KA 3PRHA 5AJVB 2F62A 2AE1A 1TT5B 1MJGM 3H5LA 3QH4A 1BWQA 3IP1A 4LBWA 4UVGA 5IUJC 1ATIA 1NTRA 2AR0A 1C9MA 1CUAA 3K9QO 5BUCA 3NVKI 4UAUA 1D1SA 3B1ZA 2BT4A 2HHHB 3DZJA 4K1XA 1NJ5A 3JYPA 4KODA 1KI6B 3AJEA 4GOXA 4C7VA 5ILOA 5CA1F 4MQEB 2OECA 2WICA 1IWBB 2XOXA 3D5TA 4GOMD 1MIHA 5KYUB 1EESA 5DBIA 1Y33E 3FNIA 4RXTA 3RUIA 1E6CA 1ISMA 3C7KA 3QVVA 1WY7A 1PJAA 2V59A 1KR5A 4RX1A 4ARAA 4DQUA 3MN1A 4IDQA 3OCUA 3CF4G 3FMIA 1SXGA 3GY0A 1DAMA 1E62A 1A9QA 2I4LA 2I22A 1DX6A 2AEMA 2FEAA 2CHUA 3SM3A 5JT1A 5KOYA 5KBYA 1JG2A 1ESMA 1TKRA 4XI9A 3MRVA 2B8TA 4C88A 3LJKA 1RZ3A 5ECYA 1O0CA 2JH9A 3HU2A 4U63A 1QCYA 1ODTC 2IGTA 4YIHA 1IYZA 3NALA 2Q6KA 5JISA 3EVZA 4MITA 4QOGA 2IYOA 4J3NA 1N34B 4U3JA 4ZFNA 1J9EA 3SC2B 5B36A 3WL5A 2RKBA 3LC0A 2ADMA 2CFCA 1Z7EA 2Y0PA 1WCYA 3UK2A 4AMVA 1J0AA 4WEQA 3ESXA 4Q4AB 5J23A 5HCUA 1NXWA 2W93A 3AUYA 3PYMA 3TTTA 3OY7A 3KEFA 1QIGA 2VCYA 2D1TA 2CBGA 4D45A 4Z8YA 4B81A 1T4CA 2O23A 2ZJ1A 4R05A 3CGGA 4QDOA 1UJ5A 4KGDA 3KL4A 4WLOA 2QPOA 2JI8A 3UN1A 1C1HA 5C35A 1FFDA 4QHYA 1DCTA 3IT1A 4FYXA 5HKOA 4I6JA 1RQPA 1USUA 4OQ4A 1XKQA 4RY8A 4I5EA 1YZKA 2QZ9A 1OD6A 4TWJA 2HJVA 2RHLA 4LUCA 4CI0B 3DEIA 2HLNA 2R4QA 3H11A 4XPIB 3ZCXA 1X14A 3CUUA 2X8LA 5HNKA 3AEUB 1OV6A 1J5PA 2LUOA 4F6RB 3D0KA 5G0UA 4BUCA 3L9WA 5KMGA 3K0CA 4ESOA 4MVJF 1O6BA 1TEXA 2A88A 4NMWA 3CH4B 1KK3A 2FEPA 2XQJA 4C0SA 5LQAA 3IVRA 1WTAA 2WWGA 4U8GA 2RC5A 5B1EA 5JV5A 4MTLA 3O47A 1HGXA 5SY6A 3VR6H 3OG9A 3PR3A 1Z26A 3ESRA 1XDBA 2FK8A 2WSSA 1CUXA 4Q47A 4RZXA 4V0SA 4E51A 1E64A 3QJYA 3IV7A 1XOIA 4DMGA 1Z4MA 1M9NA 1RW4A 5G4KA 3AR2A 1DU4A 4UNRA 1FSZA 3ENVA 4MQEA 4I55A 4CEHA 2G77B 3GK3A 3CLKA 1C9EA 3M6IA 4FS3A 2F67A 3V1KA 1XP5A 2BE9A 4NOJA 1K4YA 5HCNA 3GB9A 3LCVB 1M2KA 1XSEA 4JC8A 4Y18A 2CFOA 1CD5A 1J8FA 5EZYF 2QJTA 3EYAA 4F56A 3T5PA 3C4JA 4JSRA 4M3NA 1MPXA 2ZYGA 3FI9A 2KSQA 2VTKA 1IN1A 2JCVA 3CH6A 5L40A 3PEYA 2ZUTA 2BOVA 1RJGA 3SHVA 4FMCB 1IY0A 5GINE 1Q91A 2XGGA 3M9LA 5DOVA 1SB8A 5L9AA 1QZTA 3FYHA 4CDMA 1X1DA 1NQXA 1PGNA 1JDZA 2C00A 4O4LB 3PUWA 3H2BA 5JMTA 4EYKA 2H5JA 5FI1B 1E9DA 3GL9A 3ROTA 4EI7A 1K7SN 1AK9A 4Q12A 2PRIA 4HBGA 3AG6A 2GQ0A 3B70A 3GGPA 3HYRA 1WG8A 1Y9DA 4TVKA 1PL7A 3P52A 3W06A 2ZJAA 4OBEA 2OE2A 4KXXA 2ZB8A 3BXXA 1V7PC 5HM8A 2ZBDA 2A94A 4LZZA 2P9TA 2BWJA 1Q92A 1N7IA 4G37A 4URZR 1QGED 1P4JA 3LSTA 2FB9A 3RUPA 4NZZA 4CIDA 4I2VA 3F67A 4KXUA 1ZM2A 4MRMB 5JD4A 2B1RA 1C8LA 1MV5A 4N3NA 5HIIA 2B8NA 4UHHA 3ESBA 2O2ZA 1PV4A 2WIJA 3HYSA 2BEKA 3BIOA 2KPOA 3LC2O 3ZZ1A 1R0SA 3LZDA 3GHHA 4HDOB 2JFFA 2FOIA 4OQDA 5C34B 3RYTC 4BLTA 1H2XA 5ALSA 4F2DA 3GAZA 2DOKA 2FP4A 2ANBA 2FKNA 1Z62A 1Y5IA 1ZU5A 4QTUB 4ZJUA 3UANA 1OXTA 3QEJA 4ZIRA 3AMVA 5F64A 1SHJA 4UZEA 1B93A 2A9RA 1TYAE 3U3OA 3KSBC 3HABA 1P0QA 1CUJA 3TLJA 3WL7A 1O95C 2FOLA 3I6BA 3AR4A 4RFSB 5LMUB 5BVGB 2Q4EA 4W1SA 1AZTA 4ZJZA 5FLEX 1KTIA 5GONF 3AVXA 4O6VA 4PLFA 5TRTA 3SEZA 2BH2A 1SH7A 2YTZA 2WMNB 2ZDQA 3A31A 1PR4A 1Q0SA 2NO5A 4HNAB 1PZHA 4YJ2F 3DT8A 2P6PA 3GNLA 3GQBA 1I1OA 2B82A 4OREX 3EG5A 4OYLA 5DTRA 4EKEA 4UD6A 4PR0A 2G80A 3I9JA 3JSXA 4FONA 5FWDA 4A6PA 1QTQA 2IYVA 4CKZA 1PG0A 3SFZA 1U1CA 3O8DA 1YQXA 3HVJA 3S81A 1SBIA 2Q3JA 1U2DC 3ICPA 4J0HA 1DC8A 1SWVA 5HA5A 5J5VA 4FT4A 3H9CA 5K03A 1F5SA 1U7XA 2JS7A 4IZIA 3ZDXB 1CYDA 5IH7A 1HQCA 1WL8A 4B33A 4LV8B 5IJ0B 4ESVA 4IIUA 1V7ZA 3EB9A 1UT5A 4DLTA 4JSTA 5ISMA 2E5LB 1LQTA 1VLHA 2KI5A 3QG5A 4JJ8A 4BZZA 3LH5A 3TDMA 1MRNA 3RQIA 1AZLA 1T26A 3HB0A 3NBFA 4QNRA 3PEVA 2CFSA 2ODNA 3B6JA 4GLLA 1SKYE 2GXSA 3DG9A 4XFDA 1H1DA 1VRWA 4GQAA 2B4AA 1C30A 5A3SA 5HJ5A 1AK2A 2WP0A 4EJ0A 5CVTA 3FDIA 3VZRA 2C9CA 1ZJWA 1VJTA 1FRVA 2WHQA 2XGSA 3HI6A 3B53X 3EIOA 4IFEA 4YRDA 2PAAA 1IN7A 3C3BA 3PGJA 5LDGA 2WWFA 1VA5A 3FFAA 3LK7A 2B83A 4OJKA 1SCUA 4ZI7A 1LSSA 2QN3A 2WTNA 1DV1A 2IYFA 4OKSA 1M6VA 1QUFA 3F3MA 1P1CA 4IS3A 3RFXA 3QEMB 3DZGA 2C88A 2HBZA 3IERA 3PE3A 4OLJA 2QGZA 1I36A 3FIUA 5REQA 1DWUA 2XADA 3A1DA 3W1EA 2PBZA 2QUIA 2WHYA 3UIEA 4PZCA 1MIOA 2LDBA 2WSYB 2XPCA 1R4NB 2JLCA 4K6CA 1KI7A 3AHFA 3KVYA 4RHUA 3K1ZA 4R6WA 5DW3A 3DW3X 2ZPTX 3MZ0A 8AT1A 1RIIA 3V7NA 1NRJB 3MBKA 4AF6A 1I3LA 2WWWA 3BE8A 1X1BA 1U2DA 1XU4A 1CQPA 2WJ3A 3FN4A 4G3XA 2BM1A 3WS7A 4O0LA 5TJ9A 5KEIA 2C2BA 4GUAA 2YN2A 1EUYA 3VO1A 1XDDA 2QG6A 4BNDA 2WJJA 1XRSB 2WHRA 2WR8A 3I9V6 3PFIA 4QO8A 1QLJA 5LP6C 2VJCA 5ITSA 1YKSA 3K31A 3EDQA 4GYWA 5ESWA 1I01A 5BWLA 1XAIA 3IAFA 5CT9A 1Q44A 2F3TA 3E84A 3DT9A 3UFXB 1JBKA 3N07A 1FMCA 1ACJA 3MJSA 3Q3GE 4NARA 1OWLA 4PN7A 2CXPA 5KPDA 1PF7E 3K2IA 4E31A 2R4TA 2WV7A 2PFSA 2NZXA 2PIAA 2QVXX 2RK4A 2P9GA 1CVLA 2ACVA 2XTAA 3K9WA 2D74A 3VR6D 1D03A 3LL7A 1TO6A 5JYCA 1KAEA 1L7QA 1ZD5A 3GT3A 2VHJA 3Q1LA 1N0UA 4WSOA 4GO1A 5DLQC 2E1PA 2JJ1A 1EG7A 2FRVA 2ZBEA 1V16A 2LW7A 3BQMB 3AY0A 1YMQA 3WK6A 1A9RA 2Q2NA 1U4OA 3CX6A 3TNDA 1IM5A 2X15A 4KE8A 3QU5A 1QGOA 2GFQA 2X9GA 5FJIA 2CNDA 3OU2A 4E09A 4I8IA 1NY5A 3MFYA 1DWOA 3O2QB 4RPHA 2ZBQA 4A8TA 5K3FA 1X2BA 3VOAA 3QW2A 3HVRA 4YRNA 4IDHA 2JAOA 3V97A 1QFSA 2DFKB 3LZ6A 4M9UA 3O75A 1PJ8A 4G5RA 4A2CA 4YMTA 2QYOA 4GKKB 1ZU4A 3ICQB 5EWJB 5THKA 2FNAA 1NXSA 1PQPA 4PYMA 4E21A 1E3IA 4R5MA 1JV2B 2EX1A 2IPAB 1UWVA 2DH5A 5JI3E 5BQ3A 5KC8A 4CL8A 2XV1A 2BC9A 1V48A 4TRMA 4QYMA 3GV0A 1Q3TA 3RJZA 1Z4IA 3RT9A 4D5GA 2RIRA 3EGDA 1ZRNA 3AQ4A 4NHEA 2QLTA 5BRNA 3RC3A 2ZRNA 1GNTA 4TXJA 1A7JA 2C0PA 2W6MA 1A9PA 4IIHA 1NSFA 2BMFA 4LHEA 1KIFA 1L7BA 5JADA 3AZPA 2IEAA 3VSCA 1X1CA 3TSYA 1QBKC 3CG4A 3P9PA 1DP4A 5ALUA 1LS1A 3WA6A 3L8GA 4PXAA 4GMKA 2LVBA 3QLUC 1OHHD 4IILA 1U8YA 1ICEA 3R3VA 4GU5A 3TFQA 5BR8B 3N0RA 2HBQA 3CX4A 4FW8A 3H2KA 2QEQA 3D02A 4OHBA 2DULA 2WF5A 1NJ1A 3O4VA 3D6NB 4YAJA 3TW6A 1SCQA 1RI1A 2P3LA 3DKPA 3DPSA 1WPXA 3MIIA 2FQXA 4NZPA 4O4JB 4PAMA 5KU7A 4RFLA 3EPLA 1YD7A 3QVGA 3T7RA 2BMDA 4UE2A 3LQ4A 4DIOA 1R6TA 1NT2A 1XFDA 4A1OA 5CCXA 2NO1A 5I9SA 4AY2A 4DA8A 3EBOA 3BULA 3V33A 4OM7A 2Z2JA 5F1OA 5G2OA 4ZU3A 1AVTA 4OHCA 2BSAA 3OPVA 1EX9A 1CWUA 2I62A 4YJDA 5E9AA 4KPFC 2JIZA 2IHVA 1ZL0A 1U8XX 5DWDA 1XR3A 5C80A 3GA5A 4KRFA 3CRQA 3SHWA 3L4BA 5G0VA 3TOCA 5JXIA 4N03A 1TCCA 2QX6A 2JVKA 3B1YA 1JHOA 1JHPA 1ZD3A 5FWXB 3I4LA 4ITUA 2GNPA 3U80A 3M6MD 1P8AA 3MF4A 4UUPA 1RDFA 4PYRA 1XXHB 4HNTA 4TYYA 3B85A 4RVSA 2H4JA 1I1QB 2J3JA 2OZPA 1PZFA 1Z2NX 4LIPD 4QDUA 3ZHZA 3REQA 1KMHA 4EMSA 2Y0EA 3CINA 3KKLA 5F1PA 4ITRC 2XMQA 5FRDA 4EHHA 3PHGA 2XA2A 1G3MA 4DR6B 4GWGA 4KGZA 4HB4A 4YCBA 3RR2A 4QFDA 2R60A 3JU3A 1E20A 3MTQA 3PCTA 3U0VA 1NE2A 4YJ3B 3H16A 3IP5A 3CJQA 2B8JA 2QL9A 3OT5A 4LSGA 3ROGA 2C8LA 2FUG6 4FBLA 1RI3A 1ND6A 2CVHA 3RROA 4BLSA 4C6SA 4FKMA 1XTKA 2A0XA 3NWPA 2DEUA 3AILA 1LRJA 4TSFA 3TTXA 1VG9B 1Y9EA 2FWBA 4GD3Q 4CMGA 1E9CA 1NW8A 3PEFA 3PNMA 1A9ZA 3V3TA 4TSKA 4AURA 5JNTA 2FX3A 3GP8A 3V1LA 1JEYB 1VE6A 4RHTA 5A0FA 5GMOA 1LFDB 1SHKA 3CCCA 3NGMA 4Q15A 2BFWA 2WJPA 4C0QC 1B2LA 4TVSA 4AKIA 2FSIA 3O2SB 2Y0BA 5CPFA 3SKXA 4WNCA 5ENDA 4ME6A 3TLEA 3UGQA 1AO3A 1MTOA 1LI7A 1K7YA 1UBSB 1TE2A 3KAJA 3NEJA 4ANFA 1WKBA 2WSLA 1J97A 2YXDA 4ARZB 2V65A 2WDZA 2V6JA 2ZKIA 1BYIA 1MR3F 2FW8A 1NNSA 1UDRA 3GZTB 2MHCA 5B58T 3IC5A 5D1HA 4HX9A 1CQIB 3CLSC 3JD2A 4L8LA 1FDUA 2HEIA 4M7OA 4MUIA 4CLEA 2C7OA 1QR2A 1DUIA 1G291 4YLYA 1JLHA 2GD1O 1JR2A 2A1UB 3ETHA 4M9XA 4RCYA 2JKVA 4E1BA 4ALNA 2PGDA 4TN5A 2GO1A 5IUKC 2F64A 3AFNA 2Z0MA 3CTMA 4DM4A 3OLVA 3Q85A 4A36A 1DRVA 1WY5A 2EGHA 2VEOA 4LXXA 3ANLA 4KQHA 4MUAA 4UU1A 2X77A 5TGDA 3RUDA 5LQRA 5FFNA 2JLWA 2ZJ6A 4YS6A 2O8CB 3B52X 5H68A 3AW8A 1FNBA 2XY4A 4MVJH 2HRCA 3CUVA 3FDFA 5KOIA 2Z6AA 4K7JA 4TRNA 3M6XA 3V6LA 3VYUB 1CZHA 4IO0A 2GK7A 4KAXA 4ZC1A 3QQ5A 2O48X 3QUBA 1QRUA 1KY4A 1V9CA 3LMKA 1RXUA 2HRDA 5C8ZA 1JYSA 1MX3A 3UMBA 5MHTA 4BFSA 4GUDA 1NY6A 2HDWA 4UDYX 4N5IX 4I1IA 3UG6A 2B5VA 3AVPA 1OAOA 3FJYA 1DL5A 3P32A 2GN4A 5DNAA 3W4IA 4EEKA 3VYWA 1AUXA 1TK9A 2X2EA 3VC2A 1FJXA 1XDUA 3AI1A 5HKLA 5LXTA 4KQ2A 2P6RA 2ZE6A 3HKBA 1FDWA 1YIOA 1RKBA 2OMEA 2OVBA 4C07A 1IUKA 5GZ6A 5H59A 1NW9B 4XZ3A 4Q4LA 3UHOA 3FYCA 2W4QA 1ZA2A 2ZULA 3T1YB 2H4XA 5IVIA 4EB8A 2BFEA 2QQEA 1GVHA 3MWGA 1FUKA 2PGNA 4BE9A 5EHIA 4YASA 4C7XA 4RPLA 1RMQA 2CWWA 4CCWA 1P6XA 3TZLA 5IJAA 4BNJA 1WKVA 5P21A 4G89A 2ZITA 3IH5A 3NI2A 1XLUA 1NXOA 1U3GA 1W46A 2KB0A 4WA7A 4ONEA 1M6HA 3K6JA 3WLHA 3AC0A 4CM8B 5JNWA 5K3EA 3QWBA 3HU3A 2G04A 1SKUA 3IR5A 4GBGA 1E7SA 1GFZA 3SDZA 2DXIA 4GKBA 3V34A 2OO5A 1H9BA 4CN8A 4MIKA 4AG5A 4CFZA 4O3MA 3KB2A 3ZY4A 1O6CA 2C5AA 5TQ0A 1CPYA 1GTL1 4DR3B 2V7QD 4QASA 2VF7A 5TLSA 2W2PA 4A6DA 2UUBB 1ZGBA 4I4NA 2PRZA 2ASEA 2WC1A 2G0AA 2G5CA 1NVEA 4PQYA 4B4UA 3HV2A 3IV6A 1KI6A 1O87A 3AF5A 1IOZA 1TIBA 2ENUA 3R0QA 2VUUA 1PFWA 3OHSX 4J1TA 4IZ6A 1UMCA 4YPOA 3SEFA 1ZIPA 4DDHA 1NRXA 3RS2A 2ZYVX 3DAYA 2GBIA 4CWAA 1VI6A 1EVKA 4M99A 4AS1A 4ZVOA 4KC0A 1UINA 2FW1A 3P7MA 1Y3BE 1R7RA 4MJ3A 2IYQA 3ACDA 1IY1A 1NNEA 1CZKA 3UWMA 3CLRD 3Q8XB 3HXLA 4FYIA 3ZBTA 4JGGA 2UYGA 1HO3A 5JAPA 4ZYYA 2E85A 5CFZA 1A3CA 3ZU4A 5KU1A 4RC9A 1NFQA 1OXXK 1QPBA 3CR8A 4QXRA 1JFSA 4KDRA 3VGPA 2YZ2A 4CQMB 4CMEC 3U1BA 5A02A 5AUNB 1Z7WA 4HN2A 3BD6A 2WWYA 1KZ4A 1NP7A 3AJDA 1IOLA 1U4NA 1RRFA 2IYEA 3VU0A 3G0IA 3PRKE 4KLRA 5FHRA 2PSSA 2PVPA 2P11A 5JR3A 1KYVA 2WVJA 2MSCB 4Q19A 2VF5X 4M22A 1RRCA 4V3CA 2WHPB 2ORED 2O2DA 3EBPA 4MWOA 4D6YA 2HK9A 3DE4X 3ND8A 4L8FA 3A6JA 5FBVB 4TL9A 3TKYA 3PQ7A 4CV3A 5E6UA 3ITKA 5BSVA 4TS4A 4QVGA 1Z83A 3QYPA 3GT7A 2P3QA 4I1SA 4IKPA 4PRKA 1ACMA 2JFHA 1FTGA 3QTLA 3O3OB 2A67A 1JIVA 2B0JA 2YS7A 1A1VA 4OU5A 4BLQA 4M83A 2X4GA 2H4YA 2JGEA 3LVFO 3PVSA 4G1MB 3ZWKA 2IDZA 1V96A 3KPVA 4CUZA 3GJ8A 2JI7A 4UPEA 1H3FA 1PJQA 1GZSA 4R69A 1IHPA 2QTFA 4HNUA 4J07A 2W43A 3GPCA 4YC7A 5M3BA 3TO5A 4DA0A 4JI2B 2VG8A 3V7FA 1VL0A 3QBJA 2C1EA 2LCIA 1KYWA 1AV7A 3GEGA 5DX1A 2WPNA 1UIMA 1NVVR 4MKIA 5JG7A 3KWLA 3WADA 1KIAA 2AGVA 2IZ5A 2Y1KA 1DSSG 4ZDIA 4ROSA 2H31A 2A3RA 3VR4D 4FR5A 2IEBA 5AJUA 2FR8A 3UAYA 5A62A 1J8VA 4W82A 3TLXA 3NBZC 3GCZA 1Z29A 1EVJA 3PV0A 4PBSA 5IW8A 4DDWA 3WFIA 4FHZA 1MB2A 2VJOA 3LQKA 2BFBB 4QFBA 2O5VA 4HFJA 2GJ9A 3ORQA 2ZS9A 4I19A 4NFHA 4K87A 2I6SA 4DSNA 1NW5A 2C8KA 5HFAA 4CLRB 4D74A 4MP3A 4FDTA 4MYSA 5JCOC 3L8MA 3BS4A 3H0EA 2Z4SA 4O63O 4OJNA 4C3VA 4D97A 5LYJB 1A9XA 5CA0F 3G02A 3BXGA 2R7NA 3HA3A 4AF7A 4AKHA 3ELDA 4JS0A 1N6LA 5J9FA 1WXWA 5EL0A 3BHNA 3Q8LA 4KNWA 1XTSA 3PGA1 5EXEA 3EXEA 2VTDA 4KQ6A 3F46A 2QD5A 4C0HA 2WIDA 3B2QA 1KJ8A 1Z5UA 1YU6A 2J30A 3H8JA 5CT4A 2H0AA 4DLLA 5CYPA 2N47A 4I7EA 5DE3A 3AUTA 3G7NA 3ZI4A 4F3CA 2YICA 2GEDA 3WGKA 5KNLA 4YRRA 3PXDA 3REFA 1P91A 4YRPA 1EU1A 1MENA 1RRMA 1VYHA 3OOEA 1WEKA 2XCLA 4G9EA 5DCYA 4QPZA 4KYUA 3NKVA 1WLYA 4BUZA 4PZYA 1Z6ZA 3ZTWA 3LCUA 2H11A 3AUJB 3UT5A 4CU5A 3ZW7A 2GR9A 1PCXA 2B98A 3H6KA 1R6AA 1WAMA 3E22A 3X1ZA 3A9WA 3EWAA 3S3TA 1NUQA 1WU7A 3DZ8A 3SM9A 1K7EB 1JVBA 3GFSA 3WHLA 4AW9A 4EJMA 1HH4A 2CNBA 3QJ5A 3T9BA 1GIAA 1PW7A 4GVPA 2GUWA 2WHPA 4IHJF 2R00A 4BB5A 2XWSA 5CTJA 2TSYB 3P97A 5K4GA 4OQEA 4XIIA 1JZSA 1XTJA 3CZ4A 4CLRA 3QA3E 4MRRA 3ROKA 2II6A 1YOBA 3P96A 4Z1OA 4L3VA 3ZCUA 4EHDA 1QHEA 1X1EA 4GC9A 2AJTA 4LI3X 4ZIRB 3H18A 1GHTA 3ONNA 5JY6A 3HDGA 4IG9A 4BNNA 1VMIA 3IUJA 1JHDA 2JBAA 3P4UA 2A4MA 1DIBA 1U2QA 1X7YA 3W05A 2EYUA 1E8NA 3VTKA 3DZKA 1FQWA 2HADA 2RGYA 5BV1A 2ZJFA 3B48A 3H2JA 4EGSA 4KITB 1Y9AA 2G8LA 4OQYA 3BZUA 4G2TA 1WXHA 4H7HA 4S1NA 3R0JA 4YA6A 3A1TA 5T4FA 1KERA 2Z98A 3WGGA 3ZVKA 2F1JA 5DGTA 5F9MA 4HNQA 3W6OA 2YV1A 3CLUD 1GZUA 3HXTA 4NONA 4TWBA 1EBBA 5DZSA 3WNQA 1GLNA 4NCBA 4KREA 1VL2A 3JZDA 3Q41A 2OD2A 5AI8A 1Y81A 3E9RA 3UQZA 4B34A 5HS4A 1B00A 1Q3HA 3V4OA 1VL6A 1V8PA 5KYWA 2OBFA 3L92A 2BUCA 1PJ3A 3PHIA 5LBIA 1UR5A 1EDBA 1MP0A 2PLWA 2A5GA 3BMNB 3CMMA 2G1UA 4OB7A 4G0MA 4G0OA 4PO8A 5HRUA 4W9RA 1OPRA 3CO5A 1V8FA 1AGRA 3B5JA 4TS3A 4ARVA 1NUHA 2HWWA 1U7UA 2H16A 3LYAA 1NZJA 3NT5A 4HEHA 4BVAA 3PG5A 1DX9A 3P27A 1WVIA 3BXOA 3R23A 5DCLA 3NT2A 1J42A 1MJHA 2IY9A 4FSXA 4L9AA 1ZYUA 4L22A 3OM0A 2DR2A 3NTQA 1E9SA 1BROA 5HZHA 4KFSA 2CHQA 2A0WA 2BY4A 3LG2A 5K3SA 3FCXA 4NYIR 1DEAA 2O1XA 4L5AA 3V2UA 3WB2A 4B3HA 3KQKA 1QZ3A 4GFDA 3WAJA 1J21A 4QWWA 2QTVB 1OFGA 3CURA 1KKLA 4MV8A 1L3BA 4EYOA 5EEGA 1GGVA 3RSOA 5A7HA 2HWKA 2JHAA 1K6EA 2QTCA 3DMPA 3CXUA 1YBMA 1BG6A 3O1IC 4FWBA 1LV8A 3DBIA 3KZXA 4H3VA 5BMOA 1AUVA 3UMYA 2JDIA 1G18A 2YYYA 1TB4A 1NG1A 1R6BX 2J08A 4L5CA 4JKIA 4H4DA 1R8JA 4L76A 4LKOA 5IAKA 1VKOA 1Z15A 4LDPA 3LWNA 3QPDA 4BO2A 5CEEA 4FKZA 1SKYB 1GGNA 3O7MA