2Z1NA

Crystal structure of ape0912 from aeropyrum pernix k1
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
260
structure length
237
Chain Sequence
MDLGIQGKLAVVTAGSSGLGFASALELARNGARLLLFSRNREKLEAAASRIASLVSGAQVDIVAGDIREPGDIDRLFEKARDLGGADILVYSTGGPRPGRFMELGVEDWDESYRLLARSAVWVGRRAAEQMVEKGWGRMVYIGSVTLLRPWQDLALSNIMRLPVIGVVRTLALELAPHGVTVNAVLPSLILTDRVRRIPMGRVGKPEELASVVAFLASEKASFITGAVIPVDGGAHI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A unique catalytic triad revealed by the crystal structure of APE0912, a short-chain dehydrogenase/reductase family protein from Aeropyrum pernix K1
pubmed doi rcsb
source organism Aeropyrum pernix
molecule tags Oxidoreductase
molecule keywords dehydrogenase
total genus 89
structure length 237
sequence length 260
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2z1nA00
3ZH2A 1DRUA 1Z73A 4E5PA 4GLLA 3HADA 1H6AA 4J9VA 2NV6A 1NR7A 3I4FA 4XR9A 5H81A 4OQZA 1X0VA 1LDNA 4Z6KA 4C4OA 4R3NA 3KYBA 3RASA 2VZ0A 1F12A 1Q7BA 3IQDB 1NTOA 2NTJA 3I9LA 1Q0LA 1ZSYA 3MWEB 3QHAA 3LVFO 5IN4A 1KBZA 2Q1SA 2OHXA 4CM7A 3GN2A 1E1MA 4INAA 4UVGA 1TA4A 4GX0A 4MDHA 1GV0A 1OAAA 4MIYA 3ZHBA 3G0OA 3KRTA 3FRJA 5IXYA 2EGHA 3A14A 4IS2A 4BQRA 1AXGA 3BA1A 3GGPA 4OXKA 1LLQA 5F3RA 5B4VA 1TI7A 4Y6RA 2DTDA 4IJWA 3BMCA 5HBRA 1PQWA 1H6BA 4JBHA 2X22A 2VWHA 4OH1A 1PQPA 3VPHA 3D1LA 5KCZA 3ANMA 4K6FA 1GCOA 1LLDA 1XGKA 1E3WA 2GDZA 3OBBA 2AEJA 5JDCA 4TKLA 4BMSA 3OQ1A 5DNAA 2IZ1A 1DIAA 3MJ4A 1HF3A 2B5VA 1MFZA 4R16A 5CDSA 4NFYA 3RIHA 4CR8A 4PN3A 3GF4A 4U8GA 3NDRA 3DWFA 1ISMA 1GZ4A 3HFGA 5IDYA 3BMQB 5BNFA 3JQBC 5LDGA 2NU6A 3OFSA 3E03A 5CHEA 4R68A 2PA3A 2YQ5A 1AN9A 3PHGA 4QFDA 5G4LA 1LRKA 1I24A 2GN9A 3RJ5A 3G49A 4EITA 3PWKA 2NVUB 4BO5A 2OP0A 1P77A 1EVZA 5AXCA 4I5EA 1BMDA 1X1TA 4XKJA 3EY4A 3F4BA 3GGOA 3KV3O 4WK6A 1ZCJA 3H7AA 2EV9A 3OJEA 3FD8A 2CDCA 3R0IA 3V1UA 3RBZA 3PQDA 5JAQA 4U5QA 3TFQA 1ZK1A 3HDYA 4MP8A 3WIEA 3ZZNA 4DRYA 3AI1A 1C14A 2X5OA 1PZEA 4PLCA 3UW3A 1U4SA 3ZDFA 1DOHA 4MKXA 4RF2A 3AU9A 4CMIA 3AFMA 4D3SA 4BO7A 3RFXA 4CLRB 1HWYA 1ONPA 1TB4A 4EZBA 2IZZA 1KEVA 2UVDA 3QP9A 4ZN6A 1C0LA 1B7GO 4YACA 4IZHA 4Z0HO 3WNVA 2P9EA 4OMUA 3WS7A 5EERA 3JYQA 1P9LA 4ZQFA 4BO6A 4CLHA 1K6JA 2QHXA 2XOXA 4AJNA 2GCGA 4LRSB 2NADA 2BFAA 2EWMA 5H82A 3ROPA 2DKNA 3U9LA 4ZGWA 3MJVA 3LK7A 5JAMA 4J7CA 5CPFA 2RAFA 3NYWA 4BNGA 5C7IO 1DIBA 3L6OO 2PZKA 4XQEA 1SPXA 5C7LO 4OQYA 1KETA 2XPCA 4XDYA 1TVEA 1DFIA 2R00A 4YJGB 4WCDA 4S1VA 2EKLA 3W8FA 3HZZA 1U4OA 5L51A 2X6TA 4GI2A 4YJGA 4MKZA 4R4JA 4DYDA 1E3IA 2VN8A 2CMDA 5AYVA 1UZMA 2DBVO 4K1LA 3SBOA 1E3EA 2JD1A 5T8KC 2BKAA 4MVJA 4RL6A 2A4KA 1YQXA 1K6XA 2WD7A 3HJAA 2JFHA 3I1JA 1BXKA 3LT2A 2PR2A 3ZV4A 4D43A 1PZFA 3TFOA 4J6FA 1CRWG 4E5NA 1MC4A 3D5TA 2YDYA 2EJWA 1R37A 2YFHA 1JN0A 1T25A 1VRWA 2OZPA 1A4IA 4NMHA 3JQ8B 5FFFA 3RKRA 3VVCA 2P9GA 2W2KB 3WGOA 2Y1EA 4GPD1 3LT1A 3H9EO 2VYVA 4DPLA 3BIOA 5B37A 1UUFA 2P91A 4RPLA 4GSLA 1PWXA 5JLAA 2OMEA 3IUPA 4R41A 2ZTVA 4CMJA 4DQVA 1JKIA 1YOVB 1U8XX 4O5OA 1Y9AA 2I76A 4CV2A 1X7DA 1E3LA 2IEDA 2VT3A 3FNEA 3JSAA 2ZCVA 3MZ0A 4L4XA 2CDAA 3VH2A 5COBA 2F00A 2EERA 4BNXA 2WYWA 1NASA 2HDHA 4CJXA 4GVLA 3AW9A 4MVJE 2QRJA 2QRKA 4H7PA 4CQMB 3OQBA 3DZGA 4B4OA 4BL5A 1DJNA 4BNUA 1GCUA 2IODA 4LW8A 4CM4A 3DEYX 1XHLA 3RWBA 1C3VA 2GLXA 4D0RA 2X0NA 4NK5A 1SO8A 4AFNA 2CD9A 3NEPX 1ZIDA 3BMNA 3GOHA 4BNVA 1AHHA 4R69A 4UEOA 1MXFA 3SC6A 3GGGA 4F6CA 1NFFA 4BNHA 4BUCA 3BYZA 4N5MA 3EZLA 4IGEA 3E48A 1PJLA 3LLSA 2NM0A 2O3RA 3QA9A 4HY3A 1EUDA 1ADGA 1T2AA 3ZCXA 1NBOA 2EP5A 1U2GA 1I3MA 4YTEA 2FPGA 4RCVA 4IDCA 2IXAA 7MDHA 1L1FA 5A4DA 1N1EA 1GQ2A 4ZICA 3RC7A 1GUFA 4B3HA 2YW9A 2ET6A 2NVBA 1Y9EA 2PK3A 5B4UA 1P1JA 3K96A 1I30A 4FN4A 4HXYA 4UEJA 3KHUA 4WKGA 3JYLA 1P3DA 2R00C 4J43A 4W7IA 5L4LA 3I6IA 1E1LA 4XIJA 1E1KA 3QVSA 1MGOA 1A5ZA 4JK3A 4A03A 3EW7A 4UUPA 5IZ4A 3R6DA 1NXQA 3NT5A 2Q2WA 4AJKA 1VC2A 2B37A 3Q9NA 1ML3A 1X7GA 3AOGA 3DAFA 3QWFA 1AXEA 5AXBA 2DBRA 3GAFA 3G3EA 3GRKA 3V5NA 4Q9NA 1ISIA 1PJBA 1QYXA 1U9JA 1CJCA 1RM0A 2J5RA 3C7CB 2BD0A 4NBUA 1N2SA 2G17A 2B35A 2H9IA 4F6LA 1J49A 3KYCB 3GT0A 2P68A 3OQ6A 3VTZA 3GDGA 5CAEA 3NKLA 2G76A 5DCYA 5JPIA 3ROQA 2Q99A 4PLTA 1P1HA 2DUWA 2UV8A 3ETDA 3D4NA 4PLZA 1IE3A 4FCCA 4NR0A 5G0VA 5A9SB 4FOSA 5IXSA 2F1KA 1BVUA 4NHEA 5EL0A 4GWKA 3SLKA 2GGSA 3TZQA 4G5HA 5DOVA 3QY9A 1TT7A 3EC7A 3GPIA 3KVOA 3LC7O 1BRMA 1ZK2A 1VSUA 3VOSA 3PIDA 4PG5A 2B4RO 5JCJD 4PZDA 1U3TA 4NK4A 1PGOA 4BIIA 3D7LA 3K9QO 3GVPA 3WJAA 4QUKA 3UF0A 1IHXA 1VLLA 4CV3A 4D79A 3ASVA 4YJDA 3A06A 1WMAA 3DMYA 1SNYA 4XDZA 3WICA 1ID1A 1UAGA 4O63O 1FDWA 4M1QA 1YJQA 2O3TA 1ULSA 3E5RA 1KY4A 3MCVA 4NBWA 4YDRA 5EN4A 3FWNA 4EBFA 1DO8A 5GZ1A 1DDOA 4MINA 1LI4A 2HJRA 3ONEA 3QWHA 4NBRA 5C37A 5DP1A 3ZV6A 1I5RA 3JQ7A 1U28A 1HDZA 3S2FA 4MJLA 4B3IA 4JGBA 3AM3A 4J3FA 3OECA 3ANLA 2FR8A 2JFFA 3ETGA 1JWAB 2O50A 4OO3A 1WAMA 4XGIA 2CVOA 1NVTA 5ER6A 1VPDA 5CFZA 2AMFA 2D1YA 1M6WA 4YT8A 5JMWA 5DZSA 1CQJA 1T2FA 2PKQP 3FPCA 1NQTA 4QECA 3NTRA 4I9HA 4CLOB 3ZNPA 3HE3A 3LDHA 1HE2A 4CODB 1XU9A 3KLPX 4QX6A 4KDEA 4TRJA 5L45A 4EJ0A 1B3BA 5J23A 1Y7TA 3PYMA 4J4TA 4ROSA 3QIVA 4YJFB 4C7KA 4JLWA 2BH9A 4CQMD 3ZNOA 5DBFA 3F5QA 3BHJA 1ISJA 3JD4A 4GL4A 4JN6B 5TC4A 1PJCA 1KS9A 3GC6A 3ITKA 1A9YA 4MOWA 3IP3A 4EYEA 3P2YA 2DPGA 4BKUA 2GYYA 4XIYA 4AJPA 3H4VA 5CDYA 4GLOA 1U3UA 2J3KA 4BV9A 5DT9A 2BGLA 1ZO8A 2FRDA 3MJCA 2RHCA 2VWQA 4I8XA 1UDBA 3WOHA 1AE1A 1FF9A 3F9IA 2Q49A 1XDWA 2AG8A 3SVTA 1FDSA 1FDVA 4M55A 4OSOA 2DPHA 1PJ4A 4CLXA 3OEYA 3RU7A 5JW6A 2WJPA 3M1LA 4KUEA 2DBQA 3WGGA 5ER9A 1QV7A 3C3XA 3NV9A 3ZWNA 4XQCA 2X58A 3PHHA 5K9ZA 4R01A 3WLEA 1GZ6A 1XWFA 4CL8A 5IG2A 3KEOA 4KDFA 3WG9A 4KTVE 3AUSA 3U3XA 1GFSA 3DHEA 1ZMTA 4YWJA 3INTA 4DQUA 3L77A 1R15A 3DAGA 3FI9A 3EDMA 4GWGA 1GTMA 3INRA 1T1SA 5C3MA 3H3JA 3DHYA 1O5IA 1EK6A 1B15A 3SC4A 2PWZA 3NTOA 4YYZA 4QTZA 4OHUA 1SBYA 1DFHA 3C24A 5EINA 3I83A 3WIDA 3IL2A 3PHIA 5ITWA 3L4BC 5KVSA 1ZMOA 4IDGA 1R66A 4AJJA 2Y0DA 2XAAA 2C7GA 2H5LA 4KQWA 4Y6PA 3TOXA 4BHTA 1PS8A 1SEPA 2C59A 2NVUA 1NQAO 5JMPA 2V6MA 3MOGA 5DBIA 2OP1A 4MPDA 4HNHA 1EBFA 2VCYA 4J91A 3UHAA 3DFZA 3G1UA 3PZBA 4WOJA 1CWUA 3UFXA 3MTGA 3VH3A 3CXRA 3GNSA 4RVGA 3UCXA 2DQ4A 3LQFA 3GA0A 3C7DB 1Q7GA 4GX2A 2FMUA 4BNYA 1LEHA 3NGXA 4PVCA 1YDWA 1UP7A 5KNLA 4A5OA 4FDAA 2QW8A 4BMVA 3CUKA 2BFMA 3JV7A 3PGJA 1BWSA 1HDXA 2JCXA 4L0QA 3DOCA 1YB5A 3D64A 4XEHA 2AG5A 1N1GA 3AM4A 3VPXA 3RD5A 1HDCA 1R4NB 4DTIA 2ILTA 1E7WA 4YAKA 1YBAA 1KVQA 1PGPA 4BGEA 3BHMA 4A10A 2G82A 1PWZA 4JNKA 1YJ8A 1P1RA 1LX6A 3DZJA 3H9QA 5IF3A 3JQ7B 4J16A 3OH8A 5T57A 3TL3A 4L76A 1NP3A 2UUPA 3AU8A 4YBZA 3PVZA 5DDIP 5L9AA 4KZPA 4I1IA 5U4QA 4CMKA 1Q0QA 1YBMA 1LRJA 3GEGA 4IPTA 4PFJA 1PGJA 3RC2A 4CLOA 1B8UA 3HUDA 1JWBB 4BGVA 4YJHB 2PD3A 2HLPA 4RF3A 4PLHA 3ZV3A 4ND2A 1WP4A 3JQAA 4KUHA 3WB9A 5DBGA 1NWCA 5A02A 1ZNQO 1QRRA 1YQGA 2PH5A 4CQLA 1ZW1A 1L7DA 3DO5A 3QVOA 4XGKA 4YAJA 3PJFA 2Y1OA 5F1OA 5T67A 2YHIA 1O0SA 1UP4A 2JD2A 4JX8A 4PZCA 3E9NA 5K6AA 2D5CA 2C0CA 1Z7BA 3RFVA 4J0FA 3DMTA 5TNXA 1DC5A 2HKIA 4ZQGA 5AXDA 3GUCA 1K3TA 1E77A 5JNLA 3WJ7A 4Z9FA 1DRWA 2GNAA 4FFMA 5F5NA 3RVDA 5TJ9A 1SEVA 2X0IA 3L0DA 3PDUA 1GD1O 1E5LA 1O9BA 3ZGYA 1HT0A 1QYDA 1B16A 1YONA 2AQHA 4NPCA 4D42A 1OI7A 5KOIA 5T5QA 1N5DA 3TZHA 3JD3A 3P2OA 4WJZA 1I01A 1NPDA 3H5RA 4PLGA 3WMWA 5DULA 1JW9B 4YAEA 4XZ3A 3I9NA 3TSCA 3WGZA 4NFHA 5FI3A 2Y99A 3N74A 5K6AC 1N92A 3U5TA 1KYQA 2O3QA 2PFGA 4B4VA 4DLLA 2ZTMA 5CP8A 5L4NA 3TZ6A 2NVWA 3KYDA 3RUCA 2Z95A 4YRBA 1HETA 2Q45A 4ZD6A 2H1SA 2NU9A 5IDQA 2WE7A 5G0SA 5IDXA 2VRCD 1XIVA 2VHYA 4GMGA 2P9CA 4FR5A 3HFSA 1YQDA 1EE9A 4DMMA 4FJ1A 3HWRA 1SZJG 2WYVA 4W82A 5JCJA 1DIRA 5A5FA 1LA2A 4XJSA 3W8DA 4BNMA 1ENOA 2Q46A 4J0EA 3WTCA 2P4QA 2ZYDA 3NTQA 2C82A 4YJFA 4WLVA 3UGKA 3GHHA 4DC1A 1Y8RB 6LDHA 4II3A 1ZBQA 4IDEA 3WSVA 3BAZA 5JDIC 1DC4A 4D45A 5TT1A 1L7EA 4R1TA 4HWKA 5BQFA 3OJFA 4OOEA 2VQ3A 3GHYA 1X15A 3ZWAA 5L4SA 2AW5A 1EVIA 2AQKA 5G4KB 4BGUA 2D3TA 4IM7A 3W1VA 5B12A 4FBGA 5IDWA 1LDBA 2J6IA 2O7SA 4PRLA 3H6KA 2J3IA 4MVJP 1WXDA 4CLRA 4FOOA 5G0TA 2PH3A 3IC5A 4RVHA 4HV4A 4QQRA 1XG5A 2XXBA 3T7EA 2EW8A 3SXPA 1QYWA 1B2LA 2FOIA 4P38A 1PL7A 4LMPA 1MX3A 4EEXA 1YWGO 2X5JO 4IQ8A 4N5LA 1HYEA 3K2BA 1PGQA 1CEQA 1KERA 4RF4A 2JL1A 2OORA 3DZFA 2OBYA 4LVCA 1K5HA 1QYCA 4NJMA 3AOEA 1V3VA 4YA6A 1CF2O 3W6ZA 5A05A 1DAOA 1YL6A 5GZ3A 3DBHB 5L7YA 1BXGA 3AJRA 2FN7A 1O8CA 1QLJA 1IY8A 1ULUA 2YYYA 1SOWA 3IAHA 3PDJA 3HHPA 1LLCA 1VJTA 2BFOA 1P31A 1XSEA 4K6CA 4YCAA 3GRPA 4BNLA 2CVZA 1K0UA 4RDIA 3ABIA 3CKYA 2HUNA 2B4TO 4ZJUA 1AGNA 5EPOA 2FWMX 2I99A 3DDNA 1C1DA 4N18A 1G1AA 3H9UA 5A3JA 1DBVO 4AJOA 1DAPA 4J4HA 3KYCA 2X9NA 3AY7A 2AHRA 1X14A 3JQFA 3S2EA 2GRAA 4I9UA 4PRKA 2QIOA 2E82A 1GU7A 1LTHR 3L07A 4BO0A 4CM1A 1RYEA 2DTXA 2DU8A 3PQEA 2IYPA 4H3VA 1QR6A 1ZH8A 3BTUA 1BG6A 4UUNA 2C5AA 1PL6A 5COAA 1QXSA 4WGGA 4XB2A 2VHWA 4I08A 3FR7A 5L7TA 4DIBA 3CINA 2PZJA 2C29D 2FSSA 4IXWA 1VL0A 3DQPA 1U7TA 1UXHA 3TRIA 3VH1A 2Y0EA 2HMTA 4DC0A 3KTDA 1W0CA 3A1NA 3LT4A 2VUUA 4WOKA 1IULA 1GUYA 1FXSA 1LDGA 2I6TA 3JQFC 4JXKA 4R1UA 1XYGA 1ZK3A 2DC1A 2EP7A 5CEEA 5TF4A 4BO3A 2O2YA 1I3LA 4Q3DA 4W6ZA 2SCUA 3OHSX 3NT4A 1UDCA 5JO0A 4FIZA 2V6FA 1Q0HA 4D3FA 5CDUA 3GFBA 4UUOA 1NX6A 2PLAA 4IGFA 1PS9A 2VWPA 3OICA 4BO9A 3PP8A 5KJFA 3RSHA 4JJIA 4UULA 5GMOA 1ZJYA 5K0ZA 1ISGA 1EMDA 2J3HA 5KJCA 4IIVA 5CEFA 3PHJA 1LSOA 2EEZA 3GVIA 1VJ0A 3S2GA 4PG4A 1VI2A 4TROA 3AUTA 3ANNA 2VHZA 3WR5A 4W9NA 4ZQBA 4YR9A 2ZIZA 1KC3A 1BVRA 3H5AA 2QX7A 3AI2A 4P4NA 5DCWA 4E12A 1KVUA 4CM4B 4KTTE 3AY3A 4JP2A 4HFMA 3GH3A 3DZHA 2W98A 3ZHZA 5JS6A 2NWQA 3KLMX 5I7FA 1J6UA 4LCEA 4OIMA 4CMIB 5IAAA 2OO5A 2WSBA 5B4TA 4ALJA 1LXCA 5TGDA 3L9WA 2Y66A 4NBTA 4FC6A 2RBEA 3GG9A 3DAPA 4RJTA 3UOGA 2C54A 3UVEA 3I52A 4CMCA 5HRUA 4J7UA 4OSPA 2NQTA 1T1RA 3VKUA 5T8KA 3K5PA 3RKUA 2LDBA 7ADHA 3ITDA 1Z7EA 5CPBA 1TXGA 5BNTA 4W7HA 3BMOA 4RPGA 4ZHSA 3DR3A 2HK7A 3CH6A 2QYSA 2VRBA 3JD2A 4K9DA 2D0IA 1P74A 2DFDA 2FR1A 3NGLA 4L75A 3DFUA 2A94A 5GZ6A 5A3VA 3HG7A 3JQAB 3G79A 3K6JA 2DT5A 1PR3A 2ZB8A 2HO5A 3UKOA 3IIEA 4FD3A 4HFJA 4ND5A 4OGWA 4YAIA 1HDGO 3CSDA 2P4HX 1UP6A 4ONEA 2UUOA 1R4MA 1BTOA 4WNCA 2B0JA 3PRJA 3GPDG 5T6BA 4D7AA 1ZK0A 1X0XA 2VYVD 2Q50A 3EAGA 3F1KA 3GDOA 2CZCA 4CM3A 1HRDA 1LDEA 1LLUA 2VT2A 4NZ9A 3GZ4A 5F1KA 4BV8A 1HE4A 1NQOA 1JQBA 4CL3A 1O6ZA 3TL2A 4CM9D 3RFTA 3PFFA 3OM9A 4LRTB 3RUIA 3DB2A 1ZJZA 4UUMA 1HLDA 5DN9A 4WLNA 4AJ1A 3C7AA 4A27A 5ICSA 2HAEA 5JAIA 4B3JA 3RBVA 3V8BA 2Q3EA 4ND1A 4E6PA 4M8SA 4LISA 4D3DA 4GAEA 4E21A 4XYLA 4IXTA 2GASA 4GX1A 1TLTA 1J5PA 1PIWA 2I5PO 2PY6A 1V6AA 4CMGA 1GAEO 1JU9A 1VKNA 3GFGA 1ONOA 5TX7A 4NJOA 1SMKA 5U1PA 4WLOA 3UCFA 4XYMA 3GZNA 3F5SA 4IDFA 1RM5A 1U7HA 1SB8A 2FPIA 3O38A 4DIOA 2FHSA 1D1TA 3LSYA 1KC1A 4UVEA 3O8QB 4RVDA 5A9RA 1WDLA 3GMSA 1RWBA 2Y67A 3KB6A 1KVRA 2OL4A 2ZATA 4A7PA 3EK2A 1I8TA 4Q3BA 3IP1A 2PNFA 2PGJA 4PG8A 2AXQA 5HTOA 3WTBA 3F1LA 3Q11A 1UJMA 3GDFA 5KJ6A 1E3SA 2Z5LA 3ZV5A 4FFLA 1F0YA 4B7XA 3CZMA 4W9NC 4WASA 2YV2A 4E4YA 1P0CA 4TVOA 3ZI0A 3WGYA 4TRMA 1GPDG 2CNBA 1A7KA 3EVTA 4E31A 5I7VA 4IQ0A 3U49A 3LYLA 4RZIA 3LLVA 3TQHA 1I36A 1A4UA 4DREA 1GPJA 2WEKA 4PG7A 4LN1A 4IUYA 5I9MA 2NTNA 3UUWA 3FN4A 3PQFA 4RPKA 4XJTA 1H6DA 2DFVA 4ZVVA 2GR9A 3VPSA 3VH4A 4JJGA 1MG0A 1ZK4A 2EIHA 4EUEA 5TJHA 5ITVA 5IZCA 1MA0A 4Z0PA 2VOJA 5JCXA 4DWVA 3DZIA 3IUSA 2GF2A 3U4IA 1XCBA 2Z1MA 1DPGA 4Z0TA 1IPFA 3C8MA 1KIFA 3O4RA 3JQGB 1CETA 1WZEA 3E9QA 1FDTA 1B14A 1KEPA 1XLTA 3F3SA 2C5EA 2DAPA 3VDRA 3LF2A 3W4IA 4IDBA 3TNLA 1O94A 1YDEA 1BXZA 3PEFA 3ZN2A 1FMCA 1ZZEA 3QLJA 2HK9A 2W8ZA 2P5UA 3ULKA 4N7RA 4BMNA 2Y68A 4Z3KA 2O3UA 2OGUA 1GDHA 1SAYA 1ZKMA 2ZJ0A 3GMDA 3Q9UA 5EQDA 1OBFO 4CLEA 2PGLA 2PGDA 3ZU3A 2YZ7A 4L74A 1KEUA 1U8FO 3SX2A 4AJ4A 3U09A 2WM3A 3STHA 4HUJA 3CTMA 1P33A 3PWSA 4YT2A 3ENKA 4OXYA 1E1NA 4CM8A 5JXWA 1CIVA 4E32A 2A9FA 4TRRA 1E7MA 1X13A 2HQ1A 3U0BA 2CUKA 3HDQA 1MB4A 3K8ZA 4W4TA 5BT9A 1P44A 4RDHA 5HS6A 5G0WA 2DVMA 2ZQYA 1NFQA 3ETEA 4BNZA 4BGIA 1E7RA 3N58A 3E82A 3A4VA 4WNIA 3PLRA 3U4HA 3BMOB 4DLBA 1XELA 2E4AA 2P2SA 5KKAA 3O03A 3F46A 1NNUA 4CM9A 1A9ZA 3NJ4A 3GEMA 1XQ6A 4A2CA 1ENZA 1IL0A 4M86A 1E5QA 2WWRA 4AL4A 1JA9A 2HU2A 2IDZA 2FY8A 4RO0A 1Y8QA 4FS3A 5A04A 4WUVA 1ONNA 4UVDA 4DQXA 1P1IA 3FWZA 1VM6A 1C1XB 3WYEA 3CPSA 2JCYA 1E6WA 3JD0A 5TQVA 4E5KA 1E7QA 3DOJA 3GVCA 1SC6A 1HSZA 1EK5A 4RORA 3SJ7A 1OOEA 3N7UA 3KEQA 2CVQA 4TSKA 3ZNNA 1HZJA 2NQ8A 2WD8A 4R9SA 3VTFA 1K89A 4NDNE 3FSRA 5FEUA 4Z3DA 4KWHA 4PCVA 3SEFA 3WGHA 2WYUA 1VL6A 2ZCUA 4CQMA 4KMSA 2UDPA 3ZWYA 2GSDA 1Z6ZA 2AE1A 4UEKA 4L4SA 3ZW8A 3LF1A 4H16A 2VHXA 1Y8RA 2CF5A 5FYDA 1BDBA 4G81A 3M1AA 3QWAA 4AJHA 4W99A 4GVXA 3OA0A 3OIFA 1T2DA 1H93A 4J4BA 1DJQA 3K31A 3RAJA 1NHWA 3GUYA 1IHYA 2X5KO 4MP3A 5KIAA 1YGYA 2PD4A 1V35A 5COQA 5CEJA 3PI7A 1NHGA 4O1MA 3IKVA 5F21A 4XQ9A 2AQ8A 3GY0A 4IBOA 1FDUA 2OFPA 1T4BA 1HLPA 4U0JA 1GR0A 4G65A 2R6JA 3HQ4O 3FPLA 5TSDA 3ENNA 5IZCC 5JDCC 1AHIA 2ZJ1A 4DYVA 1J0XO 4HP8A 1IYZA 3H8VA 2X86A 2HMUA 4LMRA 1B0AA 3K2EA 1UR5A 3A9WA 3FF4A 2VNSA 4QO7A 5MGBA 5BSEA 4NNJA 4B8ZA 1ARZA 2PV7A 4HKTA 4HBGA 5H83A 3X2FA 4FJ2A 4KOAA 3OEWA 1GADO 4P22A 3FNHA 1XU7A 4FJ0A 4DGSA 2B69A 5A5EA 2UYYA 3AI3A 2XF8A 2W4QA 5I8ZA 5EJ2A 4AJEA 1OFGA 2D59A 3GG2A 2VRCA 3NRCA 3SLGA 4CMEA 3I9JA 5A06A 3VKVA 2BLLA 1XKQA 3DZKA 4E30A 1R4NA 2AEFA 4OL9A 3VHRA 2Y1DA 1NAIA 5JYEA 3R3JA 3AWDA 2QZ9A 2X0RA 1PJ2A 1Z82A 4WLEA 3RBXA 4RQUA 2W90A 3KBOA 4YRDA 1M6HA 3GQVA 3C1OA 2NUAA 4RQTA 4I5DA 1LC0A 3PWZA 1H2BA 5JE8A 1ZEMA 3RC1A 4OKNA 3NUGA 1VE9A 4H15A 5AVOA 2CSUA 4LVUA 2VYNA 5I9NA 3L6DA 3DL2A 4AJIA 4BOYA 4R9RA 3DBHA 3D4OA 4UVIA 4QSMA 4XRGA 4LK3A 2X1HA 5JYDA 1Y5RA 4HFRA 3PPIA 4TZKA 4O59O 3VPFA 1B8PA 2PZLA 4BB5A 3DOOA 3ZHYA 4BKQA 3R1IA 2RCYA 5BSHA 1ZSNA 2VTDA 3M2PA 4GGPA 4PLVA 3JQ8A 5DOZA 1I2CA 1V3UA 4ESOA 1GUZA 2NACA 2G0TA 1OC2A 2HMWA 3BZUA 3C1TA 4XR4A 5AOVA 4Z9XA 1I33A 3PYLA 3WFJA 2Y1CA 3ADPA 4RVUA 1YOVA 4YT5A 4BVAA 1OC4A 1R6DA 5ILGA 4E3ZA 2I67A 4ALLA 4BNKA 1DLIA 3TF5A 3QW2A 1MP0A 2EKPA 3TPCA 2E48A 4OAQA 3ORFA 4CMHA 2XXJA 3U62A 1YL5A 2E6UX 3OIGA 5L95A 1H9BA 1R16A 4ZQHA 1GEGA 1WVGA 1JAXA 2IYOA 4DMLA 4FFOA 1DLJA 2O3JA 2YDXA 4MO2A 4MVJG 4EJMA 1W6UA 1RKXA 4LSMA 4GBJA 4Y98A 5L3ZA 5T64A 1ORRA 2DBZA 2NSDA 1N7GA 1S7CA 4PLWA 1U3VA 1Z75A 1VSVA 1S6YA 4EUFA 4CM5A 1TT5A 2VZ9A 1PJTA 1W73A 2QZZA 4DBVO 1D1SA 2WTBA 2BMAA 4GGOA 4CUJA 2C07A 4CMAA 3C1AA 4Q39A 3JQDA 4B8WA 4EI2A 3ZU2A 4PZEA 5TIIA 4ILKA 2RIRA 3F4LA 4QT0A 4NH4A 2EXXA 4BO4A 4RVSA 2CFCA 4Q3CA 4A73A 1MV8A 5MDHA 3B1JA 1LSJA 3B1KA 1VJ1A 3WYCA 1GEEA 4ZA2A 2B5WA 2Q4EA 1I0ZA 1UXGA 2YJZA 3V2GA 1MG5A 1ISHA 1N9GB 4PLPA 1BW9B 5TRTA 4XQGA 2FSVA 3JQGA 1R0KA 2UAGA 2NU8A 5I8WA 1KOLA 3U4DA 2X7HA 3G1TA 3QVXA 3GEDA 4EGFA 3PFWO 4CMEC 9LDTA 1YS4A 3NDIA 3G17A 5GY7A 1QLHA 3QJ5A 5BR7A 1A7AA 2AEMA 5ES3A 3VZPA 3DC2A 1IPEA 1I10A 4ZRNA 1H2HA 3OSUA 3JYOA 2Q1TA 4J1SA 2I3AA 1XEAA 1DIGA 2A35A 4MIEA 4NJMB 3JQ6A 3CEAA 1ISFA 3VAZA 1Y6JA 2HMVA 3MTJA 5A1TA 1CQIA 2PKQO 1YBVA 4FFNA 1QYVA 4U7WA 4JROA 1RM3A 5CG1A 1VKOA 1P1KA 3H3FA 5C5IA 5I9LA 3I5MA 4RPJA 1HXHA 4XCVA 2J5QA 2B4QA 1JKFA 2QYTA 1C0PA 3DBRA 3TN7A 1PU2A 2JD0A 1D4FA 1HDRA 2D2IA 4CR7A 3FBTA 3IOYA 4F45A 1HDOA 5IFLA 2HRZA 1GL3A 3VZSA 5ADHA 4D0SA 1ADFA 3TZCA 5JDIA 2RH8A 3D4PA 4JBIA 2I3GA 3DBVO 1H5QA 3FTPA 1G0NA 3Q6IA 2CF6A 3PXXA 5BNIA 3DTTA 3TDKA 1NWHA 1YO6A 3JYNA 1QORA 2BFPA 4MIOA 1IUKA 1UXKA 4R5MA 3E6AA 4XYEA 2PTGA 1PZGA 8ADHA 3IKTA 1I32A 2RH4A 2FR0A 3LT0A 5CDGA 2IE0A 4BQPA 2JAPA 3WGIA 3JQ9C 4RV9A 1YRLA 4R54A 2BI8A 4DIFA 2WD7B 4E2YA 3HNPA 4P4GA 1ZEJA 3I4CA 4RPHA 3RCBA 3UCEA 3S1LA 1PJQA 1YL7A 4ZU3A 1NR1A 4UAGA 2X4GA 4WCFC 5CG2A 5EQFA 3VVBA 2YFQA 1Z74A 3ZWWA 1WNTA 1GQQA 5KVVA 2AA3A 2WE8A 3ZWMA 5U9CA 4LSWA 4FGWA 4PLFA 1FJHA 4L8VA 3VDQA 4CR6A 1F14A 4YQYA 3VPGA 2EKQA 2JAHA 1CERA 3SJUA 4B4WA 3W8EA 3TZKA 3KOUA 1P1FA 3UXYA 3DBLB 3R3SA 3NT2A 3X2EA 2GN8A 3P5SA 4HNGA 4S3MA 3CE6A 3WLFA 2BRUA 4AJLA 3GVHA 4KQXA 4JIGA 3O9ZA 3ZHXA 1PS0A 4R1SA 3M2TA 3LC2O 1LU9A 2JJYA 3ZWBA 3BXXA 4R5HA 3TJRA 3BMNB 4FGSA 3K73O 4ZQEA 3V2HA 4PLYA 4BNTA 3H9JA 5FF9A 1ZXBA 2C2YA 1BHSA 3OJLA 4NBVA 2OUIA 1QG6A 4TZTA 4WLUA 4BNNA 3M6IA 1UZLA 4Y6SA 4F46A 5JAZA 4A26A 4WCFA 2O2SA 3D3WB 1U1IA 3D5QA 1RYDA 2Z1NA 4J9UE 1LSUA 2WDZA 4QXMA 2YUTA 3WWYA 4PIVA 1RJWA 4HX5A 1F8GA 4CM6A 3MOIA 3WSWA 3MJEA 2JHFA 3PGXA 1H94A 3V1YA 1HYGA 2V6BA 2ZKLA 3DMTC 2ZB3A 3EMKA 4D46A 3ADOA 3GR6A 1ZFNA 1MC5A 4KUGA 4MVJH 4BO8A 4HFNA 4D44A 4IDDA 3JQAD 4MVJD 3KXDA 2QRLA 3EYWA 5TT0A 1WDKA 2PKRA 4GMFA 2DTEA 3L9XA 4WCFB 3AUUA 1DRVA 3P19A 1ZXLA 4JJFA 1PX0A 3HDJA 3CZRA 4ITUA 1E92A 3V1TC 4K28A 4BKRA 3BTOA 4DPKA 3Q2KA 4DBZA 2R2GA 2WMDA 4U6SA 4O6VA 3B70A 1F17A 1EBUA 2GPTA 3HSKA 1CDOA 3OA2A 4BNWA 3DZBA 2BI7A 4CQLB 2BELA 1N7HA 4ND3A 4CM8B 3ST7A 1PL8A 3L4SO 2PD6A 3DXFA 3H2SA 4FSHA 1CYDA 4YJHA 1ENYA 2NU7A 1DHRA 1Y5MA 4M54A 4QEDA 3L6EA 1PTJA 5F5LA 3KO8A 1JTVA 3JCZA 4QO8A 1R4MB 2CDBA 5AXAA 4FB5A 5EIOA 1XA0A 3EUWA 3LU1A 4PGFA 1ADBA 3GNTA 4NU6A 3KZVA 4OM8A 1T4DA 1IZ9A 2FP4A 3EGOA 1M2WA 1IOLA 3E8XA 5I7SA 1HL3A 2IXBA 3QQPA 4R51A 3BMCB 4GSKA 1HEUA 3NAQA 4II2A 1V0JA 1YE3A 3JQ9A 4ALIA 1E7YA 1DXYA 2EG9A 2H6EA 3FCOA 2DM6A 2LDXA 2VNAA 3AK4A 4YAGA 2D8AA 4D41A 5CDTA 2YV1A 1EDOA 3E5MA 1WW8A 4GX5A 1PJ3A 5ENDA 3I23A 4YEDA 4BNJA 3RI3A 1X1EA 4B7CA 4OXNA 2AQIA 5AQ1A 3KUXA 3S55A 1PEDA 1C0IA 2VTEA 2FZEA 4DPMA 3MJTA 1PJSA 2GD1O 3U4CA 5ICMA 2V7PA 1H9AA 4IY1A 2GUGA 3BTSA 1M76A 3WXBA 3WBFA 1GZ3A 1EVJA 4YQZA 2VUSA 3ZNQA 3I6QA 5JBIA 3E9MA 1UZNA 1NVGA 1VL8A 2ZTLA 4GQAA 1U3WA 1Q2XA 1U5CA 1QV6A 3FBGA 1LDYA 1DHTA 3UICA 1Y1PA 2EJVA 1NPYA 3KYDB 2HMSA 1N8KA 1EUCA 1EE2A 3W4KA 1C1XA 3QVTA 2ZK7A 3H2ZA 4YB8A 4IJUA 4E2ZA 3B1FA 1PGNA 3IMFA 1Q1NA 1JVBA 2FPPA 4UREA 3IS3A 4BS9A 3I3OA 3PTZA 3ZWOA 3COSA 3I9MA 2Y05A 4EJ6A 1E0DA 4URFA 2RHRA 1HE3A 3HN7A 4Q3NA 1ADCA 1MFPA 2Y0CA 4IJKA 5BSFA 4U6QA 3GVXA 5KTKA 2YHIB 2FZWA 4CV1A 2DLDA 1JLLA 1E6EA 5A03A 3FNGA 3PJGA 2H63A 3FNFA 1DC6A 2C2XA 4E13A 3GN1A 3RUDA 1D7OA 3OIDA 5LDHA 4YPOA 2Q4BA 1LQUA 2X23A 3TOZA 4ALKA 4ND4A 4B7UA 4J2OA 1EQUA 4I9NA 1EZ4A 4XA8A 2OXIA 1I2ZA 1NAHA 4XRRA 3WNQA 1HE5A 9LDBA 1EVYA 3WGTA 4QFCA 4WEQA 4E2XA 4ALNA 4BNFA 2BGMA 3CIFA 4FQ8A 4IDAA 4CMBA 1O95A 1W8DA 3EHEA 4OYRA 5JC8A 5L7WA 1KY5A 2A92A 4J2HA 4ZRMA 1H6CA 4J49A 1NPTO 3IJRA 4IJVA 5JO9A 4FFRA 1WZIA 3WYBA 2YQ4A 3IDSA 3WMXA 1OZAA 4JQCA 2C7VA 2G5CA 1HYHA 3ON5A 4PG6A 1Q7CA 1BDMA 3QSGA 1GQYA 2Q1WA 4J1TA 1I2BA 4AG3A 3OJ0A 3ONDA 2YY7A 1H0KA 1HKUA 1BSVA 3FHLA 2VZ8A 4OKIA 2EGGA 1C1DB 4DL9A 4E5MA 1XR3A 3ZWPA 1QKIA 2EW2A 4XX0A 3K92A 5DP2A 1DC3A 2JCVA 4BNIA 1LQTA 5JSFA 3QVWA 5KJ1A 2GO1A 2EF1A 3HB5X 2W2LA 3ZWVA 4F3YA 3ROKA 4NU5A 3DONA 1P0FA 2VUTA 1QMGA 4L73A 1ZSVA 2ZTUA 1NQ5A 4Q3AA 4DXHA 2GZ3A 1U2DA 3E1KA 4NG5A 3O26A 4IMRA 1NVMB 5L53A 5G0UA 3T4XA 4MVJF 1LNQA 4E2WA 4BKPA 1GYQA 4I5FA 5TLSA 3C85A 1MUUA 3MEQA 3Q3CA 4OOFA 1AUPA 2VWGA 3NX4A 3VZQA 2BGKA 4NQZA 3KSUA 2IEBA 1LDMA 5KWEA 3KETA 1WLYA 1YKFA 3V2UA 1EQ2A 1PQUA 1GV1A 2NTVA 3RROA 2BF7A 3RUAA 4B4UA 4CUZA 4AJ2A 8LDHA 1O89A 3RUEA 1UXIA 5JC1A 1HSOA 3W6UA 1PR9A 3QE3A 3WWZA 2Q2VA 4FC7A 2ZQZA 4ID9A 1IZ0A 1KVSA 1M66A 1T26A 4Y9DA 3UAGA 5JY6A 1JDJA 1UAYA 4J1QA 2O4UX 1XQ1A 1EUZA 3ZWCA 3BMQA 1B8VA 4O0LA 4R1NA 2J8ZA 1GY8A 2JKVA 3VC7A 3JYPA 4JBGA 3LC1O 2ZYAA 1TEHA 4L4RA 4RVFA 5I7EA 2YHUA 3GZNB 3P7MA 5KVQA 4RLHA 5DCUA 2VHVA 2QQ5A 5L40A 1A71A 4UVHA 3E18A 4P8RA 1LSSA 1SOVA 3DBLA 2W2LD 3RU9A 1UH5A 3BTVA 4RZHA 4XYBA 3FTNA 3QWIA 2HK8A 2I9PA 3JQCA 4C7JA 5HM8A 4MP6A 3O8QA 4GKVA 2QG4A 2HSDA 3AFNA 5JY1A 3CMCO 1B26A 1UDAA 3WQRA 5KJEA 3OF2A 5LC1A 4K26A 1EFLA 3UH1A 2IRWA 2O7QA 3KSZO 2TMGA 3PLNA 3PYXA 5F1PA 2I66A 5THKA 1DFGA 1A72A 4JCOA 3L4BA 3ROMA 4YXFA 3OETA 3ZU4A 4MKRA 1HTBA 2X0JA 4Y8VA 3PIIA 5LCXA 3GAZA 1F8FA 3PJEA 4YT4A 4AICA 2JHGA 2OOSA 2D4AA 2CY0A 2X8LA 4R3WA 1PSDA 5KKCA 4FPXA 3FR8A 1GYRA 3D3EA 1D3AA 4DA9A 2Q1UA 3QV1A 1KEWA 3H5NA 4P4LA 4WECA 3F6YA 2ZB7A 2Y93A 4MVJM 3RJ9A 2X9VA 3LZ6A 3MWDB 3OP4A 4NIMA 4CV0A 1E6UA 4TVBA 1P45A 1HZZA 2YV3A 4JP3A 1DEHA 1WWKA 3GLQA 2ZB4A 1LBEA 3Q2IA 3GNQA 4RF5A 4GKBA 4IS3A 4EDFA 3CMMA 3KSDO 3HDHA 4IINA 3AOEC 5IJZA 2C20A 1E3JA 4N54A 4I5GA 2E37A 1YH3A 3I9KA 4IMPA 2DUUA 3ZW9A 1RPNA 1YXMA 4DVJA 2Q2QA 2D5AA 3NDJA 1YB4A 5ILOA 1X7HA 1G6KA 2NNLD 2O48X 3I9OA 1EFKA 5TS3A 3JQEA 4RLSA 3UN1A 1GYPA 4FW8A 5EMHA 3ZU5A 4TRNA 1UXJA 1WMBA 4IIUA 3WQQA 4KP7A 4U0KA 3PK0A 3GK3A 4WPGA 5HA5A 2JFGA 2Y1FA 2J3JA 2NLOA 2GN6A 2V65A 1LUAA 1U5AA 4E5YA 3QRWA 1IB6A 5G2OA 4IZIA 4LGVA 1T24A 1Y81A 4WE3A 5KVCA 3VZRA 5A9SA 3PZRA 3AY6A 3QWBA 5ENVA 1V8BA 1M67A 3ZWXA 1SCUA 5FI5A 5A9TA 1RM4A 4Q3EA 3ONFA 3WDSA 5DF1A 4MVJI 1E3WB 3EZYA 3Q1LA 4X54A 3D0OA 1F06A 1DIHA 1EEHA 1JVSA 1NM5A 3PHLA 3Q0EA 4LCJA 1OMOA 2W2KA 1E7SA 3WGQA 4CLDA 1D8AA 3ICPA 4WEOA 3JTMA 3BHIA 1R0LA 1K6IA 5G4KA 4AVYA 4KWIA 1M75A 2O3SA 3F47A 3S2IA 1DSSG 1LC3A 1MXHA 3T4EA 3WFIA 1K2WA 1WPQA 4XGNA 1I3KA 1J4AA 5HWSA 1EDZA 4E0BA 2B36A 3DHNA 2GN4A 1LJ8A 4BO2A 3B6ZA 2ZYGA 3AUAA 4M87A 1T2EA 1BW9A 1N9GA 4N5NA 2B83A 3ASUA 5JFOA 2GZ1A 3AM5A 2HCTA 4YRAA 4DLAA 4RGBA 4Y67A 1Z45A 4IQGA 3NJ8A 2E49A 2GZ2A 1ZVMA 3JQBA 5EESA 2O23A 1I3NA 3OJOA 4XD2A 4M49A 2AE2A 2VYND 3H65A 1V9LA 1W4ZA 3H9GA 4A0SA 4WLFA 3IJPA 2HRBA 4YVFA 2V6GA 3KM0A 4OJNA 3W4JA 1B3RA 4GH5A 1JAYA 4XB1A 4BB6A 4B79A 1MLDA 4DUPA 5C7OO 2P5YA 2TMDA 6ADHA 1TT5B 4XWYA 2Y1GA 2BHLA 2HJSA 1YB1A 1HDYA 1NYTA 4L9RA 1FK8A 1R0SA 2PZMA 3ICCA 4FFPA 4CPDA 3WQSB 2OBNA 3DTYA 4BO1A 1T2CA 1C0KA 3HB4X 3RUFA 3WX0A 4PVDA 4M89A 4EUHA 3TWOA 5BSGA 5THQA 4HADA 2VOEA 3D3WA 1QSGA 2O4CA 1DB3A 1R12A 3INGA 3RUHA 4NI5A 4EEZA 3EVNA 2G1UA 1G0OA 2J5KA 1V3TA 3MJSA 1ENPA 4TMFA 4Z9YA 3JD1A 2I65A 1WDMA 3WBBA 3S8MA 4G2NA 1A27A 1BGVA 5FWNA 4BKOA 2GERA 3B20A 4EW6A 1Y8QB 1ZUD1 1YVEI 4XYGA 4J7XA 4TQGA 3DBRB 3K30A 1PZHA 2EHDA 1NFRA 4ALMA 5IN5A 3PJDA 4TKMA 4E33A 3A28A 3T7CA 2IZ0A 3RQSA 1JKJA 1LRLA 1SB9A 1QP8A 1KVTA 2POQX 3HN2A 4J1NA 4NFSA 4TWRA 3OMLA 2X9GA 4J90A 3RC9A 5HS4A 1BXGB 5B1YA 4CUKA
chains in the Genus database with same CATH superfamily
4E5PA 3FHCB 4R9NA 3I39X 3VTKA 4EG3A 2DZDA 4YN3A 2QTHA 3HKCB 1WUJS 1X70A 2NV6A 2IQ5A 2GM9A 3N0XA 4XR9A 1JWLA 4OQZA 1GXSB 3BXHA 3FPAA 1PVOA 3N07A 2NSYA 2PSJA 2W58A 3RASA 2VZ0A 3WKEA 2GKOA 1JYSA 4EELA 1VL2A 2QXTA 1GSOA 2VDLB 3EGVA 3MWEB 4HH1A 1N2OA 5IN4A 2Q1SA 3BF7A 3G2IA 2LVBA 5ISMA 3WY9A 4N0EA 3TQQA 4XLLA 5IVKA 2QRUA 2ZJFA 3ZCQA 4C04A 2GB4A 5GM2A 1W30A 1Z3CA 2Q5FA 4QU8A 5ARDA 4D6XA 4RKEA 5CIYA 4QM6A 4P35A 2VQSA 3FRJA 3NYQA 1UAAA 1EGVB 4U63A 1QPZA 1PZXA 3L79A 1OXUA 4D25A 3OCWA 3UC5A 4GOMD 3ZX4A 1ABBA 5B4VA 1NF9A 2QPTA 1I3CA 2CJFA 4A0FA 2DTDA 1PW7A 4EARA 3LX8A 5D7BA 5CLFA 3BMCA 1AKMA 3K1YA 1GKLA 3G8DA 2J9FB 5I4BA 2O2HA 2O5EA 2VWHA 1PQPA 5C34B 4YDSA 2ID7A 2BFNA 3U3MA 5KCZA 2PLFA 4EKYA 1KSFX 2QW0X 4CEHA 2VK4A 4JJEA 3WLNA 5JALA 2A88A 2B6HA 2AUTA 4JJ8A 3OBBA 5JDCA 3EIHA 3T35A 1OFTA 2D7JA 2PKEA 3H83A 4F9EA 2P90A 4YFVA 1KGSA 2F62A 1F7VA 2C1ZA 4TTPA 1G21A 2E85A 1I2AA 4NYIR 1DAEA 1JA0A 5T3UA 5HM6A 4LGYA 4DV2B 4B6RA 3WB1A 3N2GB 4EYSA 2HW8A 2OCAA 3JVEA 4ZGBA 1GZ4A 1S5PA 1WVIA 1D2CA 3AF5A 3H18A 1A95A 5IDYA 5SZHB 3TH5A 3X1YA 1IU9A 4D82A 5KOJB 2F64A 1XZKA 2A59A 4YPFA 2IYLD 4RCYA 1TIBA 3NATA 5CLQA 4UCXA 2YQ5A 4QFDA 2PKWA 4BBAA 4OYYA 3PUIA 4RH1A 3CA8A 5EFZA 2GN9A 1AS3A 1QHGA 2O06A 3B89A 4EITA 2EDAA 2XUDA 4WT7A 1K08A 4CKZA 2OP0A 1EVZA 3ZGZA 3O31A 5J2UB 1GPUA 2C2OA 5AWFC 1X1TA 1NATA 4EB6B 4Y18A 4HVCA 3GGDA 1VJGA 3OJEA 4RIEA 4BU1A 3KJFA 1A5BB 1C9MA 3R0IA 1IY0A 1G63A 3KLBA 3A25A 3GBSA 1N0UA 1T8RA 4RE6A 1JI0A 3TFQA 1PSZA 4O33A 4MO9A 1N77A 3U31A 4J29A 1Z6TA 1E1QA 3NH6A 2FPPB 4NCBA 2F8SA 2AFVA 2ZUDA 5KYUB 2NZ2A 3SD7A 4U3JB 2J67A 2O5VA 1Z0JA 3LTEA 1EFRD 4OI2A 3RYHB 6NULA 1B0PA 2PL1A 3M6AA 5IH7A 1KEVA 2DQSA 5LP6A 1E4EB 4KO3S 1YI8A 4DMCA 4ZN6A 1C0LA 2CHEA 3JRWA 4Z0HO 2P9EA 2V55B 4G09A 3IRUA 3NDPA 1KMHA 2V03A 2LZ0A 5FWAA 4YCSA 2ARKA 4K6MA 4OHVA 3PX2A 1Q0ZA 5LOVB 4ND8A 2CLHB 4BO6A 2WIGA 3SSOA 3VO1A 2PYDA 1YZGA 3S27A 2QE7D 2JGLA 4LRSB 2XUJA 3L84A 2PRSA 2BFAA 1M0SA 2EWMA 2NGRA 4GZMA 1E3MA 1S96A 2DKNA 2PMFA 4D9IA 3EWAA 4Z7NB 5JAMA 4J7CA 3UJ8A 4B3RB 5DYTA 4UNQA 3MUFA 5E8JA 4Q9JA 3L6OO 1J0EA 5J1SB 1QFZA 4UBOA 5TQJA 4GXQA 1SPXA 4F5ZA 2QX6A 1L4UA 2PDAA 3R0VA 4RH0A 5EXSA 1ISRA 4JLNA 5E0OA 5K0SA 3S2ZA 3AEYA 4WCDA 4S1VA 3W8FA 2YNMD 3UWSA 4DNXA 4QZVA 4NAUA 3F5DA 1VG8A 3CZ9A 3SDZA 4LI3X 3TAUA 4DE5A 3DE2X 1UZMA 2WM9B 3GCZA 1E2FA 4ZKDA 4K1LA 1FMJA 4BX3A 1EH5A 5C1IA 1E3EA 4YX9A 1QYIA 2AG1A 4V1CI 2BKAA 3A37A 4RL6A 3S70A 2HT6A 1YQXA 1T3HA 4NAHA 4N65A 4K1XA 1E4YA 1UBMS 1VPLA 2Y9MB 1BXKA 3LT2A 3LGAA 3S5UA 3ZV4A 1VDMA 4MTCA 1M0TA 5AOBA 3ZZUA 4ISCA 1XD8A 3DE3X 4K6OA 2B1RA 3TFOA 2XQIA 1L3CA 1LVUA 5DSXA 4F4DA 4I50A 1MC4A 1SWVA 3AHIA 2EJWA 1VCHA 2IX9A 1CR1A 2PHZA 1Q19A 1IWBB 1WHSB 1T25A 2D2XA 5ITZA 2W6IA 2FH5B 3CGWA 3OFNA 4F46A 5MN6A 4QOJA 5J47A 3Q15C 4PAWA 3JQ8B 3MWEA 4HZGA 3UBTA 2VAVA 1WCV1 2FG6C 1ZAKA 2KX7A 4M98A 5J4LA 4LHZA 5C53B 4JBWA 4BB9A 3ZY3A 1GZDA 3LT1A 4YMHA 4PYRA 4HUQA 1O1YA 4MW9A 3E7PA 5LYJA 1I5EA 2VYVA 1K97A 4DPLA 5AM3A 1IDN1 1LF0A 1UUFA 5C8DA 2P91A 2RAUA 2J09A 3C14C 2G36A 3FYUB 1PWXA 3L4JA 3IUPA 4R41A 4DQVA 2BR3A 2FSUA 5EZQA 1WIWA 4CMJA 2G1JA 5EKDA 4O5OA 1MO2A 3IUQA 4RGYA 5A6VA 3ORSA 4YHHB 2GZHA 2ISCA 1RHRA 1Y1KE 5AHKA 2PO7A 2V9PA 4F9GA 3OZSA 1OV4A 2PH7A 2ZIAA 5KYYB 4LX0A 4N3NA 3MZ0A 4HDKB 1U2QA 1Q50A 1GARA 2I7DA 3B2QA 4L4XA 1XX6A 1E99A 1VLQA 3SI7A 2VJYA 3KR9A 4G8CA 4MUHA 2HDHA 1QP7A 5CNKA 1I94B 4CJXA 4GVLA 1AKYA 1S3FA 4TLLB 3KCQA 3C39A 4BVJA 4MQEB 1SCKA 1AUOA 4NE7A 1DJNA 1BS1A 1GCUA 4ZP1A 1H05A 1HBJA 3KFXA 1SUWA 2X9QA 3RWBA 1IZYA 2IHTA 4WJLA 2H16A 4DIDA 4NK5A 1SO8A 4AFNA 2AI3A 2CD9A 3NEPX 3MFQA 1G4UR 1LQ2A 1ZIDA 3BCUA 3IO3A 2QJRA 4RKWA 4BNVA 1AHHA 3I58A 4AY3A 3AVPA 3GLRA 5EPUA 5E3HA 4HWSA 1YR3A 4OA5A 1U9YA 5GADl 1T4CA 2BTEA 4BUCA 2C5GA 4N5MA 1JQAA 3ZZMA 3AZOA 1G17A 4IGEA 4L1KA 1N1MA 4MR7A 2NM0A 2O3RA 3QA9A 5K4GA 1EUDA 1HNNA 4FR0A 4X20B 1CR2A 1T2AA 2W2PA 3IEXA 1WV0A 2QJFA 3PITA 2ZOSA 1VA4A 4LRYA 4IDCA 2FPXA 1TO6A 2YVLA 4F9TA 5ABPA 2X4LA 4Q9KA 4ZO9A 3MGGA 4POOA 5A4DA 1B2RA 2WU1A 1N6LA 1XJ5A 4EOGA 3PQ3A 5MF6A 2ZPUA 3HU3A 4B3HA 2CV0A 4ENRA 5CCBA 1I5OA 2ZRNA 4UTRA 5ILQA 1WUIS 2NVBA 4OK6A 1P1JA 3L0BA 3K96A 4ZDJA 3UMSA 4E09A 1I30A 2MSLA 2P30A 4PPQA 2P35A 4HXYA 4UEJA 3KHUA 2XCSB 1TU4A 1XMVA 2D5IA 3L7DA 1WV1A 2KW5A 4UQPA 2QZPA 1Z26A 2AZXA 2MCFA 3TUZC 1A77A 4TSRA 3GJ8A 1MGOA 1QVRA 4JK3A 3EW7A 4HQKA 3UK1A 5IZ4A 3RIGA 1SZPA 2Q2WA 1J1IA 4ZT2A 3TRJA 4IRUB 3OZIA 4AJKA 5LQKA 3Q9NA 3EAFA 4FZVA 3UT5A 1NBHA 1GPNA 1AB5A 4ZAFA 4A8JC 4MV7A 1F7UA 3HLKA 4O08A 1UMCA 2ZSJA 4IGKA 3DAFA 4INOA 1AXEA 3K72B 3NFYA 3GRKA 4QYIA 1ISIA 2ZLBA 1RM0A 4S1NA 1BCRB 4JCCA 1B73A 4FEEA 3ECCA 2H9IA 1MZVA 3Q7RA 3KYCB 5GONA 2H06A 3QBTA 5DE3A 2P68A 3KR1A 5CAEA 2I80A 3NKLA 4JI8B 3R6GA 4YQFA 2Q99A 1QYRA 2WHPB 4PLTA 1CTQA 2UV8A 3I76A 4MRAA 1TIPA 3H16A 4IIFA 1IE3A 1CZOA 2L17A 3C5VA 3ZR4B 4CI0B 1Z5GA 1DG1G 2OC9A 1MJGA 4OGKA 5D6NA 5A9SB 1DIOB 5DX0A 3WA6A 4AKGA 1XB2A 2BJHA 1I4OA 2ID4A 2SICE 2GGSA 5CIQA 1ZJ6A 1Z6AA 3G6WA 2I6QA 4G5HA 4PEVA 1DAFA 4KITB 3QY9A 1TT7A 2ZIFA 3CF2A 2R62A 5CH3A 2XYGA 2MR5A 5DHUA 1FTGA 1PKXA 1ZK2A 2GBCA 2VTBA 1X42A 4Z4HA 4C0KA 2O8NA 3M6MD 5SZJA 2X2EA 2FB9A 3O21A 5JCJD 3LHFA 4R6WA 4KN5A 3NP9A 3HKEB 3SU8A 1C4WA 1PGOA 2BI4A 3R41A 3Q87B 5NLLA 4AMBA 4KO8A 2BEVA 4P4SA 3WJAA 2W48A 4EQ6B 4J94A 1OXTA 3FDJA 1OROA 5EE0A 5IWAB 2WKSA 1SNYA 4HTFB 1CRZA 1X87A 5JHGB 4DUZB 2GCOA 1NBWB 3ELBA 3FWNA 5B30A 2P9ZA 1W0JD 5LR6A 3AIOA 3C4QA 4CHGA 4AZ3A 1TCCA 1DAKA 1XD2A 4MINA 3B78A 2ZIGA 1LI4A 3QWHA 3IMEA 2XTAA 5DP1A 1ULBA 5FWXB 1HDZA 1SXJE 1KKLA 5J9FA 1JKXA 1H65A 4B3IA 2FVYA 1FB5A 3DE1X 3ETLA 4J3FA 3RVJA 4WY5A 1P73A 4KX3A 4AG6A 1AGXA 3ETGA 2JLRA 1SBHA 3ZXIA 1JWAB 1YZTA 1MX5A 1WAMA 4XGIA 2MSEB 2P3LA 1SU7A 2AMFA 4JWTA 5CLIA 3V48A 3ROEA 4J6EA 5JMWA 4L07A 5DZSA 1QONA 2EFGA 1NQTA 5CA0F 5I4KA 2RH5A 3DPSA 2GTIA 1GPBA 3LDHA 2OGTA 3Q0IA 1K68A 1W6RA 2G63A 3SC2B 1U81A 2B92A 4RETA 1N5IA 1XU9A 1GFZA 1KFKB 4CODB 3V7YA 2CV2A 4EJ0A 3CRW1 5FO0A 2X8WA 1B3BA 1E3TA 4MV8A 3PYMA 1FVOA 3AERB 3QX7A 2HN9A 3O9MA 2C4HA 2JFUA 3RREA 4Q4CA 2H85A 4HQLA 4S2EA 3QIVA 4PYMA 4WFKA 1FLAA 2IHZA 3RAPR 4D81A 4UD2A 4CQMD 1YULA 5DBFA 1P3Y1 4UPDA 4MVWA 2XOEA 1ISJA 1FMTA 2WFAA 4JN6B 2I6GA 1L4LA 1XMJA 4JYAB 1I7QB 4M0KA 3KJEA 3UMCA 4DAEA 1UBUS 2QU7A 3QF7A 4ML3A 2GD6A 2BM0A 1ZLYA 1JA1A 4CF4A 2ZJ7A 1RQLA 3N59A 2RC6A 1U3UA 2GWHA 5ALFA 1DKOA 4OHXA 3DVQX 3DYVA 1P72A 5DT9A 1ZO8A 1II8B 3QYJA 4MLZA 1X9HA 3EA0A 2QSZA 3QG1A 4I8XA 4FWBA 2G8LA 3LFHA 5E4TA 3AF6A 1TM5E 3W77A 3V00A 3F9IA 3OFJA 5CVTA 4ZZ0A 1QO0A 1XDWA 2AG8A 2HADA 2A0KA 4OSOA 1VKJA 2DPHA 2RE8A 2BL4A 4PGGA 3RU7A 1L4KA 1NJ8A 2WJPA 2YVUA 3BJIC 1TLLA 2DBQA 2VSFA 1TQ4A 1YU6A 1SVWA 1F20A 2DWOA 1UT8A 1DC7A 2GLUA 1QV7A 2XMCA 4RY2A 4WSOA 4WXRA 1G4HA 5EEHA 5K2MA 5BNWA 2CJWA 1QR2A 3M5WA 3OUUA 4XW2A 2YZGA 4EGSA 4DDKA 4U7HA 1GTJ1 2ZE6A 3GFQA 1DBRA 1A8HA 2QI9C 4YCCA 2GFIA 1TKRA 2CGEA 4LXHA 4ICIA 3ILVA 1ZMTA 1SXPA 1EUDB 1XCJA 3L77A 1R15A 3DAGA 4NDAA 1DOAA 4PNEA 4PU0A 4CWAA 1KRHA 2FQQA 2IDMA 3UWDA 3DDZX 4PCLA 1T1SA 1GAJA 2VRNA 5C3MA 5HFNA 3T7SA 4MITA 3DHYA 4C7OB 1YRAA 4RIGA 4CKWB 2P2GA 5D3MA 2FSHA 1XLVA 2P0YA 3ANXA 4WAUA 2IS1A 4YMIA 4GZ5A 1Z06A 1E32A 2XT9A 1CZRA 1BCRA 2H5JA 3PQ5A 1LFDB 1JJBA 4QYTA 2GJ9A 2PS9A 3QEMB 1MB0A 2YKGA 2PWBA 3IKMB 3LUFA 1PK9A 3C24A 4BX0A 5CK5A 3WIDA 4I8IA 3I53A 4ZT5A 5ITWA 4WV3A 5KVSA 1Y5LA 5H1YA 4YNBA 3SR4A 1UJBA 4B32A 1VOTA 3DT6A 2EAUA 2XAAA 1DX6A 5B5SA 4HNRA 2NZVG 4K2HA 5CA0B 3ZTYA 1SEPA 1UMDB 1XQYA 2BEWB 5DK4A 3QKUA 1ETHA 4BP3A 3IAS6 2R85A 3AONB 5DBIA 4GXNA 3WRXC 2FKNA 4A36A 5LNK6 4JI2B 1M2OA 1EBFA 1LI7A 3UHAA 1NNLA 3Q9SA 4HDKA 1QKJA 3DFZA 3MYYA 4LY3A 1UFOA 1D2AA 2C4UA 3IE2A 1WZ2A 3UFXA 3CNEA 4FGLA 4HXFB 3E2PA 5F3WB 3VSDA 3IRVA 3RRYA 4MQ4A 3F6BX 4GX2A 2W2XA 5CVVA 2FMUA 2WY2D 3HA7A 1LEHA 4U2BA 8ATCA 4PVCA 3I64A 1UP7A 3OPXA 4C0BA 2BTQB 3TEJA 2GH1A 1XPOA 2QW8A 3DE0X 1N9KA 1YDFA 1ZMRA 3D7MA 1GAXA 3N75A 4QGGA 2UYCA 2JCXA 4X8MA 4GM1A 1LK0A 4HQRA 3ASYA 3R7FA 4ZQCB 1N1GA 3LUAA 2HA4A 4C22A 1DX9A 2BFDA 4N7BA 3OT4A 1H2YA 1MB9A 1YBAA 3RIMA 2YZKA 3BHMA 4A10A 5SY9A 1EFPB 1KYWA 5AUOB 2N1MA 5J40A 1LX6A 2WG1A 3H9QA 5IF3A 4ZWNA 2O2DA 4EHFA 3QMVA 4L76A 2B1JA 3CGGA 2R68A 1GDDA 4KZPA 1U94A 5C8YB 1Q0QA 1XN1A 1JG7A 5BY2A 1LRJA 3GEGA 3JRNA 4CLOA 1LPPA 1T2NA 5K8VA 4Q00A 3HUDA 2Q7OE 4XUDA 4EHBA 3P9YA 1LF5A 5KAPA 1P9RA 2HLPA 1EFTA 4W5WA 1S2MA 1GL7A 4LZNA 4OI0A 3QPUA 1OSNA 4MS3B 3E2MA 4JR0A 4UJ3A 4EQ6A 2ZRGA 2XWQA 2Q27A 1YCGA 2AD5A 3EODA 3W1WA 4UU8A 1ZNQO 2PH5A 5A02A 4YAJA 3HSYA 1TCUA 4XGKA 2N47A 621PA 4WNAA 2GEKA 1AHPA 2YHIA 5KU7A 2JD2A 3GUUA 3IQXA 4BFWA 2R2AA 5AW0A 2GBPA 3RFVA 3GMTA 2IEAA 3F3KA 5TNXA 3KOYA 2CMHA 1ZRSA 3TCNA 4D0GA 1ZESA 3LW7A 3VYRB 2X3YA 2BGRA 2ZANA 4UNIA 1LBSA 3ZIUA 5F64A 1I3OA 1WRBA 3AFGA 3WJ7A 4EGJA 5B6IA 2YYAA 5JNLA 3M9LA 4BEBA 2RC5A 3CVYA 4DV7B 1QZZA 1YSCA 1SEVA 3LI2A 1TDJA 1GD1O 2C00A 2R8YA 1O9BA 4P08A 1T6YA 3O3OB 1B16A 2AXNA 4I9GA 3ROTA 3ML1A 5T6MA 4NPCA 4QXOA 6REQB 4D42A 1NVVQ 1OI7A 2XDAA 1N5DA 4IHQA 3JD3A 1I01A 1WW2A 2ZI7A 4PBSA 3FFAA 2O0LA 2W6OA 3OWOA 4PLGA 4EKIA 3SQXA 2DQYA 3G88A 1KGDA 1U1DA 2G4CA 3H2YA 4I1UA 4IGAA 3C7TA 4JXJA 4KO1S 2XKBA 4XZ3A 4IF6A 3HZRA 1NN1A 4NFHA 5BUSA 2XNKA 4OHKA 1LV8A 3DJFA 4HMPA 3VBEA 2OCYC 3N2LA 4R71A 5C1BA 4EFLA 4I1OA 2HRDA 5K6AC 3CB4A 4Q21A 2I29A 5LPNA 1N92A 3EBPA 2IW1A 4JZYA 1PO7A 1TQHA 2F9MA 4Q0MA 2FRXA 2ONCA 2PFGA 4UDYX 3EXAA 3ZQKA 3T34A 3SF8A 5L4NA 5IS2A 2C4WA 5AUPB 3KYDA 1AGYA 2GSWA 3RUCA 4HWTA 4CEIB 4HVLA 1K5PA 1NLMA 1QH0A 1Y1LA 3KT8A 4DNFA 3ELYA 3TI7A 3O0TA 3SHOA 4Q9AA 2DERA 2HSWA 2G0NA 3KQOA 2D2VA 4BNDA 4GOLD 2VRWA 2P9CA 1J2RA 2DHQA 4Y2JA 3ITNA 1WCXA 3VR4H 1KYTA 3GLUA 3N05A 3EFEA 1J9EA 4HYYA 5HTKA 1U7XA 3HWRA 2IH4A 3SEQA 5SY4A 5ESDA 1PLJA 3H9CA 3ZCRA 4RENA 5BQ5A 5A5FA 4V03A 2BGTA 4M8NE 5FI0B 4M0FA 4BNMA 1NLYA 4QJ5A 3TAXA 2Q46A 1Z4IA 2P4QA 2PRJA 1G8MA 4C21A 4MH0R 4WLVA 1XRSB 3RVQA 2PSSA 1VG0B 3PDCA 4UHJA 1Z13A 6LDHA 3RHZA 4DR4B 4GL2A 4IDEA 1UT5A 3DV2A 3FCEA 4FZJA 5PGMA 4C1NA 3BAZA 3DT8A 3EWNA 4E2FA 2IEYA 2RHGB 3NASA 1QS0A 1KK3A 2OORC 5TT1A 1GAQA 2C9YA 1XEXA 3IULA 4J75A 4UAVA 1EQAA 3PB3A 1TK2A 4LJLA 2AEEA 3HGQA 4WZBE 4DV6B 3SP1A 5FTWA 2VQ3A 3GHYA 3U16A 2EL9A 5LNK1 5FOUA 3DQZA 4HR7A 2XA1A 4BGUA 2W6JD 4Z7JA 1TYAE 5JSQA 1EGQA 3N70A 4Q1AA 3W1VA 4FBGA 5B12A 1LDBA 3GJSA 1G3IA 1W5BA 2MYTA 3H6KA 4JC0A 1FSGA 2JH8A 1TZCA 4QFBA 4KX5A 3VSBA 4B48A 2H2GA 1WXDA 1XK7A 3DKVA 3BJMA 1O54A 1PNTA 4QTYA 4CLRA 5JSHA 3OC0A 2IZOA 2R84A 5G0TA 5BSFA 4AXXA 3CWCA 3KKKA 2XXBA 4MUEA 4QUIA 2X1MA 4EUKA 3EE6A 1QYWA 1BO6A 2NU7B 3FUCA 3EUEA 3KJNA 5CH8A 1SVUA 1HQDA 1M6NA 2C2MA 2F67A 1CHNA 1P8AA 2QAJA 4MV0A 4OM7A 2MYNA 4KR9A 4ZTUB 1PL7A 3RJMA 2VP5A 1MX3A 4RADA 3OTQA 1D2GA 4EEXA 1YWGO 1BE8A 1REQA 2QVLA 2ZJ6A 4UTOA 1PR5A 1PGQA 2CJXA 1CEQA 2R86A 4MK4A 1L5KA 3ZH9B 4R0VA 3HWSA 2ZIUB 2JL1A 1EWTA 1B6TA 1QH8A 3DZFA 1O6BA 2OBYA 1S1CA 1K5HA 2QKYA 3GEPA 4JHXA 3EAQA 3T7IA 3A4MA 3BB3A 4GKKB 4ETNA 2QVXX 2Z9CA 2ZRHA 3G8BA 4Z8XA 4E03A 5DT2A 5I01A 5BPFA 2FN7A 4H3SA 1QLJA 1IY8A 3PXCX 2OB1A 1SOWA 4ON9A 3SHFA 1UDRA 1Y1RA 4X8OA 4EVQA 4W5RA 3FVWA 2ZM6B 3E70C 3L92A 4LWPA 2OHOA 4WY2A 4N0PA 4ZCMA 4GR4A 3L5KA 3PC3A 1CR0A 2Y9PB 4MKGA 5KYUA 5JTUA 4ZJUA 2QMHA 2EBWA 3EPJA 2ACKA 1AGNA 3ABZA 2XUIA 3IBTA 4AX4A 1S2LA 1KIMA 2VJBA 4DV4B 3GWZA 1G1AA 4JC4A 4RSHA 1EGAA 2ACEA 2M2IA 5KQSA 5A3JA 3A2NA 5E4YA 3DD1A 4K46A 1DAPA 4BYGA 2NO7A 1PD0A 3KYCA 5GONB 5KUTA 3HBNA 3F73A 4UDNA 1E9BA 2H1VA 2IFTA 4H7IA 5F7OA 2X1LA 3MLBA 4PWZA 4ZO4A 4KE6A 1ZM7A 3T5CA 1QFJA 3PQEA 4W5TA 2ZYHA 3GD5A 2O7NA 1O96A 3BTUA 5CVCA 2F3UA 4UUNA 3T54A 3ENQA 4MUMA 3VYSB 2R6ZA 4GPAA 2YJ5A 4J07A 4HAWA 3KBBA 5B64A 1IQRA 3UY4A 4B2PA 2VHWA 3R24A 5BW8A 4LHSA 3CINA 3SZ3A 3RK1A 2WD9A 3JWHA 2WA2A 3L3BA 1VPVA 3HYLA 2O2XA 3GLIA 5GJCA 5D87A 1IZ8A 4RXTA 1AV7A 1U7TA 1UXHA 3W3AA 4QBHA 3TRIA 2YL2A 5SZIA 3JPWA 3GB9A 1SA0A 3A1NA 3LT4A 4GZ6A 5JV5A 3AEQA 3F6SA 5T3YA 4WOKA 3BS4A 1RP7A 4PSCA 2W22A 2XMGA 2I6TA 3JQFC 4Q05A 8MHTA 1GU1A 2QTMA 4CQJA 3KOWA 3NWEA 2DUNA 1SZCA 3ZE9A 3CW9A 5KHAA 1FUYB 5TF4A 3WRVA 4LRXA 2VL7A 4BO3A 2OAEA 2XD9A 1GJRA 2OSBA 4I2VA 4W6ZA 2XBUA 3OHSX 1Y6FA 1Y8ZA 2ODNA 2FUG6 5JNTA 3GFBA 4FLMA 1M9NA 3FZGA 2ZUUA 4GP6A 4A82A 3RSHA 1Y3AA 3UMVA 3O93A 4UULA 1OXVA 2FJUA 4HLNA 3EGDA 3FDFA 1OAOC 2HF9A 4RDCA 4FDLA 4TMKA 1KO5A 5KJCA 1NYQA 2H7VA 3DEJA 5CJ2A 3UJ3X 3PHJA 1E2KA 4A0HA 2XYHA 3JATB 3BUSA 4KHZA 3GEBA 1MQ9A 5K8UA 1N3BA 2EEZA 3GVIA 1L8AA 4Q4AB 4X45A 2XEXA 4BJ6A 2LPMA 5FA5A 1HMPA 1MGPA 3EEIA 4MWGA 3B3FA 5TQ0A 4Y3UA 4W9NA 1C3EA 1KC3A 2DP4E 2Q07A 3Q41A 4TYNA 1MR3F 1S8NA 1DBPA 3AI2A 3C43A 3K0AB 4OP2A 4W1RA 3R7SA 2I4RA 2UUCB 1KVUA 1FVFA 3DQQA 3HKEA 3QLVC 5J2UA 2FLVA 2ZRAA 3THYA 5CA0A 2IKQA 1J6UA 4Y0AA 1KJIA 4HAZA 1FEZA 3OE7D 1OUMA 3OOHA 5REQA 4AQ7A 1D1QA 2OLKA 2WWIA 2C96A 2CXXA 4ALJA 1LXCA 2CMGA 2I91A 2BCEA 2Q5JA 3TZLA 3KTAB 4AZSA 3UVEA 5HRUA 3I04A 5JJCA 1E9SA 2SKDA 4HDRB 3WDKA 4C6TA 1T1RA 1HYBA 2P2YA 1O08A 3K5PA 1MW8X 5KHLB 1OLSA 3BMOA 6ABPA 1GTVA 2F7SA 2JFBA 4G5XA 4GPBA 2HK7A 2VRBA 3DAOA 3F8TA 1ZRNA 2D0IA 3JD2A 4PPNA 3ZJUA 3M89A 4KIJA 2W83A 3LUDA 4ZQIA 1OWOA 3WAGA 2DPXA 4FMDF 2WP0A 2FR1A 3IT2A 4R1QA 3NGLA 3AFOA 4K0RA 1ULZA 2A94A 5GINE 3K6JA 1R88A 1VXOA 2ZT8A 3ZXXA 2C1EA 5JZSA 2AJLI 2HPZA 1UEIA 1A1VA 4FNAA 3EOAI 2Z2ZA 3IIEA 3C6MA 4WIAA 1UQTA 3ZE0B 5F9HA 4ZARA 5LQJA 2MTBA 4JB3A 4RQAA 1O94C 2P4HX 3QVVA 2HIHA 1R8YA 4CN9A 2PPLA 2F3PA 4J0CA 3UANA 2UUOA 2WZDA 3HMKA 4TXLA 1I9GA 1BTOA 1W88B 3WJ1A 1Z4PX 1XRQA 3NP7A 3ZD8A 4A3SA 1LJUA 4X3OA 2NO1A 5LZ8A 1SCAA 1S8OA 4EJSA 3GLHA 3HYTA 4RY0A 3SZRA 4F56A 3JWPA 3WI7A 4CM3A 4F2DA 3CLRD 5KBYA 3STYA 4E46A 3F49S 2QT1A 4IYRA 2JCGA 2R8EA 2RGGA 2BKXA 1HE4A 1Z7YA 1YIDA 3D8TA 1O8BA 1T5BA 4FP9A 4CL3A 3O83A 1AB6A 5K4AA 4CM9D 3PFFA 3OM9A 1QGED 1BGXT 3DB2A 3K9LA 4BAZA 4UUMA 5DN9A 5F98A 2HX1A 1SC4A 4G9EA 3C7AA 5ICSA 3LOQA 2HAEA 2CXNA 4N7MA 3K53A 1L7VC 3RBVA 4B3JA 2PXXA 4LZPA 3I0ZA 3TNJA 3UPTA 3F78A 3KKNA 1CEYA 4BJ1A 3TQTA 2RGEA 2O9JA 1PEAA 2B3DA 1CZLA 5THXA 2FCRA 3SJZA 1PIWA 2I5PO 4DLUA 4E6EA 1V6AA 3IAXA 1XDZA 2GHIA 1NDUA 1HQKA 2YWGA 1JBQA 2I4MA 4CIWA 5KDDA 3QKTA 2G9ZA 2YIMA 1SMKA 4QNNA 4WLOA 3UCFA 5F2NA 1JQ3A 1EP2B 1UPXA 3GZNA 4MR9A 5DBOA 1GNLA 3F5SA 1MH9A 4I1PA 4IDFA 4IILA 3PXAA 5LKAA 1ELOA 2IPOA 1U7HA 1C7ZA 3KB8A 1RC0A 2AYZA 2HPHA 3FYUC 3NBZC 3LSYA 1KC1A 3P8ZA 5AI6A 3O8QB 4NOMA 5HILA 1FY2A 2REOA 2AW3A 1QCZA 1O4WA 2VPWA 3KOMA 2GPAA 4IVQA 4MA5A 1H8ED 1O97C 1ZWKA 2MU1A 1OAOA 2ZATA 2ZVJA 1M2EA 4P36A 4UUAA 1I8TA 4XFDA 2J0VA 3RABA 3WJ2A 4Q3BA 4C0XA 4P81A 4N01A 4PG8A 2PGJA 2QAGB 5LQSA 3AUKA 1LS6A 1J23A 3D0RA 1ODTC 4ZOAA 3HVKA 1EX1A 4I46A 3WMEA 4B80A 2F43A 3ZDAA 5FORA 1OT5A 2YVAA 2QUAA 3QLUC 4FFLA 4RABA 5C9ZA 3ES9A 1QZUA 1RXCA 2H18A 2NSJA 2X2PA 3EVZA 4QVIA 2DOKA 1BMFD 1P0CA 2JZOA 1ZNXA 3Q3GE 4NMLA 2C8JA 1PYOA 1RZUA 1GPDG 1WSWA 3IV6A 1A7KA 1OKKD 2PGIA 1P2GA 1WSDA 1SCDA 5I7VA 3UJCA 1E63A 2E4UA 4LOHA 1JI3A 2A3NA 2JJ2D 1IH8A 5LA6F 4A91A 3TQHA 5KPJA 2DJIA 5H4GA 4KQ9A 4R0MA 4DREA 1QRAA 2FFBA 4L95C 4PG7A 4F8YA 5I9MA 2PXCA 4MB2A 4MR8A 1W46A 2FDXA 2HY7A 3R44A 4K3VA 4RPKA 2A2ZA 5DASA 1RXWA 1D2NA 4CHTA 1DADA 3WL7A 5A0TA 3IQIX 4ZVVA 3SYMA 2UZ3A 3OO1A 4A6XA 4X95A 4AWAA 4Q01A 2W70A 4JJGA 3VH4A 2EIHA 4EUEA 4ZI2A 4F4HA 5ITVA 1MA0A 1U0HC 4X24A 3DVAB 1RXEA 5CGZA 4D0LB 4QOFA 3ZVMA 1K9VF 3DZIA 3SC3A 2GF2A 3A1UA 4LYGA 4HDCA 1U5BA 3LNCA 3TJMA 2C88A 3ZY2A 3G9XA 1RLMA 4KR6A 4HQ0A 5KTPA 4XVUA 2OC4A 4KXLA 2V9CA 5EE3A 4DR7B 2AZTA 1X8JA 1TO2E 3TFWA 1FDTA 1OFUX 3HRHA 3S81A 3WOVA 4PICA 2WUDA 1LKZA 1YB2A 5JEEA 3W4IA 3E8MA 1YDEA 2GZRA 2HIMA 1FMCA 1Z33A 2VNIA 3G89A 3QLJA 2CXRA 2HK9A 4KPFC 1Z68A 3O0DA 2IHBA 2WF6A 4Z3KA 3Q7SA 2IVFA 2ZJ2A 4GPZA 1J7JA 3LLCA 4G0QA 1SAYA 1ZKMA 1G5FA 1TA9A 2C03A 3V8PA 1ZR2A 5EQDA 2O5RA 2PA0A 1NU6A 3H84A 4YREA 2R6HA 1AO3A 2UZ0A 3NHBA 2AYXA 4AJ4A 3R7NA 4DG8A 7REQA 2J3MA 1Q11A 3OEEA 1JFSA 4NPAA 1FVXA 1U0FA 1U0EA 2EYQA 3H05A 5JARA 1IHUA 1Q16A 1I7NA 4Y1GA 1KMCA 4AXBA 4OSEA 4QVKA 4YT2A 3NXKA 4YLYA 3K6RA 1PSWA 1FXWF 3HP7A 4G1UC 1E1NA 3D7NA 4LDNA 5EWMB 4CM8A 1CIVA 1XALA 5AP9A 2GEBA 3UWOA 2H0RA 4QU9A 3DWEX 1WJGA 1NC1A 1MB4A 4W4TA 2PRKA 2I3ZA 3D8BA 4H59A 2YJGA 1TAHA 4RDHA 5AJVB 1IOWA 5G0WA 1MHTA 1D1PA 4EMBA 4KGXA 3W9YA 2ZQYA 4MS4A 1NFQA 3P4XA 1G1MA 3UHPA 2ATXA 2K7ZA 4D4MA 4HRVA 4MI3A 4BGIA 1E7RA 1XTJA 3L1JA 3N58A 4DA8A 3A4VA 5F77A 3KZNA 3BMOB 3QG5A 5B58C 2P2SA 2E4AA 2XHEA 3TK1A 3N7AA 5EP3A 2JHAA 2HEGA 4CM9A 1MEJA 3NJ4A 4A2CA 1SBNE 1VIDA 4Q1CA 1SQ5A 1NBMA 3OLWA 1E5QA 4FKZA 4M86A 2WWRA 1QQAA 4C43A 2BT4A 3KYIB 5D85A 2R7KA 1JA9A 4AL4A 3IP5A 2HU2A 1JPUA 1P80A 1M6VA 1YR2A 3L1KA 3Q2OA 2Y92A 4LJSA 4N41A 2ZYIA 1Y42X 4FS3A 1GPMA 4WUVA 4C7MA 3N8HA 3CJRA 2WFZA 4UVDA 5A3RA 4Q9DA 5FKJA 3NW9A 2F3RA 3M6UA 5GGXA 3FWZA 1VM6A 1Y3IA 1KDTA 1QDUA 2ZWOA 1QHXA 2WPDD 4QDXA 2JFXA 5DSZA 5K3SA 5TQVA 2HXYA 5JQWA 3GVCA 3SLGA 1EK5A 5DGTA 2HI0A 3OZAA 3N7UA 4LPKA 2PJUA 4BDTA 2VH2A 3KUKA 1OYOA 4RD0A 3T3OA 3HH8A 2QL5A 1GITA 3VTFA 5LZ7A 4YECA 3FSRA 1S3SA 3C87A 5FEUA 4KWHA 4FYVA 4XWKA 4PCVA 5BV1A 4GXTA 1UM8A 4BUZA 2WG2A 5JBNA 4KXMA 2FPIB 3KXLA 4MQEA 2EARA 1Z6ZA 3PC8A 3WVNA 2PUFA 3OWHA 4L4YA 4NMWA 5BWBA 4H16A 1Y8RA 2WKPA 3A8TA 3P45A 5AKZA 4G81A 5IABA 4AU1A 3OMWA 4W99A 2H1WA 5AJUA 5AM2A 3FKQA 4V3BA 16PKA 5AI4A 2XVMA 3SHQA 1IN8A 3RR2A 4DA6A 2WJ3A 1FFWA 3CB2A 1DJQA 3K31A 3RAJA 1A88A 1NHWA 3GUYA 4BE9A 1N32B 4WINA 1K4MA 4WRRA 1SVSA 5FQNA 1VJ5A 2XT6A 2HWWA 1QHSA 2QRGA 2WFLB 5CRIA 3IUBA 5KIAA 4M21A 2DWQA 4MV6A 1KE2A 3FCCA 1YJAA 1G8KA 3GY0A 1T5LA 2O6LA 2X6RA 3I6MA 1JFTA 1FDUA 4UMDA 1T4BA 1A8UA 3CKKA 1GR0A 2H65A 3A1EA 1P2TA 4G65A 2R6JA 3AEQB 3BWDD 4X6XA 1HEYA 3ENNA 4CKBB 4RTNA 1JB9A 2DH5A 1S2IA 5CJPA 5IJ0B 1GTRA 1J0XO 1Q1ZA 2BMVA 2AF3C 2YRXA 3K2EA 4H0CA 1UR5A 3TNYA 3VNQA 5KNDD 5LWHA 3LWZA 1USKA 4BRWA 2VF5X 2ZYWX 3G2MA 5JS1A 3H11A 2OD2A 1E9CA 2HCFA 3LK6A 4DJFC 1Q3TA 1IHPA 3T3NA 5F9FA 2FFQA 2QTAA 5CB0A 3ZIAA 1G3RA 1M1YA 3DOUA 3PPVA 5IBQA 2UYYA 4HNSA 5ED0A 2B82A 3NBMA 1DINA 1S2NA 1H2WA 5JCPA 5DISB 1FBNA 1MC8A 1RU3A 4AJEA 5A06A 2IP1A 4C6SA 3HM2A 2C2WA 4WX2B 4M99A 3VKVA 2FKAA 3ZYZA 1FP4B 1R4NA 2WDPA 3LYAA 3VHRA 4HVAA 5DTMA 3WFZA 3VPAA 2W2TA 3QMMA 1YZUA 3IHKA 3M5PA 4X1IB 3UAWA 2RK4A 3EPRA 3I2KA 4YRDA 1JNYA 3IMCA 3KKQA 1VG1A 4DCGA 1XDBA 3C1OA 3LZCA 4UFOA 2NUAA 4XTRA 1EDDA 1Q22A 4RQTA 4ZOQI 3JQRA 4JFAA 4UBNA 3U1BA 1J1UA 3A6ZA 1JHXA 4M9XA 3W5JA 4ZPJA 2ODAA 2W6ZA 1XF9A 2XVZA 5DYIA 1ZEMA 3RC1A 1RTTA 5B2ZA 2WIDA 5A0FA 3HA2A 2AR0A 1E2JA 3NUGA 2JGKA 2Z2XA 4C6TB 1YVUA 3OZXA 1T3ZA 2H92A 2C84A 3AJAA 4CFYA 1M8JA 1XF1A 3TUIC 3UWPA 3V55A 4BN5A 2VF4X 3LFTA 3PPYA 4N0MA 4AJIA 2O0MA 4BOYA 2VR1A 1KMNA 1HO3A 3D4OA 4UVIA 2HJVA 1K8XB 2B9EA 4QODA 2AWNA 2QN8A 5JYDA 3CZ5A 1C2YA 3GBPA 4HFRA 1FTNA 1XNJA 1W581 4TOIA 2V4UA 2Y77A 2QR5A 3C3JA 3VPFA 1B8PA 2X5XA 1URPA 5FFNA 3HLYA 1L8XA 5LOVA 3AETA 4D5EA 1M2FA 2A5FA 3O8OA 3D6UA 1M34B 3M82A 4GGPA 4PLVA 5AFSA 1G18A 3JQ8A 4OQMA 2UUBB 4US2R 1I2CA 1V3UA 2CJWB 2TSYB 1N6HA 1GUZA 2G0TA 1ZNZA 3I30X 1OBHA 3DFKA 2ZTHA 3OPMA 4UE3S 1B00A 1I33A 3EH1A 2ODEA 1L9XA 2Y1CA 4RVUA 4TYQA 4YT5A 3U48A 5TGTA 4E3ZA 4DNPA 4ECAA 4S0XA 1SC3A 3MB5A 4ALLA 5IUNC 3EXEB 4CIAA 3CPJB 1EXWA 3B3QA 3C2QA 4A5SA 3Q3HA 2XXJA 3U62A 1YL5A 2P2NA 5D5QA 2AFRA 5L95A 1R16A 1XRMA 3CURA 1P7YA 3JX9A 1EB8A 2CYBA 1GG2A 2IYOA 4NYJR 1AO0A 4MO2A 4MVJG 3SVZA 1W6UA 2K5UA 2FN3A 4LSMA 4A0GA 4ZFNA 4CIDA 4OB8A 3AB8A 4MCJA 3VR3A 3BD7A 1BXRB 2X40A 3MT9A