2Z1NA

Crystal structure of ape0912 from aeropyrum pernix k1
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
260
structure length
237
Chain Sequence
MDLGIQGKLAVVTAGSSGLGFASALELARNGARLLLFSRNREKLEAAASRIASLVSGAQVDIVAGDIREPGDIDRLFEKARDLGGADILVYSTGGPRPGRFMELGVEDWDESYRLLARSAVWVGRRAAEQMVEKGWGRMVYIGSVTLLRPWQDLALSNIMRLPVIGVVRTLALELAPHGVTVNAVLPSLILTDRVRRIPMGRVGKPEELASVVAFLASEKASFITGAVIPVDGGAHI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A unique catalytic triad revealed by the crystal structure of APE0912, a short-chain dehydrogenase/reductase family protein from Aeropyrum pernix K1
pubmed doi rcsb
source organism Aeropyrum pernix
molecule tags Oxidoreductase
molecule keywords dehydrogenase
total genus 89
structure length 237
sequence length 260
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2z1nA00
1ML3A 2HQ1A 3ZWCA 2YUTA 3SLKA 3Q2KA 1ZNQO 2OBNA 3F6YA 4JJIA 1XLTA 3ZWNA 3ZW9A 3FSRA 3PTZA 4BB6A 4W6ZA 4YAKA 1C1DB 4E2XA 1LDYA 4CMIA 2BFPA 2DKNA 4Z9YA 2ZTMA 3D3WB 3ZV6A 3I52A 1I5RA 3CE6A 1LSJA 1HYHA 1V8BA 1PJBA 5KIAA 4TROA 5B1YA 3A4VA 1DFHA 4EJ6A 3ROMA 1GL3A 1H6AA 1O94A 3LQFA 2Q50A 1V35A 4EI2A 2Q2QA 4LMPA 4J1SA 1FJHA 1MA0A 2X22A 1R4NB 2GN9A 3M1AA 3GEDA 4TKMA 1UH5A 2WTBA 3MOIA 4BGUA 3IQDB 4P4NA 4U0KA 4Y6RA 1NAIA 3D5TA 1N1GA 4R1NA 4BGVA 2VTDA 4NJMB 1BDMA 2V6MA 4GI2A 3GN2A 4E31A 4B7CA 4H3VA 4NU5A 1KEUA 1LDGA 1CETA 2Y66A 3JQGA 4ZN6A 1NVGA 4XZ3A 3AY3A 5KCZA 3DHYA 1I36A 2UV8A 2X4GA 3RFVA 1JVSA 1I32A 3FN4A 3V2HA 3RKRA 2HKIA 3S2FA 2GNAA 5TT1A 1GY8A 1VE9A 4CLEA 1LDBA 1ISIA 1EDZA 2FHSA 4FC6A 2OXIA 5KJ1A 3HDJA 2FN7A 3DAPA 3I23A 3FI9A 2JJYA 2FSVA 5F3RA 3P19A 3GC6A 4NBWA 2QG4A 5DBGA 2DFVA 4AJ2A 5TS3A 4A73A 2AQIA 3OJEA 1U3TA 5JMPA 1WW8A 5EL0A 1HDGO 5H81A 5JYDA 2O48X 4QXMA 4MKRA 3C7AA 4MVJP 1U3WA 4IZIA 3LC7O 3OMLA 4QFCA 3DB2A 1SAYA 3GDGA 5T8KC 2Q1UA 5A9TA 2CVZA 4Q3DA 3WG9A 1NFFA 2B35A 2JCXA 2OO5A 2Y99A 1T1RA 4JP3A 4Q39A 4KQWA 3N58A 1Q7BA 4G81A 4GVLA 3K9QO 5JC1A 1B0AA 4Q3BA 3NAQA 2W90A 5K9ZA 3KHUA 1GAEO 2VTEA 4BNNA 1DFGA 5L53A 5KJFA 3GA0A 4XDYA 4FIZA 3BMQA 3JYNA 1KYQA 2BD0A 5G0UA 2GD1O 3F47A 4EITA 3QSGA 3JQ6A 3I4CA 3D7LA 2AE1A 1SB8A 2D59A 2X8LA 4IGEA 2PY6A 4KDFA 4MP8A 4N18A 4N5NA 3RASA 1B8VA 2BMAA 1E7QA 1GV0A 2WM3A 4YPOA 2FZEA 3WX0A 1T2DA 4PLPA 3STHA 2IZZA 1YGYA 3HN2A 1EQUA 1DJQA 4IDEA 5AXCA 4CQMA 5MGBA 4GX5A 4ZRMA 4DMLA 1WVGA 3U09A 1NTOA 3O9ZA 1JDJA 5T8KA 3TFOA 3ROQA 5ER6A 3O8QA 4O5OA 1NASA 1JN0A 3KEQA 4ZQHA 1K5HA 1YVEI 3GGOA 4HFNA 1HRDA 1YH3A 3ONDA 2QRJA 2P5YA 1W4ZA 4FSHA 4YACA 1DJNA 5EN4A 1IPEA 1YOVA 1XEAA 3CUKA 3GFBA 1IZ0A 4XR4A 3KO8A 1Z7EA 3HN7A 1P1JA 4NK5A 3DAFA 3KOUA 4IJWA 4TRRA 1P0CA 1P9LA 4UEJA 2W4QA 4BO3A 5F21A 1I2CA 1PGNA 4JLWA 3I9LA 4UREA 4YQYA 5JE8A 2ZYGA 3UXYA 2PKQO 4N5MA 5JAZA 3AW9A 1RM0A 1U5CA 3EW7A 1Q0LA 4KUGA 4EDFA 1LLCA 1HDRA 4CV0A 1WDMA 4WLOA 3TFQA 1UXJA 2E48A 3VH4A 1AGNA 4QFDA 2C2XA 1EDOA 3NDRA 1H6CA 4D43A 4WCFB 2GZ2A 3JQ9A 3LC1O 3IUPA 4PRLA 1CWUA 5BT9A 2C29D 4LISA 1XYGA 4HP8A 3UN1A 3GUYA 1F0YA 3I4FA 4YJDA 4A03A 2GN4A 1WMAA 4BHTA 4K1LA 4ZU3A 2XXJA 4BNFA 4P22A 3JQAD 5CHEA 4C7KA 4PG8A 1J6UA 4OH1A 3QQPA 1ONOA 1KY4A 2YV2A 3E48A 2YV3A 3NGLA 2Q2VA 2X23A 4RDHA 4XIJA 1LRKA 3NTOA 3MZ0A 3S55A 1B8PA 4KTTE 1ZEMA 4IUYA 4RPHA 4CL3A 4FQ8A 2YHIA 2R00C 3Q0EA 5CDTA 5HS4A 4D0SA 1E3EA 4R5MA 5HBRA 5CG2A 9LDBA 3KYDB 2VCYA 3S1LA 5F1OA 4NI5A 4CLRA 1I3NA 3K8ZA 3FPLA 1QYXA 3RBZA 1B26A 1U4OA 4YT4A 1V3TA 1VL6A 2DQ4A 4W99A 1Z45A 4IGFA 2Y1CA 3PDUA 1ZJZA 2IXBA 3RD5A 3TRIA 1EUDA 3DTYA 1BW9B 1A27A 1DHRA 3JQFC 5CPBA 5L9AA 2GGSA 3MJSA 1XG5A 1AUPA 1U3UA 4OSOA 2FPGA 2XAAA 3ADPA 1QKIA 3S2EA 1MP0A 3DL2A 4J4HA 2EIHA 1PJ3A 1XU9A 1BXGA 1X13A 1P44A 1U4SA 1R15A 1HLPA 4J6FA 4OKIA 4I9NA 3PP8A 4CLXA 3WWYA 4J7XA 4MVJH 4GX2A 4XYMA 4CR6A 1YJ8A 1M75A 5G4KB 5IN5A 2BGLA 3ZWOA 1TEHA 4P8RA 2VOEA 4DPLA 3ANLA 1NPTO 3N7UA 3SEFA 1Y1PA 2NNLD 1QYCA 3I1JA 1JWBB 4R1SA 1W8DA 1BXZA 2RBEA 2AEMA 3KUXA 1RJWA 3WGGA 5L95A 4YVFA 2NTJA 4JGBA 4CMIB 3MJ4A 4NIMA 2FY8A 4ALLA 1WZEA 1WDKA 4MKXA 1QMGA 4PG7A 4E3ZA 1GFSA 2HRZA 5F5NA 3R3SA 4DIOA 1Q0HA 3GAFA 1E3JA 3GMSA 4ZQEA 1A7AA 1G0OA 4R3NA 3E8XA 3V8BA 4MVJD 3WGOA 1Z82A 3AU9A 1YKFA 3F5QA 5TNXA 4BO4A 4XD2A 3PHLA 1AXGA 1FF9A 1HDYA 1XQ1A 1R37A 3C7CB 4TSKA 1TA4A 5CEFA 1YBMA 2EEZA 4PIVA 4E0BA 1QXSA 1XGKA 3PJGA 4CMEC 1EBFA 1PS0A 5DF1A 3WGYA 5T67A 2V6BA 2WD7B 1UDCA 5ICMA 5L7TA 1XU7A 1YBAA 1E92A 3GZNA 3UKOA 1OZAA 2D0IA 3GRPA 1E3LA 2XPCA 1PL6A 2W2KB 3GLQA 4TZKA 4C4OA 1ZK1A 1M67A 3LF1A 2NLOA 1H0KA 3QVWA 1N1EA 4CMHA 3WBFA 4BNIA 1PJ2A 1HYGA 1TI7A 3PJDA 5TQVA 3RC2A 1N92A 1VLLA 3BZUA 2Z95A 3FNFA 3JQDA 5K0ZA 1IUKA 1Y6JA 1QP8A 4L9RA 2Y1FA 5KOIA 3U49A 3EHEA 4R9SA 3IC5A 1E3WB 4TQGA 2CSUA 3ZU5A 3KM0A 3L4BA 4D41A 3ETEA 3U4CA 1Y8QB 2X9GA 4W7IA 2WE8A 4M86A 1UR5A 1GZ4A 1VM6A 4DMMA 4XYLA 2HK9A 4J49A 1I8TA 3OF2A 1C0LA 3F4BA 3UAGA 2VHVA 4XB1A 3HG7A 2O7QA 3CINA 1HWYA 3NRCA 1PU2A 1PGQA 4I5FA 2B5WA 4CMEA 1WPQA 4XRGA 1VC2A 4FJ2A 3P2YA 3U9LA 3FBTA 4PRKA 4K6CA 4R69A 1UDAA 1ISHA 2OORA 4DREA 3E18A 4M8SA 3ANMA 4YB8A 5TF4A 1XHLA 1UAYA 2Q4BA 2BLLA 2O3JA 4GWKA 3ULKA 4ZHSA 3OJFA 5DOVA 5JNLA 3AFMA 2NVBA 3ETGA 3ZDFA 1BDBA 3BMOB 2NU9A 3DBLB 4XQCA 4WLFA 2NVUA 2O23A 2VWHA 4KWIA 3WR5A 2JD1A 3G3EA 4FGWA 1H2BA 3TWOA 5TJHA 3ZWAA 2J3JA 3BTOA 1EQ2A 3WOHA 3GF4A 3G17A 1D7OA 1G1AA 1DAOA 1QG6A 2VWGA 4BKPA 1BXGB 3FCOA 3QWFA 3ZN2A 2CFCA 1OFGA 3D4PA 4WUVA 3DONA 1HZZA 1PQPA 2VOJA 3PWKA 5EESA 4UULA 3DBHA 5JDCC 3SX2A 1UDBA 3IJPA 4U8GA 3HADA 4HNHA 4A0SA 2HU2A 4R51A 2PD6A 1IYZA 3MEQA 4WASA 3KYCA 3D0OA 1EVJA 1LTHR 3CKYA 4B4WA 1E5LA 2NM0A 4IY1A 1HE3A 1VPDA 2B4TO 3B70A 4DYDA 3KVOA 3RWBA 3ICPA 4DBVO 4M87A 2DBRA 2Z1NA 5U4QA 7MDHA 1Q0QA 1LDEA 1C1DA 1M6WA 3GFGA 2WD8A 4GH5A 4URFA 2CDBA 1F14A 4NQZA 3VZPA 1SPXA 5A3VA 1ZXBA 2JL1A 4ITUA 3U3XA 2ZCVA 3OECA 2AQ8A 3D1LA 2VWQA 3I6QA 5ES3A 4YJGB 4ZD6A 4XEHA 1Y81A 2P2SA 1U9JA 1KIFA 4GMGA 4OMUA 3EMKA 4Q3EA 5CEJA 2NSDA 4RPJA 2Y0EA 3FR8A 4WK6A 3KZVA 4BNWA 1VKNA 1UP7A 5A02A 4CMCA 2CNBA 3FNEA 4GVXA 2HMUA 3FRJA 4R9RA 4AJHA 3DOJA 4PZEA 3PHJA 5JO0A 1FDUA 4GX0A 3ASUA 2GZ1A 2JAHA 5JXWA 2BF7A 2QX7A 3NDIA 4Q3NA 1P1HA 3ZW8A 3VVCA 1H9BA 4TWRA 5FFFA 3M6IA 4FOSA 2HK8A 3H2ZA 3BMQB 3FBGA 3LLVA 2NU6A 5T57A 5CFZA 3GHYA 3LT1A 5T64A 4DPKA 4IBOA 2AG8A 2Y1OA 2YV1A 1EMDA 1D1TA 1VJTA 4XGKA 3I9JA 3DMTA 4L4RA 3I3OA 4BMVA 4EYEA 5A9RA 4CPDA 4DQXA 3JTMA 1T2EA 1I33A 3E9QA 4OGWA 4YRBA 3ORFA 3QHAA 2X9NA 2VYVA 1P45A 3GVPA 4BO8A 4CM3A 3MWDB 2ZB3A 2I5PO 3R6DA 4YJHB 2BH9A 2X7HA 4GPD1 1Z6ZA 4DA9A 3LT4A 3PRJA 1ZSVA 4MIEA 1K6IA 3RUEA 3IIEA 4CM6A 2BFAA 4XJTA 4R1TA 2PTGA 1U3VA 3ZWBA 5G4LA 2FR0A 3H65A 3AU8A 2GN8A 3GNTA 3TZHA 3DXFA 3KSUA 5L51A 2W8ZA 3OETA 1MC4A 3UHAA 1YQDA 3L9XA 2H6EA 5COBA 1OBFO 1E7RA 2C7GA 5FEUA 2BI8A 1YL5A 3CTMA 5I7FA 5IAAA 4RPGA 1Y9AA 2YZ7A 2BGMA 4J9UE 1I3LA 5JDCA 3C24A 1HYEA 1LQUA 1NFRA 1K6XA 1NX6A 1CDOA 2A35A 1PWZA 1B16A 3OJOA 4BKRA 5C7IO 2PZLA 3RROA 3SC4A 4UVDA 3CH6A 3PVZA 4OM8A 3T4EA 1UP6A 2PH3A 1CQIA 3GHHA 4GGPA 5G0SA 5I8WA 1ZJYA 3CMCO 1EVYA 4KP7A 4MVJF 3W4JA 3FTPA 4PLYA 3TOZA 3PIDA 3QE3A 4NNJA 3LT2A 1TLTA 4WKGA 1R0KA 4JK3A 4UUMA 2Q45A 2CDCA 1LLQA 1X14A 3X2FA 4JIGA 3RC9A 2JHGA 1O6ZA 4UUPA 4ONEA 1K6JA 3WGTA 2EF1A 1R4NA 4J2OA 2R2GA 1GUFA 4M55A 2RCYA 4NU6A 5ILOA 5CDSA 3ZU2A 3C7DB 3VDRA 1BSVA 1NFQA 2XXBA 1G0NA 1LC0A 2B0JA 4Q3AA 4HV4A 4WLVA 4OOFA 2ZB8A 4IJVA 2GO1A 2O2YA 3BIOA 3AI2A 4NFSA 2P4HX 2VYND 4U0JA 1HT0A 4ZRNA 5G0WA 5BNFA 3ZV5A 2ZIZA 1BGVA 2O3RA 3TPCA 2BELA 1LNQA 4EJ0A 2UVDA 3ONEA 2TMDA 2A4KA 3K2EA 5A05A 4NJMA 4BGEA 3PQFA 4MVJI 1QR6A 4ND2A 1GZ3A 2AEFA 3Q6IA 4QX6A 4WE3A 5AXAA 1Q7GA 4D3FA 4Z9XA 4CM9A 2DPHA 1LU9A 1P1IA 4A5OA 2X86A 3AI3A 3V1TC 3DZFA 2YJZA 3Q11A 4FJ0A 2CDAA 3I83A 3F4LA 5JBIA 1E7YA 1PS9A 1VJ1A 3AM3A 3LYLA 4F45A 1O0SA 1PGOA 1HF3A 2QHXA 5THQA 4AG3A 2ZKLA 2GSDA 3NV9A 2O4CA 3VTFA 3DTTA 5BQFA 1DEHA 4HKTA 4O6VA 4ALKA 1DRVA 2V6GA 3GH3A 1BVUA 1F12A 3W8FA 4Z0PA 3CIFA 3PEFA 2G82A 4GLLA 4RF2A 5GY7A 3QW2A 2Y0CA 1ORRA 1X15A 2VHZA 5U9CA 5A5EA 2EP7A 4RVSA 1DPGA 1HEUA 3GDFA 3D4NA 1M66A 1P1FA 4CLOB 4BO1A 5L4SA 4R1UA 2DBVO 3T7CA 4DIBA 1A72A 5AYVA 1E5QA 2B4RO 5GZ6A 3DQPA 3PGXA 2GDZA 2J3KA 1UJMA 1N9GB 3E03A 4NK4A 1BWSA 3EVNA 3H8VA 5KJEA 3AOEC 4MDHA 2O2SA 1P31A 5TIIA 1UZNA 5IDXA 1Y9EA 1PR9A 3WB9A 1Y8RA 1PGPA 3IJRA 4CR8A 4E21A 1LQTA 1NHGA 3FF4A 1EBUA 4LGVA 4YEDA 3TL2A 4JXKA 4H7PA 2C59A 4OKNA 2DTDA 2W2LA 4BNUA 1NWHA 4NZ9A 5I9NA 1YONA 3JQ8A 3JD4A 3GQVA 3O38A 1N9GA 3LU1A 4GL4A 4E2ZA 1QSGA 4MVJG 1UZMA 1QYVA 3I9KA 3CZRA 5CPFA 4J43A 2B36A 1GPDG 5FF9A 3IP3A 4PLHA 3LSYA 4Z9FA 5C7OO 8LDHA 2IRWA 4EEZA 3W6ZA 3DOOA 3G0OA 2ZATA 3PFWO 1KVRA 2V65A 5H82A 1F06A 1MC5A 4YWJA 1E6WA 1R12A 1NPDA 1YB5A 3NDJA 3DBHB 5L4LA 1I3MA 3F46A 1I2BA 3SXPA 1HDOA 4PLVA 3ANNA 2I3GA 4YQZA 3K6JA 3GOHA 4AVYA 3AWDA 4K9DA 4BOYA 3QJ5A 3AJRA 1X0XA 4M49A 3JQAB 3NT5A 1R0SA 1PJCA 1ZK3A 3BA1A 1SEVA 1Z7BA 4FCCA 2RH4A 3ON5A 7ADHA 1U8XX 3RIHA 2WYVA 1ZVMA 2ZCUA 2Q1SA 3IMFA 4ZGWA 1WZIA 4NHEA 3SVTA 2PR2A 2EKPA 4CM4B 2JFHA 5ER9A 3PWSA 4CM1A 3PJFA 4P4LA 3BMCB 5K6AC 3MTGA 5JPIA 5KNLA 2D5CA 4G65A 4E5YA 5IDYA 3JQCA 3RI3A 3ZU4A 3NYWA 4EBFA 3QV1A 1KVTA 2C7VA 4GSKA 4AICA 1PZEA 1ZW1A 4RJTA 2V6FA 4LCEA 1LEHA 1I10A 3BTUA 3DZBA 4D79A 2LDBA 1UXGA 1UAGA 3WFJA 2XF8A 1Q7CA 1UXHA 2O50A 5EQDA 5CG1A 1E3SA 3Q9UA 1E6UA 3WFIA 5EQFA 4OAQA 2J5QA 3B6ZA 4PLFA 4E5MA 3H4VA 4YT8A 4U6QA 3FTNA 3BXXA 3K2BA 1SOVA 1LLDA 5GZ3A 1DO8A 4PZDA 1WWKA 3X2EA 5BNTA 4M89A 3E5MA 4LSWA 3HZZA 4CL8A 1HXHA 5EPOA 2Q2WA 1J5PA 2Q3EA 1MXHA 2HSDA 4L75A 1EK6A 4BQPA 1T24A 2Y05A 3Q2IA 3LZ6A 4IS3A 1EE9A 1M2WA 2VUUA 3A28A 4BO2A 3RSHA 3F3SA 2GZ3A 4YAJA 3JQBA 4DWVA 3KEOA 1XIVA 1ZXLA 4XA8A 2W98A 1K3TA 3GZNB 3TL3A 5I9LA 1PGJA 2NQ8A 1D8AA 1R4MB 5JCJA 3U4HA 1H93A 4BO6A 4U5QA 5IJZA 2IZ0A 1O95A 3HFGA 1ZBQA 2YYYA 3EYWA 5DZSA 3VAZA 5JCXA 1KVQA 4R4JA 4E2YA 3QVTA 4WNCA 4EJMA 1NQ5A 2H5LA 1ARZA 1FK8A 1V6AA 1U7HA 1P0FA 3DHNA 1VSVA 3D64A 2HMVA 4NPCA 4D46A 4P38A 2P4QA 6ADHA 1LX6A 2DUUA 3E5RA 4WLUA 4BS9A 1GEEA 3VTZA 4QUKA 3KRTA 2AG5A 2AXQA 3E1KA 3OQ6A 1ZEJA 4IQGA 2D4AA 2B83A 4BO5A 5A03A 4A7PA 3DBRB 2A92A 3Q1LA 2BFOA 5KVCA 3O8QB 3ZH2A 2WMDA 1LDMA 3GZ4A 5LC1A 3IKVA 3FWZA 4RDIA 4N5LA 4GKBA 5AOVA 1Y8QA 4QO7A 4CMAA 3PLNA 1QYWA 2GYYA 4M54A 1T2FA 5A04A 4HX5A 1D3AA 4IIUA 3AUAA 3K96A 1DHTA 3K92A 1OAAA 4FN4A 4ZQBA 4JCOA 4BNGA 5JAQA 1LLUA 4PLZA 4J9VA 4Z3KA 3JQGB 1DLIA 1XR3A 3C1OA 4FFNA 3W6UA 3VZSA 2G1UA 4O1MA 2CUKA 2QZ9A 5C7LO 4PZCA 4WCFA 2HDHA 4LVCA 5BSGA 3JYLA 5A3JA 1IE3A 1QORA 2JCVA 3RUDA 5FWNA 4WOKA 5LDHA 1AXEA 1X7GA 1MFPA 3AM4A 1E7SA 2PGDA 3HB4X 3KB6A 3WIEA 5L4NA 3TZCA 3ZWMA 4ZICA 4FFRA 3DOCA 4DTIA 4WLEA 2OP0A 5LCXA 2QRLA 5JLAA 1VJ0A 4IJUA 1DFIA 4O63O 4J1NA 5CP8A 1EE2A 1JKIA 1TB4A 2UUOA 4WLNA 5I8ZA 2FPIA 1RYEA 3KSZO 3QWHA 4QEDA 4ND5A 3WQQA 4TZTA 3QWBA 2J3HA 3MOGA 1U1IA 1K89A 3PHGA 4FC7A 1ENPA 4W9NA 5B12A 3LK7A 3ICCA 4L76A 4D45A 5IDQA 1O8CA 4F6CA 4LVUA 4NDNE 5I7SA 5K6AA 2HAEA 3UUWA 2F00A 1OI7A 2AEJA 3ZNPA 2VRCD 4J4TA 5A06A 1LRJA 3W4KA 1NR7A 4RZIA 3UGKA 1PJLA 4BVAA 3QLJA 2ZTVA 3PYXA 4W82A 5CDYA 4Y67A 1KOLA 4II2A 4BNZA 2I76A 3OIDA 2VNAA 3ZNOA 5JY6A 3JQAA 2Z1MA 1FDSA 3L4SO 1VRWA 5IG2A 3OEYA 5KKCA 1FDWA 1E0DA 4RF3A 5COAA 3WSWA 3WWZA 2FMUA 5ADHA 5FI3A 2EERA 3TOXA 2C0CA 3EDMA 1Z74A 4KUHA 5DCYA 5BSEA 2FR1A 2NACA 1KC3A 1I30A 1ISJA 4QT0A 4I9HA 3B1FA 3BMNA 1YS4A 1HSOA 2NWQA 5L7YA 4WPGA 3VPHA 2GRAA 4CJXA 5B4UA 3ASVA 4R5HA 5FYDA 4D7AA 4UUNA 2HJSA 3JQ8B 4AJOA 2D8AA 4OQYA 2X58A 5DOZA 3W4IA 4ALJA 1K0UA 1EZ4A 5IDWA 3JQEA 4RVFA 1YL6A 1A5ZA 4YXFA 3INRA 1PX0A 1YQXA 3DBVO 1RYDA 5ITVA 1GU7A 4KMSA 1X1TA 1Z75A 2G17A 4BKQA 1VKOA 1KEPA 3I6IA 1Y8RB 2FOIA 3GPDG 4NFYA 2EJWA 1U28A 4L4SA 3WQRA 3OJ0A 4XX0A 3NKLA 4AL4A 1DBVO 3UW3A 1GPJA 1U7TA 4J0FA 5G4KA 3VKUA 4II3A 1C1XB 1RPNA 4OL9A 4ZVVA 5EERA 2HRBA 4Y8VA 2TMGA 4GMFA 1R16A 2NQTA 3COSA 3ONFA 3OICA 5BSFA 4CR7A 2C82A 1LRLA 3S8MA 1OC2A 2ZQZA 4FPXA 4PLTA 3ITDA 4FJ1A 4TKLA 4CM8B 4UVIA 4OQZA 3UF0A 3K5PA 3FNHA 2B37A 4L4XA 4EUHA 3QWAA 5JMWA 4U7WA 2GCGA 2XOXA 3BTVA 4HFRA 1SC6A 4XYGA 1P74A 5BSHA 3JYQA 1HKUA 3VPSA 1LSUA 1GQ2A 2P9CA 1BVRA 2P91A 4DQUA 5L7WA 3ZWVA 1NPYA 4ALNA 1OOEA 5KVQA 2W2KA 3VPGA 3AY6A 2VHYA 4C7JA 4RO0A 3QA9A 1LI4A 3LDHA 2NUAA 4NBVA 1NVTA 1PQUA 4XQGA 4J16A 4BNJA 3L6EA 3OA0A 3I5MA 3V2GA 5JC8A 1DAPA 3AY7A 3DDNA 3VHRA 5TRTA 1N7GA 3DBRA 4WECA 1T25A 3ZCXA 2EWMA 3MJCA 2EHDA 1H94A 4YJGA 2YFQA 4D0RA 4ALIA 2WYWA 1NR1A 4HUJA 5CDUA 1P1KA 4BMSA 3QWIA 3Q9NA 4JROA 1DC4A 4ND4A 4WNIA 1H9AA 5IXYA 1IOLA 4KDEA 4RF4A 2E82A 3DZIA 3TJRA 4CMKA 1RM5A 1WLYA 2HCTA 3ENKA 1DRWA 3PWZA 3QY9A 3PGJA 3WSVA 4IS2A 4J90A 3TZQA 2X5KO 3WYEA 1E7WA 3EAGA 3RKUA 3L0DA 3OM9A 2D2IA 2CVQA 2UAGA 3ZV3A 1C0IA 4MIOA 1XKQA 5KJCA 4AJNA 1LJ8A 5F5LA 1LBEA 2QYSA 2ZB7A 3H5NA 1CYDA 1LC3A 2F1KA 2X0RA 2VZ8A 4DPMA 4K28A 4A2CA 4MP3A 3L9WA 2HJRA 2VT3A 3EZYA 4J1QA 5ENVA 4L0QA 2Y0DA 3WNVA 1E1MA 1C3VA 1ISMA 3VZRA 4EW6A 1CEQA 3HE3A 5DN9A 3OHSX 5TGDA 2Q1TA 4E2WA 5ICSA 1YOVB 3JD2A 4JN6B 1IULA 2IZ1A 4IDBA 3GEMA 3UOGA 2WJPA 1EUCA 1U2DA 3JSAA 3SJUA 1ZH8A 4MINA 3WDSA 2NVWA 3RFTA 4BNLA 1N7HA 2DC1A 2B5VA 2CD9A 4CLRB 1DIGA 1NAHA 3R3JA 5J23A 3ROPA 1P33A 3ZWYA 4D42A 4K6FA 4OXNA 5IZ4A 3ZHBA 1EFKA 4XGNA 4IXWA 1GUZA 1JKJA 3PJEA 2EP5A 2OHXA 2CY0A 2PZMA 3JYOA 1MUUA 3GMDA 3VC7A 4ESOA 3WJ7A 4MVJM 1ADGA 1UUFA 4TMFA 2B4QA 4AJKA 4MVJA 4Q9NA 3UCFA 4YA6A 1DDOA 3VDQA 4Z6KA 3F5SA 3H9JA 1CJCA 4IQ8A 3KBOA 1BMDA 5AVOA 1E6EA 3OFSA 4Y98A 4YT2A 1HETA 4IZHA 3LVFO 4WOJA 4YAIA 4CLDA 4GGOA 4BNMA 5KVSA 4JBHA 4NH4A 3G79A 1GYRA 3OJLA 4FBGA 1GZ6A 3EVTA 3ITKA 4F3YA 3B1JA 3H9EO 1QV7A 3E9MA 4DUPA 1YXMA 4FOOA 4JQCA 1BW9A 3WIDA 3FD8A 5HWSA 1EK5A 4HNGA 4BUCA 4BNKA 4FW8A 3ZNQA 2A9FA 3PYMA 4DXHA 4F46A 1GADO 3HSKA 1JKFA 4NBUA 5KVVA 2ET6A 1YQGA 3JCZA 4ZQFA 2RAFA 1YB4A 2BGKA 1P3DA 3PXXA 4WEQA 4RL6A 1ONNA 2IYPA 3VH3A 2CF6A 2PD3A 4UVHA 3GNSA 1L7DA 2PNFA 4CODB 2OUIA 2OZPA 4DQVA 1LXCA 4CLHA 5JW6A 4L8VA 3ZHXA 1YJQA 3OQ1A 2YQ4A 4RVHA 3KLMX 1YDWA 4RLHA 3RVDA 2X5JO 3U0BA 2H9IA 2RH8A 1RWBA 3CSDA 1E3WA 4IDDA 4N54A 4BNTA 3T4XA 4TRJA 1HDCA 4DGSA 4PGFA 5C3MA 3O03A 1JLLA 4I5GA 1EVZA 4XYBA 3BHIA 5JAIA 3ZHZA 3W1VA 4R41A 3TDKA 3AM5A 4WCDA 1PL8A 2WEKA 4OYRA 1TXGA 2WWRA 2PZJA 4LRSB 4QECA 4H15A 3EY4A 4FFPA 3V2UA 2DAPA 4KUEA 2Y1EA 4ND3A 2PH5A 4YR9A 3ZNNA 3DAGA 5JY1A 1YBVA 1ZK0A 1GCOA 2C5AA 1RKXA 2UDPA 4YRDA 5A5FA 5IF3A 5IFLA 2NVUB 4MJLA 4FB5A 1X7DA 3H5RA 3OSUA 1JAYA 3MJEA 2EJVA 2X5OA 1EFLA 5AXBA 3GR6A 4X54A 4BB5A 5JCJD 1DC6A 4OOEA 3SC6A 4CUZA 3DWFA 3HWRA 4TRMA 2AE2A 4NBTA 3FPCA 5TX7A 3MWEB 3INGA 1D1SA 3GVHA 3ADOA 4PG6A 3EC7A 2VT2A 4AJPA 4FDAA 4B3HA 4W7HA 2GR9A 1ZK2A 4AJJA 3P5SA 4XYEA 4B4VA 4OXYA 3A1NA 5EIOA 3QVSA 2CF5A 4XR9A 1N8KA 4L73A 4XCVA 3JD3A 3MTJA 1FXSA 3AOEA 1WXDA 3NT2A 3QRWA 4CM4A 3PIIA 1I3KA 5DDIP 1MG0A 4OXKA 3M2PA 3ST7A 2PFGA 1E1NA 5A1TA 2YFHA 3QVXA 3RUIA 3H6KA 4O59O 2X0IA 1W6UA 1T4BA 3DZGA 3K73O 3GY0A 2G76A 1H6DA 1PJ4A 2NU7A 4MP6A 2VN8A 2FZWA 4TRNA 1NP3A 1VI2A 5DCWA 5THKA 4MIYA 5EINA 3CEAA 5LDGA 4IDAA 2VHXA 4B4OA 5JS6A 2R00A 5TJ9A 4S1VA 2SCUA 2VNSA 1GQQA 1MX3A 2DFDA 2Q99A 3IKTA 3ZZNA 1GEGA 4WEOA 3RC1A 1TT5B 4H16A 1BHSA 3CPSA 1A9YA 3FR7A 3HJAA 5HA5A 5JDIC 1KBZA 1C14A 1H6BA 1J4AA 3CZMA 5U1PA 3OIFA 3UFXA 4A10A 4BNVA 4J91A 4Q3CA 3TZKA 4JNKA 4UEOA 1V3UA 3BHJA 3DC2A 2VWPA 3F1LA 4CM7A 1A7KA 1M76A 4HXYA 1F17A 3BMOA 3DBLA 4TVOA 4B7UA 2OGUA 1GUYA 1YDEA 2O3SA 4HFJA 2J5KA 4CMGA 3LLSA 3ZHYA 4IJKA 2R6JA 2JD2A 4LN1A 4CQMD 1V3VA 4ZQGA 3NT4A 2EGGA 3A06A 1PSDA 1NWCA 2JFGA 4OSPA 2VZ9A 5HS6A 4DIFA 4RVGA 6LDHA 4B3JA 3ETDA 1C1XA 1KETA 2GPTA 2X6TA 5T6BA 4CMJA 3EUWA 1SOWA 5G0VA 4B7XA 1YWGO 4CM9D 3RUHA 1SCUA 4AJIA 4QTZA 4ROSA 3EGOA 1H5QA 3E82A 1JU9A 4B4UA 4E5KA 5A9SB 2PGLA 3PHHA 1GYQA 5B4VA 2JAPA 1DB3A 2YQ5A 4AJLA 2D5AA 3PQDA 4NBRA 2JKVA 1ENYA 4S3MA 4RQTA 3ZGYA 4R16A 4I1IA 4E13A 1LDNA 4B8ZA 3TNLA 1B3BA 2BRUA 2PK3A 2C5EA 3TQHA 4ILKA 1ZCJA 3I9NA 2LDXA 2PV7A 8ADHA 2P9GA 1XA0A 1NQTA 2HO5A 3N74A 4PLWA 1A9ZA 5F1PA 1D4FA 3KTDA 4XQEA 3UVEA 3D5QA 4F6LA 1FMCA 2JHFA 3W8EA 4E33A 4J0EA 3AUTA 4BO7A 2OMEA 1LA2A 1Y5MA 2NTVA 3LT0A 1NXQA 3AFNA 4R3WA 2G5CA 3F1KA 2DTXA 2FP4A 5B4TA 2C2YA 2IDZA 4RLSA 1Z73A 3RCBA 2I3AA 4JP2A 1JAXA 3AOGA 1WDLA 1A71A 3WYBA 2I67A 4FGSA 2IYOA 1SZJG 3EZLA 1MB4A 4PCVA 1PS8A 4FFMA 2HLPA 3ROKA 3PLRA 4DVJA 4LW8A 5TC4A 3IP1A 3KETA 5TSDA 2I99A 4IQ0A 2EW8A 1MV8A 3GNQA 3GEGA 1P77A 4BNHA 2W2LD 4MPDA 4RVUA 4XRRA 2GLXA 1GYPA 4OIMA 3RJ5A 5HRUA 1C0KA 3DZHA 2IODA 1LUAA 4BKUA 2HMSA 3BMCA 3F9IA 3HDQA 3ZI0A 1XSEA 2YDXA 3CXRA 3CMMA 1E1KA 5ITWA 3WGIA 2E49A 1BXKA 1S7CA 4DRYA 2ZK7A 3TN7A 4YT5A 1R6DA 4YTEA 4RPLA 5G2OA 2O3QA 9LDTA 1JW9B 1ULSA 5DULA 3IL2A 3QP9A 1HSZA 4XQ9A 2ZTLA 1PTJA 4D3SA 1I2ZA 4JBIA 1O89A 1U2GA 4YJHA 1SO8A 4P4GA 4RCVA 2VHWA 2DU8A 1PZGA 3EK2A 3NJ4A 3GRKA 3PQEA 4R54A 2C54A 4E5PA 3I9OA 4EUEA 1VSUA 5DNAA 3ZWXA 4Z0TA 3RFXA 2BHLA 2QQ5A 3PYLA 3I9MA 3C1AA 1UP4A 3DO5A 3GAZA 4XWYA 5KJ6A 3PZRA 4INAA 4NG5A 3W8DA 3ZWPA 1XQ6A 1JVBA 2I66A 5MDHA 1LSOA 1XDWA 4PVDA 3DFZA 5A9SA 1ZFNA 1KC1A 3LF2A 4IDCA 2VYVD 3WJAA 2JD0A 3AI1A 4I5EA 4I5DA 1HDXA 2Q46A 4GSLA 3KXDA 4PN3A 2OOSA 4YAEA 1L7EA 3TSCA 4IINA 3JQ7B 4NR0A 2DT5A 3L07A 3MJVA 3WS7A 2DBZA 1PR3A 2I6TA 4AFNA 1E7MA 1PZFA 3KYCB 5AXDA 2HMTA 4FS3A 1CQJA 2ZTUA 2WDZA 1VL0A 4YBZA 5A4DA 3JQ9C 2X1HA 3HDHA 5TLSA 2Z5LA 2CMDA 4E6PA 1EEHA 3KSDO 3OH8A 1GD1O 4EZBA 2A94A 3H9UA 1Y5RA 1KEWA 2GUGA 3AUUA 3FHLA 3WMXA 3JV7A 1XELA 1ENZA 1IY8A 3INTA 4XDZA 4DLAA 1OMOA 1U8FO 1IL0A 3MCVA 4QO8A 4XB2A 2DM6A 1A4UA 2DVMA 3RAJA 1DIHA 4R01A 3GVCA 3PK0A 1NYTA 3H9GA 3GVXA 4DBZA 2H1SA 4JX8A 1KS9A 4LCJA 1DLJA 3LC2O 5TT0A 4PG5A 3HFSA 2O3TA 3WICA 3VPFA 4CUJA 2IEDA 2PWZA 2AA3A 3IOYA 5I7VA 3C3XA 5JAMA 3M1LA 4AJEA 4BV9A 3RU7A 4XJSA 4E32A 1WNTA 4Z3DA 2DLDA 2PA3A 2ILTA 1XWFA 4PVCA 1R66A 3U4DA 3RC7A 2OBYA 3UCXA 1CIVA 2HK7A 2ZQYA 5DT9A 1W73A 4BO0A 2OFPA 4CQMB 1ZUD1 2ZYDA 1HLDA 4K26A 3NJ8A 4DLBA 3H3JA 4QQRA 1S6YA 2AMFA 3GK3A 1HE2A 4KZPA 3BTSA 2ZYAA 3RU9A 2OL4A 2VRBA 4Y6PA 3G1UA 4CLOA 4HADA 2DPGA 4BMNA 1F8GA 1GQYA 3VH2A 4BNXA 1DXYA 2BKAA 2NADA 1MG5A 4E5NA 2GERA 5L3ZA 2QIOA 1O9BA 3DZKA 4CM5A 4IM7A 3GGGA 2Q49A 1AHIA 1PWXA 3U5TA 3S2IA 1HL3A 4HY3A 4RQUA 1V9LA 3PI7A 3WYCA 2VYNA 3TZ6A 3IAHA 1T2AA 2E37A 1NQAO 2PKQP 3WMWA 2HMWA 2FWMX 4OO3A 1ADBA 1EVIA 4BL5A 3NEPX 4QSMA 4BGIA 4N7RA 2Q1WA 2ZJ1A 4XIYA 1HE4A 4CV2A 2E6UX 3H7AA 2VUSA 5IN4A 2EKLA 1A4IA 2J3IA 3AK4A 2AQKA 1B3RA 2I9PA 3GUCA 3JQFA 4EUFA 2YHIB 4I8XA 4RZHA 5IZCC 2NTNA 5JSFA 1T1SA 1ISGA 1V0JA 3PPIA 2X9VA 5CEEA 5JDIA 2EW2A 3A14A 4BO9A 5KKAA 4OJNA 1VL8A 3OA2A 3ZWWA 1CF2O 1GR0A 4YAGA 4YRAA 4G5HA 1HDZA 2IEBA 1FDTA 1MLDA 3FWNA 1KY5A 1Y7TA 4PFJA 3VKVA 1B14A 1E3IA 4XGIA 1NQOA 1BG6A 1SBYA 2O7SA 3SBOA 3P7MA 2VRCA 1SEPA 1QLHA 2P9EA 3H5AA 1ISFA 3OIGA 3WLFA 3Q3CA 1YL7A 1ZSNA 4NMHA 2EV9A 2PKRA 5I7EA 4Y9DA 1TVEA 2P5UA 3GPIA 2I65A 3PFFA 4PLGA 2WD7A 4M1QA 3NGXA 3SLGA 2JCYA 1PL7A 1KVUA 1DSSG 4KWHA 4GX1A 3WTBA 1MGOA 2GF2A 3D3WA 1PZHA 1F8FA 3UCEA 4GAEA 4BNYA 4NJOA 3BAZA 1N2SA 2POQX 1N5DA 3PHIA 4IIVA 3GN1A 2DUWA 3B1KA 2EXXA 2QRKA 1DRUA 1RM4A 4YCAA 1UZLA 4L74A 1NHWA 5T5QA 3VOSA 2UUPA 3ABIA 3DMYA 3OBBA 5HTOA 3R1IA 2ZB4A 4EGFA 2G0TA 3P2OA 4CV1A 3IUSA 3HNPA 2NU8A 3JQ7A 1ONPA 3C85A 3DHEA 3HDYA 5ENDA 1ZK4A 5DP1A 3VH1A 4B79A 1MFZA 1YE3A 3E6AA 4TVBA 1DIBA 3HB5X 4JJGA 3OQBA 4CQLA 4UAGA 4I08A 4IPTA 3JQBC 1ADCA 3L4BC 2FRDA 1R0LA 3SJ7A 1T2CA 4ND1A 5I9MA 4ALMA 4B3IA 4LSMA 3GGPA 4JBGA 1HE5A 1ZKMA 4WJZA 3GG9A 5JO9A 1B2LA 4J2HA 2AHRA 4UVEA 1TT7A 4I9UA 1ID1A 5GMOA 1CERA 4YJFA 5L40A 2PD4A 4BIIA 1JTVA 3WNQA 1JA9A 2B69A 1IPFA 3JYPA 3HQ4O 1IZ9A 3G49A 1JWAB 3K31A 4DYVA 1NNUA 3RUCA 5IZCA 1U5AA 4FR5A 3HHPA 3QIVA 3U4IA 2UYYA 1Q1NA 4J7UA 4LMRA 1Q2XA 2VQ3A 1AE1A 4EEXA 4ZJUA 2J8ZA 5BR7A 1DIRA 3UICA 4J3FA 3L6OO 1UXIA 3RUFA 3RUAA 1QYDA 1XCBA 1ZO8A 3WLEA 3RQSA 4HBGA 1DC5A 5JYEA 3KYDA 4E4YA 5COQA 1FDVA 4ID9A 2QW8A 4CUKA 1ENOA 2X0NA 3NTRA 3MJTA 1AHHA 4BKOA 4IMRA 2Y1GA 3WQSB 1KEVA 3RJ9A 1QV6A 2QYTA 4O0LA 3RBXA 2D3TA 3JD1A 2AW5A 2DBQA 1DOHA 3H3FA 4BQRA 4RGBA 2NV6A 1OC4A 5C37A 3K30A 3V1UA 1WAMA 1IHXA 4CQLB 1ADFA 4WCFC 5DP2A 2P68A 4XKJA 3RBVA 3VZQA 2FPPA 1NM5A 4UVGA 2X0JA 3E9NA 5KWEA 2E4AA 1ULUA 1PQWA 3GDOA 5H83A 4FD3A 1ZMTA 1HZJA 2PZKA 1DC3A 1IHYA 1QRRA 2FR8A 1DIAA 1J0XO 2Y67A 3NUGA 3D4OA 4HFMA 4U6SA 3VPXA 4IDGA 3BHMA 1SNYA 1R4MA 2AQHA 2C20A 2YDYA 1KERA 1ZSYA 1GV1A 1MXFA 2GN6A 4DL9A 3WBBA 1LSSA 2BI7A 2VZ0A 1C0PA 3S2GA 5EMHA 1W0CA 4FFLA 1PJQA 1H2HA 4KOAA 1NVMB 4Z0HO 3PDJA 2WSBA 5CAEA 2QZZA 3KYBA 2EG9A 1PJSA 1T26A 3DFUA 4KQXA 4J4BA 1K2WA 4MKZA 1BRMA 4MO2A 3TF5A 3B20A 1RM3A 1B7GO 2YY7A 1SMKA 3DMTC 2J5RA 3OP4A 4DC0A 1I24A 3DEYX 5KTKA 3FNGA 3WXBA 3C8MA 1PIWA 4YYZA 5C5IA 3D3EA 2WE7A 3GT0A 4A27A 4B8WA 1ZIDA 2V7PA 1UXKA 2O3UA 5L45A 1GTMA 1T4DA 3L6DA 4MVJE 3WGHA 3IDSA 4RVDA 5HM8A 1M6HA 3O4RA 2Y1DA 4RPKA 4YJFB 3UH1A 3M2TA 1CRWG 1YB1A 1YO6A 3HUDA 1YRLA 4RF5A 2PLAA 1GCUA 2DTEA 3C1TA 5JFOA 2IE0A 1ZZEA 4BV8A 3L77A 1X1EA 3ZU3A 3WGZA 1X7HA 1X0VA 2GASA 2D1YA 2HUNA 4CMBA 3KLPX 3ENNA 3O26A 2RHRA 1AN9A 3PZBA 1JQBA 2JFFA 1E77A 1HTBA 4J7CA 4RORA 4D3DA 4A26A 3WTCA 2YW9A 2IXAA 5FI5A 4GBJA 4D44A 1B15A 4JJFA 4E30A 3DR3A 4G2NA 1GDHA 4GKVA 5BNIA 1G6KA 3QVOA 4HWKA 2EKQA 3OEWA 1B8UA 2Y93A 4LK3A 5G0TA 4FFOA 5ILGA 1L1FA 4W4TA 4R68A 4Y6SA 4PLCA 5DBIA 5EJ2A 1KVSA 2PGJA 3BMNB 5DCUA 3H2SA 5AQ1A 3H9QA 2O4UX 3ZV4A 2RIRA 2CVOA 3NX4A 3G1TA 2EGHA 3A9WA 4RV9A 5B37A 1PJTA 3NTQA 2RHCA 2J6IA 3GVIA 4DC1A 1I0ZA 4IMPA 1ZMOA 5IXSA 4LRTB 2YHUA 3VVBA 1TT5A 4KTVE 2Q4EA 2ZJ0A 4MOWA 4UUOA 4W9NC 1SB9A 3GG2A 1O5IA 1WP4A 1IB6A 2C07A 4NFHA 4E12A 5F1KA 1EUZA 4PG4A 3WGQA 1NBOA 3R0IA 1I01A 4GLOA 3IS3A 2BFMA 1BTOA 4J1TA 4CV3A 4DLLA 2Y68A 4GQAA 3KV3O 2FSSA 4CM8A 2WYUA 4WGGA 1E1LA 1J49A 2H63A 1QLJA 1WMBA 4IDFA 2VUTA 4OHUA 4ZA2A 4IXTA 4UEKA 1PEDA 3DZJA 4GWGA 5DBFA 4YDRA 2CZCA 3V1YA 4AJ1A 5CDGA 5GZ1A 3BYZA 2OP1A 3U62A 3AUSA 3V5NA 3T7EA 4AJ4A 3JD0A 1P1RA
chains in the Genus database with same CATH superfamily
3L5KA 1ML3A 3OCJA 1JG1A 1ATIA 2YUTA 1GRCA 1KU6A 4YCBA 3SLKA 4CDRA 1HV8A 2XMQA 2Y71A 1P80A 2GPNA 4AF6A 1GKKA 4JJIA 5HCIA 3RARA 1L4UA 3ZWNA 4JZKA 4ZO7A 3ZY2A 1Z0SA 3P4UA 3A7DA 4XCXA 3H8WA 5AVVA 1C1DB 3GLGA 1LDYA 1TJYA 5I9IA 1K08A 1V6CA 2BFPA 2DKNA 4QHYA 5DLEA 4DMRA 3DLBA 2ZTMA 4M53A 1CIPA 3I52A 2XRFA 3PD1A 2O06A 1HYHA 1SVSA 2WPDA 5H7XA 5KIAA 3NANA 5CB0A 4B79A 3EDRA 1DFHA 4FXOA 1PNVA 2J09A 4MHOA 5HTKA 3ROMA 4EJ6A 5KDDA 1V6SA 1O94A 4X7BA 4JYZA 1V35A 2GBIA 3HNRA 4QREA 5AI0A 2F9FA 2Q2QA 5LU9A 1XPOA 3B1ZA 3ZGZA 5A2QA 3HO6A 3CUEF 1F9EA 1FJHA 2GESA 4J1SA 1K86A 3H42B 3O5AA 1IEQA 1NF8A 1R4NB 4V3BA 2GN9A 3M7IA 3K9FC 3LL7A 1P9WA 2H8GA 4TKMA 4JDUA 5FBLB 3MOIA 3NAZA 3O8LA 2VYCA 2X6RA 4F04A 4K46A 1GVNB 5KNCA 4KQGA 3FYHA 2MSWA 3GO4A 5EYPB 4ZVRA 4PGMA 3TSWA 2B7BA 4AC9A 4D1YA 4IG9A 2XQVA 4E31A 3DD1A 4B7CA 1N3BA 1K5GA 4H3VA 3WGNA 1E4YA 1KEUA 1GNQA 3AQ4A 1MEEA 2V9CA 4JI1B 4F1JA 2ACWA 3AY3A 3QEOA 1XKXA 3HVKA 2BKXA 3RREA 1QH0A 1Z5GA 2QMZA 2X9QA 4EAAA 4G24A 3X1JA 2X4GA 3RFVA 1QQ7A 2XV1A 2QG6A 2WFMA 3V2HA 3JWHA 3K09C 1OD6A 3S2FA 5JS8A 1RTKA 2GNAA 4UJ3A 5TT1A 1YRBA 1GY8A 2Z2YA 4BBAA 4CLEA 3H18A 1VHJA 2XZTA 5AIBA 1JDZA 3AHIA 4FC6A 1XLWA 3HDJA 2FN7A 3DAPA 1IZYA 1YIOA 2FYTA 3LP8A 5B1DA 4UTPA 1YJBA 5F3RA 2FSVA 3BIXA 4X60A 3LW8A 4L72A 2QG4A 2P9BA 1TMGE 5DBGA 3RG2A 2IW1A 4J16C 4AJ2A 3MB5A 4H60A 3IPAA 4H4EA 5FTJA 3N7AA 3OQMA 1J24A 3OJEA 5JMPA 1E0SA 5I9SA 4FYWA 2EFYA 1ZM7A 1TW3A 1UCFA 1CJVC 3LZCA 4LZNA 3IHTA 1SELA 2H4WA 4HDRA 4B43A 1YZKA 4NDAA 4AX8A 4G97A 4BP8A 2QZ4A 1SHZA 1N3YA 4IZIA 4P53A 3HXTA 4ZYZA 3I6MA 2Q1UA 3VU3A 5FNZA 3NV7A 1Z4LA 1NFFA 3VDNB 3GCXA 4F3CA 1T1RA 4JP3A 4Q39A 3ER6A 2VDWB 4F1KA 4U8HA 1EB9A 1E63A 3ZE1B 1L3IA 1BCRA 4BJ1A 2AJ8A 3E70C 2JH9A 3DKPA 3TBHA 1US8A 1DELA 2W90A 1NI3A 2XHZA 1NN3A 1SUEA 1WCYA 1ZPDA 2C61A 2Q3LA 2VTEA 3RJMA 5IMSA 5KJFA 4HEJA 4FIZA 1UMKA 4Q48A 4B6EA 3ZE6A 1GSHA 1MCZA 2C7PA 3MJRA 4PSDA 1E9FA 4MNTA 3ZR4B 2HL6A 1WDTA 2Z9CA 4HNUA 5C7YA 2I7DA 5AJTA 2AE1A 2D59A 4HSEA 4WX2B 4IGEA 2OXTA 4MP8A 3ZH9B 3VNUA 4B33A 4UTVA 3GELA 3RYIA 1B8VA 4AX4A 3LP6A 4M76B 1M2JA 2P2GA 3FCUB 3WX0A 1GTJ1 4BQQA 3CVWA 4OJTA 1T8WA 1ECGA 3GJSA 5CJ2A 2LV8A 3QM1A 1YGYA 2NSJA 4XWGA 3HN2A 1JQ5A 4CQMA 5JZOA 3H2KA 2WVJA 1WVGA 1MJNA 5IKOA 3QV2A 2E4YA 3OT5A 5CJPA 3WO0A 1ID8A 3IUJA 2JGDB 2QTAA 3F6SA 3ROQA 1R4ZA 1R8JA 3O8QA 4O5OA 3OX1A 4M46A 5AJZA 3RTCA 4A8PA 3D3KA 4JVOA 4A91A 3E58A 4CRWB 3IP7A 4FSHA 2G07A 3NVMB 4KO8A 1RI3A 3RT1A 4AY6A 4CEHA 1Q15A 1UWCA 3KQSA 2HJ9A 1XEAA 2GO7A 13PKA 1U0EA 2G36A 2X9LA 2Y6VA 2GPJA 2JGKA 2ZWOA 3CUKA 1IZ0A 2AF4C 3R0JA 5EWJB 2XCUA 5FL7A 5HKAA 4II7A 5IXJA 4DR7B 2VPIA 1KOGA 1MR3F 1V48A 4L0MA 3QPBA 4GUAA 4DM4A 3X43A 1NSYA 1SPBS 4RJIA 1QS0A 4UEJA 3TIVA 3O74A 1Y3IA 4MW4A 5KKNB 4RDCA 4EVQA 3DDCA 3FTCA 4YQYA 2VF4X 2ZYGA 4QYSA 1SC9A 5FBHA 5AK0A 3B2EA 3U80A 3OEHA 1Q0LA 3GOQA 4KUGA 2NXNA 3UJCA 1HDRA 1H2XA 3I2FA 3MLEA 3AEZA 4CV0A 1WDMA 2XMCA 5JG7A 3I8SA 5DM2A 1AGNA 1CR2A 1WQ4A 1Z5OA 3MA0A 5ULLA 5AVTA 3T3HA 4QFDA 2DECA 2C2XA 2M6KA 1EDOA 4MCIA 4ZWNA 3NDRA 4JUFA 4P0TA 4X85A 5DV9A 4MUFA 3I2IA 1M8FA 4HRXA 4XWTA 3JQ9A 4DSNA 4X5OA 4PRLA 2ZR7A 1ODSA 3RHTA 3WMGA 4JOBA 3HEBA 2CHGA 4QOEA 2I6UA 4DBLE 4WERA 4PR0A 3UN1A 2WHYA 1CUBA 4O29A 4WOCA 3JAKA 1NVUQ 4KWTA 4UTXA 4B80A 4BHTA 2RAVA 3HM2A 4NRDA 4CKBA 1YR6A 2XXJA 2JIOA 3A4YA 2CEAA 3ABOB 3H84A 1XZBA 4J3JA 4G5GA 4DA8A 5MHTA 4BX8A 4OH1A 3PR1A 3QQPA 2WY2D 3ED1A 5H8WA 3OC6A 4W5JA 5IJ0A 3NGLA 3E7PA 3KCQA 3AHDA 2Q2VA 1RYFA 5K3CA 4ZVQA 3WGKA 1IM5A 1BX1A 5CXQA 2X23A 4ZCSA 1H4SA 3IE1A 2AKYA 4HH0A 4LWZA 4XIJA 1WXHA 2HEGA 3FPAA 2RGWA 4UDOA 1KBQA 3MZ0A 1Z2DA 3QK7A 1KH3A 4LJ9A 3R9XB 1R0WA 1Y1TA 3QKTA 1ZEMA 1G6HA 4KTTE 1FVOA 5IEBA 4ZMBA 1S8OA 4RPHA 3BGSA 4L4UA 2X2FA 2B94A 4LTNA 2O7NA 3INYA 3Q0EA 5CDTA 4LIPD 2BV3A 2QTFA 2H4JA 3ITEA 2HU8A 5HBRA 5CG2A 5JS7A 1XPUA 2PXAA 1ABFA 3U9TA 2COKA 2JFYA 3G0CA 1F9AA 4GPEA 3TLEA 1KZ9A 3AL2A 4R40A 1ZWLA 1XOIA 3KWJA 5K6TA 3K8ZA 3RBZA 3RFFA 1R8SA 1K0FA 3TXXA 2XCQA 3PKJA 2K7FA 3G2KA 1RC0A 1AS3A 3FOZA 3PDUA 2FX3A 1RC1A 2Q7XA 4HDOB 1ZJZA 2JLWA 1EUDA 4UATA 3VJMA 4CKYA 3ECCA 4I4TF 4V0RA 3SF0A 3D6HA 3NBFA 3SICE 1IWPB 3FMIA 5JCZA 2WIJA 4IX1A 1NT4A 3ZD9A 4F71A 2FLWA 5BOSA 3JWIA 2EIHA 3H3XA 1G291 2ADFA 1I4OA 3AVTA 2G1PA 4NX2A 4CTMA 2FQWA 3BL6A 1VTKA 4GI1A 1R15A 4OKIA 3I2YX 4HN9A 4I9NA 4AP9A 4Z4HA 2NO7A 5JAPA 3WWYA 4QBKA 4G5OA 1O95D 2H11A 2REBA 3OMWA 2WT4A 4UMFA 1YS2X 1TEHA 1FPMA 3MELA 1G21A 2BUBA 4DCCA 2O5CA 3D8NA 1FP1D 5HRAA 3N7UA 3IEMA 2QJOA 2NNLD 5CRIA 1P3JA 3OY2A 1KMHB 1QHEA 3HFJA 4O3MA 2RBEA 2AEMA 1RJWA 2MTBA 2ZI4A 3OIVA 4CMIB 3MJ4A 4B71A 1DAFA 3U37A 4LYHA 2QROA 1ZD4A 1FTNA 3LTEA 1QMGA 4F4FA 3LTNC 2QL6A 3W5AA 3EZGA 3G8YA 4MI3A 3RRFA 2JG3A 4KHPB 1ZM9A 1IMOA 1ESMA 1EFHA 1KEEB 1OFUX 1Q0HA 4OBEA 4X1KA 5LUAA 1E3JA 3GMSA 4ZQEA 1A7AA 1Q0UA 2AZMA 3A70A 2EWWA 2EZUA 3B78A 3L6BA 3SP1A 4W5HA 2W6OA 4YMIA 1TD9A 2ZSKA 1PK9A 4Q7QA 1Q5PA 5AKJA 4BO4A 5HF5A 3EF0A 4XD2A 5DKFA 3PHLA 4C4XA 1FF9A 4INJA 1V5EA 2N47A 4TSKA 4HB4A 2AL7A 4ETMA 3B7WA 3R5XA 5ADWA 3G2MA 1QXSA 2CUNA 1XGKA 4K0RA 3SU8A 4FFSA 4TS4A 3G02A 2BDTA 4MUHA 1RWVA 2V6BA 3B7PA 1WULS 5F2EA 4AKGA 1D2CA 1DAKA 1GG9A 1NE7A 1OI3A 1W29A 2OFXA 2I7XA 4AI6A 3OIUA 3UKOA 5MN4A 1W36D 1G6Q1 2Z57A 2Y27A 3L82B 3GLQA 4TZKA 4C4OA 2Q5FA 1UK7A 4W8GA 1ZK1A 4KSYA 4DHWA 4D4KA 1AMNA 3CEJA 4X3OA 3MWGA 2ICAA 2DE0X 2X3FA 4PHTA 2VXBA 4BNIA 5TQVA 1HYGA 1TI7A 3CSUA 5E1DA 1U99A 1MJGM 1VLLA 3RC2A 3BZUA 2QRMA 2Z95A 3FNFA 4TKZA 3ZS9A 3QHQA 5JH7B 3FJOA 1IUKA 3EPPA 4JEMA 3RH0A 1YDHA 4JR0A 4YYEA 2Y1FA 4IYJA 1J9ZA 2OO5C 3N0VA 4N5HX 3EHEA 4NENA 3KM0A 3L4BA 3NWBA 5ALSA 4YNBA 2NUPB 3DULA 2X9GA 2OHOA 5SYNA 1XAHA 1J2RA 2WE8A 3DNFA 3FYUA 1TW2A 4KU4A 4M86A 3TLBA 1LCIA 4IEFB 1GPKA 1I8TA 4L8LA 1C0LA 3UAGA 2Y2VA 2CYCA 3ZCPA 1P19A 2O7QA 3CINA 1FPQA 3FPJA 3NRCA 1ZUHA 2R4TA 4QZVA 2C77A 3FOWA 1PGQA 3KDPA 4PYIA 4XSVA 5AKEA 5E6SA 4D81A 4QDOA 2MR5A 4U7JA 2PPVA 4P92A 1DKQA 1R9GA 2NOAA 3FBTA 5TEVA 3I5YA 3CU5A 1AT1A 1GGNA 2OORA 2Z08A 1LPPA 4GP7A 4BQFA 4DREA 3BX1A 4YB8A 2EF0A 3U1VA 3E9RA 1FFGA 2Q4BA 3OPVA 4ZREA 1JFSA 4RQBA 2AI2A 2AJDA 5CH8A 1ZGZA 1ZAYA 3ETGA 4RJKA 2OPBA 3BMOB 5CCDA 3VZDA 3TTTA 2VWHA 3LQ4A 4FE4A 4Q4JB 5CMLA 3VR4A 1FFCA 1NBMD 3FDZB 4ZVOA 5GP1A 3Q0IA 1E0KA 2H16A 1JQEA 3AV0B 3ZWAA 1RWOA 3NATA 4JT4A 1U81A 3RNLA 1V16B 3M4NA 3HCNA 3T9CA 1D7OA 1F0KA 3O3CA 1DAOA 1JT9A 1IN6A 1RPTA 2ZU0C 1DV1A 1RD4A 1UMBB 3OLXA 4LXQA 4BKPA 2DLNA 3ZE8A 5DYWA 1Z6XA 4O4HB 1IAQA 3DONA 3EH1A 4WUVA 2QM0A 4UULA 3DBHA 3SX2A 1UDBA 4B6PA 1QM5A 3CCFA 1CEEA 4HGNA 1UEJA 2I7VA 1EYZA 2E1RA 3CLRC 3IQFA 4O2BA 4OGLA 4TXMA 4WINA 1PX2A 2HTFA 1XQXA 4EL0A 2ZRIA 4HNHA 4A0SA 4Q4JA 4RYLA 3T15A 1A5BB 1KP3A 3OZSA 4JH0A 3SX4A 1P29A 4B4WA 1A9RA 1CEYA 2NM0A 2V7EA 1HE3A 2A5FA 1JEQB 2B4TO 2R5NA 3C8ZA 3KZCA 3UHPA 5KYXB 3NVKI 1OZFA 4YROA 4DBVO 4Z2AA 3G68A 1JILA 1LDEA 1THZA 1AQYA 2QLLA 3HVIA 3NYRA 3KJQA 1PFKA 2ODTX 4MV8A 4GH5A 4FCTA 1Q3HA 1OFVA 3NNDA 2CDBA 4U7TB 3S68A 5JAOA 1R6BX 4S2EA 2QGFA 5FD8A 4UDNA 3HY6A 2INGX 1SXQA 4MV5A 5HMLA 1CUSA 2UYGA 2JL1A 4ITUA 4EIWA 2ZCVA 4XTRA 5K03A 3D1LA 1KFBB 1NJSA 2VWQA 3I6QA 3TDMA 1B41A 4W8HA 2OBMA 4DUZB 5D86A 1GU0A 1R5JA 4YJGB 2HIHA 3CV3A 4EUSA 1Y81A 1KIFA 4OMUA 4AIRA 2IV3A 3RADC 1Q11A 1EI9A 1E5VA 1DQNA 4Q3EA 1IBKB 1QF9A 3HJUA 2NUPA 3ZXSA 2ODAA 4B3MB 4KIWA 5AR1A 3G7NA 1VKNA 1T3ZA 2IP2A 4O5AA 4Q1BA 4B32A 4BQEA 2IGBA 5A02A 2O2IA 3RE1A 7GPBA 4M83A 1A88A 4GVXA 4J29A 4EG4A 2HMUA 2PTHA 3FJYA 3IX7A 2A59A 1MAUA 3P4YA 3Q3JB 1HTWA 2AD5A 2IHUA 4KG7A 4GX0A 1YKSA 4N3BA 1NGSA 3SM9A 2PU7A 3IT3A 3PXGA 2VSOA 1Q3KA 1ZKDA 4H18A 4Q93A 1QIGA 4AG6A 4F4HA 3D3JA 5GJCA 4ZEXA 3CUUA 3W3AD 5F9MA 1BKSB 2NNWB 3EVEA 4YO8A 4Z8XA 2QX7A 4NSNA 1RAEA 1W5TA 2XCSB 1T8RA 3DVAB 5GOTA 2QXTA 3CUSA 1H9BA 2FXVA 2GM9A 1OWLA 5FFFA 4L0CA 5D8DA 2OAQ1 3W2IA 4FOSA 2YWJA 2XVAA 1A8SA 4HEA6 5HFJA 3GDHA 1QQTA 5T64A 1CB0A 1R6TA 2NZXA 2P11A 1LJUA 1N3LA 3QTBA 1R00A 1D1TA 3JX9A 4XGKA 2IL1A 3MFQA 4RH3A 1FX0B 2Q62A 3I3OA 4BMVA 5JI2E 1T2EA 4MVYA 1EX7A 1GNTA 2J7PD 3K0FA 4RJJA 4DMCA 2QUBA 2WW8A 4L2IA 4OGWA 5FOSA 4EECA 3DS8A 121PA 5FA5A 3KR2A 2ZB3A 4YJHB 5KQPA 3ONVA 4M1WA 4XPIA 4GPD1 1M8JA 1Z6ZA 4GT1A 1KZ1A 2XITA 4X3CA 4CVNA 5LNK1 2I2FA 2P9TA 3IUBA 4TZ6A 1P5HA 2D1SA 3RUEA 2H7YA 3L1UA 3PFBA 3HRKA 4XJTA 1W87A 1YA6A 1D2EA 3DEJA 1FFAA 2PSSA 2YWEA 4Q24A 5AW5A 5EJ7A 2FR0A 3LRPA 3TK1A 3GJYA 2Y1XA 1ZRMA 3UHAA 4OB7A 4ZHQB 1JQJC 1GPH1 2N0SA 4KYIB 4NMMA 5FEUA 2BI8A 3OQNA 4Y6QA 1JSRA 1SZDA 1QGUB 1UBSB 2ERYA 2ZRFA 1Y9AA 1JFVA 4DNXA 2BGMA 4J9UE 2G72A 2BSAA 2EFHB 4MARA 2Z9DA 4EUNA 2CT8A 3C7TA 5EHGA 3C24A 4HLUA 2UYQA 2E21A 1K6XA 3PSAA 3C43A 1PVDA 2QL7A 1UMDA 5C7IO 4O25A 2PZBA 3RROA 3SC4A 4Z1OA 3SQMA 3T4EA 2PH3A 1PR6A 1VOTA 3EIUA 4DSTA 3GHHA 4W9RA 4DB4A 2AVDA 3AG6A 4PW0A 2LZ0A 2OV3A 2P1DA 4P3KA 5CTAA 5G0SA 1ZJYA 4MVJF 2OCPA 3EPLA 1AKEA 4Q12A 3GLFE 3ANTA 5E95A 3QE3A 2CZQA 3BC1A 3LT2A 2R6DA 4WKGA 2OFFA 4C0KA 4JK3A 5BSMA 1JSZA 1LLQA 1X14A 5HJ7A 4IAOA 4YJ2F 1SCIA 4FDTA 1US8B 3B3AA 2JHGA 3CWQA 4JIGA 3LM8A 2PFSA 5K8UA 3A2KA 1T3GA 1TFRA 3UJDA 4B87A 3VMFA 1PVVA 5IJXA 1IWOA 4J2OA 5ALXA 4EW2A 3NKFA 1PAUA 1IN5A 4JIMA 5ALQA 5LVAA 4DV4B 4J0KA 5IKMA 5ILOA 5CDSA 1DBIA 5CM9C 3C7DB 3VDRA 1JFRA 4IRXA 4R3UC 4MUMA 1KSJA 1W2HA 4YXWD 4HV4A 3IUYA 2GRUA 1YCFA 2O2JA 2FWJA 3FGOA 2CJFA 3IKLA 4OOFA 1TYBE 4CF5A 3BIOA 4ZZ0A 2BCEA 4ZRNA 4U0JA 3ZV5A 1XCPA 2VH1A 2VJQA 3TPCA 3OFKA 2PJDA 2QA5A 4OFZA 3SIRA 2VBCA 2BELA 1A8IA 3SVLA 5IJ9B 2OQVA 4BV3A 1ODTC 1P4AA 1WD5A 2EATA 3IVCA 3ONEA 3R5TA 4LJLA 5EKDA 1S7GA 5AW7A 4R7TA 5A05A 3Q1KA 1LPMA 2PX8A 2PG3A 3O2SB 2CK3D 1KE1A 4BGEA 1QR6A 4WE3A 1R5NA 4BMOB 4QX6A 1PR2A 4Z9XA 1QH1B 1EGHA 1TL7C 2PSHA 4DQ0A 3ODGA 4RY9A 3ZJVA 3GFRA 1XMVA 5LJIA 2C9BA 1W5EA 4UHDA 3DZFA 5EGNA 3FNIA 3S27A 1AGRA 3F4LA 3I83A 3KE8A 1E7YA 1PS9A 3SM3A 1VZ2A 1EZ1A 1MB3A 5IYZB 4PNPA 5CFLA 5IBCA 3WB0A 5THQA 1MW9X 1GKIA 1PT7A 1SOUA 3ABRB 3KQOA 3P9IA 4AG3A 2BGWA 2EGUA 4FILA 4ECEA 1XE3A 1VJCA 5AJYA 4M22A 2X13A 1BVUA 2JFVA 1ZMRA 4Z0PA 1XEWY 2EZ8A 4MW0A 2G82A 2V0NA 3BSYA 1ESZA 2DH5A 1FRZA 5E7MA 5GY7A 1X15A 1DJLA 2GILA 5FFMA 3CVXA 3D2CA 5U9CA 2EP7A 3IPCA 1DPGA 2RGCA 3HKBA 3K16A 3LUBA 4S35A 3HKEA 5DNEA 4YRPA 3RM3A 4CEIA 1N2CA 2HCFA 4RTRA 4BO1A 5L4SA 4R1UA 5KWSA 3O8CA 1NVWQ 1XNRB 3WLJA 5AYVA 4EVSA 4IDQA 4C88A 2GDZA 1OWOA 2J3KA 3E03A 3SQXA 4RXMA 3RVOA 1BWSA 4FGKA 3S8EA 2NZ2A 2H92A 4FX2A 4AY5A 2RHDA 4MDHA 3LDUA 2O2SA 1N75A 2UVQA 4RSGA 3OF5A 3SKXA 1RQXA 1UZNA 3QE0A 1XRJA 2AUTA 1YZTA 2J41A 2AMYA 4BUZA 1FP4B 1EFRD 1Y8RA 4ZMSA 3F2VA 1DWUA 1NHGA 3FF4A 3GFFA 3KOZA 4R9NA 4ZHQA 5KB3A 3MT8A 5EFZA 4V0KA 3TL2A 3M6FA 1YACA 4H7PA 2L82A 3O1JC 2ONKA 3IJ5A 4MQLA 1EWYA 2A9VA 5LZ5A 1ACMA 1NWHA 2DQSA 4BVGA 5I9NA 3WISA 2HWKA 5LZ9A 4JVNA 2CL5A 2WU0A 4EGCB 2GPYA 3GQVA 6YASA 2CDRA 2IYRA 3QU2A 2DH6A 4E2ZA 4F8EA 4LEIA 4MVJG 4ZXFA 2REXB 2R6AA 4J43A 3IQXA 1GPDG 3T7KA 1ZXXA 2YVAA 3IP3A 4PLHA 2QK4A 4N82A 4ZVTA 2K2QB 2OOKA 3JATB 5REQB 5HQTA 1SK8A 5DTMA 4IIJF 1CUVA 5AVQA 1UFOA 4L6IA 4DG5A 4B2YA 5FP0A 3T1VA 5K8JB 2B2NA 3ACDA 1NPDA 3ILHA 3VU0A 2W2NA 2XB6A 1I3MA 4M8KA 1I2BA 5H3CA 4RBNA 1T6XA 1WMDA 1E2FA 1M2NA 1WS6A 2AS0A 4M8LA 4NU0A 4PLVA 3K6JA 5BUCA 3GOHA 4H3SA 1XEXB 1T9ZA 1X42A 3QJ5A 4N48A 3IBTA 4D9MA 3PF8A 3ESCA 1PP4A 1SXIA 4M49A 3VNBA 3L8CA 3ZQ6A 4IUCS 3MUEA 4M9QA 4FCCA 2RH4A 4F9GA 2TSYB 1AQNA 1H2ZA 3T5AA 2J46A 4A15A 1CDDA 2WYVA 1ZVMA 1QWSA 1QFYA 2YWHA 2Q1SA 2PFKA 3M3PA 4L5YA 2PX5A 1TX4B 3OPYA 4OQQA 4RSRA 1KDOA 3WLQA 4NHEA 5EJ8A 1VGQA 2O5RA 1HDEA 1Z34A 2OSVA 4FR2A 1UC8A 1CQJB 2CLMB 1PDWA 3DHVA 3LY8A 5ER9A 3UYLA 6ABPA 3PJFA 1KHHA 2K6GA 3BMCB 4GZMA 4Q9KA 2RGDA 3RVJA 3MTGA 2BEJA 3SKVA 3V9AA 1GAXA 2D5CA 4YRQA 5FUVA 3G2QA 4E5YA 3CXUA 2GK3A 4YHHB 4QGGA 3D6NB 1CUAA 3QE2A 4QVGA 2X0DA 1XX6A 3QELB 1U7WA 2JLRA 4D6XA 2C92A 4P08A 4N7JA 3NYWA 4EBFA 1KVTA 2QUJA 4URUR 2XOKA 3IHKA 3NHAA 2YX1A 4RJTA 2V6FA 2WG0A 4U4AA 4B7AA 4LCEA 1DGQA 4OHYA 1J8VA 1JDNA 4PBRA 3DW1X 2J0SA 2GEUA 2GJSA 1GAWA 2X0EA 3WFJA 3VKWA 2O50A 3P0JA 2ZUFA 3Q9UA 1E6UA 2G9UA 3WFIA 1GARA 2LW7A 1XZNA 3H4VA 4YT8A 8AT1A 4OGFA 2IOFK 5H9VA 2HCBA 3JARA 1KMCA 5LM3A 7YASA 1SD5A 2XKBA 1RLMA 2Q0SA 1XJ0A 3IPYA 1TZBA 3A1VA 1UADA 3DMRA 4R0NA 5DGHA 1Z2EA 3W5SA 4B83A 5K99A 3WAJA 1JIKA 3E5MA 2WJ3A 2FW6A 3RJTA 3TR5A 4JQSA 2OESA 1J5PA 3VOBA 2ORIA 4EWLA 1VE7A 5EYPA 1MXHA 1Z39A 2HSDA 4L75A 1J2YA 1QB7A 1PLJA 4HYQA 4M9UA 3SYRA 3WZLA 3EGVA 3EEQA 5CT6A 4D8UA 4JXJA 3Q2IA 5C8ZA 3LZ6A 3PC8C 3FOEC 3SJBA 4EI7A 4ETIA 1U2SA 4PO1A 3E7DA 3HRIA 4BO2A 4FYXA 2R8BA 3HJFA 1OLUB 2GZ3A 4YAJA 4ADSG 2VF7A 2A0FA 4UZEA 1N5IA 1TEXA 1XIVA 3GZNB 5KC8A 2NQ8A 5EUMA 2ODWA 4BEJA 3V8EA 2PGOA 2Z6AA 3D54D 2FWNA 4Q4AB 3FBWA 1FTQA 3GFSA 1HEIA 4I4CA 1JFLA 4BO6A 5JSZB 4QU9A 1Q50A 2ZVDA 2C4KA 3FX2A 4IXMA 3P45A 4L16A 4LX0A 4GVPA 2HBRA 5DZSA 5F9FA 1KVQA 1VG1A 1TQ4A 3IV7A 4E2YA 1QGUA 2VDWA 4WNCA 1FLVA 1NQ5A 4YRCA 2PX4A 4ZVMA 1HFKA 1G7SA 3V7UA 2DJ5A 4YPVA 3MGGA 3IOCA 5HFAA 4RTJA 4P38A 1FRVA 1RJ9A 1UKEA 4BS9A 1EK1A 4MO9A 1AUOA 3N3BC 2PE5A 1PTJC 3E1KA 3KC2A 3KRTA 1KKLA 3OQ6A 2AUNA 4Q3LA 1Y9JA 2QZPA 3RRYA 3D0RA 3PC8A 3ROTA 3WJ2A 4U39A 2X77A 1FDRA 3KLNA 2MYNA 2AHOA 4QXRA 4K88A 4X45A 1XD9A 2WMDA 1YAHA 3PRYA 4UE2A 5AUOB 4TTTS 5H3LA 1R8YA 3EISA 1T9KA 2ZJ4A 4LGCA 5AOVA 2HY7A 4I5IA 5HMMA 2XUHA 1KGSA 1KY2A 3HWX1 1THMA 4OQNA 4G25A 3WB2A 5EIEA 3WA7A 1F8UA 1T2FA 4Q66C 3HCRA 4CT0A 2V9ZA 3AUAA 4TWAA 1OAAA 2ZAOA 4FN4A 5K0BA 1I4LD 2IS1A 3DTNA 4O4IB 4R7ZA 5C4GB 1K7FB 4KBFA 4OB8A 3TI9A 4BC1A 3LFHA 1G3QA 5ECGC 1DLIA 4IIBA 1XDSA 3DVAA 3W6UA 4PF1A 4CT5A 4YAWA 4EJ2A 1SHTX 5AHKA 5DSTA 5LDDC 2XWQA 3RLFA 4QJIA 3PEWA 4ME6A 3ODPA 1U7XA 1LZLA 5I3ZA 3ZKWB 1JUDA 5A3JA 4F06A 4IFEA 1QORA 3GFQA 3IB6A 2JJ1D 1T43A 5ITZA 2YHSA 3KOWA 1MFPA 4YMLA 2VH2A 2CLIB 2PDAA 5BXQC 2ECFA 5FCDA 2EX0A 3VISA 1OKKA 1FU7A 1XTKA 1D04A 1WG8A 1JJIA 5HILA 3WQHA 4ZICA 1LW7A 3OU6A 2ZULA 4D9JA 5LCXA 3AKZA 4IHQA 1IBMB 1VJ0A 3CLKA 3B9QA 3N05A 2GI4A 4O63O 2W58A 2BMEA 1CNEA 3IRVA 1JKIA 1NY6A 1TB4A 5I8ZA 4MCAA 2FPIA 3QLEA 1YZNA 4YC7A 5EHQA 3WQQA 4JC4A 5A5GA 4TZTA 1VE6A 1VRCA 3QWBA 2O8EA 1Y1LA 3MOGA 4AYTA 3RYFB 5IS2A 5FB3A 3ZK8A 5KTPA 4FC7A 2BR5A 5ERGB 3R7DA 1FMJA 4G4SO 5D3QA 3ICCA 4UE6A 3MXOA 5B12A 3GGCA 1LPNA 3TQQA 4MR7B 2EW1A 2D1QA 2QRGA 5IDQA 1OBVA 5M7EA 4L8FA 4RM2A 3DUFA 4NDNE 3LPAA 1Y6GA 4DW8A 3GROA 3NP7A 5ANRB 5GONB 3UUWA 1ND6A 4C04A 3LYAA 2QLNA 4J4TA 3DB1A 4DCTA 2GT1A 1KO1A 2CMHA 4EZIA 5LP1A 5T4FA 2E2WA 2Z04A 2M6SA 2QAIA 1UMCB 2ZJ7A 4MI9A 4W82A 1XJQA 5LZ7A 2PRZA 1S01A 4M0CA 3G0BA 4Y67A 5CDYA 5IT9A 3U3DA 1SVNA 2Q8NA 1KOLA 3UGJA 4BNZA 3ZV7A 1HX7A 2P69A 3SBXA 3OQPA 2NU6B 2X1MA 1WMFA 2Z1MA 3V32A 1PR5A 4WQMA 4C6TB 1VRWA 1FDWA 2OYRA 1E0DA 5E1OA 4RF3A 3NTXA 4RV5A 2PJZA 3B9RA 3BGOS 5BSKA 4IWYA 1VCIA 2VPYA 3EXG2 2XYVA 3HZHA 3R75A 3WSWA 1X8JA 5ALOA 3HV0A 1DC8A 4ZK2A 4CI9A 3IUNA 2EJCA 3HABA 4YMUA 2WT9A 3CLTD 3EDMA 4OQEA 5J47A 1Z74A 2VJBA 1BCRB 5DCYA 3HWWA 1E60A 3TLCA 3C0KA 3DLAA 1NUSA 1I30A 4FMDB 2OGZA 1T8SA 3UZUA 1UPBA 1XTQA 3BMNA 2NWQA 3V8QA 3H4MA 4WPGA 1XXHB 5K2MA 5BSTA 3VPHA 4HG2A 5FYDA 4IHJF 1D6NA 1QKJA 3ZYZA 4CJXA 3GP8A 4N8DA 3ZUGA 4AJOA 5AVSA 3N59A 5J3JA 1JQ3A 4PHCA 1NVBA 2X58A 3W4IA 4MICA 4FMBB 5CFQA 1XMQB 1EZ4A 2BVNA 5KAPA 1CF4A 4OJMX 4RVFA 1P1BA 4KR9A 4WADA 5FUYA 1PX0A 1YQXA 4XVCA 5ITVA 4KXQA 1LWNA 4MUXA 4ER6A 1Z75A 4PXSA 1SURA 4Y0AA 5EMMA 2FOIA 2PS1A 1AC5A 4QG7A 3L41A 2DWQA 4HAXA 2H0AA 2WIBA 3GLIE 2EJWA 1U28A 1CRQA 4HQ0A 2W6NA 1ORHA 4XX0A 2RK3A 4UQOA 4AKHA 4J0FA 5G4KA 1KKMA 3RIYA 1INLA 3CLUD 3VKUA 3WIBA 2RGEA 1R88A 1WD7A 4JB0A 2P9QA 2PRJA 3H0CA 1L5MA 5EERA 3THOA 3U7FB 4GMFA 2NQTA 2P62A 3COSA 4CKBB 3R5FA 2AG1A 1Z8DA 2C82A 1N2CE 4LYJA 2ZQZA 5E4JA 3K9BA 2FEAA 4UU8A 4MWCA 4FJ1A 1KO7A 1L5RA 1CUXA 4HLNA 4LWOA 4CM8B 4XTCS 2P90A 2R4UA 4K86A 5E9QA 4L4XA 2UYHA 4U7WA 3MRTA 2XOXA 3O3NB 3RU2A 4FKBA 4GM1A 4CG3A 3JYQA 1UDRA 1BH6A 4PSCA 1AQIA 3W0LB 1GQ2A 2OCLA 2VDMB 3QXCA 2P9CA 1J97A 4RHEA 5EIFA 4DCGA 4TYMA 2IUUA 1N6IA 4TSFD 2P27A 2YWBA 3BIWA 3OPYI 1OOEA 3MBKA 3U26A 3CNNA 4ALNA 4AMGA 5H59A 1SJ9A 2HW8A 4K03A 3SD7A 2JFUA 3NIBA 3VO2A 3SC3A 2PYDA 1AKMA 4L27A 3ZHRA 1CQWA 2V7UA 3QPVA 3D8HA 3O4VA 3OEED 2P2ZA 5J63A 4BNJA 1GNPA 3L6EA 2C4UA 2H1WA 7MHTA 3N0WA 4BFLA 2H65A 5D7NA 3BF7A 3UMYA 1R74A 5CA0B 2XKKA 3QPDA 3FG9A 2J3QA 2W2QA 3B1XA 3ZCXA 2VYQA 3NZEA 4XWWA 3AI7A 3HUEA 2AEEA 4R6WA 4NC9A 4BVJA 1V1RA 4D0RA 2XUFA 3JRNA 2WYWA 4ALIA 1UMCA 1OAKA 2J5XA 2CHEA 621PA 2M6RA 3KB8A 1H9CA 4HUJA 2VSNA 2Z9BA 4KAAA 4TYPA 2NMVA 1KMHA 4DCPA 1CQZA 5E0KB 4WNIA 4MWDA 3S28A 3ICOA 4B3SB 2NPFA 3RS3A 4KDEA 2CWWA 3EGDA 2E82A 3FFAA 4I1SA 1WLYA 1R8XA 1BN7A 2HCTA 3WV5A 3CIOA 2ZPTX 1C1HA 3WSVA 3TZQA 3VA7A 1X1SA 1CG6A 4PN7A 1TECE 5BV0A 4INZA 4AQYB 4NAUA 1XA3A 4OX9B 5IKEA 3OM9A 3KKOA 1WTAA 2FPRA 2O8EB 4MW9A 4RFSB 1QFZA 2CUTA 3C16C 4MPTA 1M0TA 1IIBA 5HFNA 1VIDA 2LCFA 2XRMA 3RGWS 4KYUA 4RIEA 4K40A 5D5HA 16PKA 4A1OA 4UE3S 1LBEA 1WCIA 5EIAA 1NUTA 1X80A 3M89A 3K70B 3ESXA 2P79A 4KGZA 2AOTB 2ZRMA 4M6WA 2UZ4A 1LC3A 2X0RA 1IOVA 4K28A 3A9SA 1ZOSA 4QFMA 3U61B 3OTGA 1K98A 2FQ1A 3L3BA 3LFUA 4PR3A 1N6LA 3EZYA 4X7MA 1H05A 1TQ2A 1JJBA 3E3AA 1OZGA 4G07A 4J1QA 4NESA 5HIJA 4DNQA 2XDQA 3T99A 4EATA 3WNVA 4X41A 5DGCA 3EIEA 1C3VA 2CBXA 3LZDA 1X7WB 5ESWA 5I6DA 1STOA 5EEGA 5CTJA 2WWWA 5TPWB 2DXIA 3LGSA 2QT1A 3LCRA 5LNK6 2OWEA 3KQPA 2G7MC 1X9HA 3PX7A 2J9GA 5ICSA 3RVKA 1NLMA 1DXHA 3O8BA 2Z0MA 4PX2A 3UOGA 4C4TA 2QZJA 1KP9A 1T6BY 3K9LA 1NKVA 1MC8A 3H1PA 4JC8A 4MINA 1V41E 4PC3A 4RK1A 1N7HA 3OOEA 4ZT5A 2SKEA 1CLEA 2WJGA 2GX6A 1SKYE 5CIWA 1H8HA 2E6KA 3JAWA 4CLRB 5CFRA 1JR3A 3VHLB 4MS4A 5GOZA 3BSFA 1O95C 1QTQA 2Y9MB 1P33A 3ZWYA 3UV3A 4K6FA 4D42A 3ZHBA 1SA0B 4JLDA 1C7FA 1EFKA 1GRVA 1ZN9A 5EXDA 4CN9A 1JKJA 2C2GA 2C9YA 2I1WA 3BORA 4G1FA 4EY8A 2FW0A 4NMLA 3Q3HA 1H8HD 3JYOA 1MUUA 1S2LA 3D4BA 3TIXB 1MJHA 2XTJA 5CT9A 3VC7A 2YYAA 3WJ7A 4BVFA 2G80A 2EQ5A 4JR1A 2OHIA 4HN2A 3SZRA 3HYCA 1GPMA 4HO1X 4XSGA 1NLZA 5BN1A 1C7QA 3VSBA 3HVRA 1FLNA 1DDOA 2A3RA 4MV9A 2QZSA 4IQ8A 1CJCA 3MGKA 3KBOA 4LXTA 4P81A 5IW8A 2CB0A 2QSJA 1PYOA 3K70D 2WQ6A 1N32B 2C4MA 4Y98A 4DLRA 3HI4A 1M2EA 4TYNA 1VGVA 2EZTA 3NBXX 1GGKA 1QK3A 2HNBA 2YMQA 4PQRA 3W7BA 3QUAA 3WLKX 5KX5B 1USGA 2CLOB 4QOJA 2RHOA 3ZIAD 4EB6B 2YL2A 2FPMA 1RLUA 5I8PA 4KYVA 2C3YA 3IXMA 1GZ6A 1J0BA 5KYVA 3THWB 5CVUA 3EVTA 1NVVQ 3ITKA 2FMTA 3S7TA 2XQJA 3ILVA 4QBTA 4O4JA 4PNZA 3DA8A 2OWDA 4DUPA 1YC5A 3A9RA 4PZAA 2HHLA 3KUKA 2EC5A 4FOOA 4LXHA 2HN9A 1CNFA 1P5ZB 1BW9A 3QX9A 4FYKA 4AO7A 5K5EA 5HWSA 4Q47A 4WFIA 2D00A 3CB2A 3PU6A 2FRVA 3ZD7A 5IX8A 3V4RA 3Q7TA 4FW8A 4WXMA 3ZVNA 3ZNQA 3EEFA 1BH2A 1IM2A 4KAXA 4I50A 2BFFA 4F46A 3FDFA 2YJ3A 2Z2IA 3A0UA 3HSKA 4X6LA 1PFVA 5HCUA 5AW9A 3U4AA 4LKOA 5EZQA 3JCZA 3E5NA 3G2LA 4Y9RA 4ZQFA 2W93A 4G89A 1YB4A 5TMPA 4ACBA 4HUTA 5AESA 2JPDA 2NYAA 4ZCLA 4L08A 4BC0A 2ZRPA 1LWOA 2WKWA 3KL4A 3P9YA 3PXXA 1ONNA 3VH3A 4QYXA 3TEJA 1S96A 2JEOA 1L7DA 2PNFA 2OZPA 2EBHX 3TX6A 5JW6A 2M1XA 1TYZA 1Y42X 4X20A 3MWDA 4Q15A 1KJYA 4BZPA 4OBXA 1VPLA 3I2GA 4ARAA 1SHKA 4KO4S 1FW8A 3MILA 3RVDA 3F6EX 2X5JO 1YF3A 2H9IA 4RGVA 4UTRA 4GI5A 1E3WA 1EXDA 4QUGA 2J67A 4IDDA 4W7SA 3UA4A 1BMFA 2NSHA 2YINC 3A1UA 1GUDA 1KYZA 2JZNA 1XZAA 1YDGA 5DNDA 3GEHA 1Z7GA 1HDCA 2P0EA 5G53C 3DZ8A 5DLYA 1DJMA 1QG0A 4PGFA 4LNHA 1Z38A 1V11A 2V7WA 1RRPA 3KR0A 4J0QA 1L8LA 4XH9B 3N28A 4YUYA 5LXTA 4R41A 1M34E 4KI7A 3AGPA 1PL8A 2WEKA 1Z22A 4DQKA 2R65A 2WWRA 2GBLC 1V1MA 1DUIA 1I51A 1NJ8A 1RJDA 4ENRA 1MVOA 3IALA 1JJVA