2Z22A

Crystal structure of phosphate preplasmic binding protein psts from yersinia pestis
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
321
structure length
321
Chain Sequence
EASLTGAGATFPAPVYAKWADSYQKETGNKINYQGIGSSGGVKQIIANTVDFGASDAPLTDEKLATEGLFQFPTVIGGVVLAVNIPGIKSGELTLDGKTLGDIYLGTVKKWNDPAIVKLNPGVKLPDQNIAVVRRADGSGTSFVFTSYLAKVNAEWKEKVGAGSTVNWPTGLGGKGNDGIAAFVQRLPGSIGYVEYAYAKQNNLAYTKLISADGKPVSPTEHSFSSAAKGVDWSKSFAQDLTNQKGDDVWPITSTTFILVHKEQKNAANGTEVLKFFDWGYTHGAKQANELDYATLPAEVVEQVRAAWKTQIKDSSGKPIF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Periplasmic phosphate-binding protein
publication title Structures of OppA and PstS from Yersinia pestis indicate variability of interactions with transmembrane domains.
pubmed doi rcsb
source organism Yersinia pestis
molecule tags Transport protein,immune system
total genus 108
structure length 321
sequence length 321
chains with identical sequence X
ec nomenclature
pdb deposition date 2007-05-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2z22A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2z22A02
1EZ9A 4I62A 3QYTA 2XXYA 1QKAA 1JNFA 1ZU0A 4F3BA 5DYHA 4F3SA 3FD3A 2H4IA 5AA2D 3IOUA 4IO6A 2IEEA 2GHBA 1BKAA 1KWHA 4G8MA 1ZJLA 2XX7A 1B5IA 4H67A 2PT1A 3MPKA 3MQ9A 1FTJA 5CBSA 1B1HA 1CE2A 3TFLA 1NNPA 4QFLA 4KQPA 4YICA 4PFYA 2AL5A 2BJJX 4GRKA 3G3JA 4DLDA 4KD5A 3LSLA 1IEJA 4LUBA 4ELOA 3VVFA 3MP6A 1LAHE 4YB5A 3VV5A 3KEIA 3BFTA 4ZEBA 3TMGA 1TWYA 3TEPA 3A3CA 4K3FA 1I6QA 3SERA 3TDJA 5AA2A 4UACA 4KYDA 2XXIA 4POWA 1MY4A 2AL4A 3S9MC 4ZDMA 3OSQA 3KN7A 2DE4A 2DVCA 4G2ZA 5CMKA 1QKBA 5ISUA 2A5SA 4GXSB 2RINA 2X26A 1MQHA 1TT1A 4PFWA 1Y9UA 1LAXA 1MQDA 1B05A 3EHTA 2HXWA 3VDFA 2I6EA 3O6IA 5CM6A 2GH9A 4G4PA 1PB8A 2Z22A 4P0GA 3C34A 3QXMA 1T0KA 1ZLQA 5JEIA 4FAJA 3EPEA 4AB5A 4H1XA 3MP8A 1PB7A 3CFZA 3E9XA 4OQOA 3TTRA 3C4MA 5I2KA 1O64A 3FVOA 4O3AA 2CMOA 3VXBA 3ZSFA 3OSRA 4NF4B 3TKDA 4ZECA 3LC8A 2P1SA 4DXCA 5AA1A 3M3FA 5I57B 5F7VA 1VR5A 1TFAA 1B40A 1IZ1A 5DT6A 4R75A 1MXUA 1SVXB 3CSBA 2F78A 3FXUA 2H5YA 3KJ7A 1A54A 4I8CA 1B7UA 4F39A 2R9JA 1H76A 1TXFA 2FA7A 3LR1A 3OELA 4JBZA 3QUFA 2RCBA 1UTHA 3H03A 1MQGA 1MPCA 4YAHX 4F1VA 4BDNA 4EQ7A 3ILUB 2YLNA 3N6UA 4ZE8A 3C35A 3V8XB 3HCQA 2DWIA 4MF3A 2Y7KA 3K1MA 3TELA 4NF5A 4Q0CA 4GVOA 1IUDA 3KN3A 1II5A 1LFGA 1MM6A 4GLIA 3S9LC 3D4CA 4HCYA 1JEUA 4EXLA 1SW2A 3FVKA 3N26A 3K02A 3IB0A 4DXUA 1USYE 3C32A 1MRPA 4AB6A 1LSTA 3RPWA 1B1XA 5HM4B 4ZE9A 4F3PA 1MPBA 4L17A 4POXA 4FE8A 3DP8A 5FHMA 1NFTA 1R1NA 4XKRA 3T9XB 1B51A 4PE5B 5KDTB 4FATA 1LFIA 5ICQA 5L9SA 1M5DA 1ATGA 4R6HA 3O28A 3KSXA 3LSXA 2HZKA 4XIGQ 4G77A 2A5TA 4NF6B 2O69A 4KPTA 3VLWA 2ZMBA 4YMAA 3EF7A 4U1OA 2ALUA 5H8FA 1M5EA 4U2RA 3TZAA 5IAIA 2B3FA 4JWOA 1UIVA 4OMBA 5L9MA 3Q28A 1N0TA 4G68A 3USDA 5I58B 5AA4B 5L9OA 1B5HA 1QUIA 3Q29A 5I2NB 2O1MA 1IITA 4LA9A 4KYSA 4Z0IA 1AOVA 2DWJA 3BFUA 5DVFA 4HTGA 2OWTA 1NL5A 4M4GA 2Q2AA 5FTIA 1JW4A 4GXAA 3O6HA 1ZKBA 3SEYA 3KBRA 2OK2A 4F18A 4IO2A 1XVXA 4FECA 2ZYMA 4H8JA 4NF8B 3F11A 4KCDA 3O6GA 3T96B 2QMXA 3ZKKA 2F7BA 1B7HA 1VFEA 1MQJA 1D9YA 5BUUA 2DP8A 2YJPA 2GFEA 1B3LA 2ZYOA 5H8NA 5JTYA 1UTBA 4QSEA 4YKIA 1OLAA 1PB9A 3CIJA 3WAFA 1FCKA 3MJNA 4EXKA 3W9WA 4FEDA 2HZLA 1HSEA 1S7YA 2NVUB 2ONSA 3PGFA 1MS7A 2H98A 4I9DA 4IY6A 5J1DA 3TTLA 2XXHA 3K01A 2O6AA 1P1NA 4JSDA 3IB1A 1SI0A 1FTKA 4EQBA 1B4ZA 1XOCA 4KCCA 4F22A 1A40A 3VLVA 3QAXA 2Y7RA 5DVIA 1B6HA 1OQGA 3T9HB 3TTNA 4ZEFA 2O51A 3THIA 3HHFA 1EH3A 4OFLA 1Q1KA 2O1LA 3EHUA 4KYEA 2HQ0A 4F2OA 1WDNA 1OMPA 2UVIA 1I6BA 2V3QA 3TQLA 1P1QA 3FZVA 3H6UA 1A8FA 2QS4A 1ZIUA 2PBWA 3PMVA 3U94A 5DVJA 1FQFA 3CI8A 4MFIA 5H8QA 2QL3A 4RY1A 5ITOA 2I3WA 1URGA 2G29A 4FIMA 4ECFA 1A8EA 5M2VA 3TTKA 4JWYA 1DSNA 2NXOA 4R6KA 4F3GA 1R9LA 1O7TA 1ZMGA 5A5XA 4QFPA 3VE1B 1XT8A 3H06B 5DTBA 2G93A 1UIUA 2PX1A 2Z8DA 4TQUQ 3UORA 1FTLA 1Y3QA 3WAEA 5K2YA 3IO4A 1Y3PA 2I58A 1RKMA 4QHQA 4DXBA 5DEXB 3HV1A 3IOTA 4QFNA 1ZBMA 4RYAA 4LZ5A 3A3UA 3DELB 4RJZA 1A99A 4MH5A 4ONYA 1MXXA 2DYXA 5CBRA 4C0RA 2O68A 3MUQA 3V89B 3S9NC 3QIMA 2NUVA 1Y1ZA 2F6GA 3SEXA 1IXGA 1LCTA 4JDFA 1NNKA 2F8DA 4QSCA 2OLBA 2Q8JA 3UP9A 5KCJA 1UTHB 1MY2A 2Z23A 3FXRA 3CG3A 3M8UA 3RGYA 1CB6A 1SD3A 3N94A 1N04A 3KG2A 4ZZEA 1LCFA 3O66A 5CRYA 4O3BA 2QS2A 2ZNTA 3KSJA 2I48A 2O84X 1JEVA 1XHYA 4GL0A 4THIA 2THIA 1SW1A 4ZZAA 1AIVA 1BLFA 4IO4A 4IGRA 1NMUA 3HHGA 4MBPA 4AQ4A 4Z7EA 2ANJA 2B3BA 1GTKA 1AMFA 3LBSA 4WEDA 2DSFA 1LGBC 4NTLA 4ELQA 4BDLA 1NKXA 2V3UA 4XKNA 2O7UA 3FASA 2AYSA 2KLFA 2Q2CA 4C1TA 3Q25A 3FIRA 2D3IA 3ONMA 4GL8A 2ZYNA 3PMWA 1MXWA 1P1WA 3H3GA 3ODBA 2Q89A 3FATA 3EN3A 1OVBA 4TLLB 2RF1A 3CG1A 4LQ5A 2QSXA 1DPPA 3VLUA 3S2VA 2OWSA 4OXVA 3U1OA 5IKBA 3MVZA 4LVQA 2D21A 1AL3A 1P1UA 2UYFA 2A5TB 1US5A 2QJEA 1N3WA 2ONRA 3K0VA 5AA3A 2F36A 3O29A 4H6DA 4C1UA 1MY0A 4FORA 3GZGA 1IIWA 3KGCA 3CSGA 2VHAA 4HCWA 3QK6A 3HPIA 3BKIB 3OO6A 1OQHA 3K6WA 4NE4A 3VFJA 4E0WA 2GHAA 3OOAA 2V93A 5I56A 4H5FA 3PMXA 4EDPA 2ONKE 5CMMA 2OBGA 3SESA 1LBBA 3U93A 4F19A 3ZKLA 1USYH 1S50A 4JSOA 4DZ1A 3FVNA 4RK2A 1H44A 3W9VA 3PPPA 4RPNA 1D3KA 5I84A 4M1VA 2VD2A 2XXRA 5B70A 1Z7NE 3HSTA 4X1DA 4OVJA 1QULA 2X7PA 1PDAA 4H8IA 1JVYA 4ZEKA 2UXAA 3MC2A 4OEUA 1QVSA 3H4ZA 3LUYA 3T22A 1Y3NA 1B7ZA 5HBCA 4G8NA 1LLSA 1N84A 1QW0A 1RYXA 3SKPA 4RNSA 4LONB 5TP9B 5CMCA 1SDXA 3P7IA 3MPLA 3PV0E 4NF4A 3O2AA 3T66A 1M5FA 1MQIA 5EHMA 3O9PA 3S4UA 3AXFA 1Y4CA 4QF9A 5I57A 5FHNA 1ZTYA 4U21A 4N07A 4R73A 4GFRA 1FW0A 3C33A 1OIBA 3U92A 1YAEA 4YKPA 3BBRA 5ICTA 1GGGA 2QS3A 1SI1A 3E3KA 1MXZA 3C9HA 4F1UA 3S9EA 4YB6A 4NEDA 2DVZA 4ESXA 1JETA 5K2XA 3RUMA 3K1NA 1UQWA 3DM0A 1ELJA 1NH7A 4UA8A 4ELRA 1DTZA 1DOTA 1FQAA 4IO7A 4OENA 2OCUA 3IO6A 1PBQA 2XD2A 1H45A 3KZGA 2IA4A 4RA1A 4PP0A 3TYHA 4R9GA 2O7IA 3O97A 3FJ7A 2REJA 3MAMA 2E1SA 5EHSA 3TAJA 1SQYA 5I59B 3H6WA 1WVJA 4ZEDA 1O63A 1JW5A 1POY1 3VXCA 1PEBA 1YTVA 5A5XB 4GWOA 1GR2A 5ELVA 2ZXTA 4Q30B 2Q88A 1A55A 4U22A 4XXUA 3G3KA 3CR9A 3MVXA 3CVGA 1SW5A 1PC3A 4H5GA 3PUWE 1H43A 1IXIA 1I6AA 2F34A 2Z8EA 4GOTA 1HSJA 3OXNA 4R2FA 1L5TA 1RYOA 3K1PA 1B4HA 3B7DA 1LBCA 4IO3A 2B65A 2ESNA 4O3CA 4NF6A 3FXQA 3OO9A 1Y1MA 2I49A 4LZ8A 1Z7ME 3I5OA 2AIXA 2Q9TA 5TPAA 3TODA 4PFUA 4ESWA 1OLCA 4MLVA 4U23A 4U1ZA 2I0CA 2UVHA 1URDA 4GQOA 1FTMA 3RTWB 3UIFA 2HEUA 3KOTA 3R6UA 2Y7PA 4N13A 3SEWA 2E0SA 3MBPA 1MY1A 1SBPA 1GVCA 1FQEA 3TPAA 2P0SA 1BIYA 5I58A 5AA4A 4GD5A 1IXCA 2ZYKA 4EUOA 3GBAA 1P1OA 4JWXA 5I2NA 2HCAA 4HW8A 1MPDA 4LP2B 5AA2B 1B3HA 4QSDA 3G3GA 3GBBA 1TFDA 4YU0A 4OERA 4DIGA 4P11A 4E0XA 2FYIA 3HO7A 2UVGA 3IJXB 4DCYA 1B3GA 1MDP1 2NWJA 2PMSA 4QRZA 4NF8A 2QMWA 4HS7A 1MH3A 4ISUA 1B3FA 4PETA 4YB7A 4KHZE 3IR1A 2DXYA 3RN8A 3OEKA 4X1BA 3CFXA 3PUZE 4KR5A 3SEVA 4OFOA 3SETA 4OFJA 4Q5TA 1BP5A 3PPOA 4TLMB 3MVWA 1AH5A 3QSLA 5CMBA 4U4SA 5I2KB 1JQFA 3G3IA 2Y84A 4OETA 1DPEA 1VSOA 3UGWA 4GIZA 4RXLA 3CFLA 3QUJA 2R6GE 4X48A 3PD8A 2RC7A 3RT8A 1MG1A 4OZ9A 2VP1A 3JZJA 1LFHA 1US4A 4BDQA 3UK4A 3N6TA 4NWDA 3PU5A 3PUVE 4QFOA 1LB9A 3EHSA 1QUJA 2UVJA 2RC9A 1ANFA 2F97A 5TU0A 1J1NA 2XHDA 3U8QA 1N3XA 3Q26A 2H25A 3Q27A 2I4CA 4JB7A 2DWHA 2I3VA 4JXIA 1D9VA 5I56B 1VFDA 1FQCA 3IOVA 3R26A 1NH8A 4F2QA 3LSFB 3U72A 3L6HA 4NF5B 5H8HA 4BDRA 1LAFE 1IQ7A 3K4UA 3FV1A 4ZS9A 3OD7A 3GXAA 3KN8A 4ZEIA 2QPQA 2PVUA 2I0BA 1M5BA 3FVGA 4FJPA 3FUZA 4LZ7A 4U4XA 3T9VA 4P0IA 3A09A 4YMBA 3DLNA 4IO5A 3W15C 4R9FA 3MWBA 2ZNSA 1P99A 1QUKA 2PT2A 3TCFA 4OYVA 4R2BA 2GRVA 3PD9A 1B58A 4XKPA 2V3TA 4XTCQ 4WKMA 1BTJA 1SYIA 3G3HA 3MZBA 3IAZA 3V5AA 3R7XA 3B6TA 1M5CA 5DEXA 1MDQA 1XC1A 2HAUA 1YCJA 1B5JA 1XVYA 3PPNA 5KZTA 4ND9A 1VE4A 3VVDA 1MH4A 4RK9A 2W7YA 5H8FB 3PUXE 1Y20A 3OEMA 2RC8A 1FTOA 1N7XA 2I4BA 3ILTB 5F1QA 2REGA 2CZLA 3TCHA 3SDFA 4IGTA 3TUSA 4G68B 3PPRA 4R74A 5EYFA 1MXVA 3VVEA 4F1YA 3C36A 4PQJA 3M3LA 3KOSA 3IX1A 2DWAA 1PBPA 2F35A 1R9QA 4ELPA 3EQ1A 5AE4A 4R6YA 4TOZA 2XD3A 4LQ2A 3I6VA 2XXVA 1MY3A 3B6QA 3TTMA 4G8HA 4OESA 1SYHA 3DP4A 4YZZA 1Q35A 2XX9A 1POTA 4MLQA 3B6WA 2UYEA 1N7WA 1JVXA 5H8SA 4PFTA 4YKKA 3I3VA 4WEPA 1MXYA 2QS1A 1EZOA 3KFMA 2DXRA 5H8NB 4EQ9A 5JTYB 3JV9A 4DDDA 2QRYA 1UTBB 1N76A 2F7CA 2DQVA 3MZ1A 4F31B 3RQTA 1OVTA 2DOJA 3MP1A 3K6UA 3TCGA 3DP6A 2P2AA 1WODA 2XXXA 2XXWA 1B52A 4RPOA 1Y4TA 1FQBA 3CRBA 3IL1B 5FHOA 5TPAB 3T9UA 2Y7WA 4WXJA 2D5WA 3JYRA 3TQWA 2XXTA 2LAOA 3GLBA 2OZZA 3RTFB 2RKMA 2XXUA 2WKYA 3OMBA 3H7MA 3FGSA 3K00A 1MM7A 3UN6A 1B2HA 1D4NA 3K6XA 4I1DA 3RY3A 4NMYA 2Z8FA 3IK6B 4OWDA 5FTHA 1I69A 3HN0A 3L6GA 5L8DA 3IB2A 2YPNA 3OO7A 5H8QB 4KI0E 4H0WA 3PUYE 3IOWA 3MW0A 4KFQA 1B32A 4XKQA 5CI5A 3FJGA 1S9TA 2FNCA 1B0LA 1NNFA 1GV8A 1SW4A 2V84A 1DMBA 1QJMA 2RCAA 2M8CA 4YKJA 4DE8A 2PYYA 2HFBA 4EF2A 4OEVA 5LOMA 3K2DA 3ZS6A 1A7LA 3E13X 4DCXA 2HAVA 4OHNA 1URSA 1EZPA 1B3EA 3RT6B 1DTGA 1EU8A 2ABHA 5JK4A 1FQDA 3T93B 5KDTA 5TP9A 2Y7IA 2V25A 5B7DA 2XXPA 1XS5A 2R71A 3N5LA 4IB2A 4FEBA 4BDOA 4N6PA 2NOOA 3RNNA 3PPQA 4Q8RA 4R72A 4X9TA 1LAGE 5ITPA 2F7AA 1B0HA 1R6ZA 1YPNA 3LSWA 3OO8A 4GF8A 2DE2A 4EF1A 5CC2A 2ZNUA 3FV2A 2XX8A 4IY5A 2VGQA 1IXHA 1JW1A 4OTEA 3MVYA 2DE3A 1F9BA 4BLAA 2XXQA 2DS9A 3D4GA 3KJTA 4QFKA 1NNTA 2X7QA 3MZ9A 3IJOB 3G3FA 3E4RA 3H6VA 3RLFE 5KCJB 3V83A 3G7WA 2VD3A 2F6PA 1B9JA 5BWJA 1B46A 3ECRA 3C31A 3IORA 4LATA 1LB8A 2H9BA 2F5XA 4BDMA 2H99A 1H3DA 3OENA 2OJTA 2VOZA 5H8HB 3H6TA 4NWCA 4G68C 5HPQA 3M3KA 4H65A 4F29A 3K6VA 1HSLA 3FJMA 3UA8A 5I59A 3SEUA
chains in the Genus database with same CATH superfamily
1EZ9A 1FBEA 4I62A 3QYTA 2XXYA 1QKAA 1JNFA 1ZU0A 2QFLA 1FPBA 4F3BA 5DYHA 3BIHA 4F3SA 3FD3A 2H4IA 5AA2D 3IOUA 4IO6A 2IEEA 4PAFA 2GHBA 2PFZA 1BKAA 1KWHA 4G8MA 1ZJLA 2XX7A 1B5IA 4H67A 2PT1A 3MPKA 3MQ9A 1FTJA 4MHFA 5CBSA 1B1HA 1CE2A 2VPOA 3TFLA 1NNPA 4QFLA 4KQPA 4YICA 4PFYA 2QVVA 2AL5A 2BJJX 4GRKA 3G3JA 4DLDA 4KD5A 3LSLA 1IEJA 4LUBA 4ELOA 3VVFA 3MSTA 3MP6A 1LAHE 1KZ8A 4YB5A 3VV5A 3KEIA 3BFTA 1FBDA 4ZEBA 3SZPA 3TMGA 1TWYA 3TEPA 3A3CA 4K3FA 1D9QA 1I6QA 3SERA 2WBDA 3TDJA 5ET5A 5AA2A 4UACA 4KYDA 2XXIA 4POWA 1MY4A 4GWUA 2AL4A 3S9MC 4ZDMA 4AS5A 4P8BA 3LUZA 3OSQA 3KN7A 2DE4A 2DVCA 4G2ZA 5CMKA 1NV1A 1FPEA 1QKBA 5ISUA 2A5SA 4GXSB 1EYKA 2RINA 2X26A 1MQHA 1TT1A 4PFWA 1Y9UA 1LAXA 1MQDA 1B05A 3EHTA 2HXWA 2Q74A 2I6EA 3VDFA 3O6IA 5CM6A 2GH9A 4G4PA 1PB8A 2Z22A 4P0GA 3C34A 3QXMA 1T0KA 1ZLQA 5JEIA 4FAJA 3EPEA 4AB5A 4H1XA 3MP8A 1PB7A 3CFZA 3E9XA 4OQOA 3TTRA 3C4MA 5I2KA 1O64A 3FVOA 4O3AA 4OVPA 5T3JA 2CMOA 2KR0A 3VXBA 3ZSFA 3OSRA 4NF4B 3TKDA 4ZECA 3LC8A 2P1SA 4DXCA 4N15A 2QVRA 5AA1A 2QVUA 4HXVA 3M3FA 5I57B 5F7VA 1VR5A 1TFAA 1B40A 1IZ1A 5DT6A 4R75A 1MXUA 1SVXB 3CSBA 4OVRA 2F78A 3FXUA 2H5YA 2B4LA 3KJ7A 1RDXA 1A54A 4I8CA 1B7UA 4P3LA 4F39A 2R9JA 1H76A 1TXFA 2FA7A 3LR1A 3OELA 4JBZA 3QUFA 2RCBA 1UTHA 3H03A 1MQGA 1MPCA 4YAHX 4F1VA 4BDNA 1SPIA 4EQ7A 3ILUB 5I3SA 2YLNA 3N6UA 3RYDA 4ZE8A 3C35A 3V8XB 3HCQA 2DWIA 4MF3A 1KA1A 2Y7KA 3K1MA 1NV5A 3TELA 4NF5A 4NF0A 4Q0CA 4GVOA 1IUDA 4N91A 3KN3A 1II5A 1LFGA 1MM6A 4GLIA 3S9LC 3D4CA 4HCYA 1JEUA 4EXLA 1SW2A 3FVKA 3N26A 1FTAA 4GBVA 1FBCA 3K02A 3IB0A 4DXUA 1USYE 3C32A 1MRPA 1FPKA 4AB6A 1LSTA 1IMAA 3RPWA 1B1XA 5HM4B 4ZE9A 4F3PA 4P56A 1MPBA 4L17A 4POXA 4FE8A 2V4CA 3DP8A 5FHMA 1NFTA 1R1NA 1LBZA 4XKRA 4N81A 3T9XB 1B51A 4PE5B 5KDTB 4FATA 1LFIA 5ICQA 5L9SA 1IMBA 1M5DA 1ATGA 4R6HA 3O28A 3KSXA 3LSXA 2HZKA 4XIGQ 4G77A 2A5TA 4NF6B 2O69A 4KPTA 1YZ0A 3VLWA 2ZMBA 4YMAA 3EF7A 4U1OA 2ALUA 5H8FA 1M5EA 4U2RA 3TZAA 5IAIA 4OVSA 4IR8A 2B3FA 4JWOA 1UIVA 4OMBA 5L9MA 1NUZA 3Q28A 1N0TA 4G68A 3USDA 5I58B 5AA4B 2FHYA 5L9OA 1B5HA 1QUIA 3Q29A 4PF6A 5EQ7A 5I2NB 2O1MA 1IITA 4LA9A 4KYSA 3A29A 4H45A 4Z0IA 1AOVA 2XXKA 2DWJA 3BFUA 5DVFA 4HTGA 2OWTA 1NL5A 4M4GA 2Q2AA 5FTIA 1JW4A 4GXAA 3O6HA 1ZKBA 2CEXA 1NV0A 3SEYA 3KBRA 2OK2A 4MNPA 4F18A 4IO2A 1XVXA 2PFYA 4FECA 2ZYMA 4H8JA 4NF8B 3F11A 4KCDA 3O6GA 3T96B 2QMXA 3ZKKA 2F7BA 3RPLB 1B7HA 1VFEA 1MQJA 1D9YA 5BUUA 2DP8A 2YJPA 2GFEA 2XWKA 1B3LA 2ZYOA 5H8NA 5JTYA 1UTBA 4QSEA 4YKIA 1OLAA 1PB9A 3CIJA 3WAFA 1FCKA 3GYYA 3MJNA 4EXKA 3W9WA 4FEDA 2HZLA 1HSEA 1S7YA 2NVUB 2ONSA 3PGFA 1MS7A 2H98A 4I9DA 4IY6A 5J1DA 3TTLA 4PTKA 4PAIA 2XXHA 3K01A 3MYUA 2O6AA 1P1NA 3HFUA 4MAGA 4JSDA 3IB1A 1SI0A 4FBPA 1FTKA 4EQBA 1B4ZA 1XOCA 4KCCA 4X8RA 4F22A 1A40A 3VLVA 3QAXA 2Y7RA 5DVIA 1B6HA 1OQGA 3T9HB 3KBZA 3TTNA 1NUXA 4ZEFA 2O51A 3THIA 5I7IA 3HHFA 1EH3A 5EYGA 4OFLA 4QXDA 1Q1KA 2O1LA 3EHUA 2WBBA 4KYEA 2HQ0A 4F2OA 1WDNA 1OMPA 3E79A 2UVIA 1I6BA 2V3QA 3TQLA 1P1QA 3FZVA 3H6UA 1A8FA 4OVQA 2XWOA 2QS4A 1FPFA 1ZIUA 2PBWA 3PMVA 3U94A 5DVJA 1FQFA 3CI8A 4MFIA 5H8QA 2QL3A 4RY1A 5ITOA 1G0IA 2I3WA 1URGA 2G29A 4FIMA 4ECFA 1A8EA 4MNCA 4JVDA 5M2VA 3TTKA 5EQAA 4JWYA 1DSNA 2DDKA 2NXOA 4R6KA 4F3GA 1R9LA 2FBPA 1O7TA 1ZMGA 5A5XA 4QFPA 3VE1B 4PF8A 4PDDA 4HE0A 1XT8A 3H06B 5DTBA 1LBWA 2G93A 1UIUA 2PX1A 2Z8DA 4PCDA 4TQUQ 2CZIA 3UORA 1FTLA 3KC1A 5ET6A 1Y3QA 3WAEA 5K2YA 1JP4A 3IO4A 1Y3PA 4MMPA 4PFIA 2I58A 1RKMA 3FBPA 4O7MA 4N4UA 4QHQA 4DI3D 4DXBA 1FJ9A 5DEXB 4N6DA 3HV1A 3IOTA 4QFNA 1ZBMA 4RYAA 4LZ5A 3A3UA 4GX6A 3DELB 4RJZA 1A99A 4MH5A 4ONYA 1MXXA 2DYXA 4NHBA 5CBRA 4C0RA 2O68A 3MUQA 3V89B 4MX6A 3S9NC 3QIMA 2NUVA 1Y1ZA 2F6GA 1QGXA 3PTYA 2WYPA 3SEXA 1IXGA 1K9ZA 1LCTA 4JDFA 1NNKA 2F8DA 4QSCA 2OX3A 2OLBA 2Q8JA 3UP9A 5KCJA 1UTHB 1MY2A 2Z23A 3FXRA 4G61A 3CG3A 3M8UA 3RGYA 1CB6A 1SD3A 3N94A 1G0HA 1N04A 4GWWA 3KG2A 4ZZEA 1LCFA 2WYKA 3O66A 1LBVA 4O3BA 5CRYA 2QS2A 4GX3A 4MEVA 2ZNTA 4JVIA 3KSJA 4OA4A 2I48A 2O84X 1JEVA 1XHYA 4GL0A 4THIA 2THIA 1SW1A 4I40A 1DCUA 4ZZAA 1AIVA 1BLFA 4IO4A 4IGRA 1NMUA 3HHGA 4MBPA 4AQ4A 4Z7EA 2Y5KA 2ANJA 2B3BA 1GTKA 1AMFA 3LBSA 4WEDA 2DSFA 1LGBC 4NTLA 4ELQA 4BDLA 1NKXA 2V3UA 4XKNA 2Y5LA 2O7UA 3FASA 2AYSA 2KLFA 2Q2CA 5EYHA 4C1TA 2B4MA 3Q25A 3FIRA 4JVCA 2D3IA 3ONMA 4GL8A 2ZYNA 3PMWA 4X04A 1MXWA 1P1WA 3H3GA 3ODBA 2Q89A 3FATA 3EN3A 1OVBA 4P1LA 1FBGA 4TLLB 2RF1A 3CG1A 4LQ5A 2QSXA 1DPPA 4AS4A 2OWSA 3S2VA 4OXVA 3VLUA 3U1OA 5IKBA 3MVZA 4LVQA 2D21A 1AL3A 1P1UA 2UYFA 2A5TB 1US5A 2QJEA 1N3WA 2ONRA 3K0VA 5AA3A 4PFRA 2F36A 4GWYA 3O29A 4H6DA 4C1UA 1MY0A 4FORA 3GZGA 1IIWA 3KGCA 3CSGA 1IMDA 2VHAA 3KC0A 2CEYA 4HCWA 3QK6A 3HPIA 5F24A 3BKIB 4KXPA 2WX9A 3OO6A 1OQHA 3K6WA 2FIEA 4NE4A 5LDZA 5ET8A 3VFJA 4E0WA 2GHAA 3OOAA 2V93A 5I56A 4MIJA 4H5FA 3PMXA 4OANA 4EDPA 2ONKE 5CMMA 2OBGA 3SESA 3IFAA 1LBBA 3U93A 4F19A 1RDYA 3ZKLA 1USYH 1S50A 4XEQA 4JSOA 4DZ1A 3FVNA 4RK2A 1LBXA 1H44A 1FPIA 3W9VA 3PPPA 4RPNA 1D3KA 5I84A 4M1VA 2VD2A 2XXRA 4NQ8A 5B70A 1Z7NE 3HSTA 4X1DA 4OVJA 2HHMA 1QULA 2X7PA 1PDAA 4H8IA 1JVYA 4NG7A 4ZEKA 2UXAA 3MC2A 4OEUA 1QVSA 3H4ZA 1KA0A 3LUYA 3IFCA 3T22A 1Y3NA 1B7ZA 5HBCA 4G8NA 1LLSA 1N84A 4P9KA 1QW0A 1RYXA 2CZHA 3SKPA 4RNSA 4LONB 5TP9B 5CMCA 1SDXA 2JJKA 3MPLA 3P7IA 3PV0E 4NF4A 3O2AA 3T66A 1M5FA 1MQIA 4H46A 5EHMA 3O9PA 3S4UA 3AXFA 1Y4CA 4QF9A 5I57A 5FHNA 1ZTYA 4U21A 4N07A 4R73A 4GBWA 4GFRA 2WEFA 1FW0A 3C33A 2XA5A 1OIBA 3U92A 1YAEA 4YKPA 3BBRA 5ICTA 5J16A 4N8YA 1GGGA 2P3NA 3ROJA 2QS3A 1SI1A 3E3KA 1MXZA 4NX1A 3C9HA 4F1UA 2FVZA 3S9EA 4YB6A 4NEDA 2DVZA 4ESXA 1JETA 5K2XA 3B50A 3RUMA 3K1NA 2XWVA 1UQWA 3DM0A 1ELJA 3T1BA 1NH7A 4UA8A 4ELRA 1DTZA 1DOTA 4XF5A 1FQAA 4IO7A 4OENA 2OCUA 3IO6A 1PBQA 2XD2A 1H45A 4PAKA 3KZGA 2IA4A 4RA1A 5ET7A 4PP0A 3TYHA 4R9GA 2O7IA 3O97A 3FJ7A 2REJA 3MAMA 2E1SA 5EHSA 3TAJA 1SQYA 5I59B 3H6WA 1WVJA 4ZEDA 1O63A 1JW5A 1POY1 5ESYA 3VXCA 1PEBA 1YTVA 5A5XB 4GWOA 1GR2A 5ELVA 1XI6A 2ZXTA 4Q30B 2Q88A 1A55A 4U22A 5IZ3A 4XXUA 3G3KA 2GQ1A 3CR9A 3MVXA 3CVGA 1SW5A 1PC3A 4H5GA 3PUWE 1H43A 1IXIA 1I6AA 2F34A 2Z8EA 4GOTA 1HSJA 3OXNA 4R2FA 1L5TA 1RYOA 3K1PA 1B4HA 4O8MA 3B7DA 1LBCA 4IO3A 2B65A 2ESNA 4O3CA 4NF6A 3FXQA 3OO9A 1Y1MA 4O94A 2I49A 4LZ8A 1FBFA 1Z7ME 2AIXA 2Q9TA 3I5OA 5TPAA 4PFUA 3TODA 2F3BA 2L5VA 4HE2A 4ESWA 1OLCA 4MLVA 4U23A 4U1ZA 2I0CA 2UVHA 1URDA 4GQOA 1FTMA 3RTWB 3UIFA 1LBYA 2HEUA 3KOTA 3R6UA 2Y7PA 4N13A 3SEWA 2E0SA 1NI9A 3MBPA 1MY1A 1SBPA 1GVCA 1FQEA 3TPAA 2P0SA 3EKIA 1BIYA 5I58A 5AA4A 4GD5A 1IXCA 2ZYKA 4EUOA 3GBAA 1P1OA 4JWXA 5I2NA 5LTCA 2HCAA 4HW8A 1MPDA 4PBQA 1EYJA 4LP2B 5AA2B 1B3HA 4QSDA 3G3GA 1FPLA 3GBBA 1TFDA 4YU0A 1NUWA 5DW8A 4N17A 4OERA 4DIGA 2P3VA 4P11A 4NAPA 4E0XA 2FYIA 3HO7A 2UVGA 3IJXB 4DCYA 1B3GA 1MDP1 3BIGA 2NWJA 2PMSA 4QRZA 4NF8A 2QMWA 4HS7A 1FJ6A 1MH3A 4ISUA 1B3FA 4PETA 4YB7A 4KHZE 3IR1A 2DXYA 3RN8A 3RPLA 3OEKA 1IMCA 4X1BA 4LN5A 3CFXA 3PUZE 4KR5A 3SEVA 4OFOA 4N6KA 3SETA 4OFJA 4Q5TA 1BP5A 2OWZA 3PPOA 4TLMB 3MVWA 1INPA 1AH5A 3QSLA 5CMBA 4U4SA 5I2KB 1EYIA 1JQFA 3G3IA 2Y84A 4OETA 1DPEA 1VSOA 3UGWA 1BK4A 4GIZA 4RXLA 2R8TA 1NV3A 3CFLA 3QUJA 2R6GE 4X48A 3PD8A 2RC7A 3RT8A 1MG1A 4OZ9A 2VP1A 3JZJA 1LFHA 1US4A 4BDQA 3UK4A 3N6TA 4NWDA 3PU5A 5FBPA 3PUVE 4QFOA 1LB9A 1FPDA 2BJIA 1RDZA 3EHSA 4OVTA 1QUJA 1FBHA 2ZZVA 3U65A 2UVJA 5IZZA 2VT5A 2ZZWA 2RC9A 4NGUA 1ANFA 2F97A 5TU0A 1J1NA 1AWBA 2XHDA 3U8QA 1N3XA 3Q26A 2H25A 3Q27A 1CNQA 2I4CA 4JB7A 5A5LA 2DWHA 2I3VA 4JXIA 1D9VA 5I56B 1DK4A 1VFDA 1FQCA 3IOVA 5EQ9A 3R26A 1NH8A 4F2QA 3LSFB 3U72A 3L6HA 4NF5B 5H8HA 4BDRA 1LAFE 1IQ7A 3K4UA 3FV1A 4MJOA 4ZS9A 1YXIA 3OD7A 3GXAA 3KN8A 4ZEIA 2QPQA 2PVUA 1Q9DA 2I0BA 1M5BA 3FVGA 4FJPA 3FUZA 4LZ7A 4U4XA 3T9VA 4P0IA 3A09A 4YMBA 3DLNA 1NV7A 5EQ8A 4I3EA 4IO5A 3NOHA 3W15C 4R9FA 3MWBA 2ZNSA 1P99A 1QUKA 2PT2A 3TCFA 4OYVA 4R2BA 2GRVA 3PD9A 1B58A 4XKPA 2V3TA 4XTCQ 4WKMA 1YYZA 1BTJA 1SYIA 5IM2A 3G3HA 3MZBA 3IAZA 3V5AA 3R7XA 3B6TA 1M5CA 5DEXA 1MDQA 5I5PA 1XC1A 4P1EA 2HAUA 1YCJA 1B5JA 4PE3A 1XVYA 3PPNA 5KZTA 4ND9A 1VE4A 3VVDA 1MH4A 4RK9A 4PFBA 2W7YA 5H8FB 3PUXE 1NV6A 1Y20A 3OEMA 2RC8A 1FTOA 1N7XA 2I4BA 3ILTB 2ZZXA 5F1QA 2REGA 2CZLA 3TCHA 3SDFA 1IMFA 4IGTA 3TUSA 4G68B 3PPRA 4R74A 5EYFA 1MXVA 3VVEA 4F1YA 3C36A 4PQJA 3M3LA 2HPGA 4GWSA 3KOSA 3IX1A 2DWAA 1PBPA 2F35A 1R9QA 4ELPA 3EQ1A 5AE4A 2Q8MA 4R6YA 4TOZA 2XD3A 3CHGA 4LQ2A 1NV2A 3I6VA 2XXVA 1MY3A 4N8GA 3B6QA 3TTMA 4G8HA 4OESA 1IMEA 1SYHA 3DP4A 4YZZA 1Q35A 2F3DA 3E78A 2XX9A 1POTA 4MLQA 3B6WA 2UYEA 1N7WA 1JVXA 5H8SA 4PFTA 4YKKA 4MCOA 3I3VA 4WEPA 1LEVA 1MXYA 2HXRA 2QS1A 1EZOA 3KFMA 2DXRA 5H8NB 4EQ9A 5JTYB 3JV9A 4DDDA 2QRYA 1UTBB 1VDWA 2XWIA 1N76A 2F7CA 2DQVA 3MZ1A 4F31B 3RQTA 1FPJA 2KQZA 1OVTA 2DOJA 3MP1A 5IZ3B 3K6UA 3TCGA 4MNIA 3QMFA 3DP6A 2P2AA 1WODA 2XXXA 2XXWA 1B52A 3T0JA 4RPOA 1Y4TA 1FQBA 4DI4B 1FBPA 3CRBA 4GWXA 3IL1B 5FHOA 5TPAB 3T9UA 2CZKA 4PC9A 2VPNA 4I3YA 2Y7WA 4WXJA 1FRPA 2D5WA 3JYRA 5IGAA 3TQWA 2XXTA 2LAOA 3GLBA 4PBHA 2OZZA 3RTFB 2RKMA 2XXUA 2WKYA 3OMBA 3H7MA 3D1RA 3FGSA 1MM7A 3K00A 3UN6A 1B2HA 1D4NA 3K6XA 4I1DA 3RY3A 4NMYA 1DBZA 2Z8FA 3IK6B 4P47A 4OWDA 1K9YA 5FTHA 1I69A 3HN0A 3L6GA 3B8BA 5L8DA 3IB2A 2YPNA 3OO7A 4UABA 5H8QB 4KI0E 4H0WA 3PUYE 3IOWA 3MW0A 4KFQA 1B32A 4XKQA 5CI5A 3FJGA 1S9TA 2FNCA 1B0LA 1NNFA 1GV8A 1SW4A 2V84A 3LV0A 4HE1A 1DMBA 1QJMA 2RCAA 2M8CA 4YKJA 4DE8A 2PYYA 4NN3A 2HFBA 4EF2A 4OEVA 5LOMA 3K2DA 3ZS6A 1A7LA 3E13X 4DCXA 2HAVA 4OHNA 1URSA 1EZPA 1B3EA 3RT6B 1DTGA 1EU8A 2ABHA 5JK4A 1FQDA 3T93B 5KDTA 5TP9A 2Y7IA 2V25A 5B7DA 2XXPA 3FXBA 1XS5A 2R71A 3N5LA 4IB2A 1NV4A 4FEBA 4BDOA 4N6PA 2NOOA 3RNNA 3PPQA 4O7IA 4Q8RA 4R72A 2FIXA 4X9TA 1LAGE 5ITPA 2F7AA 1B0HA 1R6ZA 1YPNA 3LSWA 3OO8A 4GF8A 2DE2A 4EF1A 5CC2A 2ZNUA 3FV2A 2XX8A 4IY5A 2VGQA 4GWZA 1IXHA 1JW1A 1FSAA 2PCRA 4OTEA 3MVYA 2DE3A 1FPGA 1F9BA 4BLAA 4PGNA 2XXQA 2DS9A 4XFEA 3D4GA 3KJTA 4QFKA 1NNTA 2X7QA 1NUYA 3MZ9A 3IJOB 3G3FA 3E4RA 3ISPA 4PGPA 5IZ1A 3H6VA 2MKZA 3RLFE 5KCJB 3V83A 3G7WA 2VD3A 2F6PA 4PDHA 1B9JA 5BWJA 1B46A 3ECRA 3C31A 3IORA 4LATA 1LB8A 2H9BA 2F5XA 4BDMA 2H99A 1H3DA 4GX4A 3OENA 2OJTA 2VOZA 5H8HB 3H6TA 4NWCA 4G68C 5HPQA 3M3KA 4H65A 4QBAA 3K6VA 4F29A 1HSLA 3FJMA 3UA8A 5I59A 3SEUA
chains in the Genus database with same CATH topology
1EZ9A 4I62A 3QYTA 2XXYA 1QKAA 1JNFA 1ZU0A 4F3BA 5DYHA 4F3SA 3FD3A 2H4IA 5AA2D 3IOUA 4IO6A 2IEEA 2GHBA 1BKAA 1KWHA 4G8MA 1ZJLA 2XX7A 1B5IA 4H67A 2PT1A 3MPKA 3MQ9A 1FTJA 5CBSA 1B1HA 1CE2A 3TFLA 1NNPA 4QFLA 4KQPA 4YICA 4PFYA 2AL5A 2BJJX 4GRKA 3G3JA 4DLDA 4KD5A 3LSLA 1IEJA 4LUBA 4ELOA 3VVFA 3MP6A 1LAHE 4YB5A 3VV5A 3KEIA 3BFTA 4ZEBA 3TMGA 1TWYA 3TEPA 3A3CA 4K3FA 1I6QA 3SERA 3TDJA 5AA2A 4UACA 4KYDA 2XXIA 4POWA 1MY4A 2AL4A 3S9MC 4ZDMA 3OSQA 3KN7A 2DE4A 2DVCA 4G2ZA 5CMKA 1QKBA 5ISUA 2A5SA 4GXSB 2RINA 2X26A 1MQHA 1TT1A 4PFWA 1Y9UA 1LAXA 1MQDA 1B05A 3EHTA 2HXWA 3VDFA 2I6EA 3O6IA 5CM6A 2GH9A 4G4PA 1PB8A 2Z22A 4P0GA 3C34A 3QXMA 1T0KA 1ZLQA 5JEIA 4FAJA 3EPEA 4AB5A 4H1XA 3MP8A 1PB7A 3CFZA 3E9XA 4OQOA 3TTRA 3C4MA 5I2KA 1O64A 3FVOA 4O3AA 2CMOA 3VXBA 3ZSFA 3OSRA 4NF4B 3TKDA 4ZECA 3LC8A 2P1SA 4DXCA 5AA1A 3M3FA 5I57B 5F7VA 1VR5A 1TFAA 1B40A 1IZ1A 5DT6A 4R75A 1MXUA 1SVXB 3CSBA 2F78A 3FXUA 2H5YA 3KJ7A 1A54A 4I8CA 1B7UA 4F39A 2R9JA 1H76A 1TXFA 2FA7A 3LR1A 3OELA 4JBZA 3QUFA 2RCBA 1UTHA 3H03A 1MQGA 1MPCA 4YAHX 4F1VA 4BDNA 4EQ7A 3ILUB 2YLNA 3N6UA 4ZE8A 3C35A 3V8XB 3HCQA 2DWIA 4MF3A 2Y7KA 3K1MA 3TELA 4NF5A 4Q0CA 4GVOA 1IUDA 3KN3A 1II5A 1LFGA 1MM6A 4GLIA 3S9LC 3D4CA 4HCYA 1JEUA 4EXLA 1SW2A 3FVKA 3N26A 3K02A 3IB0A 4DXUA 1USYE 3C32A 1MRPA 4AB6A 1LSTA 3RPWA 1B1XA 5HM4B 4ZE9A 4F3PA 1MPBA 4L17A 4POXA 4FE8A 3DP8A 5FHMA 1NFTA 1R1NA 4XKRA 3T9XB 1B51A 4PE5B 5KDTB 4FATA 1LFIA 5ICQA 5L9SA 1M5DA 1ATGA 4R6HA 3O28A 3KSXA 3LSXA 2HZKA 4XIGQ 4G77A 2A5TA 4NF6B 2O69A 4KPTA 3VLWA 2ZMBA 4YMAA 3EF7A 4U1OA 2ALUA 5H8FA 1M5EA 4U2RA 3TZAA 5IAIA 2B3FA 4JWOA 1UIVA 4OMBA 5L9MA 3Q28A 1N0TA 4G68A 3USDA 5I58B 5AA4B 5L9OA 1B5HA 1QUIA 3Q29A 5I2NB 2O1MA 1IITA 4LA9A 4KYSA 4Z0IA 1AOVA 2DWJA 3BFUA 5DVFA 4HTGA 2OWTA 1NL5A 4M4GA 2Q2AA 5FTIA 1JW4A 4GXAA 3O6HA 1ZKBA 3SEYA 3KBRA 2OK2A 4F18A 4IO2A 1XVXA 4FECA 2ZYMA 4H8JA 4NF8B 3F11A 4KCDA 3O6GA 3T96B 2QMXA 3ZKKA 2F7BA 1B7HA 1VFEA 1MQJA 1D9YA 5BUUA 2DP8A 2YJPA 2GFEA 1B3LA 2ZYOA 5H8NA 5JTYA 1UTBA 4QSEA 4YKIA 1OLAA 1PB9A 3CIJA 3WAFA 1FCKA 3MJNA 4EXKA 3W9WA 4FEDA 2HZLA 1HSEA 1S7YA 2NVUB 2ONSA 3PGFA 1MS7A 2H98A 4I9DA 4IY6A 5J1DA 3TTLA 2XXHA 3K01A 2O6AA 1P1NA 4JSDA 3IB1A 1SI0A 1FTKA 4EQBA 1B4ZA 1XOCA 4KCCA 4F22A 1A40A 3VLVA 3QAXA 2Y7RA 5DVIA 1B6HA 1OQGA 3T9HB 3TTNA 4ZEFA 2O51A 3THIA 3HHFA 1EH3A 4OFLA 1Q1KA 2O1LA 3EHUA 4KYEA 2HQ0A 4F2OA 1WDNA 1OMPA 2UVIA 1I6BA 2V3QA 3TQLA 1P1QA 3FZVA 3H6UA 1A8FA 2QS4A 1ZIUA 2PBWA 3PMVA 3U94A 5DVJA 1FQFA 3CI8A 4MFIA 5H8QA 2QL3A 4RY1A 5ITOA 2I3WA 1URGA 2G29A 4FIMA 4ECFA 1A8EA 5M2VA 3TTKA 4JWYA 1DSNA 2NXOA 4R6KA 4F3GA 1R9LA 1O7TA 1ZMGA 5A5XA 4QFPA 3VE1B 1XT8A 3H06B 5DTBA 2G93A 1UIUA 2PX1A 2Z8DA 4TQUQ 3UORA 1FTLA 1Y3QA 3WAEA 5K2YA 3IO4A 1Y3PA 2I58A 1RKMA 4QHQA 4DXBA 5DEXB 3HV1A 3IOTA 4QFNA 1ZBMA 4RYAA 4LZ5A 3A3UA 3DELB 4RJZA 1A99A 4MH5A 4ONYA 1MXXA 2DYXA 5CBRA 4C0RA 2O68A 3MUQA 3V89B 3S9NC 3QIMA 2NUVA 1Y1ZA 2F6GA 3SEXA 1IXGA 1LCTA 4JDFA 1NNKA 2F8DA 4QSCA 2OLBA 2Q8JA 3UP9A 5KCJA 1UTHB 1MY2A 2Z23A 3FXRA 3CG3A 3M8UA 3RGYA 1CB6A 1SD3A 3N94A 1N04A 3KG2A 4ZZEA 1LCFA 3O66A 5CRYA 4O3BA 2QS2A 2ZNTA 3KSJA 2I48A 2O84X 1JEVA 1XHYA 4GL0A 4THIA 2THIA 1SW1A 4ZZAA 1AIVA 1BLFA 4IO4A 4IGRA 1NMUA 3HHGA 4MBPA 4AQ4A 4Z7EA 2ANJA 2B3BA 1GTKA 1AMFA 3LBSA 4WEDA 2DSFA 1LGBC 4NTLA 4ELQA 4BDLA 1NKXA 2V3UA 4XKNA 2O7UA 3FASA 2AYSA 2KLFA 2Q2CA 4C1TA 3Q25A 3FIRA 2D3IA 3ONMA 4GL8A 2ZYNA 3PMWA 1MXWA 1P1WA 3H3GA 3ODBA 2Q89A 3FATA 3EN3A 1OVBA 4TLLB 2RF1A 3CG1A 4LQ5A 2QSXA 1DPPA 3VLUA 3S2VA 2OWSA 4OXVA 3U1OA 5IKBA 3MVZA 4LVQA 2D21A 1AL3A 1P1UA 2UYFA 2A5TB 1US5A 2QJEA 1N3WA 2ONRA 3K0VA 5AA3A 2F36A 3O29A 4H6DA 4C1UA 1MY0A 4FORA 3GZGA 1IIWA 3KGCA 3CSGA 2VHAA 4HCWA 3QK6A 3HPIA 3BKIB 3OO6A 1OQHA 3K6WA 4NE4A 3VFJA 4E0WA 2GHAA 3OOAA 2V93A 5I56A 4H5FA 3PMXA 4EDPA 2ONKE 5CMMA 2OBGA 3SESA 1LBBA 3U93A 4F19A 3ZKLA 1USYH 1S50A 4JSOA 4DZ1A 3FVNA 4RK2A 1H44A 3W9VA 3PPPA 4RPNA 1D3KA 5I84A 4M1VA 2VD2A 2XXRA 5B70A 1Z7NE 3HSTA 4X1DA 4OVJA 1QULA 2X7PA 1PDAA 4H8IA 1JVYA 4ZEKA 2UXAA 3MC2A 4OEUA 1QVSA 3H4ZA 3LUYA 3T22A 1Y3NA 1B7ZA 5HBCA 4G8NA 1LLSA 1N84A 1QW0A 1RYXA 3SKPA 4RNSA 4LONB 5TP9B 5CMCA 1SDXA 3P7IA 3MPLA 3PV0E 4NF4A 3O2AA 3T66A 1M5FA 1MQIA 5EHMA 3O9PA 3S4UA 3AXFA 1Y4CA 4QF9A 5I57A 5FHNA 1ZTYA 4U21A 4N07A 4R73A 4GFRA 1FW0A 3C33A 1OIBA 3U92A 1YAEA 4YKPA 3BBRA 5ICTA 1GGGA 2QS3A 1SI1A 3E3KA 1MXZA 3C9HA 4F1UA 3S9EA 4YB6A 4NEDA 2DVZA 4ESXA 1JETA 5K2XA 3RUMA 3K1NA 1UQWA 3DM0A 1ELJA 1NH7A 4UA8A 4ELRA 1DTZA 1DOTA 1FQAA 4IO7A 4OENA 2OCUA 3IO6A 1PBQA 2XD2A 1H45A 3KZGA 2IA4A 4RA1A 4PP0A 3TYHA 4R9GA 2O7IA 3O97A 3FJ7A 2REJA 3MAMA 2E1SA 5EHSA 3TAJA 1SQYA 5I59B 3H6WA 1WVJA 4ZEDA 1O63A 1JW5A 1POY1 3VXCA 1PEBA 1YTVA 5A5XB 4GWOA 1GR2A 5ELVA 2ZXTA 4Q30B 2Q88A 1A55A 4U22A 4XXUA 3G3KA 3CR9A 3MVXA 3CVGA 1SW5A 1PC3A 4H5GA 3PUWE 1H43A 1IXIA 1I6AA 2F34A 2Z8EA 4GOTA 1HSJA 3OXNA 4R2FA 1L5TA 1RYOA 3K1PA 1B4HA 3B7DA 1LBCA 4IO3A 2B65A 2ESNA 4O3CA 4NF6A 3FXQA 3OO9A 1Y1MA 2I49A 4LZ8A 1Z7ME 3I5OA 2AIXA 2Q9TA 5TPAA 3TODA 4PFUA 4ESWA 1OLCA 4MLVA 4U23A 4U1ZA 2I0CA 2UVHA 1URDA 4GQOA 1FTMA 3RTWB 3UIFA 2HEUA 3KOTA 3R6UA 2Y7PA 4N13A 3SEWA 2E0SA 3MBPA 1MY1A 1SBPA 1GVCA 1FQEA 3TPAA 2P0SA 1BIYA 5I58A 5AA4A 4GD5A 1IXCA 2ZYKA 4EUOA 3GBAA 1P1OA 4JWXA 5I2NA 2HCAA 4HW8A 1MPDA 4LP2B 5AA2B 1B3HA 4QSDA 3G3GA 3GBBA 1TFDA 4YU0A 4OERA 4DIGA 4P11A 4E0XA 2FYIA 3HO7A 2UVGA 3IJXB 4DCYA 1B3GA 1MDP1 2NWJA 2PMSA 4QRZA 4NF8A 2QMWA 4HS7A 1MH3A 4ISUA 1B3FA 4PETA 4YB7A 4KHZE 3IR1A 2DXYA 3RN8A 3OEKA 4X1BA 3CFXA 3PUZE 4KR5A 3SEVA 4OFOA 3SETA 4OFJA 4Q5TA 1BP5A 3PPOA 4TLMB 3MVWA 1AH5A 3QSLA 5CMBA 4U4SA 5I2KB 1JQFA 3G3IA 2Y84A 4OETA 1DPEA 1VSOA 3UGWA 4GIZA 4RXLA 3CFLA 3QUJA 2R6GE 4X48A 3PD8A 2RC7A 3RT8A 1MG1A 4OZ9A 2VP1A 3JZJA 1LFHA 1US4A 4BDQA 3UK4A 3N6TA 4NWDA 3PU5A 3PUVE 4QFOA 1LB9A 3EHSA 1QUJA 2UVJA 2RC9A 1ANFA 2F97A 5TU0A 1J1NA 2XHDA 3U8QA 1N3XA 3Q26A 2H25A 3Q27A 2I4CA 4JB7A 2DWHA 2I3VA 4JXIA 1D9VA 5I56B 1VFDA 1FQCA 3IOVA 3R26A 1NH8A 4F2QA 3LSFB 3U72A 3L6HA 4NF5B 5H8HA 4BDRA 1LAFE 1IQ7A 3K4UA 3FV1A 4ZS9A 3OD7A 3GXAA 3KN8A 4ZEIA 2QPQA 2PVUA 2I0BA 1M5BA 3FVGA 4FJPA 3FUZA 4LZ7A 4U4XA 3T9VA 4P0IA 3A09A 4YMBA 3DLNA 4IO5A 3W15C 4R9FA 3MWBA 2ZNSA 1P99A 1QUKA 2PT2A 3TCFA 4OYVA 4R2BA 2GRVA 3PD9A 1B58A 4XKPA 2V3TA 4XTCQ 4WKMA 1BTJA 1SYIA 3G3HA 3MZBA 3IAZA 3V5AA 3R7XA 3B6TA 1M5CA 5DEXA 1MDQA 1XC1A 2HAUA 1YCJA 1B5JA 1XVYA 3PPNA 5KZTA 4ND9A 1VE4A 3VVDA 1MH4A 4RK9A 2W7YA 5H8FB 3PUXE 1Y20A 3OEMA 2RC8A 1FTOA 1N7XA 2I4BA 3ILTB 5F1QA 2REGA 2CZLA 3TCHA 3SDFA 4IGTA 3TUSA 4G68B 3PPRA 4R74A 5EYFA 1MXVA 3VVEA 4F1YA 3C36A 4PQJA 3M3LA 3KOSA 3IX1A 2DWAA 1PBPA 2F35A 1R9QA 4ELPA 3EQ1A 5AE4A 4R6YA 4TOZA 2XD3A 4LQ2A 3I6VA 2XXVA 1MY3A 3B6QA 3TTMA 4G8HA 4OESA 1SYHA 3DP4A 4YZZA 1Q35A 2XX9A 1POTA 4MLQA 3B6WA 2UYEA 1N7WA 1JVXA 5H8SA 4PFTA 4YKKA 3I3VA 4WEPA 1MXYA 2QS1A 1EZOA 3KFMA 2DXRA 5H8NB 4EQ9A 5JTYB 3JV9A 4DDDA 2QRYA 1UTBB 1N76A 2F7CA 2DQVA 3MZ1A 4F31B 3RQTA 1OVTA 2DOJA 3MP1A 3K6UA 3TCGA 3DP6A 2P2AA 1WODA 2XXXA 2XXWA 1B52A 4RPOA 1Y4TA 1FQBA 3CRBA 3IL1B 5FHOA 5TPAB 3T9UA 2Y7WA 4WXJA 2D5WA 3JYRA 3TQWA 2XXTA 2LAOA 3GLBA 2OZZA 3RTFB 2RKMA 2XXUA 2WKYA 3OMBA 3H7MA 3FGSA 3K00A 1MM7A 3UN6A 1B2HA 1D4NA 3K6XA 4I1DA 3RY3A 4NMYA 2Z8FA 3IK6B 4OWDA 5FTHA 1I69A 3HN0A 3L6GA 5L8DA 3IB2A 2YPNA 3OO7A 5H8QB 4KI0E 4H0WA 3PUYE 3IOWA 3MW0A 4KFQA 1B32A 4XKQA 5CI5A 3FJGA 1S9TA 2FNCA 1B0LA 1NNFA 1GV8A 1SW4A 2V84A 1DMBA 1QJMA 2RCAA 2M8CA 4YKJA 4DE8A 2PYYA 2HFBA 4EF2A 4OEVA 5LOMA 3K2DA 3ZS6A 1A7LA 3E13X 4DCXA 2HAVA 4OHNA 1URSA 1EZPA 1B3EA 3RT6B 1DTGA 1EU8A 2ABHA 5JK4A 1FQDA 3T93B 5KDTA 5TP9A 2Y7IA 2V25A 5B7DA 2XXPA 1XS5A 2R71A 3N5LA 4IB2A 4FEBA 4BDOA 4N6PA 2NOOA 3RNNA 3PPQA 4Q8RA 4R72A 4X9TA 1LAGE 5ITPA 2F7AA 1B0HA 1R6ZA 1YPNA 3LSWA 3OO8A 4GF8A 2DE2A 4EF1A 5CC2A 2ZNUA 3FV2A 2XX8A 4IY5A 2VGQA 1IXHA 1JW1A 4OTEA 3MVYA 2DE3A 1F9BA 4BLAA 2XXQA 2DS9A 3D4GA 3KJTA 4QFKA 1NNTA 2X7QA 3MZ9A 3IJOB 3G3FA 3E4RA 3H6VA 3RLFE 5KCJB 3V83A 3G7WA 2VD3A 2F6PA 1B9JA 5BWJA 1B46A 3ECRA 3C31A 3IORA 4LATA 1LB8A 2H9BA 2F5XA 4BDMA 2H99A 1H3DA 3OENA 2OJTA 2VOZA 5H8HB 3H6TA 4NWCA 4G68C 5HPQA 3M3KA 4H65A 4F29A 3K6VA 1HSLA 3FJMA 3UA8A 5I59A 3SEUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EZ9 A;  4I62 A;  3QYT A;  2XXY A;  1QKA A;  1JNF A;  1ZU0 A;  4F3B A;  5DYH A;  4F3S A;  3FD3 A;  2H4I A;  5AA2 D;  3IOU A;  4IO6 A;  2IEE A;  2GHB A;  1BKA A;  1KWH A;  4G8M A;  1ZJL A;  2XX7 A;  1B5I A;  4H67 A;  2PT1 A;  3MPK A;  3MQ9 A;  1FTJ A;  5CBS A;  1B1H A;  1CE2 A;  3TFL A;  1NNP A;  4QFL A;  4KQP A;  4YIC A;  4PFY A;  2AL5 A;  2BJJ X;  4GRK A;  3G3J A;  4DLD A;  4KD5 A;  3LSL A;  1IEJ A;  4LUB A;  4ELO A;  3VVF A;  3MP6 A;  1LAH E;  4YB5 A;  3VV5 A;  3KEI A;  3BFT A;  4ZEB A;  3TMG A;  1TWY A;  3TEP A;  3A3C A;  4K3F A;  1I6Q A;  3SER A;  3TDJ A;  5AA2 A;  4UAC A;  4KYD A;  2XXI A;  4POW A;  1MY4 A;  2AL4 A;  3S9M C;  4ZDM A;  3OSQ A;  3KN7 A;  2DE4 A;  2DVC A;  4G2Z A;  5CMK A;  1QKB A;  5ISU A;  2A5S A;  4GXS B;  2RIN A;  2X26 A;  1MQH A;  1TT1 A;  4PFW A;  1Y9U A;  1LAX A;  1MQD A;  1B05 A;  3EHT A;  2HXW A;  3VDF A;  2I6E A;  3O6I A;  5CM6 A;  2GH9 A;  4G4P A;  1PB8 A;  2Z22 A;  4P0G A;  3C34 A;  3QXM A;  1T0K A;  1ZLQ A;  5JEI A;  4FAJ A;  3EPE A;  4AB5 A;  4H1X A;  3MP8 A;  1PB7 A;  3CFZ A;  3E9X A;  4OQO A;  3TTR A;  3C4M A;  5I2K A;  1O64 A;  3FVO A;  4O3A A;  2CMO A;  3VXB A;  3ZSF A;  3OSR A;  4NF4 B;  3TKD A;  4ZEC A;  3LC8 A;  2P1S A;  4DXC A;  5AA1 A;  3M3F A;  5I57 B;  5F7V A;  1VR5 A;  1TFA A;  1B40 A;  1IZ1 A;  5DT6 A;  4R75 A;  1MXU A;  1SVX B;  3CSB A;  2F78 A;  3FXU A;  2H5Y A;  3KJ7 A;  1A54 A;  4I8C A;  1B7U A;  4F39 A;  2R9J A;  1H76 A;  1TXF A;  2FA7 A;  3LR1 A;  3OEL A;  4JBZ A;  3QUF A;  2RCB A;  1UTH A;  3H03 A;  1MQG A;  1MPC A;  4YAH X;  4F1V A;  4BDN A;  4EQ7 A;  3ILU B;  2YLN A;  3N6U A;  4ZE8 A;  3C35 A;  3V8X B;  3HCQ A;  2DWI A;  4MF3 A;  2Y7K A;  3K1M A;  3TEL A;  4NF5 A;  4Q0C A;  4GVO A;  1IUD A;  3KN3 A;  1II5 A;  1LFG A;  1MM6 A;  4GLI A;  3S9L C;  3D4C A;  4HCY A;  1JEU A;  4EXL A;  1SW2 A;  3FVK A;  3N26 A;  3K02 A;  3IB0 A;  4DXU A;  1USY E;  3C32 A;  1MRP A;  4AB6 A;  1LST A;  3RPW A;  1B1X A;  5HM4 B;  4ZE9 A;  4F3P A;  1MPB A;  4L17 A;  4POX A;  4FE8 A;  3DP8 A;  5FHM A;  1NFT A;  1R1N A;  4XKR A;  3T9X B;  1B51 A;  4PE5 B;  5KDT B;  4FAT A;  1LFI A;  5ICQ A;  5L9S A;  1M5D A;  1ATG A;  4R6H A;  3O28 A;  3KSX A;  3LSX A;  2HZK A;  4XIG Q;  4G77 A;  2A5T A;  4NF6 B;  2O69 A;  4KPT A;  3VLW A;  2ZMB A;  4YMA A;  3EF7 A;  4U1O A;  2ALU A;  5H8F A;  1M5E A;  4U2R A;  3TZA A;  5IAI A;  2B3F A;  4JWO A;  1UIV A;  4OMB A;  5L9M A;  3Q28 A;  1N0T A;  4G68 A;  3USD A;  5I58 B;  5AA4 B;  5L9O A;  1B5H A;  1QUI A;  3Q29 A;  5I2N B;  2O1M A;  1IIT A;  4LA9 A;  4KYS A;  4Z0I A;  1AOV A;  2DWJ A;  3BFU A;  5DVF A;  4HTG A;  2OWT A;  1NL5 A;  4M4G A;  2Q2A A;  5FTI A;  1JW4 A;  4GXA A;  3O6H A;  1ZKB A;  3SEY A;  3KBR A;  2OK2 A;  4F18 A;  4IO2 A;  1XVX A;  4FEC A;  2ZYM A;  4H8J A;  4NF8 B;  3F11 A;  4KCD A;  3O6G A;  3T96 B;  2QMX A;  3ZKK A;  2F7B A;  1B7H A;  1VFE A;  1MQJ A;  1D9Y A;  5BUU A;  2DP8 A;  2YJP A;  2GFE A;  1B3L A;  2ZYO A;  5H8N A;  5JTY A;  1UTB A;  4QSE A;  4YKI A;  1OLA A;  1PB9 A;  3CIJ A;  3WAF A;  1FCK A;  3MJN A;  4EXK A;  3W9W A;  4FED A;  2HZL A;  1HSE A;  1S7Y A;  2NVU B;  2ONS A;  3PGF A;  1MS7 A;  2H98 A;  4I9D A;  4IY6 A;  5J1D A;  3TTL A;  2XXH A;  3K01 A;  2O6A A;  1P1N A;  4JSD A;  3IB1 A;  1SI0 A;  1FTK A;  4EQB A;  1B4Z A;  1XOC A;  4KCC A;  4F22 A;  1A40 A;  3VLV A;  3QAX A;  2Y7R A;  5DVI A;  1B6H A;  1OQG A;  3T9H B;  3TTN A;  4ZEF A;  2O51 A;  3THI A;  3HHF A;  1EH3 A;  4OFL A;  1Q1K A;  2O1L A;  3EHU A;  4KYE A;  2HQ0 A;  4F2O A;  1WDN A;  1OMP A;  2UVI A;  1I6B A;  2V3Q A;  3TQL A;  1P1Q A;  3FZV A;  3H6U A;  1A8F A;  2QS4 A;  1ZIU A;  2PBW A;  3PMV A;  3U94 A;  5DVJ A;  1FQF A;  3CI8 A;  4MFI A;  5H8Q A;  2QL3 A;  4RY1 A;  5ITO A;  2I3W A;  1URG A;  2G29 A;  4FIM A;  4ECF A;  1A8E A;  5M2V A;  3TTK A;  4JWY A;  1DSN A;  2NXO A;  4R6K A;  4F3G A;  1R9L A;  1O7T A;  1ZMG A;  5A5X A;  4QFP A;  3VE1 B;  1XT8 A;  3H06 B;  5DTB A;  2G93 A;  1UIU A;  2PX1 A;  2Z8D A;  4TQU Q;  3UOR A;  1FTL A;  1Y3Q A;  3WAE A;  5K2Y A;  3IO4 A;  1Y3P A;  2I58 A;  1RKM A;  4QHQ A;  4DXB A;  5DEX B;  3HV1 A;  3IOT A;  4QFN A;  1ZBM A;  4RYA A;  4LZ5 A;  3A3U A;  3DEL B;  4RJZ A;  1A99 A;  4MH5 A;  4ONY A;  1MXX A;  2DYX A;  5CBR A;  4C0R A;  2O68 A;  3MUQ A;  3V89 B;  3S9N C;  3QIM A;  2NUV A;  1Y1Z A;  2F6G A;  3SEX A;  1IXG A;  1LCT A;  4JDF A;  1NNK A;  2F8D A;  4QSC A;  2OLB A;  2Q8J A;  3UP9 A;  5KCJ A;  1UTH B;  1MY2 A;  2Z23 A;  3FXR A;  3CG3 A;  3M8U A;  3RGY A;  1CB6 A;  1SD3 A;  3N94 A;  1N04 A;  3KG2 A;  4ZZE A;  1LCF A;  3O66 A;  5CRY A;  4O3B A;  2QS2 A;  2ZNT A;  3KSJ A;  2I48 A;  2O84 X;  1JEV A;  1XHY A;  4GL0 A;  4THI A;  2THI A;  1SW1 A;  4ZZA A;  1AIV A;  1BLF A;  4IO4 A;  4IGR A;  1NMU A;  3HHG A;  4MBP A;  4AQ4 A;  4Z7E A;  2ANJ A;  2B3B A;  1GTK A;  1AMF A;  3LBS A;  4WED A;  2DSF A;  1LGB C;  4NTL A;  4ELQ A;  4BDL A;  1NKX A;  2V3U A;  4XKN A;  2O7U A;  3FAS A;  2AYS A;  2KLF A;  2Q2C A;  4C1T A;  3Q25 A;  3FIR A;  2D3I A;  3ONM A;  4GL8 A;  2ZYN A;  3PMW A;  1MXW A;  1P1W A;  3H3G A;  3ODB A;  2Q89 A;  3FAT A;  3EN3 A;  1OVB A;  4TLL B;  2RF1 A;  3CG1 A;  4LQ5 A;  2QSX A;  1DPP A;  3VLU A;  3S2V A;  2OWS A;  4OXV A;  3U1O A;  5IKB A;  3MVZ A;  4LVQ A;  2D21 A;  1AL3 A;  1P1U A;  2UYF A;  2A5T B;  1US5 A;  2QJE A;  1N3W A;  2ONR A;  3K0V A;  5AA3 A;  2F36 A;  3O29 A;  4H6D A;  4C1U A;  1MY0 A;  4FOR A;  3GZG A;  1IIW A;  3KGC A;  3CSG A;  2VHA A;  4HCW A;  3QK6 A;  3HPI A;  3BKI B;  3OO6 A;  1OQH A;  3K6W A;  4NE4 A;  3VFJ A;  4E0W A;  2GHA A;  3OOA A;  2V93 A;  5I56 A;  4H5F A;  3PMX A;  4EDP A;  2ONK E;  5CMM A;  2OBG A;  3SES A;  1LBB A;  3U93 A;  4F19 A;  3ZKL A;  1USY H;  1S50 A;  4JSO A;  4DZ1 A;  3FVN A;  4RK2 A;  1H44 A;  3W9V A;  3PPP A;  4RPN A;  1D3K A;  5I84 A;  4M1V A;  2VD2 A;  2XXR A;  5B70 A;  1Z7N E;  3HST A;  4X1D A;  4OVJ A;  1QUL A;  2X7P A;  1PDA A;  4H8I A;  1JVY A;  4ZEK A;  2UXA A;  3MC2 A;  4OEU A;  1QVS A;  3H4Z A;  3LUY A;  3T22 A;  1Y3N A;  1B7Z A;  5HBC A;  4G8N A;  1LLS A;  1N84 A;  1QW0 A;  1RYX A;  3SKP A;  4RNS A;  4LON B;  5TP9 B;  5CMC A;  1SDX A;  3P7I A;  3MPL A;  3PV0 E;  4NF4 A;  3O2A A;  3T66 A;  1M5F A;  1MQI A;  5EHM A;  3O9P A;  3S4U A;  3AXF A;  1Y4C A;  4QF9 A;  5I57 A;  5FHN A;  1ZTY A;  4U21 A;  4N07 A;  4R73 A;  4GFR A;  1FW0 A;  3C33 A;  1OIB A;  3U92 A;  1YAE A;  4YKP A;  3BBR A;  5ICT A;  1GGG A;  2QS3 A;  1SI1 A;  3E3K A;  1MXZ A;  3C9H A;  4F1U A;  3S9E A;  4YB6 A;  4NED A;  2DVZ A;  4ESX A;  1JET A;  5K2X A;  3RUM A;  3K1N A;  1UQW A;  3DM0 A;  1ELJ A;  1NH7 A;  4UA8 A;  4ELR A;  1DTZ A;  1DOT A;  1FQA A;  4IO7 A;  4OEN A;  2OCU A;  3IO6 A;  1PBQ A;  2XD2 A;  1H45 A;  3KZG A;  2IA4 A;  4RA1 A;  4PP0 A;  3TYH A;  4R9G A;  2O7I A;  3O97 A;  3FJ7 A;  2REJ A;  3MAM A;  2E1S A;  5EHS A;  3TAJ A;  1SQY A;  5I59 B;  3H6W A;  1WVJ A;  4ZED A;  1O63 A;  1JW5 A;  1POY 1;  3VXC A;  1PEB A;  1YTV A;  5A5X B;  4GWO A;  1GR2 A;  5ELV A;  2ZXT A;  4Q30 B;  2Q88 A;  1A55 A;  4U22 A;  4XXU A;  3G3K A;  3CR9 A;  3MVX A;  3CVG A;  1SW5 A;  1PC3 A;  4H5G A;  3PUW E;  1H43 A;  1IXI A;  1I6A A;  2F34 A;  2Z8E A;  4GOT A;  1HSJ A;  3OXN A;  4R2F A;  1L5T A;  1RYO A;  3K1P A;  1B4H A;  3B7D A;  1LBC A;  4IO3 A;  2B65 A;  2ESN A;  4O3C A;  4NF6 A;  3FXQ A;  3OO9 A;  1Y1M A;  2I49 A;  4LZ8 A;  1Z7M E;  3I5O A;  2AIX A;  2Q9T A;  5TPA A;  3TOD A;  4PFU A;  4ESW A;  1OLC A;  4MLV A;  4U23 A;  4U1Z A;  2I0C A;  2UVH A;  1URD A;  4GQO A;  1FTM A;  3RTW B;  3UIF A;  2HEU A;  3KOT A;  3R6U A;  2Y7P A;  4N13 A;  3SEW A;  2E0S A;  3MBP A;  1MY1 A;  1SBP A;  1GVC A;  1FQE A;  3TPA A;  2P0S A;  1BIY A;  5I58 A;  5AA4 A;  4GD5 A;  1IXC A;  2ZYK A;  4EUO A;  3GBA A;  1P1O A;  4JWX A;  5I2N A;  2HCA A;  4HW8 A;  1MPD A;  4LP2 B;  5AA2 B;  1B3H A;  4QSD A;  3G3G A;  3GBB A;  1TFD A;  4YU0 A;  4OER A;  4DIG A;  4P11 A;  4E0X A;  2FYI A;  3HO7 A;  2UVG A;  3IJX B;  4DCY A;  1B3G A;  1MDP 1;  2NWJ A;  2PMS A;  4QRZ A;  4NF8 A;  2QMW A;  4HS7 A;  1MH3 A;  4ISU A;  1B3F A;  4PET A;  4YB7 A;  4KHZ E;  3IR1 A;  2DXY A;  3RN8 A;  3OEK A;  4X1B A;  3CFX A;  3PUZ E;  4KR5 A;  3SEV A;  4OFO A;  3SET A;  4OFJ A;  4Q5T A;  1BP5 A;  3PPO A;  4TLM B;  3MVW A;  1AH5 A;  3QSL A;  5CMB A;  4U4S A;  5I2K B;  1JQF A;  3G3I A;  2Y84 A;  4OET A;  1DPE A;  1VSO A;  3UGW A;  4GIZ A;  4RXL A;  3CFL A;  3QUJ A;  2R6G E;  4X48 A;  3PD8 A;  2RC7 A;  3RT8 A;  1MG1 A;  4OZ9 A;  2VP1 A;  3JZJ A;  1LFH A;  1US4 A;  4BDQ A;  3UK4 A;  3N6T A;  4NWD A;  3PU5 A;  3PUV E;  4QFO A;  1LB9 A;  3EHS A;  1QUJ A;  2UVJ A;  2RC9 A;  1ANF A;  2F97 A;  5TU0 A;  1J1N A;  2XHD A;  3U8Q A;  1N3X A;  3Q26 A;  2H25 A;  3Q27 A;  2I4C A;  4JB7 A;  2DWH A;  2I3V A;  4JXI A;  1D9V A;  5I56 B;  1VFD A;  1FQC A;  3IOV A;  3R26 A;  1NH8 A;  4F2Q A;  3LSF B;  3U72 A;  3L6H A;  4NF5 B;  5H8H A;  4BDR A;  1LAF E;  1IQ7 A;  3K4U A;  3FV1 A;  4ZS9 A;  3OD7 A;  3GXA A;  3KN8 A;  4ZEI A;  2QPQ A;  2PVU A;  2I0B A;  1M5B A;  3FVG A;  4FJP A;  3FUZ A;  4LZ7 A;  4U4X A;  3T9V A;  4P0I A;  3A09 A;  4YMB A;  3DLN A;  4IO5 A;  3W15 C;  4R9F A;  3MWB A;  2ZNS A;  1P99 A;  1QUK A;  2PT2 A;  3TCF A;  4OYV A;  4R2B A;  2GRV A;  3PD9 A;  1B58 A;  4XKP A;  2V3T A;  4XTC Q;  4WKM A;  1BTJ A;  1SYI A;  3G3H A;  3MZB A;  3IAZ A;  3V5A A;  3R7X A;  3B6T A;  1M5C A;  5DEX A;  1MDQ A;  1XC1 A;  2HAU A;  1YCJ A;  1B5J A;  1XVY A;  3PPN A;  5KZT A;  4ND9 A;  1VE4 A;  3VVD A;  1MH4 A;  4RK9 A;  2W7Y A;  5H8F B;  3PUX E;  1Y20 A;  3OEM A;  2RC8 A;  1FTO A;  1N7X A;  2I4B A;  3ILT B;  5F1Q A;  2REG A;  2CZL A;  3TCH A;  3SDF A;  4IGT A;  3TUS A;  4G68 B;  3PPR A;  4R74 A;  5EYF A;  1MXV A;  3VVE A;  4F1Y A;  3C36 A;  4PQJ A;  3M3L A;  3KOS A;  3IX1 A;  2DWA A;  1PBP A;  2F35 A;  1R9Q A;  4ELP A;  3EQ1 A;  5AE4 A;  4R6Y A;  4TOZ A;  2XD3 A;  4LQ2 A;  3I6V A;  2XXV A;  1MY3 A;  3B6Q A;  3TTM A;  4G8H A;  4OES A;  1SYH A;  3DP4 A;  4YZZ A;  1Q35 A;  2XX9 A;  1POT A;  4MLQ A;  3B6W A;  2UYE A;  1N7W A;  1JVX A;  5H8S A;  4PFT A;  4YKK A;  3I3V A;  4WEP A;  1MXY A;  2QS1 A;  1EZO A;  3KFM A;  2DXR A;  5H8N B;  4EQ9 A;  5JTY B;  3JV9 A;  4DDD A;  2QRY A;  1UTB B;  1N76 A;  2F7C A;  2DQV A;  3MZ1 A;  4F31 B;  3RQT A;  1OVT A;  2DOJ A;  3MP1 A;  3K6U A;  3TCG A;  3DP6 A;  2P2A A;  1WOD A;  2XXX A;  2XXW A;  1B52 A;  4RPO A;  1Y4T A;  1FQB A;  3CRB A;  3IL1 B;  5FHO A;  5TPA B;  3T9U A;  2Y7W A;  4WXJ A;  2D5W A;  3JYR A;  3TQW A;  2XXT A;  2LAO A;  3GLB A;  2OZZ A;  3RTF B;  2RKM A;  2XXU A;  2WKY A;  3OMB A;  3H7M A;  3FGS A;  3K00 A;  1MM7 A;  3UN6 A;  1B2H A;  1D4N A;  3K6X A;  4I1D A;  3RY3 A;  4NMY A;  2Z8F A;  3IK6 B;  4OWD A;  5FTH A;  1I69 A;  3HN0 A;  3L6G A;  5L8D A;  3IB2 A;  2YPN A;  3OO7 A;  5H8Q B;  4KI0 E;  4H0W A;  3PUY E;  3IOW A;  3MW0 A;  4KFQ A;  1B32 A;  4XKQ A;  5CI5 A;  3FJG A;  1S9T A;  2FNC A;  1B0L A;  1NNF A;  1GV8 A;  1SW4 A;  2V84 A;  1DMB A;  1QJM A;  2RCA A;  2M8C A;  4YKJ A;  4DE8 A;  2PYY A;  2HFB A;  4EF2 A;  4OEV A;  5LOM A;  3K2D A;  3ZS6 A;  1A7L A;  3E13 X;  4DCX A;  2HAV A;  4OHN A;  1URS A;  1EZP A;  1B3E A;  3RT6 B;  1DTG A;  1EU8 A;  2ABH A;  5JK4 A;  1FQD A;  3T93 B;  5KDT A;  5TP9 A;  2Y7I A;  2V25 A;  5B7D A;  2XXP A;  1XS5 A;  2R71 A;  3N5L A;  4IB2 A;  4FEB A;  4BDO A;  4N6P A;  2NOO A;  3RNN A;  3PPQ A;  4Q8R A;  4R72 A;  4X9T A;  1LAG E;  5ITP A;  2F7A A;  1B0H A;  1R6Z A;  1YPN A;  3LSW A;  3OO8 A;  4GF8 A;  2DE2 A;  4EF1 A;  5CC2 A;  2ZNU A;  3FV2 A;  2XX8 A;  4IY5 A;  2VGQ A;  1IXH A;  1JW1 A;  4OTE A;  3MVY A;  2DE3 A;  1F9B A;  4BLA A;  2XXQ A;  2DS9 A;  3D4G A;  3KJT A;  4QFK A;  1NNT A;  2X7Q A;  3MZ9 A;  3IJO B;  3G3F A;  3E4R A;  3H6V A;  3RLF E;  5KCJ B;  3V83 A;  3G7W A;  2VD3 A;  2F6P A;  1B9J A;  5BWJ A;  1B46 A;  3ECR A;  3C31 A;  3IOR A;  4LAT A;  1LB8 A;  2H9B A;  2F5X A;  4BDM A;  2H99 A;  1H3D A;  3OEN A;  2OJT A;  2VOZ A;  5H8H B;  3H6T A;  4NWC A;  4G68 C;  5HPQ A;  3M3K A;  4H65 A;  4F29 A;  3K6V A;  1HSL A;  3FJM A;  3UA8 A;  5I59 A;  3SEU A; 
#chains in the Genus database with same CATH topology
 1EZ9 A;  1FBE A;  4I62 A;  3QYT A;  2XXY A;  1QKA A;  1JNF A;  1ZU0 A;  2QFL A;  1FPB A;  4F3B A;  5DYH A;  3BIH A;  4F3S A;  3FD3 A;  2H4I A;  5AA2 D;  3IOU A;  4IO6 A;  2IEE A;  4PAF A;  2GHB A;  2PFZ A;  1BKA A;  1KWH A;  4G8M A;  1ZJL A;  2XX7 A;  1B5I A;  4H67 A;  2PT1 A;  3MPK A;  3MQ9 A;  1FTJ A;  4MHF A;  5CBS A;  1B1H A;  1CE2 A;  2VPO A;  3TFL A;  1NNP A;  4QFL A;  4KQP A;  4YIC A;  4PFY A;  2QVV A;  2AL5 A;  2BJJ X;  4GRK A;  3G3J A;  4DLD A;  4KD5 A;  3LSL A;  1IEJ A;  4LUB A;  4ELO A;  3VVF A;  3MST A;  3MP6 A;  1LAH E;  1KZ8 A;  4YB5 A;  3VV5 A;  3KEI A;  3BFT A;  1FBD A;  4ZEB A;  3SZP A;  3TMG A;  1TWY A;  3TEP A;  3A3C A;  4K3F A;  1D9Q A;  1I6Q A;  3SER A;  2WBD A;  3TDJ A;  5ET5 A;  5AA2 A;  4UAC A;  4KYD A;  2XXI A;  4POW A;  1MY4 A;  4GWU A;  2AL4 A;  3S9M C;  4ZDM A;  4AS5 A;  4P8B A;  3LUZ A;  3OSQ A;  3KN7 A;  2DE4 A;  2DVC A;  4G2Z A;  5CMK A;  1NV1 A;  1FPE A;  1QKB A;  5ISU A;  2A5S A;  4GXS B;  1EYK A;  2RIN A;  2X26 A;  1MQH A;  1TT1 A;  4PFW A;  1Y9U A;  1LAX A;  1MQD A;  1B05 A;  3EHT A;  2HXW A;  2Q74 A;  2I6E A;  3VDF A;  3O6I A;  5CM6 A;  2GH9 A;  4G4P A;  1PB8 A;  2Z22 A;  4P0G A;  3C34 A;  3QXM A;  1T0K A;  1ZLQ A;  5JEI A;  4FAJ A;  3EPE A;  4AB5 A;  4H1X A;  3MP8 A;  1PB7 A;  3CFZ A;  3E9X A;  4OQO A;  3TTR A;  3C4M A;  5I2K A;  1O64 A;  3FVO A;  4O3A A;  4OVP A;  5T3J A;  2CMO A;  2KR0 A;  3VXB A;  3ZSF A;  3OSR A;  4NF4 B;  3TKD A;  4ZEC A;  3LC8 A;  2P1S A;  4DXC A;  4N15 A;  2QVR A;  5AA1 A;  2QVU A;  4HXV A;  3M3F A;  5I57 B;  5F7V A;  1VR5 A;  1TFA A;  1B40 A;  1IZ1 A;  5DT6 A;  4R75 A;  1MXU A;  1SVX B;  3CSB A;  4OVR A;  2F78 A;  3FXU A;  2H5Y A;  2B4L A;  3KJ7 A;  1RDX A;  1A54 A;  4I8C A;  1B7U A;  4P3L A;  4F39 A;  2R9J A;  1H76 A;  1TXF A;  2FA7 A;  3LR1 A;  3OEL A;  4JBZ A;  3QUF A;  2RCB A;  1UTH A;  3H03 A;  1MQG A;  1MPC A;  4YAH X;  4F1V A;  4BDN A;  1SPI A;  4EQ7 A;  3ILU B;  5I3S A;  2YLN A;  3N6U A;  3RYD A;  4ZE8 A;  3C35 A;  3V8X B;  3HCQ A;  2DWI A;  4MF3 A;  1KA1 A;  2Y7K A;  3K1M A;  1NV5 A;  3TEL A;  4NF5 A;  4NF0 A;  4Q0C A;  4GVO A;  1IUD A;  4N91 A;  3KN3 A;  1II5 A;  1LFG A;  1MM6 A;  4GLI A;  3S9L C;  3D4C A;  4HCY A;  1JEU A;  4EXL A;  1SW2 A;  3FVK A;  3N26 A;  1FTA A;  4GBV A;  1FBC A;  3K02 A;  3IB0 A;  4DXU A;  1USY E;  3C32 A;  1MRP A;  1FPK A;  4AB6 A;  1LST A;  1IMA A;  3RPW A;  1B1X A;  5HM4 B;  4ZE9 A;  4F3P A;  4P56 A;  1MPB A;  4L17 A;  4POX A;  4FE8 A;  2V4C A;  3DP8 A;  5FHM A;  1NFT A;  1R1N A;  1LBZ A;  4XKR A;  4N81 A;  3T9X B;  1B51 A;  4PE5 B;  5KDT B;  4FAT A;  1LFI A;  5ICQ A;  5L9S A;  1IMB A;  1M5D A;  1ATG A;  4R6H A;  3O28 A;  3KSX A;  3LSX A;  2HZK A;  4XIG Q;  4G77 A;  2A5T A;  4NF6 B;  2O69 A;  4KPT A;  1YZ0 A;  3VLW A;  2ZMB A;  4YMA A;  3EF7 A;  4U1O A;  2ALU A;  5H8F A;  1M5E A;  4U2R A;  3TZA A;  5IAI A;  4OVS A;  4IR8 A;  2B3F A;  4JWO A;  1UIV A;  4OMB A;  5L9M A;  1NUZ A;  3Q28 A;  1N0T A;  4G68 A;  3USD A;  5I58 B;  5AA4 B;  2FHY A;  5L9O A;  1B5H A;  1QUI A;  3Q29 A;  4PF6 A;  5EQ7 A;  5I2N B;  2O1M A;  1IIT A;  4LA9 A;  4KYS A;  3A29 A;  4H45 A;  4Z0I A;  1AOV A;  2XXK A;  2DWJ A;  3BFU A;  5DVF A;  4HTG A;  2OWT A;  1NL5 A;  4M4G A;  2Q2A A;  5FTI A;  1JW4 A;  4GXA A;  3O6H A;  1ZKB A;  2CEX A;  1NV0 A;  3SEY A;  3KBR A;  2OK2 A;  4MNP A;  4F18 A;  4IO2 A;  1XVX A;  2PFY A;  4FEC A;  2ZYM A;  4H8J A;  4NF8 B;  3F11 A;  4KCD A;  3O6G A;  3T96 B;  2QMX A;  3ZKK A;  2F7B A;  3RPL B;  1B7H A;  1VFE A;  1MQJ A;  1D9Y A;  5BUU A;  2DP8 A;  2YJP A;  2GFE A;  2XWK A;  1B3L A;  2ZYO A;  5H8N A;  5JTY A;  1UTB A;  4QSE A;  4YKI A;  1OLA A;  1PB9 A;  3CIJ A;  3WAF A;  1FCK A;  3GYY A;  3MJN A;  4EXK A;  3W9W A;  4FED A;  2HZL A;  1HSE A;  1S7Y A;  2NVU B;  2ONS A;  3PGF A;  1MS7 A;  2H98 A;  4I9D A;  4IY6 A;  5J1D A;  3TTL A;  4PTK A;  4PAI A;  2XXH A;  3K01 A;  3MYU A;  2O6A A;  1P1N A;  3HFU A;  4MAG A;  4JSD A;  3IB1 A;  1SI0 A;  4FBP A;  1FTK A;  4EQB A;  1B4Z A;  1XOC A;  4KCC A;  4X8R A;  4F22 A;  1A40 A;  3VLV A;  3QAX A;  2Y7R A;  5DVI A;  1B6H A;  1OQG A;  3T9H B;  3KBZ A;  3TTN A;  1NUX A;  4ZEF A;  2O51 A;  3THI A;  5I7I A;  3HHF A;  1EH3 A;  5EYG A;  4OFL A;  4QXD A;  1Q1K A;  2O1L A;  3EHU A;  2WBB A;  4KYE A;  2HQ0 A;  4F2O A;  1WDN A;  1OMP A;  3E79 A;  2UVI A;  1I6B A;  2V3Q A;  3TQL A;  1P1Q A;  3FZV A;  3H6U A;  1A8F A;  4OVQ A;  2XWO A;  2QS4 A;  1FPF A;  1ZIU A;  2PBW A;  3PMV A;  3U94 A;  5DVJ A;  1FQF A;  3CI8 A;  4MFI A;  5H8Q A;  2QL3 A;  4RY1 A;  5ITO A;  1G0I A;  2I3W A;  1URG A;  2G29 A;  4FIM A;  4ECF A;  1A8E A;  4MNC A;  4JVD A;  5M2V A;  3TTK A;  5EQA A;  4JWY A;  1DSN A;  2DDK A;  2NXO A;  4R6K A;  4F3G A;  1R9L A;  2FBP A;  1O7T A;  1ZMG A;  5A5X A;  4QFP A;  3VE1 B;  4PF8 A;  4PDD A;  4HE0 A;  1XT8 A;  3H06 B;  5DTB A;  1LBW A;  2G93 A;  1UIU A;  2PX1 A;  2Z8D A;  4PCD A;  4TQU Q;  2CZI A;  3UOR A;  1FTL A;  3KC1 A;  5ET6 A;  1Y3Q A;  3WAE A;  5K2Y A;  1JP4 A;  3IO4 A;  1Y3P A;  4MMP A;  4PFI A;  2I58 A;  1RKM A;  3FBP A;  4O7M A;  4N4U A;  4QHQ A;  4DI3 D;  4DXB A;  1FJ9 A;  5DEX B;  4N6D A;  3HV1 A;  3IOT A;  4QFN A;  1ZBM A;  4RYA A;  4LZ5 A;  3A3U A;  4GX6 A;  3DEL B;  4RJZ A;  1A99 A;  4MH5 A;  4ONY A;  1MXX A;  2DYX A;  4NHB A;  5CBR A;  4C0R A;  2O68 A;  3MUQ A;  3V89 B;  4MX6 A;  3S9N C;  3QIM A;  2NUV A;  1Y1Z A;  2F6G A;  1QGX A;  3PTY A;  2WYP A;  3SEX A;  1IXG A;  1K9Z A;  1LCT A;  4JDF A;  1NNK A;  2F8D A;  4QSC A;  2OX3 A;  2OLB A;  2Q8J A;  3UP9 A;  5KCJ A;  1UTH B;  1MY2 A;  2Z23 A;  3FXR A;  4G61 A;  3CG3 A;  3M8U A;  3RGY A;  1CB6 A;  1SD3 A;  3N94 A;  1G0H A;  1N04 A;  4GWW A;  3KG2 A;  4ZZE A;  1LCF A;  2WYK A;  3O66 A;  1LBV A;  4O3B A;  5CRY A;  2QS2 A;  4GX3 A;  4MEV A;  2ZNT A;  4JVI A;  3KSJ A;  4OA4 A;  2I48 A;  2O84 X;  1JEV A;  1XHY A;  4GL0 A;  4THI A;  2THI A;  1SW1 A;  4I40 A;  1DCU A;  4ZZA A;  1AIV A;  1BLF A;  4IO4 A;  4IGR A;  1NMU A;  3HHG A;  4MBP A;  4AQ4 A;  4Z7E A;  2Y5K A;  2ANJ A;  2B3B A;  1GTK A;  1AMF A;  3LBS A;  4WED A;  2DSF A;  1LGB C;  4NTL A;  4ELQ A;  4BDL A;  1NKX A;  2V3U A;  4XKN A;  2Y5L A;  2O7U A;  3FAS A;  2AYS A;  2KLF A;  2Q2C A;  5EYH A;  4C1T A;  2B4M A;  3Q25 A;  3FIR A;  4JVC A;  2D3I A;  3ONM A;  4GL8 A;  2ZYN A;  3PMW A;  4X04 A;  1MXW A;  1P1W A;  3H3G A;  3ODB A;  2Q89 A;  3FAT A;  3EN3 A;  1OVB A;  4P1L A;  1FBG A;  4TLL B;  2RF1 A;  3CG1 A;  4LQ5 A;  2QSX A;  1DPP A;  4AS4 A;  2OWS A;  3S2V A;  4OXV A;  3VLU A;  3U1O A;  5IKB A;  3MVZ A;  4LVQ A;  2D21 A;  1AL3 A;  1P1U A;  2UYF A;  2A5T B;  1US5 A;  2QJE A;  1N3W A;  2ONR A;  3K0V A;  5AA3 A;  4PFR A;  2F36 A;  4GWY A;  3O29 A;  4H6D A;  4C1U A;  1MY0 A;  4FOR A;  3GZG A;  1IIW A;  3KGC A;  3CSG A;  1IMD A;  2VHA A;  3KC0 A;  2CEY A;  4HCW A;  3QK6 A;  3HPI A;  5F24 A;  3BKI B;  4KXP A;  2WX9 A;  3OO6 A;  1OQH A;  3K6W A;  2FIE A;  4NE4 A;  5LDZ A;  5ET8 A;  3VFJ A;  4E0W A;  2GHA A;  3OOA A;  2V93 A;  5I56 A;  4MIJ A;  4H5F A;  3PMX A;  4OAN A;  4EDP A;  2ONK E;  5CMM A;  2OBG A;  3SES A;  3IFA A;  1LBB A;  3U93 A;  4F19 A;  1RDY A;  3ZKL A;  1USY H;  1S50 A;  4XEQ A;  4JSO A;  4DZ1 A;  3FVN A;  4RK2 A;  1LBX A;  1H44 A;  1FPI A;  3W9V A;  3PPP A;  4RPN A;  1D3K A;  5I84 A;  4M1V A;  2VD2 A;  2XXR A;  4NQ8 A;  5B70 A;  1Z7N E;  3HST A;  4X1D A;  4OVJ A;  2HHM A;  1QUL A;  2X7P A;  1PDA A;  4H8I A;  1JVY A;  4NG7 A;  4ZEK A;  2UXA A;  3MC2 A;  4OEU A;  1QVS A;  3H4Z A;  1KA0 A;  3LUY A;  3IFC A;  3T22 A;  1Y3N A;  1B7Z A;  5HBC A;  4G8N A;  1LLS A;  1N84 A;  4P9K A;  1QW0 A;  1RYX A;  2CZH A;  3SKP A;  4RNS A;  4LON B;  5TP9 B;  5CMC A;  1SDX A;  2JJK A;  3MPL A;  3P7I A;  3PV0 E;  4NF4 A;  3O2A A;  3T66 A;  1M5F A;  1MQI A;  4H46 A;  5EHM A;  3O9P A;  3S4U A;  3AXF A;  1Y4C A;  4QF9 A;  5I57 A;  5FHN A;  1ZTY A;  4U21 A;  4N07 A;  4R73 A;  4GBW A;  4GFR A;  2WEF A;  1FW0 A;  3C33 A;  2XA5 A;  1OIB A;  3U92 A;  1YAE A;  4YKP A;  3BBR A;  5ICT A;  5J16 A;  4N8Y A;  1GGG A;  2P3N A;  3ROJ A;  2QS3 A;  1SI1 A;  3E3K A;  1MXZ A;  4NX1 A;  3C9H A;  4F1U A;  2FVZ A;  3S9E A;  4YB6 A;  4NED A;  2DVZ A;  4ESX A;  1JET A;  5K2X A;  3B50 A;  3RUM A;  3K1N A;  2XWV A;  1UQW A;  3DM0 A;  1ELJ A;  3T1B A;  1NH7 A;  4UA8 A;  4ELR A;  1DTZ A;  1DOT A;  4XF5 A;  1FQA A;  4IO7 A;  4OEN A;  2OCU A;  3IO6 A;  1PBQ A;  2XD2 A;  1H45 A;  4PAK A;  3KZG A;  2IA4 A;  4RA1 A;  5ET7 A;  4PP0 A;  3TYH A;  4R9G A;  2O7I A;  3O97 A;  3FJ7 A;  2REJ A;  3MAM A;  2E1S A;  5EHS A;  3TAJ A;  1SQY A;  5I59 B;  3H6W A;  1WVJ A;  4ZED A;  1O63 A;  1JW5 A;  1POY 1;  5ESY A;  3VXC A;  1PEB A;  1YTV A;  5A5X B;  4GWO A;  1GR2 A;  5ELV A;  1XI6 A;  2ZXT A;  4Q30 B;  2Q88 A;  1A55 A;  4U22 A;  5IZ3 A;  4XXU A;  3G3K A;  2GQ1 A;  3CR9 A;  3MVX A;  3CVG A;  1SW5 A;  1PC3 A;  4H5G A;  3PUW E;  1H43 A;  1IXI A;  1I6A A;  2F34 A;  2Z8E A;  4GOT A;  1HSJ A;  3OXN A;  4R2F A;  1L5T A;  1RYO A;  3K1P A;  1B4H A;  4O8M A;  3B7D A;  1LBC A;  4IO3 A;  2B65 A;  2ESN A;  4O3C A;  4NF6 A;  3FXQ A;  3OO9 A;  1Y1M A;  4O94 A;  2I49 A;  4LZ8 A;  1FBF A;  1Z7M E;  2AIX A;  2Q9T A;  3I5O A;  5TPA A;  4PFU A;  3TOD A;  2F3B A;  2L5V A;  4HE2 A;  4ESW A;  1OLC A;  4MLV A;  4U23 A;  4U1Z A;  2I0C A;  2UVH A;  1URD A;  4GQO A;  1FTM A;  3RTW B;  3UIF A;  1LBY A;  2HEU A;  3KOT A;  3R6U A;  2Y7P A;  4N13 A;  3SEW A;  2E0S A;  1NI9 A;  3MBP A;  1MY1 A;  1SBP A;  1GVC A;  1FQE A;  3TPA A;  2P0S A;  3EKI A;  1BIY A;  5I58 A;  5AA4 A;  4GD5 A;  1IXC A;  2ZYK A;  4EUO A;  3GBA A;  1P1O A;  4JWX A;  5I2N A;  5LTC A;  2HCA A;  4HW8 A;  1MPD A;  4PBQ A;  1EYJ A;  4LP2 B;  5AA2 B;  1B3H A;  4QSD A;  3G3G A;  1FPL A;  3GBB A;  1TFD A;  4YU0 A;  1NUW A;  5DW8 A;  4N17 A;  4OER A;  4DIG A;  2P3V A;  4P11 A;  4NAP A;  4E0X A;  2FYI A;  3HO7 A;  2UVG A;  3IJX B;  4DCY A;  1B3G A;  1MDP 1;  3BIG A;  2NWJ A;  2PMS A;  4QRZ A;  4NF8 A;  2QMW A;  4HS7 A;  1FJ6 A;  1MH3 A;  4ISU A;  1B3F A;  4PET A;  4YB7 A;  4KHZ E;  3IR1 A;  2DXY A;  3RN8 A;  3RPL A;  3OEK A;  1IMC A;  4X1B A;  4LN5 A;  3CFX A;  3PUZ E;  4KR5 A;  3SEV A;  4OFO A;  4N6K A;  3SET A;  4OFJ A;  4Q5T A;  1BP5 A;  2OWZ A;  3PPO A;  4TLM B;  3MVW A;  1INP A;  1AH5 A;  3QSL A;  5CMB A;  4U4S A;  5I2K B;  1EYI A;  1JQF A;  3G3I A;  2Y84 A;  4OET A;  1DPE A;  1VSO A;  3UGW A;  1BK4 A;  4GIZ A;  4RXL A;  2R8T A;  1NV3 A;  3CFL A;  3QUJ A;  2R6G E;  4X48 A;  3PD8 A;  2RC7 A;  3RT8 A;  1MG1 A;  4OZ9 A;  2VP1 A;  3JZJ A;  1LFH A;  1US4 A;  4BDQ A;  3UK4 A;  3N6T A;  4NWD A;  3PU5 A;  5FBP A;  3PUV E;  4QFO A;  1LB9 A;  1FPD A;  2BJI A;  1RDZ A;  3EHS A;  4OVT A;  1QUJ A;  1FBH A;  2ZZV A;  3U65 A;  2UVJ A;  5IZZ A;  2VT5 A;  2ZZW A;  2RC9 A;  4NGU A;  1ANF A;  2F97 A;  5TU0 A;  1J1N A;  1AWB A;  2XHD A;  3U8Q A;  1N3X A;  3Q26 A;  2H25 A;  3Q27 A;  1CNQ A;  2I4C A;  4JB7 A;  5A5L A;  2DWH A;  2I3V A;  4JXI A;  1D9V A;  5I56 B;  1DK4 A;  1VFD A;  1FQC A;  3IOV A;  5EQ9 A;  3R26 A;  1NH8 A;  4F2Q A;  3LSF B;  3U72 A;  3L6H A;  4NF5 B;  5H8H A;  4BDR A;  1LAF E;  1IQ7 A;  3K4U A;  3FV1 A;  4MJO A;  4ZS9 A;  1YXI A;  3OD7 A;  3GXA A;  3KN8 A;  4ZEI A;  2QPQ A;  2PVU A;  1Q9D A;  2I0B A;  1M5B A;  3FVG A;  4FJP A;  3FUZ A;  4LZ7 A;  4U4X A;  3T9V A;  4P0I A;  3A09 A;  4YMB A;  3DLN A;  1NV7 A;  5EQ8 A;  4I3E A;  4IO5 A;  3NOH A;  3W15 C;  4R9F A;  3MWB A;  2ZNS A;  1P99 A;  1QUK A;  2PT2 A;  3TCF A;  4OYV A;  4R2B A;  2GRV A;  3PD9 A;  1B58 A;  4XKP A;  2V3T A;  4XTC Q;  4WKM A;  1YYZ A;  1BTJ A;  1SYI A;  5IM2 A;  3G3H A;  3MZB A;  3IAZ A;  3V5A A;  3R7X A;  3B6T A;  1M5C A;  5DEX A;  1MDQ A;  5I5P A;  1XC1 A;  4P1E A;  2HAU A;  1YCJ A;  1B5J A;  4PE3 A;  1XVY A;  3PPN A;  5KZT A;  4ND9 A;  1VE4 A;  3VVD A;  1MH4 A;  4RK9 A;  4PFB A;  2W7Y A;  5H8F B;  3PUX E;  1NV6 A;  1Y20 A;  3OEM A;  2RC8 A;  1FTO A;  1N7X A;  2I4B A;  3ILT B;  2ZZX A;  5F1Q A;  2REG A;  2CZL A;  3TCH A;  3SDF A;  1IMF A;  4IGT A;  3TUS A;  4G68 B;  3PPR A;  4R74 A;  5EYF A;  1MXV A;  3VVE A;  4F1Y A;  3C36 A;  4PQJ A;  3M3L A;  2HPG A;  4GWS A;  3KOS A;  3IX1 A;  2DWA A;  1PBP A;  2F35 A;  1R9Q A;  4ELP A;  3EQ1 A;  5AE4 A;  2Q8M A;  4R6Y A;  4TOZ A;  2XD3 A;  3CHG A;  4LQ2 A;  1NV2 A;  3I6V A;  2XXV A;  1MY3 A;  4N8G A;  3B6Q A;  3TTM A;  4G8H A;  4OES A;  1IME A;  1SYH A;  3DP4 A;  4YZZ A;  1Q35 A;  2F3D A;  3E78 A;  2XX9 A;  1POT A;  4MLQ A;  3B6W A;  2UYE A;  1N7W A;  1JVX A;  5H8S A;  4PFT A;  4YKK A;  4MCO A;  3I3V A;  4WEP A;  1LEV A;  1MXY A;  2HXR A;  2QS1 A;  1EZO A;  3KFM A;  2DXR A;  5H8N B;  4EQ9 A;  5JTY B;  3JV9 A;  4DDD A;  2QRY A;  1UTB B;  1VDW A;  2XWI A;  1N76 A;  2F7C A;  2DQV A;  3MZ1 A;  4F31 B;  3RQT A;  1FPJ A;  2KQZ A;  1OVT A;  2DOJ A;  3MP1 A;  5IZ3 B;  3K6U A;  3TCG A;  4MNI A;  3QMF A;  3DP6 A;  2P2A A;  1WOD A;  2XXX A;  2XXW A;  1B52 A;  3T0J A;  4RPO A;  1Y4T A;  1FQB A;  4DI4 B;  1FBP A;  3CRB A;  4GWX A;  3IL1 B;  5FHO A;  5TPA B;  3T9U A;  2CZK A;  4PC9 A;  2VPN A;  4I3Y A;  2Y7W A;  4WXJ A;  1FRP A;  2D5W A;  3JYR A;  5IGA A;  3TQW A;  2XXT A;  2LAO A;  3GLB A;  4PBH A;  2OZZ A;  3RTF B;  2RKM A;  2XXU A;  2WKY A;  3OMB A;  3H7M A;  3D1R A;  3FGS A;  1MM7 A;  3K00 A;  3UN6 A;  1B2H A;  1D4N A;  3K6X A;  4I1D A;  3RY3 A;  4NMY A;  1DBZ A;  2Z8F A;  3IK6 B;  4P47 A;  4OWD A;  1K9Y A;  5FTH A;  1I69 A;  3HN0 A;  3L6G A;  3B8B A;  5L8D A;  3IB2 A;  2YPN A;  3OO7 A;  4UAB A;  5H8Q B;  4KI0 E;  4H0W A;  3PUY E;  3IOW A;  3MW0 A;  4KFQ A;  1B32 A;  4XKQ A;  5CI5 A;  3FJG A;  1S9T A;  2FNC A;  1B0L A;  1NNF A;  1GV8 A;  1SW4 A;  2V84 A;  3LV0 A;  4HE1 A;  1DMB A;  1QJM A;  2RCA A;  2M8C A;  4YKJ A;  4DE8 A;  2PYY A;  4NN3 A;  2HFB A;  4EF2 A;  4OEV A;  5LOM A;  3K2D A;  3ZS6 A;  1A7L A;  3E13 X;  4DCX A;  2HAV A;  4OHN A;  1URS A;  1EZP A;  1B3E A;  3RT6 B;  1DTG A;  1EU8 A;  2ABH A;  5JK4 A;  1FQD A;  3T93 B;  5KDT A;  5TP9 A;  2Y7I A;  2V25 A;  5B7D A;  2XXP A;  3FXB A;  1XS5 A;  2R71 A;  3N5L A;  4IB2 A;  1NV4 A;  4FEB A;  4BDO A;  4N6P A;  2NOO A;  3RNN A;  3PPQ A;  4O7I A;  4Q8R A;  4R72 A;  2FIX A;  4X9T A;  1LAG E;  5ITP A;  2F7A A;  1B0H A;  1R6Z A;  1YPN A;  3LSW A;  3OO8 A;  4GF8 A;  2DE2 A;  4EF1 A;  5CC2 A;  2ZNU A;  3FV2 A;  2XX8 A;  4IY5 A;  2VGQ A;  4GWZ A;  1IXH A;  1JW1 A;  1FSA A;  2PCR A;  4OTE A;  3MVY A;  2DE3 A;  1FPG A;  1F9B A;  4BLA A;  4PGN A;  2XXQ A;  2DS9 A;  4XFE A;  3D4G A;  3KJT A;  4QFK A;  1NNT A;  2X7Q A;  1NUY A;  3MZ9 A;  3IJO B;  3G3F A;  3E4R A;  3ISP A;  4PGP A;  5IZ1 A;  3H6V A;  2MKZ A;  3RLF E;  5KCJ B;  3V83 A;  3G7W A;  2VD3 A;  2F6P A;  4PDH A;  1B9J A;  5BWJ A;  1B46 A;  3ECR A;  3C31 A;  3IOR A;  4LAT A;  1LB8 A;  2H9B A;  2F5X A;  4BDM A;  2H99 A;  1H3D A;  4GX4 A;  3OEN A;  2OJT A;  2VOZ A;  5H8H B;  3H6T A;  4NWC A;  4G68 C;  5HPQ A;  3M3K A;  4H65 A;  4QBA A;  3K6V A;  4F29 A;  1HSL A;  3FJM A;  3UA8 A;  5I59 A;  3SEU A; 
#chains in the Genus database with same CATH homology
 1EZ9 A;  4I62 A;  3QYT A;  2XXY A;  1QKA A;  1JNF A;  1ZU0 A;  4F3B A;  5DYH A;  4F3S A;  3FD3 A;  2H4I A;  5AA2 D;  3IOU A;  4IO6 A;  2IEE A;  2GHB A;  1BKA A;  1KWH A;  4G8M A;  1ZJL A;  2XX7 A;  1B5I A;  4H67 A;  2PT1 A;  3MPK A;  3MQ9 A;  1FTJ A;  5CBS A;  1B1H A;  1CE2 A;  3TFL A;  1NNP A;  4QFL A;  4KQP A;  4YIC A;  4PFY A;  2AL5 A;  2BJJ X;  4GRK A;  3G3J A;  4DLD A;  4KD5 A;  3LSL A;  1IEJ A;  4LUB A;  4ELO A;  3VVF A;  3MP6 A;  1LAH E;  4YB5 A;  3VV5 A;  3KEI A;  3BFT A;  4ZEB A;  3TMG A;  1TWY A;  3TEP A;  3A3C A;  4K3F A;  1I6Q A;  3SER A;  3TDJ A;  5AA2 A;  4UAC A;  4KYD A;  2XXI A;  4POW A;  1MY4 A;  2AL4 A;  3S9M C;  4ZDM A;  3OSQ A;  3KN7 A;  2DE4 A;  2DVC A;  4G2Z A;  5CMK A;  1QKB A;  5ISU A;  2A5S A;  4GXS B;  2RIN A;  2X26 A;  1MQH A;  1TT1 A;  4PFW A;  1Y9U A;  1LAX A;  1MQD A;  1B05 A;  3EHT A;  2HXW A;  3VDF A;  2I6E A;  3O6I A;  5CM6 A;  2GH9 A;  4G4P A;  1PB8 A;  2Z22 A;  4P0G A;  3C34 A;  3QXM A;  1T0K A;  1ZLQ A;  5JEI A;  4FAJ A;  3EPE A;  4AB5 A;  4H1X A;  3MP8 A;  1PB7 A;  3CFZ A;  3E9X A;  4OQO A;  3TTR A;  3C4M A;  5I2K A;  1O64 A;  3FVO A;  4O3A A;  2CMO A;  3VXB A;  3ZSF A;  3OSR A;  4NF4 B;  3TKD A;  4ZEC A;  3LC8 A;  2P1S A;  4DXC A;  5AA1 A;  3M3F A;  5I57 B;  5F7V A;  1VR5 A;  1TFA A;  1B40 A;  1IZ1 A;  5DT6 A;  4R75 A;  1MXU A;  1SVX B;  3CSB A;  2F78 A;  3FXU A;  2H5Y A;  3KJ7 A;  1A54 A;  4I8C A;  1B7U A;  4F39 A;  2R9J A;  1H76 A;  1TXF A;  2FA7 A;  3LR1 A;  3OEL A;  4JBZ A;  3QUF A;  2RCB A;  1UTH A;  3H03 A;  1MQG A;  1MPC A;  4YAH X;  4F1V A;  4BDN A;  4EQ7 A;  3ILU B;  2YLN A;  3N6U A;  4ZE8 A;  3C35 A;  3V8X B;  3HCQ A;  2DWI A;  4MF3 A;  2Y7K A;  3K1M A;  3TEL A;  4NF5 A;  4Q0C A;  4GVO A;  1IUD A;  3KN3 A;  1II5 A;  1LFG A;  1MM6 A;  4GLI A;  3S9L C;  3D4C A;  4HCY A;  1JEU A;  4EXL A;  1SW2 A;  3FVK A;  3N26 A;  3K02 A;  3IB0 A;  4DXU A;  1USY E;  3C32 A;  1MRP A;  4AB6 A;  1LST A;  3RPW A;  1B1X A;  5HM4 B;  4ZE9 A;  4F3P A;  1MPB A;  4L17 A;  4POX A;  4FE8 A;  3DP8 A;  5FHM A;  1NFT A;  1R1N A;  4XKR A;  3T9X B;  1B51 A;  4PE5 B;  5KDT B;  4FAT A;  1LFI A;  5ICQ A;  5L9S A;  1M5D A;  1ATG A;  4R6H A;  3O28 A;  3KSX A;  3LSX A;  2HZK A;  4XIG Q;  4G77 A;  2A5T A;  4NF6 B;  2O69 A;  4KPT A;  3VLW A;  2ZMB A;  4YMA A;  3EF7 A;  4U1O A;  2ALU A;  5H8F A;  1M5E A;  4U2R A;  3TZA A;  5IAI A;  2B3F A;  4JWO A;  1UIV A;  4OMB A;  5L9M A;  3Q28 A;  1N0T A;  4G68 A;  3USD A;  5I58 B;  5AA4 B;  5L9O A;  1B5H A;  1QUI A;  3Q29 A;  5I2N B;  2O1M A;  1IIT A;  4LA9 A;  4KYS A;  4Z0I A;  1AOV A;  2DWJ A;  3BFU A;  5DVF A;  4HTG A;  2OWT A;  1NL5 A;  4M4G A;  2Q2A A;  5FTI A;  1JW4 A;  4GXA A;  3O6H A;  1ZKB A;  3SEY A;  3KBR A;  2OK2 A;  4F18 A;  4IO2 A;  1XVX A;  4FEC A;  2ZYM A;  4H8J A;  4NF8 B;  3F11 A;  4KCD A;  3O6G A;  3T96 B;  2QMX A;  3ZKK A;  2F7B A;  1B7H A;  1VFE A;  1MQJ A;  1D9Y A;  5BUU A;  2DP8 A;  2YJP A;  2GFE A;  1B3L A;  2ZYO A;  5H8N A;  5JTY A;  1UTB A;  4QSE A;  4YKI A;  1OLA A;  1PB9 A;  3CIJ A;  3WAF A;  1FCK A;  3MJN A;  4EXK A;  3W9W A;  4FED A;  2HZL A;  1HSE A;  1S7Y A;  2NVU B;  2ONS A;  3PGF A;  1MS7 A;  2H98 A;  4I9D A;  4IY6 A;  5J1D A;  3TTL A;  2XXH A;  3K01 A;  2O6A A;  1P1N A;  4JSD A;  3IB1 A;  1SI0 A;  1FTK A;  4EQB A;  1B4Z A;  1XOC A;  4KCC A;  4F22 A;  1A40 A;  3VLV A;  3QAX A;  2Y7R A;  5DVI A;  1B6H A;  1OQG A;  3T9H B;  3TTN A;  4ZEF A;  2O51 A;  3THI A;  3HHF A;  1EH3 A;  4OFL A;  1Q1K A;  2O1L A;  3EHU A;  4KYE A;  2HQ0 A;  4F2O A;  1WDN A;  1OMP A;  2UVI A;  1I6B A;  2V3Q A;  3TQL A;  1P1Q A;  3FZV A;  3H6U A;  1A8F A;  2QS4 A;  1ZIU A;  2PBW A;  3PMV A;  3U94 A;  5DVJ A;  1FQF A;  3CI8 A;  4MFI A;  5H8Q A;  2QL3 A;  4RY1 A;  5ITO A;  2I3W A;  1URG A;  2G29 A;  4FIM A;  4ECF A;  1A8E A;  5M2V A;  3TTK A;  4JWY A;  1DSN A;  2NXO A;  4R6K A;  4F3G A;  1R9L A;  1O7T A;  1ZMG A;  5A5X A;  4QFP A;  3VE1 B;  1XT8 A;  3H06 B;  5DTB A;  2G93 A;  1UIU A;  2PX1 A;  2Z8D A;  4TQU Q;  3UOR A;  1FTL A;  1Y3Q A;  3WAE A;  5K2Y A;  3IO4 A;  1Y3P A;  2I58 A;  1RKM A;  4QHQ A;  4DXB A;  5DEX B;  3HV1 A;  3IOT A;  4QFN A;  1ZBM A;  4RYA A;  4LZ5 A;  3A3U A;  3DEL B;  4RJZ A;  1A99 A;  4MH5 A;  4ONY A;  1MXX A;  2DYX A;  5CBR A;  4C0R A;  2O68 A;  3MUQ A;  3V89 B;  3S9N C;  3QIM A;  2NUV A;  1Y1Z A;  2F6G A;  3SEX A;  1IXG A;  1LCT A;  4JDF A;  1NNK A;  2F8D A;  4QSC A;  2OLB A;  2Q8J A;  3UP9 A;  5KCJ A;  1UTH B;  1MY2 A;  2Z23 A;  3FXR A;  3CG3 A;  3M8U A;  3RGY A;  1CB6 A;  1SD3 A;  3N94 A;  1N04 A;  3KG2 A;  4ZZE A;  1LCF A;  3O66 A;  5CRY A;  4O3B A;  2QS2 A;  2ZNT A;  3KSJ A;  2I48 A;  2O84 X;  1JEV A;  1XHY A;  4GL0 A;  4THI A;  2THI A;  1SW1 A;  4ZZA A;  1AIV A;  1BLF A;  4IO4 A;  4IGR A;  1NMU A;  3HHG A;  4MBP A;  4AQ4 A;  4Z7E A;  2ANJ A;  2B3B A;  1GTK A;  1AMF A;  3LBS A;  4WED A;  2DSF A;  1LGB C;  4NTL A;  4ELQ A;  4BDL A;  1NKX A;  2V3U A;  4XKN A;  2O7U A;  3FAS A;  2AYS A;  2KLF A;  2Q2C A;  4C1T A;  3Q25 A;  3FIR A;  2D3I A;  3ONM A;  4GL8 A;  2ZYN A;  3PMW A;  1MXW A;  1P1W A;  3H3G A;  3ODB A;  2Q89 A;  3FAT A;  3EN3 A;  1OVB A;  4TLL B;  2RF1 A;  3CG1 A;  4LQ5 A;  2QSX A;  1DPP A;  3VLU A;  3S2V A;  2OWS A;  4OXV A;  3U1O A;  5IKB A;  3MVZ A;  4LVQ A;  2D21 A;  1AL3 A;  1P1U A;  2UYF A;  2A5T B;  1US5 A;  2QJE A;  1N3W A;  2ONR A;  3K0V A;  5AA3 A;  2F36 A;  3O29 A;  4H6D A;  4C1U A;  1MY0 A;  4FOR A;  3GZG A;  1IIW A;  3KGC A;  3CSG A;  2VHA A;  4HCW A;  3QK6 A;  3HPI A;  3BKI B;  3OO6 A;  1OQH A;  3K6W A;  4NE4 A;  3VFJ A;  4E0W A;  2GHA A;  3OOA A;  2V93 A;  5I56 A;  4H5F A;  3PMX A;  4EDP A;  2ONK E;  5CMM A;  2OBG A;  3SES A;  1LBB A;  3U93 A;  4F19 A;  3ZKL A;  1USY H;  1S50 A;  4JSO A;  4DZ1 A;  3FVN A;  4RK2 A;  1H44 A;  3W9V A;  3PPP A;  4RPN A;  1D3K A;  5I84 A;  4M1V A;  2VD2 A;  2XXR A;  5B70 A;  1Z7N E;  3HST A;  4X1D A;  4OVJ A;  1QUL A;  2X7P A;  1PDA A;  4H8I A;  1JVY A;  4ZEK A;  2UXA A;  3MC2 A;  4OEU A;  1QVS A;  3H4Z A;  3LUY A;  3T22 A;  1Y3N A;  1B7Z A;  5HBC A;  4G8N A;  1LLS A;  1N84 A;  1QW0 A;  1RYX A;  3SKP A;  4RNS A;  4LON B;  5TP9 B;  5CMC A;  1SDX A;  3P7I A;  3MPL A;  3PV0 E;  4NF4 A;  3O2A A;  3T66 A;  1M5F A;  1MQI A;  5EHM A;  3O9P A;  3S4U A;  3AXF A;  1Y4C A;  4QF9 A;  5I57 A;  5FHN A;  1ZTY A;  4U21 A;  4N07 A;  4R73 A;  4GFR A;  1FW0 A;  3C33 A;  1OIB A;  3U92 A;  1YAE A;  4YKP A;  3BBR A;  5ICT A;  1GGG A;  2QS3 A;  1SI1 A;  3E3K A;  1MXZ A;  3C9H A;  4F1U A;  3S9E A;  4YB6 A;  4NED A;  2DVZ A;  4ESX A;  1JET A;  5K2X A;  3RUM A;  3K1N A;  1UQW A;  3DM0 A;  1ELJ A;  1NH7 A;  4UA8 A;  4ELR A;  1DTZ A;  1DOT A;  1FQA A;  4IO7 A;  4OEN A;  2OCU A;  3IO6 A;  1PBQ A;  2XD2 A;  1H45 A;  3KZG A;  2IA4 A;  4RA1 A;  4PP0 A;  3TYH A;  4R9G A;  2O7I A;  3O97 A;  3FJ7 A;  2REJ A;  3MAM A;  2E1S A;  5EHS A;  3TAJ A;  1SQY A;  5I59 B;  3H6W A;  1WVJ A;  4ZED A;  1O63 A;  1JW5 A;  1POY 1;  3VXC A;  1PEB A;  1YTV A;  5A5X B;  4GWO A;  1GR2 A;  5ELV A;  2ZXT A;  4Q30 B;  2Q88 A;  1A55 A;  4U22 A;  4XXU A;  3G3K A;  3CR9 A;  3MVX A;  3CVG A;  1SW5 A;  1PC3 A;  4H5G A;  3PUW E;  1H43 A;  1IXI A;  1I6A A;  2F34 A;  2Z8E A;  4GOT A;  1HSJ A;  3OXN A;  4R2F A;  1L5T A;  1RYO A;  3K1P A;  1B4H A;  3B7D A;  1LBC A;  4IO3 A;  2B65 A;  2ESN A;  4O3C A;  4NF6 A;  3FXQ A;  3OO9 A;  1Y1M A;  2I49 A;  4LZ8 A;  1Z7M E;  3I5O A;  2AIX A;  2Q9T A;  5TPA A;  3TOD A;  4PFU A;  4ESW A;  1OLC A;  4MLV A;  4U23 A;  4U1Z A;  2I0C A;  2UVH A;  1URD A;  4GQO A;  1FTM A;  3RTW B;  3UIF A;  2HEU A;  3KOT A;  3R6U A;  2Y7P A;  4N13 A;  3SEW A;  2E0S A;  3MBP A;  1MY1 A;  1SBP A;  1GVC A;  1FQE A;  3TPA A;  2P0S A;  1BIY A;  5I58 A;  5AA4 A;  4GD5 A;  1IXC A;  2ZYK A;  4EUO A;  3GBA A;  1P1O A;  4JWX A;  5I2N A;  2HCA A;  4HW8 A;  1MPD A;  4LP2 B;  5AA2 B;  1B3H A;  4QSD A;  3G3G A;  3GBB A;  1TFD A;  4YU0 A;  4OER A;  4DIG A;  4P11 A;  4E0X A;  2FYI A;  3HO7 A;  2UVG A;  3IJX B;  4DCY A;  1B3G A;  1MDP 1;  2NWJ A;  2PMS A;  4QRZ A;  4NF8 A;  2QMW A;  4HS7 A;  1MH3 A;  4ISU A;  1B3F A;  4PET A;  4YB7 A;  4KHZ E;  3IR1 A;  2DXY A;  3RN8 A;  3OEK A;  4X1B A;  3CFX A;  3PUZ E;  4KR5 A;  3SEV A;  4OFO A;  3SET A;  4OFJ A;  4Q5T A;  1BP5 A;  3PPO A;  4TLM B;  3MVW A;  1AH5 A;  3QSL A;  5CMB A;  4U4S A;  5I2K B;  1JQF A;  3G3I A;  2Y84 A;  4OET A;  1DPE A;  1VSO A;  3UGW A;  4GIZ A;  4RXL A;  3CFL A;  3QUJ A;  2R6G E;  4X48 A;  3PD8 A;  2RC7 A;  3RT8 A;  1MG1 A;  4OZ9 A;  2VP1 A;  3JZJ A;  1LFH A;  1US4 A;  4BDQ A;  3UK4 A;  3N6T A;  4NWD A;  3PU5 A;  3PUV E;  4QFO A;  1LB9 A;  3EHS A;  1QUJ A;  2UVJ A;  2RC9 A;  1ANF A;  2F97 A;  5TU0 A;  1J1N A;  2XHD A;  3U8Q A;  1N3X A;  3Q26 A;  2H25 A;  3Q27 A;  2I4C A;  4JB7 A;  2DWH A;  2I3V A;  4JXI A;  1D9V A;  5I56 B;  1VFD A;  1FQC A;  3IOV A;  3R26 A;  1NH8 A;  4F2Q A;  3LSF B;  3U72 A;  3L6H A;  4NF5 B;  5H8H A;  4BDR A;  1LAF E;  1IQ7 A;  3K4U A;  3FV1 A;  4ZS9 A;  3OD7 A;  3GXA A;  3KN8 A;  4ZEI A;  2QPQ A;  2PVU A;  2I0B A;  1M5B A;  3FVG A;  4FJP A;  3FUZ A;  4LZ7 A;  4U4X A;  3T9V A;  4P0I A;  3A09 A;  4YMB A;  3DLN A;  4IO5 A;  3W15 C;  4R9F A;  3MWB A;  2ZNS A;  1P99 A;  1QUK A;  2PT2 A;  3TCF A;  4OYV A;  4R2B A;  2GRV A;  3PD9 A;  1B58 A;  4XKP A;  2V3T A;  4XTC Q;  4WKM A;  1BTJ A;  1SYI A;  3G3H A;  3MZB A;  3IAZ A;  3V5A A;  3R7X A;  3B6T A;  1M5C A;  5DEX A;  1MDQ A;  1XC1 A;  2HAU A;  1YCJ A;  1B5J A;  1XVY A;  3PPN A;  5KZT A;  4ND9 A;  1VE4 A;  3VVD A;  1MH4 A;  4RK9 A;  2W7Y A;  5H8F B;  3PUX E;  1Y20 A;  3OEM A;  2RC8 A;  1FTO A;  1N7X A;  2I4B A;  3ILT B;  5F1Q A;  2REG A;  2CZL A;  3TCH A;  3SDF A;  4IGT A;  3TUS A;  4G68 B;  3PPR A;  4R74 A;  5EYF A;  1MXV A;  3VVE A;  4F1Y A;  3C36 A;  4PQJ A;  3M3L A;  3KOS A;  3IX1 A;  2DWA A;  1PBP A;  2F35 A;  1R9Q A;  4ELP A;  3EQ1 A;  5AE4 A;  4R6Y A;  4TOZ A;  2XD3 A;  4LQ2 A;  3I6V A;  2XXV A;  1MY3 A;  3B6Q A;  3TTM A;  4G8H A;  4OES A;  1SYH A;  3DP4 A;  4YZZ A;  1Q35 A;  2XX9 A;  1POT A;  4MLQ A;  3B6W A;  2UYE A;  1N7W A;  1JVX A;  5H8S A;  4PFT A;  4YKK A;  3I3V A;  4WEP A;  1MXY A;  2QS1 A;  1EZO A;  3KFM A;  2DXR A;  5H8N B;  4EQ9 A;  5JTY B;  3JV9 A;  4DDD A;  2QRY A;  1UTB B;  1N76 A;  2F7C A;  2DQV A;  3MZ1 A;  4F31 B;  3RQT A;  1OVT A;  2DOJ A;  3MP1 A;  3K6U A;  3TCG A;  3DP6 A;  2P2A A;  1WOD A;  2XXX A;  2XXW A;  1B52 A;  4RPO A;  1Y4T A;  1FQB A;  3CRB A;  3IL1 B;  5FHO A;  5TPA B;  3T9U A;  2Y7W A;  4WXJ A;  2D5W A;  3JYR A;  3TQW A;  2XXT A;  2LAO A;  3GLB A;  2OZZ A;  3RTF B;  2RKM A;  2XXU A;  2WKY A;  3OMB A;  3H7M A;  3FGS A;  3K00 A;  1MM7 A;  3UN6 A;  1B2H A;  1D4N A;  3K6X A;  4I1D A;  3RY3 A;  4NMY A;  2Z8F A;  3IK6 B;  4OWD A;  5FTH A;  1I69 A;  3HN0 A;  3L6G A;  5L8D A;  3IB2 A;  2YPN A;  3OO7 A;  5H8Q B;  4KI0 E;  4H0W A;  3PUY E;  3IOW A;  3MW0 A;  4KFQ A;  1B32 A;  4XKQ A;  5CI5 A;  3FJG A;  1S9T A;  2FNC A;  1B0L A;  1NNF A;  1GV8 A;  1SW4 A;  2V84 A;  1DMB A;  1QJM A;  2RCA A;  2M8C A;  4YKJ A;  4DE8 A;  2PYY A;  2HFB A;  4EF2 A;  4OEV A;  5LOM A;  3K2D A;  3ZS6 A;  1A7L A;  3E13 X;  4DCX A;  2HAV A;  4OHN A;  1URS A;  1EZP A;  1B3E A;  3RT6 B;  1DTG A;  1EU8 A;  2ABH A;  5JK4 A;  1FQD A;  3T93 B;  5KDT A;  5TP9 A;  2Y7I A;  2V25 A;  5B7D A;  2XXP A;  1XS5 A;  2R71 A;  3N5L A;  4IB2 A;  4FEB A;  4BDO A;  4N6P A;  2NOO A;  3RNN A;  3PPQ A;  4Q8R A;  4R72 A;  4X9T A;  1LAG E;  5ITP A;  2F7A A;  1B0H A;  1R6Z A;  1YPN A;  3LSW A;  3OO8 A;  4GF8 A;  2DE2 A;  4EF1 A;  5CC2 A;  2ZNU A;  3FV2 A;  2XX8 A;  4IY5 A;  2VGQ A;  1IXH A;  1JW1 A;  4OTE A;  3MVY A;  2DE3 A;  1F9B A;  4BLA A;  2XXQ A;  2DS9 A;  3D4G A;  3KJT A;  4QFK A;  1NNT A;  2X7Q A;  3MZ9 A;  3IJO B;  3G3F A;  3E4R A;  3H6V A;  3RLF E;  5KCJ B;  3V83 A;  3G7W A;  2VD3 A;  2F6P A;  1B9J A;  5BWJ A;  1B46 A;  3ECR A;  3C31 A;  3IOR A;  4LAT A;  1LB8 A;  2H9B A;  2F5X A;  4BDM A;  2H99 A;  1H3D A;  3OEN A;  2OJT A;  2VOZ A;  5H8H B;  3H6T A;  4NWC A;  4G68 C;  5HPQ A;  3M3K A;  4H65 A;  4F29 A;  3K6V A;  1HSL A;  3FJM A;  3UA8 A;  5I59 A;  3SEU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...