2Z22A

Crystal structure of phosphate preplasmic binding protein psts from yersinia pestis
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
321
structure length
321
Chain Sequence
EASLTGAGATFPAPVYAKWADSYQKETGNKINYQGIGSSGGVKQIIANTVDFGASDAPLTDEKLATEGLFQFPTVIGGVVLAVNIPGIKSGELTLDGKTLGDIYLGTVKKWNDPAIVKLNPGVKLPDQNIAVVRRADGSGTSFVFTSYLAKVNAEWKEKVGAGSTVNWPTGLGGKGNDGIAAFVQRLPGSIGYVEYAYAKQNNLAYTKLISADGKPVSPTEHSFSSAAKGVDWSKSFAQDLTNQKGDDVWPITSTTFILVHKEQKNAANGTEVLKFFDWGYTHGAKQANELDYATLPAEVVEQVRAAWKTQIKDSSGKPIF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of OppA and PstS from Yersinia pestis indicate variability of interactions with transmembrane domains.
pubmed doi rcsb
source organism Yersinia pestis
molecule tags Transport protein,immune system
molecule keywords Periplasmic phosphate-binding protein
total genus 108
structure length 321
sequence length 321
chains with identical sequence X
ec nomenclature
pdb deposition date 2007-05-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2z22A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2z22A02
1M5CA 1PEBA 1GR2A 1XOCA 2V3TA 1OVBA 2YJPA 3CFXA 3N5LA 4R2FA 4BDLA 3A3CA 2W7YA 1DMBA 1PBQA 2PX1A 2XXWA 2ZYMA 3AXFA 3CSBA 3GXAA 2P0SA 3HCQA 3K6UA 2O68A 2I6EA 3SESA 1RYOA 1A55A 4DIGA 4ELRA 2OLBA 3G3KA 4POWA 5F7VA 5CRYA 4GL0A 5H8HB 2H98A 2V3QA 4PFTA 3K0VA 5F1QA 1TWYA 3E3KA 1JW5A 2I0BA 3B6TA 1B5IA 4U21A 2HFBA 5I59B 5IKBA 1RYXA 4H5GA 3RY3A 3S4UA 3PUWE 1FQEA 2GRVA 4GWOA 4F3GA 2RF1A 3QYTA 4ZEIA 3T93B 1OQHA 2ONRA 3KFMA 4R6HA 1F9BA 1II5A 3QK6A 1LAHE 1OQGA 1P99A 1FQAA 1S7YA 2RC9A 1UTHB 2THIA 2XD3A 4GQOA 3UK4A 4XKQA 3DM0A 1B6HA 4F3SA 4EXLA 1MY4A 3N6UA 4GL8A 4XIGQ 2O69A 5TPAB 3QXMA 1QW0A 3QUJA 2DOJA 4KQPA 3MVZA 2HZLA 4F3PA 5B70A 3RQTA 3QAXA 4RK2A 4R73A 2XXTA 3MVWA 3MUQA 4G77A 4GIZA 4IY5A 3IR1A 3BFUA 3KSJA 1N7WA 1A8FA 2O6AA 3Q26A 5H8NA 3OXNA 3ILTB 5TPAA 3ZS6A 4F39A 4PE5B 2H99A 2O7IA 4EDPA 1B7HA 4GFRA 1FQCA 2DXYA 2OZZA 1NFTA 2H5YA 3EQ1A 3L6GA 2HEUA 5DTBA 5DEXA 4F1VA 2F6GA 5K2XA 4ELQA 3CIJA 4IO5A 4EQ9A 1FTKA 1D4NA 4R9FA 2ZYNA 4FECA 4NTLA 1LAGE 1D3KA 5H8SA 4E0WA 3TMGA 2DS9A 1MXXA 3R6UA 2XX8A 3D4GA 2ONKE 1LFHA 2FA7A 1H43A 3K2DA 2Y84A 3EN3A 4PFYA 2H9BA 1GV8A 3SETA 4AB5A 1A7LA 2FNCA 3CFLA 1UIUA 1Y20A 4NWDA 2Z23A 4IGRA 4P0IA 3T22A 2B3BA 1P1UA 4GVOA 1Q1KA 3IO6A 4OETA 5H8FA 1URDA 1FQFA 4JWYA 4QSCA 3LBSA 4Q5TA 5CMBA 4ZEFA 4TOZA 5H8NB 5I2NA 1MS7A 1I6AA 2RC7A 3O97A 1JETA 4KCDA 4QSEA 4KPTA 3HV1A 1PB7A 4ZE8A 1FTJA 2NXOA 3K00A 3P7IA 2XX7A 2VD2A 1ATGA 1BLFA 1EZ9A 3LR1A 4FEDA 4G2ZA 1Z7ME 2QS3A 2ZYKA 4O3CA 1MXVA 4KHZE 5I2NB 5I56B 1TT1A 2XXXA 3PU5A 5BUUA 3S9NC 1EZOA 4GXSB 2I4CA 1LAFE 2NUVA 2QMWA 1I6BA 3H4ZA 1CB6A 3IO4A 1NH7A 3K1NA 2I48A 2Q2CA 3PMWA 4IO6A 5DVFA 3U1OA 1NKXA 2ABHA 4RK9A 1ZLQA 3K4UA 3R26A 4N07A 4EF2A 1US5A 3DP6A 3TKDA 5FHOA 1IUDA 3PPNA 1QKBA 1WVJA 3H6UA 4KCCA 1JW1A 3TODA 4BDQA 2D21A 5DVIA 3U8QA 2Y7PA 2G29A 1POY1 4I62A 4JDFA 4JBZA 4MBPA 3K01A 2DSFA 2NVUB 3MP1A 1DSNA 3BBRA 3OEMA 2Z8DA 3PPPA 2F36A 3U92A 4EQBA 4BDMA 4F1YA 3Q28A 2Z8FA 3K6VA 4FORA 4GD5A 4NF4B 5AA4A 1SVXB 2A5SA 3KSXA 4FJPA 4XTCQ 1FCKA 4PETA 1MY3A 4ZZAA 1IITA 1CE2A 1JEUA 3FUZA 1IZ1A 1M5DA 4H5FA 5FHMA 2G93A 3OO9A 3U72A 5KDTA 4WEPA 3FVOA 3H6TA 3M3KA 1B3FA 1IXGA 4YKKA 3VVEA 5KCJB 2R71A 4DXCA 3C4MA 3TTLA 2UVIA 3A09A 1SI1A 1Q35A 2F7BA 3DELB 1B9JA 3IK6B 3IOVA 5TP9A 2PYYA 2DXRA 4R6YA 1BIYA 4I1DA 5ELVA 1P1WA 3TUSA 5M2VA 2V93A 4XKNA 5L8DA 4IB2A 2QMXA 4F19A 5I57B 2X7QA 4OTEA 4I8CA 4EF1A 3M3FA 3Q27A 1VSOA 1HSEA 2I49A 3C33A 3FIRA 4JWXA 1JW4A 3SERA 2E0SA 2HQ0A 1SDXA 3FZVA 1UIVA 4AQ4A 3E9XA 4ESXA 3SEYA 4HS7A 5HM4B 3SEVA 3T9HB 3OSRA 4TQUQ 1MY0A 3V5AA 4NF8A 4F31B 2I3WA 4IO2A 1QKAA 5ITPA 5EHMA 3KJTA 3TTRA 4NF5B 3OOAA 2DVCA 3EHSA 1LFIA 4LZ5A 1UTBA 2F8DA 3T9UA 4F2OA 4JSDA 2QSXA 4JWOA 5L9SA 4ISUA 5BWJA 1NL5A 4LA9A 3QIMA 2Y7IA 2ZNTA 3KEIA 5ISUA 1R9LA 1AOVA 2ALUA 3B7DA 3KOSA 2OWSA 1AIVA 4P0GA 4QHQA 5FTHA 3S2VA 2I0CA 3LC8A 1MXZA 1SD3A 3MAMA 1WDNA 2XXHA 4IO4A 4BLAA 3RTFB 1M5BA 4WXJA 3E13X 4MLQA 1BTJA 1XHYA 2DWJA 1B3HA 3EHTA 2F5XA 4YKIA 4U4XA 2HAVA 4THIA 2REGA 5I56A 3S9MC 1PC3A 1JVYA 3UP9A 3PUZE 3VFJA 2QS1A 4ZEBA 1B58A 1L5TA 3QSLA 1MQIA 4LUBA 1HSJA 3ZKKA 3VXCA 2AL5A 1B5HA 1B3LA 3FGSA 3N6TA 4O3AA 3E4RA 5AA2A 4XKPA 2DE4A 4KI0E 2H25A 4U22A 5I59A 2UYEA 4DXBA 4YKPA 1KWHA 4GRKA 1NMUA 2GH9A 2RKMA 2HZKA 1MH3A 3FATA 2XXYA 1NNFA 2WKYA 4G68C 3G3GA 2F7CA 2RINA 5DT6A 3CRBA 3FXQA 2XXVA 4OVJA 3HO7A 4MFIA 3T96B 3EHUA 4DCXA 2GHBA 3VVDA 1PB9A 1Y3PA 3RN8A 5JK4A 3PUYE 1NNKA 4DZ1A 2DE2A 1JQFA 1MXUA 3PD9A 1URSA 3HPIA 4G4PA 4OYVA 3IOUA 5CC2A 4IO3A 4Z0IA 2PT1A 5I2KA 4X48A 2A5TB 1TFDA 3FXUA 4LQ2A 4LVQA 3VLVA 3TTMA 4OEUA 5L9OA 4FE8A 4BDRA 1UTBB 1POTA 3O28A 1Y3QA 2O51A 3OD7A 2DYXA 3O6HA 1BP5A 3K1MA 3K6XA 4GOTA 1LAXA 4C1UA 3LSXA 4H65A 3UN6A 1QUKA 1XS5A 4BDNA 5K2YA 3TELA 3UA8A 1XVXA 1LB8A 3T66A 1N0TA 4OFLA 3ZSFA 2AL4A 4QFNA 2I4BA 1MDP1 2IA4A 4LATA 2OBGA 4LONB 2O1MA 2DWHA 2XXIA 4QF9A 3CVGA 3HHFA 1EZPA 1YCJA 1B0HA 4POXA 3O2AA 5JEIA 1JNFA 1P1OA 4NF6A 1FTLA 2D5WA 3H6WA 3T9VA 1SI0A 3QUFA 2ONSA 3KGCA 1ZTYA 4X1BA 5CBSA 2OCUA 1IIWA 4GLIA 4LP2B 3UIFA 2ZXTA 5CMKA 5FTIA 3CG1A 4PQJA 1S50A 4KYDA 3TQWA 3IB2A 1MPDA 4IO7A 3H6VA 3OENA 1SW5A 3F11A 2QJEA 2OWTA 2PBWA 3PMXA 3UORA 4Q8RA 1B3EA 1A54A 1OLCA 4X1DA 3GZGA 4GF8A 2PMSA 1MXWA 2PT2A 3MVXA 4G68B 5EYFA 3OEKA 3VLUA 4AB6A 1H45A 1OVTA 5AA3A 3THIA 3DP4A 4MLVA 4NWCA 1GVCA 1SW2A 3OMBA 4XXUA 4YB5A 4DLDA 3VV5A 1H76A 3KN7A 4TLMB 1DTGA 2Y7RA 4G8NA 5HBCA 3IOWA 2M8CA 4NMYA 5I58B 4Z7EA 2CZLA 2OJTA 2O7UA 2YPNA 4NF6B 4F2QA 3G3FA 2AIXA 3O6GA 1B7ZA 4LZ7A 4PFUA 1MQHA 2I58A 4U1OA 3RNNA 2ZYOA 1Y4CA 1URGA 3W9WA 3Q25A 1MDQA 1MG1A 2XXPA 5DEXB 4YKJA 3TAJA 1EU8A 3IL1B 4G68A 1R1NA 2X7PA 1ZBMA 5ICTA 1QULA 1JVXA 4O3BA 2F35A 3M8UA 4PP0A 3KG2A 5I57A 1LLSA 3MZ1A 2Y7WA 3RLFE 4F3BA 5AE4A 1B1HA 1O63A 4UACA 5H8QB 4KFQA 3ECRA 3FASA 5CMCA 1YTVA 3TYHA 1OLAA 4LZ8A 3Q29A 3O9PA 5TU0A 1Y3NA 2GFEA 3I5OA 1MQDA 4U4SA 4RY1A 4G8MA 1FW0A 4P11A 1OIBA 3K6WA 2IEEA 3PD8A 4U2RA 1IQ7A 4C0RA 3A3UA 1HSLA 3B6WA 1N3XA 3MQ9A 4MF3A 2NWJA 2Z22A 3CR9A 1XT8A 3G3IA 4ZS9A 3D4CA 1IXIA 3IB1A 3IJXB 1USYE 2OK2A 1LFGA 4YICA 5AA1A 3N94A 1LGBC 2UXAA 2ZNSA 3CFZA 3ILUB 3IORA 2DWAA 5JTYA 1ZU0A 3WAEA 3C9HA 5I58A 3GBAA 4R6KA 3PPOA 2HCAA 3ZKLA 1GTKA 1LB9A 1SBPA 3OSQA 4ELPA 1NNTA 3MBPA 1ZKBA 2DQVA 2VD3A 2XXRA 2ZMBA 4OMBA 2I3VA 3KJ7A 4G8HA 4X9TA 3SDFA 1SW4A 2VP1A 4YZZA 5IAIA 3MP8A 3SKPA 3PUVE 2F6PA 5CI5A 3FXRA 1US4A 1SW1A 5J1DA 3KZGA 4H8JA 1MQGA 3EF7A 3RPWA 3I3VA 4DXUA 1M5FA 4KYSA 3FVNA 4LQ5A 1MM7A 1QVSA 1B05A 4M1VA 4YAHX 5JTYB 5TP9B 2DWIA 2RC8A 2ZNUA 3DP8A 3IB0A 4QSDA 5H8QA 3RGYA 3CI8A 3HN0A 3HSTA 4ZDMA 5A5XB 3PUXE 3SEWA 3TCGA 5ITOA 4R2BA 4R9GA 1B46A 4OZ9A 3SEUA 1FQBA 1PB8A 3O66A 1I69A 3C36A 4YMBA 1Y9UA 2X26A 2XX9A 2R9JA 3C35A 1NNPA 3GBBA 1N04A 3B6QA 2B65A 3FV2A 3RT8A 1LBCA 1QUJA 4QFOA 4RPOA 5FHNA 4OXVA 4R75A 3OO8A 3PGFA 4EXKA 3PV0E 4F1UA 4F18A 3TTKA 2NOOA 1A8EA 4PFWA 4RXLA 4ELOA 1LBBA 4HCWA 1JEVA 4ZEDA 1H44A 4RA1A 2RCBA 2O84X 4ZEKA 3OO6A 3TTNA 4FATA 1N84A 2V25A 1ELJA 3LSLA 5KZTA 1MPCA 3MZBA 4XKRA 3H7MA 3TDJA 1O64A 5A5XA 1BKAA 4I9DA 3FD3A 3TEPA 1SQYA 2KLFA 4N13A 4ZE9A 3K1PA 3O6IA 3BFTA 3RUMA 4OERA 4EUOA 1R6ZA 2Q88A 3MP6A 1MQJA 1XC1A 2HAUA 1ZMGA 1B4ZA 3BKIB 4QFKA 5L9MA 5LOMA 3G3JA 1VR5A 2V3UA 3RT6B 4OENA 3H03A 2LAOA 3KN3A 4GXAA 1ANFA 4OHNA 3U93A 2QS4A 3IJOB 1ZJLA 3KOTA 4ONYA 3TCHA 1N3WA 3U94A 3VE1B 4NEDA 2DP8A 3G3HA 1N7XA 1MPBA 4H6DA 3JYRA 1SYHA 2D3IA 1IXHA 5CMMA 1QJMA 3FV1A 3VLWA 4ECFA 3JV9A 4YB6A 4OQOA 4RYAA 1B32A 3LSWA 1FTMA 1MY1A 1N76A 2XXQA 4L17A 4DE8A 1T0KA 4M4GA 1O7TA 3W15C 1UQWA 2QPQA 4R72A 4E0XA 4UA8A 2DVZA 4F29A 3JZJA 1B3GA 3MC2A 1SYIA 4WEDA 1TFAA 4U1ZA 3V83A 1AH5A 3FJ7A 4U23A 4DCYA 4K3FA 5KCJA 3IX1A 2HXWA 2F78A 2UVGA 1J1NA 2B3FA 5H8HA 3O29A 4MH5A 1PDAA 2UVJA 3R7XA 5CBRA 1FTOA 1WODA 4KR5A 3C34A 1QUIA 5KDTB 4HW8A 4YMAA 5I84A 3H06B 2ANJA 5H8FB 3HHGA 3FVKA 1GGGA 1VE4A 1B5JA 1Y4TA 4FEBA 1LCTA 4IGTA 3PMVA 2AYSA 1IXCA 3VXBA 4OESA 3T9XB 2XHDA 1FQDA 4HTGA 1B4HA 3IOTA 1UTHA 2H4IA 2REJA 1S9TA 4RPNA 4KD5A 2VOZA 4Q30B 4YU0A 1B40A 4OFJA 3W9VA 4F22A 4NF8B 2UYFA 3MZ9A 3KBRA 1DOTA 1VFEA 3L6HA 4FIMA 3USDA 1MM6A 2A5TA 3OELA 3RTWB 3TQLA 2VGQA 4R74A 2DE3A 4KYEA 2BJJX 2F7AA 3LSFB 1DPEA 3MWBA 4RNSA 3UGWA 2R6GE 2V84A 1D9VA 4NE4A 3WAFA 3G7WA 1DPPA 1B0LA 2CMOA 3N26A 1P1NA 4ZZEA 1MH4A 3S9LC 4QRZA 5DVJA 3KN8A 1D9YA 1B52A 4DDDA 4C1TA 2ESNA 4H1XA 3ONMA 2FYIA 2QS2A 1B7UA 2Y7KA 3FJGA 3MJNA 5I2KB 1B1XA 3ODBA 2F34A 4H0WA 1Z7NE 4FAJA 1B2HA 3C31A 4WKMA 2Q9TA 3FJMA 3MPKA 4JB7A 4ND9A 2QRYA 1DTZA 4JXIA 1AMFA 4IY6A 4OEVA 3VDFA 1YPNA 1RKMA 3CSGA 3DLNA 1M5EA 2Q89A 2VHAA 3C32A 5AA2B 1P1QA 3LUYA 1Y1MA 3V89B 5EHSA 4N6PA 1PBPA 1A99A 2GHAA 2XD2A 2XXUA 4HCYA 1MXYA 3MPLA 1I6QA 3PPQA 1LSTA 4QFPA 3S9EA 2F97A 3VVFA 1B51A 1MY2A 2Q2AA 4NF4A 5AA4B 3K02A 4H67A 1Y1ZA 5CM6A 2Q8JA 3GLBA 1NH8A 1VFDA 4YB7A 3TCFA 2RCAA 3TPAA 5DYHA 3TFLA 4QFLA 3V8XB 4OFOA 4Q0CA 4BDOA 1EH3A 2Z8EA 4OWDA 1H3DA 3MVYA 1LCFA 2YLNA 1R9QA 3I6VA 3MW0A 1XVYA 1AL3A 2QL3A 3IAZA 1A40A 2P1SA 4RJZA 3M3LA 3CG3A 1ZIUA 4NF5A 2O1LA 4H8IA 5AA2D 3EPEA 3SEXA 5B7DA 1MRPA 3TZAA 1YAEA 4EQ7A 4ZECA 5HPQA 4JSOA 3H3GA 1IEJA 1OMPA 1TXFA 2PVUA 2E1SA 3FVGA 4TLLB 5ICQA 1USYH 2P2AA 4ESWA 3PPRA 2UVHA 3OO7A
chains in the Genus database with same CATH superfamily
1PEBA 1XI6A 1DMBA 2XXWA 2ZYMA 2O68A 5I3SA 3K0VA 4U21A 1B5IA 4H5GA 3IFAA 3PUWE 4XF5A 4PAKA 3SZPA 3T93B 1OQHA 3KFMA 4GQOA 2XD3A 4XKQA 1B6HA 4F3SA 3N6UA 4GL8A 1QW0A 3QAXA 4R73A 4IY5A 3IR1A 1A8FA 3OXNA 5TPAA 4AS4A 1B7HA 1NFTA 2HEUA 3CIJA 1FTKA 4R9FA 4PFIA 1EYJA 5H8SA 4N4UA 2ONKE 1LFHA 1GV8A 3U65A 4PFYA 3SETA 2HPGA 1UIUA 4NWDA 2FIXA 1K9ZA 4OETA 1URDA 1FQFA 4Q5TA 4PBHA 1MS7A 4KCDA 5LTCA 3P7IA 2VD2A 1Z7ME 2VT5A 2XXXA 5BUUA 3S9NC 4GXSB 4QSCA 2I4CA 1LAFE 5IGAA 1I6BA 5DVFA 2Q2CA 2ABHA 4KCCA 1QKBA 5DVIA 3MP1A 3U92A 4EQBA 1FPLA 3Q28A 3IFCA 4NF4B 3FUZA 4H5FA 3OO9A 5KDTA 4DXCA 1SPIA 2UVIA 1SI1A 1Q35A 2F7BA 3IK6B 3IOVA 5TP9A 4IB2A 2QMXA 2X7QA 4EF1A 3C33A 4PF6A 4JWXA 2HQ0A 2XA5A 4ESXA 1UIVA 2DVCA 4JSDA 4JWOA 5L9SA 5BWJA 4LA9A 3QIMA 2Y7IA 2ZNTA 4P0GA 4QHQA 5FTHA 1G0HA 4XFEA 1SD3A 3RTFB 1M5BA 4MLQA 1BTJA 2NVUB 4THIA 4JVIA 3S9MC 1PC3A 3VFJA 1FBPA 1B5HA 1FSAA 4O3AA 5AA2A 2WBDA 1KWHA 1NMUA 2GH9A 2WKYA 3G3GA 3CRBA 4PAFA 1Y3PA 1JQFA 4NF0A 1URSA 4N6KA 5CC2A 4IO3A 2PT1A 2A5TB 5L9OA 3O28A 2PFZA 4GOTA 3LSXA 1IMAA 1FPIA 4BDNA 5K2YA 3TELA 1XVXA 4QFNA 2DWHA 2R8TA 4QF9A 3CVGA 1JNFA 4X1BA 2OCUA 1IIWA 1LBYA 2ZXTA 3CG1A 4PQJA 1S50A 3TQWA 3IB2A 1MPDA 3PMXA 2PBWA 3UORA 1B3EA 5F24A 4X1DA 3GZGA 2PMSA 1MXWA 3MVXA 3OEKA 4AB6A 1H45A 1GVCA 2XXKA 5HBCA 4Z7EA 2YPNA 4NF6B 1B7ZA 2FIEA 1MQHA 4QBAA 3T0JA 2I58A 2ZYOA 1BK4A 3W9WA 3TAJA 2F3BA 1EU8A 1ZBMA 5ICTA 3RYDA 3KG2A 5I57A 4KFQA 3FASA 1YTVA 3TYHA 5TU0A 2CZHA 1MQDA 4RY1A 2IEEA 1AWBA 1IQ7A 1HSLA 1N3XA 3MQ9A 3G3IA 2XWOA 1IXIA 1LFGA 4YICA 3N94A 2UXAA 3IORA 2DWAA 4PCDA 1NNTA 2XXRA 5ESYA 3KJ7A 1SW4A 2VP1A 5IAIA 3MP8A 3SKPA 1MQGA 1M5FA 5ET5A 3FVNA 4IR8A 5JTYB 2ZNUA 3DP8A 4PFBA 4PTKA 2OWZA 3HN0A 4ZDMA 1JP4A 3HSTA 3SEWA 3SEUA 3O66A 4N8GA 1NNPA 1N04A 3FV2A 5FHNA 1QUJA 5J16A 4EXKA 3PV0E 4F1UA 2NOOA 4PFWA 4HCWA 4ZEDA 2O84X 2QVVA 4I9DA 4N13A 4ZE9A 4C0RA 2Q88A 1XC1A 2QS4A 3IJOB 4ONYA 3TCHA 1N3WA 1Q9DA 4NEDA 1MPBA 3JYRA 2D3IA 1QJMA 1LEVA 3VLWA 4RYAA 3LSWA 4L17A 1O7TA 1NV3A 2XWIA 4R72A 4F29A 4UA8A 3ROJA 1B3GA 4WEDA 4U1ZA 2OX3A 5KCJA 3IX1A 2UVGA 5I59B 1QUIA 3H06B 2ANJA 4PE3A 1GGGA 4FEBA 5ET6A 4HTGA 3IOTA 1KZ8A 1NUZA 2H4IA 1S9TA 4OFJA 3W9VA 1IMBA 3L6HA 1MM6A 2VGQA 3FXBA 1DBZA 4KXPA 2R6GE 5ET7A 2V84A 1D9VA 3G7WA 1DPPA 3N26A 4FBPA 3KN8A 1B52A 4C1TA 4H1XA 3LV0A 3MJNA 1NV2A 1NV6A 3MPKA 1FBFA 2QRYA 3VDFA 3CSGA 3KBZA 4XEQA 5AA2B 5I7IA 2GHAA 2XD2A 3RPLA 1MXYA 3MYUA 4QFPA 3VVFA 2B4MA 1B51A 1MY2A 4NF4A 3TPAA 1NH8A 3V8XB 4OFOA 4Q0CA 4BDOA 1EH3A 4N91A 5LDZA 1LCFA 1AL3A 2QL3A 3IAZA 4P9KA 1G0IA 3CG3A 4OVRA 4NQ8A 3EPEA 1MRPA 3TZAA 4EQ7A 4ZECA 4JSOA 1NV1A 1USYH 2P2AA 4ESWA 5I2NA 3OO7A 1M5CA 4RK9A 1PBQA 4MJOA 3HCQA 3K6UA 3EKIA 4ELRA 5H8HB 2V3QA 3E3KA 2I0BA 4O8MA 1FPGA 1DCUA 2HFBA 3S4UA 4GWOA 4PFRA 2RF1A 2ONRA 4R6HA 3QK6A 1UTHB 4X8RA 1MY4A 3QUJA 3MVZA 2HZLA 2FHYA 4G61A 2XXTA 3MVWA 4GIZA 1N7WA 3ZS6A 2H99A 2O7IA 2KQZA 1FQCA 3L6GA 5DTBA 4F1VA 4ELQA 1IMDA 1D4NA 3RPLB 2ZYNA 1LAGE 4E0WA 2DS9A 2XX8A 3D4GA 2FA7A 2Y84A 2H9BA 2Z23A 4P0IA 1P1UA 4GVOA 3IO6A 5H8FA 3LBSA 2RC7A 4KPTA 3HV1A 1PB7A 4ZE8A 2ZZVA 1ATGA 5EQ8A 2ZYKA 3PU5A 3K1NA 2QMWA 3KJTA 3PMWA 3U1OA 1NKXA 3TODA 4BDQA 2Y7PA 2G29A 4MBPA 4JVCA 2F36A 4FORA 5AA4A 4PETA 1MY3A 4ZZAA 1CE2A 1IZ1A 1M5DA 4PBQA 2FVZA 4WEPA 3H6TA 1IXGA 1NI9A 2HHMA 3C4MA 3A09A 3DELB 1B9JA 4OANA 4I1DA 5M2VA 4F19A 4OTEA 3Q27A 3FIRA 3SERA 2E0SA 3FZVA 4AQ4A 3E9XA 3SEYA 5HM4B 1VDWA 3SEVA 3T9HB 1MY0A 4PF8A 4NF8A 3V5AA 5ITPA 4NF5B 1LFIA 4LZ5A 3T9UA 4F2OA 3NOHA 2V4CA 1AOVA 3B7DA 4PGPA 3KOSA 3S2VA 4IO4A 4WXJA 3E13X 4YKIA 1XHYA 2DWJA 2F5XA 4U4XA 4PAIA 1JVYA 3UP9A 1B58A 3KC1A 1L5TA 4LUBA 3ZKKA 3FGSA 2DE4A 2UYEA 4DXBA 2RKMA 1NNFA 4G68C 5DT6A 4OVJA 3VVDA 3LUZA 1PB9A 4G4PA 4Z0IA 5I2KA 3VLVA 3TTMA 1NUWA 4FE8A 4BDRA 1UTBB 3K6XA 4C1UA 1LAXA 2B4LA 3UN6A 4OFLA 2I4BA 4NAPA 1EZPA 1YCJA 3O2AA 3H6WA 1SI0A 2ONSA 5CMKA 4LP2B 4MNIA 4HE2A 3OENA 1EYKA 1A54A 1OLCA 4OVTA 2PT2A 2CEXA 3VLUA 1OVTA 4NWCA 3OMBA 4YB5A 1H76A 3KN7A 4TLMB 4G8NA 2CZLA 4LZ7A 4U1OA 1URGA 3Q25A 1MG1A 1YZ0A 4YKJA 3IL1B 1R1NA 2X7PA 3M8UA 3MZ1A 3RLFE 5AE4A 3ECRA 1OLAA 3BIGA 4LZ8A 1Y3NA 3I5OA 4U4SA 4G8MA 3PD8A 4U2RA 3A3UA 3B6WA 3CR9A 2WYKA 3D4CA 3IB1A 3IJXB 2OK2A 2ZNSA 3ILUB 4I3YA 5I58A 4R6KA 3ZKLA 1GTKA 1SBPA 1CNQA 4YZZA 2F6PA 1US4A 4P8BA 4KYSA 1MM7A 1B05A 5TP9B 1FBDA 5H8QA 3B8BA 4JVDA 3TCGA 4OZ9A 1PB8A 3C36A 1Y9UA 2XX9A 3B6QA 2B65A 4GWUA 4RPOA 3OO8A 3PGFA 4F18A 1NV5A 1LBBA 3OO6A 4PC9A 1N84A 2V25A 3MZBA 3H7MA 3TEPA 1SQYA 2KLFA 3O6IA 5L9MA 3BKIB 4QFKA 3ISPA 3KN3A 1ANFA 1FPEA 4N81A 5IZZA 1IXHA 4OQOA 1B32A 2XXQA 3MC2A 1SYIA 3V83A 1FBHA 4K3FA 2Q74A 5H8HA 3R7XA 1VE4A 1Y4TA 4IGTA 4MMPA 1LCTA 2AYSA 1B4HA 4MNCA 2WYPA 4Q30B 1B40A 4NF8B 4FIMA 3USDA 3RTWB 3TQLA 4HE0A 4KYEA 2BJJX 4RNSA 1LBWA 1P1NA 4PGNA 4DDDA 3ONMA 5I2KB 4NN3A 4OA4A 3C31A 4WKMA 4JB7A 4ND9A 4IY6A 4OEVA 3DLNA 1M5EA 2VHAA 3C32A 1P1QA 3V89B 1PBPA 2XXUA 3MPLA 3PPQA 1I6QA 1NV7A 1Y1ZA 5CM6A 3GLBA 4YB7A 1RDXA 2RCAA 3TFLA 4QFLA 1RDYA 4O7MA 4OWDA 2QVRA 1FBGA 1R9QA 1XVYA 1FJ9A 1A40A 2P1SA 4RJZA 4OVQA 3M3LA 2O1LA 1NUXA 1IEJA 1TXFA 3FVGA 3PPRA 4BDLA 1XOCA 1OVBA 4BLAA 3A3CA 4RPNA 3CSBA 2PX1A 3AXFA 3GXAA 3SESA 4POWA 3G3KA 5F7VA 5F1QA 1TWYA 1YXIA 3A29A 2GRVA 3QYTA 4ZEIA 1F9BA 1LAHE 1OQGA 3UK4A 1S7YA 2THIA 3DM0A 3QXMA 1FTAA 4KQPA 4RK2A 3MUQA 3Q26A 5H8NA 2O6AA 1NUYA 3KC0A 2Q8MA 4GFRA 4MNPA 2DXYA 4GX4A 2OZZA 3EQ1A 2H5YA 5DEXA 2F6GA 5K2XA 4EQ9A 4FECA 4NTLA 1D3KA 3TMGA 4GWXA 3EN3A 1A7LA 4P47A 4GWSA 3T22A 2B3BA 1Q1KA 4JWYA 5H8NB 5CMBA 4TOZA 1I6AA 3O97A 1JETA 4N17A 2VPOA 2XX7A 1EZ9A 4FEDA 4O3CA 1MXVA 4KHZE 2NUVA 3PPPA 3IO4A 4IO6A 1CB6A 1NH7A 1ZLQA 3R26A 4GWWA 1INPA 1US5A 3TKDA 5FHOA 1IUDA 3PPNA 1WVJA 3H6UA 1JW1A 3U8QA 4I62A 4JDFA 4JBZA 2DSFA 1DSNA 3BBRA 3OEMA 4F1YA 3K6VA 3KSXA 2A5SA 4XTCQ 1JEUA 2G93A 3U72A 3M3KA 4YKKA 3VVEA 2R71A 5IM2A 5EQAA 3TTLA 2PYYA 2DXRA 5ELVA 1FPDA 3TUSA 1P1WA 2V93A 5I57B 1KA1A 1VSOA 2I49A 4I40A 2I3WA 4IO2A 3TTRA 2VPNA 3OOAA 5EQ9A 5IZ1A 1UTBA 3B50A 2F8DA 4ISUA 3KEIA 5ISUA 1R9LA 2OWSA 1AIVA 2I0CA 1MXZA 3S9LC 1B3HA 3EHTA 2QS1A 1MQIA 1HSJA 3VXCA 2AL5A 1B3LA 3N6TA 3E4RA 4XKPA 1IMEA 4U22A 2HZKA 2KR0A 3FATA 2F7CA 3HO7A 3T96B 2GHBA 3RN8A 5JK4A 3PUYE 1MXUA 3PD9A 3HPIA 2QVUA 3IOUA 4X48A 1TFDA 4LVQA 1POTA 4NX1A 1Y3QA 3OD7A 3O6HA 1BP5A 3K1MA 1QUKA 1XS5A 4O7IA 3E78A 3UA8A 1LB8A 3ZSFA 2AL4A 1RDZA 2IA4A 4LATA 2OBGA 2O1MA 2XXIA 4MIJA 5JEIA 1B0HA 2CEYA 2DDKA 4NF6A 3KGCA 1ZTYA 5CBSA 4GLIA 5FTIA 4KYDA 2OWTA 4Q8RA 3DP4A 4MLVA 1SW2A 3VV5A 1DTGA 2Y7RA 3IOWA 4NMYA 2ZZXA 2AIXA 3O6GA 4P3LA 1Y4CA 2Y5LA 5DEXB 1MDQA 2XXPA 5DW8A 4G68A 1QULA 4PP0A 2F35A 4GWZA 3CHGA 1LLSA 3GYYA 1B1HA 5H8QB 3Q29A 4P11A 1OIBA 2NWJA 4H45A 4ZS9A 1USYE 1LGBC 3CFZA 5JTYA 1ZU0A 4MX6A 3WAEA 3C9HA 3GBAA 3PPOA 2HCAA 1LB9A 3OSQA 4ELPA 1ZKBA 1QGXA 4OMBA 2I3VA 4X9TA 3FXRA 5J1DA 3KZGA 4DXUA 3I3VA 4M1VA 4YAHX 2FBPA 2RC8A 3IB0A 3CI8A 5A5XB 4LN5A 3PTYA 4DI3D 5ITOA 4R2BA 4R9GA 1B46A 2X26A 3C35A 3GBBA 3RT8A 4QFOA 5IZ3B 1A8EA 4ELOA 3MSTA 1H44A 4MHFA 2RCBA 4ZEKA 4XKRA 3TDJA 1BKAA 3FD3A 2F3DA 3BFTA 3RUMA 4EUOA 3MP6A 1R6ZA 1MQJA 3T1BA 1ZMGA 1B4ZA 3D1RA 3G3JA 1VR5A 3RT6B 3H03A 2LAOA 4OHNA 3U93A 3KOTA 1ZJLA 2DP8A 3G3HA 5CMMA 3FV1A 4ECFA 3JV9A 1N76A 1T0KA 4M4GA 2JJKA 2QPQA 1AH5A 2HXRA 1FPBA 4OVPA 2HXWA 1J1NA 4MH5A 1PDAA 2UVJA 5CBRA 1FTOA 3C34A 4HW8A 4YMAA 3HHGA 3FVKA 1B5JA 3VXBA 3T9XB 1UTHA 4YU0A 4MCOA 4KD5A 4H46A 1IMFA 3MZ9A 4GX3A 2A5TA 2DE3A 4DI4B 1FBCA 3WAFA 2CMOA 2ESNA 2FYIA 1B7UA 1B1XA 1Z7NE 1B2HA 1DTZA 4JXIA 1YPNA 5I5PA 1RKMA 2Q89A 4N8YA 2ZZWA 1Y1MA 1FPFA 4HCYA 2F97A 2Q2AA 1FPKA 3K02A 4H67A 1VFDA 3TCFA 1D9QA 2GQ1A 1H3DA 2YLNA 3I6VA 5AA2D 4H8IA 1YAEA 3H3GA 2E1SA 4TLLB 2CZKA 1GR2A 2V3TA 2YJPA 3N5LA 3CFXA 4R2FA 2W7YA 2P0SA 2I6EA 1RYOA 1A55A 4DIGA 2OLBA 5CRYA 4GL0A 2H98A 4PFTA 1JW5A 5IKBA 3B6TA 1FJ6A 1RYXA 1FQEA 4F3GA 1II5A 1P99A 1FQAA 2RC9A 4EXLA 3FBPA 4XIGQ 2O69A 5TPAB 2DOJA 4F3PA 5B70A 3RQTA 4G77A 3BFUA 3KSJA 3ILTB 4F39A 4PE5B 4EDPA 4IO5A 1FRPA 1MXXA 3R6UA 1H43A 5EQ7A 3K2DA 4AB5A 2FNCA 3CFLA 1Y20A 4IGRA 4AS5A 4ZEFA 2WX9A 1KA0A 4QSEA 1FTJA 2NXOA 3K00A 3LR1A 1BLFA 4HE1A 4G2ZA 2QS3A 5I56B 5I2NB 1FPJA 1TT1A 5EYHA 2BJIA 1EZOA 4NE4A 3H4ZA 2I48A 5A5LA 4PDHA 3K4UA 4N07A 4EF2A 3DP6A 5ET8A 2P3VA 2D21A 1POY1 3K01A 2Z8DA 4BDMA 2Z8FA 4GD5A 1SVXB 4FJPA 1FCKA 1IITA 5FBPA 5FHMA 3FVOA 1B3FA 5KCJB 2QFLA 5T3JA 4R6YA 1BIYA 4XKNA 1K9YA 5L8DA 4I8CA 3M3FA 1HSEA 1JW4A 1SDXA 2PFYA 4HS7A 4NGUA 3OSRA 4TQUQ 4GBVA 4F31B 1QKAA 5EHMA 3EHSA 3BIHA 2QSXA 4HXVA 1NL5A 2ALUA 1NV4A 1IMCA 3LC8A 4N6DA 3MAMA 1WDNA 2XXHA 3RY3A 2HAVA 5I56A 2REGA 3PUZE 4ZEBA 3QSLA 1LBVA 4KI0E 2H25A 5I59A 4YKPA 4GRKA 1MH3A 3QMFA 2XXYA 2RINA 2Y5KA 3FXQA 2XXVA 4MFIA 3EHUA 4DCXA 4P1EA 1NNKA 4DZ1A 2DE2A 4OYVA 4GBWA 2P3NA 3FXUA 4LQ2A 4OEUA 2O51A 2DYXA 4H65A 4NHBA 3T66A 1N0TA 1MDP1 4LONB 3HHFA 2CZIA 4POXA 1P1OA 1FTLA 2D5WA 3T9VA 3QUFA 3UIFA 4IO7A 3H6VA 1SW5A 3F11A 2QJEA 4GF8A 4G68B 5EYFA 5AA3A 3THIA 4XXUA 4DLDA 4I3EA 5EYGA 2M8CA 5I58B 2OJTA 4F2QA 2O7UA 3G3FA 4PFUA 2PCRA 3RNNA 1YYZA 1JVXA 4MEVA 4O3BA 2Y7WA 4F3BA 1O63A 4UACA 3E79A 5CMCA 3O9PA 2GFEA 1FW0A 4GWYA 3K6WA 4P1LA 4MF3A 2Z22A 1XT8A 4QXDA 5AA1A 1DK4A 4PDDA 3MBPA 2DQVA 2VD3A 2ZMBA 2L5VA 4G8HA 1EYIA 3SDFA 3PUVE 5CI5A 1SW1A 4H8JA 3EF7A 3RPWA 4LQ5A 1QVSA 5IZ3A 2DWIA 4QSDA 3RGYA 3PUXE 1FQBA 1I69A 4YMBA 2R9JA 4P56A 1LBCA 4OXVA 4R75A 3TTKA 4RXLA 1JEVA 2XWKA 4RA1A 3TTNA 4FATA 4GX6A 1ELJA 3LSLA 5KZTA 1MPCA 1O64A 5A5XA 3K1PA 4OERA 2XWVA 2HAUA 5LOMA 2V3UA 4OENA 4GXAA 3U94A 3VE1B 4H6DA 1N7XA 1SYHA 3HFUA 4YB6A 1FTMA 1MY1A 4DE8A 1LBZA 3W15C 1UQWA 4E0XA 2DVZA 4OVSA 2WEFA 3JZJA 1TFAA 3FJ7A 4U23A 4DCYA 4X04A 2F78A 2B3FA 3O29A 1WODA 4KR5A 5KDTB 5I84A 5H8FB 3PMVA 1IXCA 4OESA 2XHDA 1FQDA 4NG7A 2REJA 4F22A 2VOZA 2UYFA 3KBRA 1DOTA 1VFEA 3OELA 4R74A 2F7AA 3LSFB 1DPEA 3MWBA 3UGWA 1B0LA 4ZZEA 1MH4A 4QRZA 5DVJA 1D9YA 2QS2A 2Y7KA 3FJGA 3ODBA 2F34A 4H0WA 4FAJA 4O94A 2Q9TA 3FJMA 4N15A 1AMFA 3LUYA 5EHSA 4N6PA 1A99A 4UABA 3S9EA 1LSTA 5AA4B 2Q8JA 2MKZA 5DYHA 2Z8EA 3MVYA 3MW0A 1NV0A 2WBBA 1FBEA 4MAGA 1LBXA 1ZIUA 4NF5A 3SEXA 5B7DA 5HPQA 1OMPA 2PVUA 5ICQA 2UVHA
chains in the Genus database with same CATH topology
1M5CA 1PEBA 1GR2A 1XOCA 2V3TA 1OVBA 2YJPA 3CFXA 3N5LA 4R2FA 4BDLA 3A3CA 2W7YA 1DMBA 1PBQA 2PX1A 2XXWA 2ZYMA 3AXFA 3CSBA 3GXAA 2P0SA 3HCQA 3K6UA 2O68A 2I6EA 3SESA 1RYOA 1A55A 4DIGA 4ELRA 2OLBA 3G3KA 4POWA 5F7VA 5CRYA 4GL0A 5H8HB 2H98A 2V3QA 4PFTA 3K0VA 5F1QA 1TWYA 3E3KA 1JW5A 2I0BA 3B6TA 1B5IA 4U21A 2HFBA 5I59B 5IKBA 1RYXA 4H5GA 3RY3A 3S4UA 3PUWE 1FQEA 2GRVA 4GWOA 4F3GA 2RF1A 3QYTA 4ZEIA 3T93B 1OQHA 2ONRA 3KFMA 4R6HA 1F9BA 1II5A 3QK6A 1LAHE 1OQGA 1P99A 1FQAA 1S7YA 2RC9A 1UTHB 2THIA 2XD3A 4GQOA 3UK4A 4XKQA 3DM0A 1B6HA 4F3SA 4EXLA 1MY4A 3N6UA 4GL8A 4XIGQ 2O69A 5TPAB 3QXMA 1QW0A 3QUJA 2DOJA 4KQPA 3MVZA 2HZLA 4F3PA 5B70A 3RQTA 3QAXA 4RK2A 4R73A 2XXTA 3MVWA 3MUQA 4G77A 4GIZA 4IY5A 3IR1A 3BFUA 3KSJA 1N7WA 1A8FA 2O6AA 3Q26A 5H8NA 3OXNA 3ILTB 5TPAA 3ZS6A 4F39A 4PE5B 2H99A 2O7IA 4EDPA 1B7HA 4GFRA 1FQCA 2DXYA 2OZZA 1NFTA 2H5YA 3EQ1A 3L6GA 2HEUA 5DTBA 5DEXA 4F1VA 2F6GA 5K2XA 4ELQA 3CIJA 4IO5A 4EQ9A 1FTKA 1D4NA 4R9FA 2ZYNA 4FECA 4NTLA 1LAGE 1D3KA 5H8SA 4E0WA 3TMGA 2DS9A 1MXXA 3R6UA 2XX8A 3D4GA 2ONKE 1LFHA 2FA7A 1H43A 3K2DA 2Y84A 3EN3A 4PFYA 2H9BA 1GV8A 3SETA 4AB5A 1A7LA 2FNCA 3CFLA 1UIUA 1Y20A 4NWDA 2Z23A 4IGRA 4P0IA 3T22A 2B3BA 1P1UA 4GVOA 1Q1KA 3IO6A 4OETA 5H8FA 1URDA 1FQFA 4JWYA 4QSCA 3LBSA 4Q5TA 5CMBA 4ZEFA 4TOZA 5H8NB 5I2NA 1MS7A 1I6AA 2RC7A 3O97A 1JETA 4KCDA 4QSEA 4KPTA 3HV1A 1PB7A 4ZE8A 1FTJA 2NXOA 3K00A 3P7IA 2XX7A 2VD2A 1ATGA 1BLFA 1EZ9A 3LR1A 4FEDA 4G2ZA 1Z7ME 2QS3A 2ZYKA 4O3CA 1MXVA 4KHZE 5I2NB 5I56B 1TT1A 2XXXA 3PU5A 5BUUA 3S9NC 1EZOA 4GXSB 2I4CA 1LAFE 2NUVA 2QMWA 1I6BA 3H4ZA 1CB6A 3IO4A 1NH7A 3K1NA 2I48A 2Q2CA 3PMWA 4IO6A 5DVFA 3U1OA 1NKXA 2ABHA 4RK9A 1ZLQA 3K4UA 3R26A 4N07A 4EF2A 1US5A 3DP6A 3TKDA 5FHOA 1IUDA 3PPNA 1QKBA 1WVJA 3H6UA 4KCCA 1JW1A 3TODA 4BDQA 2D21A 5DVIA 3U8QA 2Y7PA 2G29A 1POY1 4I62A 4JDFA 4JBZA 4MBPA 3K01A 2DSFA 2NVUB 3MP1A 1DSNA 3BBRA 3OEMA 2Z8DA 3PPPA 2F36A 3U92A 4EQBA 4BDMA 4F1YA 3Q28A 2Z8FA 3K6VA 4FORA 4GD5A 4NF4B 5AA4A 1SVXB 2A5SA 3KSXA 4FJPA 4XTCQ 1FCKA 4PETA 1MY3A 4ZZAA 1IITA 1CE2A 1JEUA 3FUZA 1IZ1A 1M5DA 4H5FA 5FHMA 2G93A 3OO9A 3U72A 5KDTA 4WEPA 3FVOA 3H6TA 3M3KA 1B3FA 1IXGA 4YKKA 3VVEA 5KCJB 2R71A 4DXCA 3C4MA 3TTLA 2UVIA 3A09A 1SI1A 1Q35A 2F7BA 3DELB 1B9JA 3IK6B 3IOVA 5TP9A 2PYYA 2DXRA 4R6YA 1BIYA 4I1DA 5ELVA 1P1WA 3TUSA 5M2VA 2V93A 4XKNA 5L8DA 4IB2A 2QMXA 4F19A 5I57B 2X7QA 4OTEA 4I8CA 4EF1A 3M3FA 3Q27A 1VSOA 1HSEA 2I49A 3C33A 3FIRA 4JWXA 1JW4A 3SERA 2E0SA 2HQ0A 1SDXA 3FZVA 1UIVA 4AQ4A 3E9XA 4ESXA 3SEYA 4HS7A 5HM4B 3SEVA 3T9HB 3OSRA 4TQUQ 1MY0A 3V5AA 4NF8A 4F31B 2I3WA 4IO2A 1QKAA 5ITPA 5EHMA 3KJTA 3TTRA 4NF5B 3OOAA 2DVCA 3EHSA 1LFIA 4LZ5A 1UTBA 2F8DA 3T9UA 4F2OA 4JSDA 2QSXA 4JWOA 5L9SA 4ISUA 5BWJA 1NL5A 4LA9A 3QIMA 2Y7IA 2ZNTA 3KEIA 5ISUA 1R9LA 1AOVA 2ALUA 3B7DA 3KOSA 2OWSA 1AIVA 4P0GA 4QHQA 5FTHA 3S2VA 2I0CA 3LC8A 1MXZA 1SD3A 3MAMA 1WDNA 2XXHA 4IO4A 4BLAA 3RTFB 1M5BA 4WXJA 3E13X 4MLQA 1BTJA 1XHYA 2DWJA 1B3HA 3EHTA 2F5XA 4YKIA 4U4XA 2HAVA 4THIA 2REGA 5I56A 3S9MC 1PC3A 1JVYA 3UP9A 3PUZE 3VFJA 2QS1A 4ZEBA 1B58A 1L5TA 3QSLA 1MQIA 4LUBA 1HSJA 3ZKKA 3VXCA 2AL5A 1B5HA 1B3LA 3FGSA 3N6TA 4O3AA 3E4RA 5AA2A 4XKPA 2DE4A 4KI0E 2H25A 4U22A 5I59A 2UYEA 4DXBA 4YKPA 1KWHA 4GRKA 1NMUA 2GH9A 2RKMA 2HZKA 1MH3A 3FATA 2XXYA 1NNFA 2WKYA 4G68C 3G3GA 2F7CA 2RINA 5DT6A 3CRBA 3FXQA 2XXVA 4OVJA 3HO7A 4MFIA 3T96B 3EHUA 4DCXA 2GHBA 3VVDA 1PB9A 1Y3PA 3RN8A 5JK4A 3PUYE 1NNKA 4DZ1A 2DE2A 1JQFA 1MXUA 3PD9A 1URSA 3HPIA 4G4PA 4OYVA 3IOUA 5CC2A 4IO3A 4Z0IA 2PT1A 5I2KA 4X48A 2A5TB 1TFDA 3FXUA 4LQ2A 4LVQA 3VLVA 3TTMA 4OEUA 5L9OA 4FE8A 4BDRA 1UTBB 1POTA 3O28A 1Y3QA 2O51A 3OD7A 2DYXA 3O6HA 1BP5A 3K1MA 3K6XA 4GOTA 1LAXA 4C1UA 3LSXA 4H65A 3UN6A 1QUKA 1XS5A 4BDNA 5K2YA 3TELA 3UA8A 1XVXA 1LB8A 3T66A 1N0TA 4OFLA 3ZSFA 2AL4A 4QFNA 2I4BA 1MDP1 2IA4A 4LATA 2OBGA 4LONB 2O1MA 2DWHA 2XXIA 4QF9A 3CVGA 3HHFA 1EZPA 1YCJA 1B0HA 4POXA 3O2AA 5JEIA 1JNFA 1P1OA 4NF6A 1FTLA 2D5WA 3H6WA 3T9VA 1SI0A 3QUFA 2ONSA 3KGCA 1ZTYA 4X1BA 5CBSA 2OCUA 1IIWA 4GLIA 4LP2B 3UIFA 2ZXTA 5CMKA 5FTIA 3CG1A 4PQJA 1S50A 4KYDA 3TQWA 3IB2A 1MPDA 4IO7A 3H6VA 3OENA 1SW5A 3F11A 2QJEA 2OWTA 2PBWA 3PMXA 3UORA 4Q8RA 1B3EA 1A54A 1OLCA 4X1DA 3GZGA 4GF8A 2PMSA 1MXWA 2PT2A 3MVXA 4G68B 5EYFA 3OEKA 3VLUA 4AB6A 1H45A 1OVTA 5AA3A 3THIA 3DP4A 4MLVA 4NWCA 1GVCA 1SW2A 3OMBA 4XXUA 4YB5A 4DLDA 3VV5A 1H76A 3KN7A 4TLMB 1DTGA 2Y7RA 4G8NA 5HBCA 3IOWA 2M8CA 4NMYA 5I58B 4Z7EA 2CZLA 2OJTA 2O7UA 2YPNA 4NF6B 4F2QA 3G3FA 2AIXA 3O6GA 1B7ZA 4LZ7A 4PFUA 1MQHA 2I58A 4U1OA 3RNNA 2ZYOA 1Y4CA 1URGA 3W9WA 3Q25A 1MDQA 1MG1A 2XXPA 5DEXB 4YKJA 3TAJA 1EU8A 3IL1B 4G68A 1R1NA 2X7PA 1ZBMA 5ICTA 1QULA 1JVXA 4O3BA 2F35A 3M8UA 4PP0A 3KG2A 5I57A 1LLSA 3MZ1A 2Y7WA 3RLFE 4F3BA 5AE4A 1B1HA 1O63A 4UACA 5H8QB 4KFQA 3ECRA 3FASA 5CMCA 1YTVA 3TYHA 1OLAA 4LZ8A 3Q29A 3O9PA 5TU0A 1Y3NA 2GFEA 3I5OA 1MQDA 4U4SA 4RY1A 4G8MA 1FW0A 4P11A 1OIBA 3K6WA 2IEEA 3PD8A 4U2RA 1IQ7A 4C0RA 3A3UA 1HSLA 3B6WA 1N3XA 3MQ9A 4MF3A 2NWJA 2Z22A 3CR9A 1XT8A 3G3IA 4ZS9A 3D4CA 1IXIA 3IB1A 3IJXB 1USYE 2OK2A 1LFGA 4YICA 5AA1A 3N94A 1LGBC 2UXAA 2ZNSA 3CFZA 3ILUB 3IORA 2DWAA 5JTYA 1ZU0A 3WAEA 3C9HA 5I58A 3GBAA 4R6KA 3PPOA 2HCAA 3ZKLA 1GTKA 1LB9A 1SBPA 3OSQA 4ELPA 1NNTA 3MBPA 1ZKBA 2DQVA 2VD3A 2XXRA 2ZMBA 4OMBA 2I3VA 3KJ7A 4G8HA 4X9TA 3SDFA 1SW4A 2VP1A 4YZZA 5IAIA 3MP8A 3SKPA 3PUVE 2F6PA 5CI5A 3FXRA 1US4A 1SW1A 5J1DA 3KZGA 4H8JA 1MQGA 3EF7A 3RPWA 3I3VA 4DXUA 1M5FA 4KYSA 3FVNA 4LQ5A 1MM7A 1QVSA 1B05A 4M1VA 4YAHX 5JTYB 5TP9B 2DWIA 2RC8A 2ZNUA 3DP8A 3IB0A 4QSDA 5H8QA 3RGYA 3CI8A 3HN0A 3HSTA 4ZDMA 5A5XB 3PUXE 3SEWA 3TCGA 5ITOA 4R2BA 4R9GA 1B46A 4OZ9A 3SEUA 1FQBA 1PB8A 3O66A 1I69A 3C36A 4YMBA 1Y9UA 2X26A 2XX9A 2R9JA 3C35A 1NNPA 3GBBA 1N04A 3B6QA 2B65A 3FV2A 3RT8A 1LBCA 1QUJA 4QFOA 4RPOA 5FHNA 4OXVA 4R75A 3OO8A 3PGFA 4EXKA 3PV0E 4F1UA 4F18A 3TTKA 2NOOA 1A8EA 4PFWA 4RXLA 4ELOA 1LBBA 4HCWA 1JEVA 4ZEDA 1H44A 4RA1A 2RCBA 2O84X 4ZEKA 3OO6A 3TTNA 4FATA 1N84A 2V25A 1ELJA 3LSLA 5KZTA 1MPCA 3MZBA 4XKRA 3H7MA 3TDJA 1O64A 5A5XA 1BKAA 4I9DA 3FD3A 3TEPA 1SQYA 2KLFA 4N13A 4ZE9A 3K1PA 3O6IA 3BFTA 3RUMA 4OERA 4EUOA 1R6ZA 2Q88A 3MP6A 1MQJA 1XC1A 2HAUA 1ZMGA 1B4ZA 3BKIB 4QFKA 5L9MA 5LOMA 3G3JA 1VR5A 2V3UA 3RT6B 4OENA 3H03A 2LAOA 3KN3A 4GXAA 1ANFA 4OHNA 3U93A 2QS4A 3IJOB 1ZJLA 3KOTA 4ONYA 3TCHA 1N3WA 3U94A 3VE1B 4NEDA 2DP8A 3G3HA 1N7XA 1MPBA 4H6DA 3JYRA 1SYHA 2D3IA 1IXHA 5CMMA 1QJMA 3FV1A 3VLWA 4ECFA 3JV9A 4YB6A 4OQOA 4RYAA 1B32A 3LSWA 1FTMA 1MY1A 1N76A 2XXQA 4L17A 4DE8A 1T0KA 4M4GA 1O7TA 3W15C 1UQWA 2QPQA 4R72A 4E0XA 4UA8A 2DVZA 4F29A 3JZJA 1B3GA 3MC2A 1SYIA 4WEDA 1TFAA 4U1ZA 3V83A 1AH5A 3FJ7A 4U23A 4DCYA 4K3FA 5KCJA 3IX1A 2HXWA 2F78A 2UVGA 1J1NA 2B3FA 5H8HA 3O29A 4MH5A 1PDAA 2UVJA 3R7XA 5CBRA 1FTOA 1WODA 4KR5A 3C34A 1QUIA 5KDTB 4HW8A 4YMAA 5I84A 3H06B 2ANJA 5H8FB 3HHGA 3FVKA 1GGGA 1VE4A 1B5JA 1Y4TA 4FEBA 1LCTA 4IGTA 3PMVA 2AYSA 1IXCA 3VXBA 4OESA 3T9XB 2XHDA 1FQDA 4HTGA 1B4HA 3IOTA 1UTHA 2H4IA 2REJA 1S9TA 4RPNA 4KD5A 2VOZA 4Q30B 4YU0A 1B40A 4OFJA 3W9VA 4F22A 4NF8B 2UYFA 3MZ9A 3KBRA 1DOTA 1VFEA 3L6HA 4FIMA 3USDA 1MM6A 2A5TA 3OELA 3RTWB 3TQLA 2VGQA 4R74A 2DE3A 4KYEA 2BJJX 2F7AA 3LSFB 1DPEA 3MWBA 4RNSA 3UGWA 2R6GE 2V84A 1D9VA 4NE4A 3WAFA 3G7WA 1DPPA 1B0LA 2CMOA 3N26A 1P1NA 4ZZEA 1MH4A 3S9LC 4QRZA 5DVJA 3KN8A 1D9YA 1B52A 4DDDA 4C1TA 2ESNA 4H1XA 3ONMA 2FYIA 2QS2A 1B7UA 2Y7KA 3FJGA 3MJNA 5I2KB 1B1XA 3ODBA 2F34A 4H0WA 1Z7NE 4FAJA 1B2HA 3C31A 4WKMA 2Q9TA 3FJMA 3MPKA 4JB7A 4ND9A 2QRYA 1DTZA 4JXIA 1AMFA 4IY6A 4OEVA 3VDFA 1YPNA 1RKMA 3CSGA 3DLNA 1M5EA 2Q89A 2VHAA 3C32A 5AA2B 1P1QA 3LUYA 1Y1MA 3V89B 5EHSA 4N6PA 1PBPA 1A99A 2GHAA 2XD2A 2XXUA 4HCYA 1MXYA 3MPLA 1I6QA 3PPQA 1LSTA 4QFPA 3S9EA 2F97A 3VVFA 1B51A 1MY2A 2Q2AA 4NF4A 5AA4B 3K02A 4H67A 1Y1ZA 5CM6A 2Q8JA 3GLBA 1NH8A 1VFDA 4YB7A 3TCFA 2RCAA 3TPAA 5DYHA 3TFLA 4QFLA 3V8XB 4OFOA 4Q0CA 4BDOA 1EH3A 2Z8EA 4OWDA 1H3DA 3MVYA 1LCFA 2YLNA 1R9QA 3I6VA 3MW0A 1XVYA 1AL3A 2QL3A 3IAZA 1A40A 2P1SA 4RJZA 3M3LA 3CG3A 1ZIUA 4NF5A 2O1LA 4H8IA 5AA2D 3EPEA 3SEXA 5B7DA 1MRPA 3TZAA 1YAEA 4EQ7A 4ZECA 5HPQA 4JSOA 3H3GA 1IEJA 1OMPA 1TXFA 2PVUA 2E1SA 3FVGA 4TLLB 5ICQA 1USYH 2P2AA 4ESWA 3PPRA 2UVHA 3OO7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M5C A;  1PEB A;  1GR2 A;  1XOC A;  2V3T A;  1OVB A;  2YJP A;  3CFX A;  3N5L A;  4R2F A;  4BDL A;  3A3C A;  2W7Y A;  1DMB A;  1PBQ A;  2PX1 A;  2XXW A;  2ZYM A;  3AXF A;  3CSB A;  3GXA A;  2P0S A;  3HCQ A;  3K6U A;  2O68 A;  2I6E A;  3SES A;  1RYO A;  1A55 A;  4DIG A;  4ELR A;  2OLB A;  3G3K A;  4POW A;  5F7V A;  5CRY A;  4GL0 A;  5H8H B;  2H98 A;  2V3Q A;  4PFT A;  3K0V A;  5F1Q A;  1TWY A;  3E3K A;  1JW5 A;  2I0B A;  3B6T A;  1B5I A;  4U21 A;  2HFB A;  5I59 B;  5IKB A;  1RYX A;  4H5G A;  3RY3 A;  3S4U A;  3PUW E;  1FQE A;  2GRV A;  4GWO A;  4F3G A;  2RF1 A;  3QYT A;  4ZEI A;  3T93 B;  1OQH A;  2ONR A;  3KFM A;  4R6H A;  1F9B A;  1II5 A;  3QK6 A;  1LAH E;  1OQG A;  1P99 A;  1FQA A;  1S7Y A;  2RC9 A;  1UTH B;  2THI A;  2XD3 A;  4GQO A;  3UK4 A;  4XKQ A;  3DM0 A;  1B6H A;  4F3S A;  4EXL A;  1MY4 A;  3N6U A;  4GL8 A;  4XIG Q;  2O69 A;  5TPA B;  3QXM A;  1QW0 A;  3QUJ A;  2DOJ A;  4KQP A;  3MVZ A;  2HZL A;  4F3P A;  5B70 A;  3RQT A;  3QAX A;  4RK2 A;  4R73 A;  2XXT A;  3MVW A;  3MUQ A;  4G77 A;  4GIZ A;  4IY5 A;  3IR1 A;  3BFU A;  3KSJ A;  1N7W A;  1A8F A;  2O6A A;  3Q26 A;  5H8N A;  3OXN A;  3ILT B;  5TPA A;  3ZS6 A;  4F39 A;  4PE5 B;  2H99 A;  2O7I A;  4EDP A;  1B7H A;  4GFR A;  1FQC A;  2DXY A;  2OZZ A;  1NFT A;  2H5Y A;  3EQ1 A;  3L6G A;  2HEU A;  5DTB A;  5DEX A;  4F1V A;  2F6G A;  5K2X A;  4ELQ A;  3CIJ A;  4IO5 A;  4EQ9 A;  1FTK A;  1D4N A;  4R9F A;  2ZYN A;  4FEC A;  4NTL A;  1LAG E;  1D3K A;  5H8S A;  4E0W A;  3TMG A;  2DS9 A;  1MXX A;  3R6U A;  2XX8 A;  3D4G A;  2ONK E;  1LFH A;  2FA7 A;  1H43 A;  3K2D A;  2Y84 A;  3EN3 A;  4PFY A;  2H9B A;  1GV8 A;  3SET A;  4AB5 A;  1A7L A;  2FNC A;  3CFL A;  1UIU A;  1Y20 A;  4NWD A;  2Z23 A;  4IGR A;  4P0I A;  3T22 A;  2B3B A;  1P1U A;  4GVO A;  1Q1K A;  3IO6 A;  4OET A;  5H8F A;  1URD A;  1FQF A;  4JWY A;  4QSC A;  3LBS A;  4Q5T A;  5CMB A;  4ZEF A;  4TOZ A;  5H8N B;  5I2N A;  1MS7 A;  1I6A A;  2RC7 A;  3O97 A;  1JET A;  4KCD A;  4QSE A;  4KPT A;  3HV1 A;  1PB7 A;  4ZE8 A;  1FTJ A;  2NXO A;  3K00 A;  3P7I A;  2XX7 A;  2VD2 A;  1ATG A;  1BLF A;  1EZ9 A;  3LR1 A;  4FED A;  4G2Z A;  1Z7M E;  2QS3 A;  2ZYK A;  4O3C A;  1MXV A;  4KHZ E;  5I2N B;  5I56 B;  1TT1 A;  2XXX A;  3PU5 A;  5BUU A;  3S9N C;  1EZO A;  4GXS B;  2I4C A;  1LAF E;  2NUV A;  2QMW A;  1I6B A;  3H4Z A;  1CB6 A;  3IO4 A;  1NH7 A;  3K1N A;  2I48 A;  2Q2C A;  3PMW A;  4IO6 A;  5DVF A;  3U1O A;  1NKX A;  2ABH A;  4RK9 A;  1ZLQ A;  3K4U A;  3R26 A;  4N07 A;  4EF2 A;  1US5 A;  3DP6 A;  3TKD A;  5FHO A;  1IUD A;  3PPN A;  1QKB A;  1WVJ A;  3H6U A;  4KCC A;  1JW1 A;  3TOD A;  4BDQ A;  2D21 A;  5DVI A;  3U8Q A;  2Y7P A;  2G29 A;  1POY 1;  4I62 A;  4JDF A;  4JBZ A;  4MBP A;  3K01 A;  2DSF A;  2NVU B;  3MP1 A;  1DSN A;  3BBR A;  3OEM A;  2Z8D A;  3PPP A;  2F36 A;  3U92 A;  4EQB A;  4BDM A;  4F1Y A;  3Q28 A;  2Z8F A;  3K6V A;  4FOR A;  4GD5 A;  4NF4 B;  5AA4 A;  1SVX B;  2A5S A;  3KSX A;  4FJP A;  4XTC Q;  1FCK A;  4PET A;  1MY3 A;  4ZZA A;  1IIT A;  1CE2 A;  1JEU A;  3FUZ A;  1IZ1 A;  1M5D A;  4H5F A;  5FHM A;  2G93 A;  3OO9 A;  3U72 A;  5KDT A;  4WEP A;  3FVO A;  3H6T A;  3M3K A;  1B3F A;  1IXG A;  4YKK A;  3VVE A;  5KCJ B;  2R71 A;  4DXC A;  3C4M A;  3TTL A;  2UVI A;  3A09 A;  1SI1 A;  1Q35 A;  2F7B A;  3DEL B;  1B9J A;  3IK6 B;  3IOV A;  5TP9 A;  2PYY A;  2DXR A;  4R6Y A;  1BIY A;  4I1D A;  5ELV A;  1P1W A;  3TUS A;  5M2V A;  2V93 A;  4XKN A;  5L8D A;  4IB2 A;  2QMX A;  4F19 A;  5I57 B;  2X7Q A;  4OTE A;  4I8C A;  4EF1 A;  3M3F A;  3Q27 A;  1VSO A;  1HSE A;  2I49 A;  3C33 A;  3FIR A;  4JWX A;  1JW4 A;  3SER A;  2E0S A;  2HQ0 A;  1SDX A;  3FZV A;  1UIV A;  4AQ4 A;  3E9X A;  4ESX A;  3SEY A;  4HS7 A;  5HM4 B;  3SEV A;  3T9H B;  3OSR A;  4TQU Q;  1MY0 A;  3V5A A;  4NF8 A;  4F31 B;  2I3W A;  4IO2 A;  1QKA A;  5ITP A;  5EHM A;  3KJT A;  3TTR A;  4NF5 B;  3OOA A;  2DVC A;  3EHS A;  1LFI A;  4LZ5 A;  1UTB A;  2F8D A;  3T9U A;  4F2O A;  4JSD A;  2QSX A;  4JWO A;  5L9S A;  4ISU A;  5BWJ A;  1NL5 A;  4LA9 A;  3QIM A;  2Y7I A;  2ZNT A;  3KEI A;  5ISU A;  1R9L A;  1AOV A;  2ALU A;  3B7D A;  3KOS A;  2OWS A;  1AIV A;  4P0G A;  4QHQ A;  5FTH A;  3S2V A;  2I0C A;  3LC8 A;  1MXZ A;  1SD3 A;  3MAM A;  1WDN A;  2XXH A;  4IO4 A;  4BLA A;  3RTF B;  1M5B A;  4WXJ A;  3E13 X;  4MLQ A;  1BTJ A;  1XHY A;  2DWJ A;  1B3H A;  3EHT A;  2F5X A;  4YKI A;  4U4X A;  2HAV A;  4THI A;  2REG A;  5I56 A;  3S9M C;  1PC3 A;  1JVY A;  3UP9 A;  3PUZ E;  3VFJ A;  2QS1 A;  4ZEB A;  1B58 A;  1L5T A;  3QSL A;  1MQI A;  4LUB A;  1HSJ A;  3ZKK A;  3VXC A;  2AL5 A;  1B5H A;  1B3L A;  3FGS A;  3N6T A;  4O3A A;  3E4R A;  5AA2 A;  4XKP A;  2DE4 A;  4KI0 E;  2H25 A;  4U22 A;  5I59 A;  2UYE A;  4DXB A;  4YKP A;  1KWH A;  4GRK A;  1NMU A;  2GH9 A;  2RKM A;  2HZK A;  1MH3 A;  3FAT A;  2XXY A;  1NNF A;  2WKY A;  4G68 C;  3G3G A;  2F7C A;  2RIN A;  5DT6 A;  3CRB A;  3FXQ A;  2XXV A;  4OVJ A;  3HO7 A;  4MFI A;  3T96 B;  3EHU A;  4DCX A;  2GHB A;  3VVD A;  1PB9 A;  1Y3P A;  3RN8 A;  5JK4 A;  3PUY E;  1NNK A;  4DZ1 A;  2DE2 A;  1JQF A;  1MXU A;  3PD9 A;  1URS A;  3HPI A;  4G4P A;  4OYV A;  3IOU A;  5CC2 A;  4IO3 A;  4Z0I A;  2PT1 A;  5I2K A;  4X48 A;  2A5T B;  1TFD A;  3FXU A;  4LQ2 A;  4LVQ A;  3VLV A;  3TTM A;  4OEU A;  5L9O A;  4FE8 A;  4BDR A;  1UTB B;  1POT A;  3O28 A;  1Y3Q A;  2O51 A;  3OD7 A;  2DYX A;  3O6H A;  1BP5 A;  3K1M A;  3K6X A;  4GOT A;  1LAX A;  4C1U A;  3LSX A;  4H65 A;  3UN6 A;  1QUK A;  1XS5 A;  4BDN A;  5K2Y A;  3TEL A;  3UA8 A;  1XVX A;  1LB8 A;  3T66 A;  1N0T A;  4OFL A;  3ZSF A;  2AL4 A;  4QFN A;  2I4B A;  1MDP 1;  2IA4 A;  4LAT A;  2OBG A;  4LON B;  2O1M A;  2DWH A;  2XXI A;  4QF9 A;  3CVG A;  3HHF A;  1EZP A;  1YCJ A;  1B0H A;  4POX A;  3O2A A;  5JEI A;  1JNF A;  1P1O A;  4NF6 A;  1FTL A;  2D5W A;  3H6W A;  3T9V A;  1SI0 A;  3QUF A;  2ONS A;  3KGC A;  1ZTY A;  4X1B A;  5CBS A;  2OCU A;  1IIW A;  4GLI A;  4LP2 B;  3UIF A;  2ZXT A;  5CMK A;  5FTI A;  3CG1 A;  4PQJ A;  1S50 A;  4KYD A;  3TQW A;  3IB2 A;  1MPD A;  4IO7 A;  3H6V A;  3OEN A;  1SW5 A;  3F11 A;  2QJE A;  2OWT A;  2PBW A;  3PMX A;  3UOR A;  4Q8R A;  1B3E A;  1A54 A;  1OLC A;  4X1D A;  3GZG A;  4GF8 A;  2PMS A;  1MXW A;  2PT2 A;  3MVX A;  4G68 B;  5EYF A;  3OEK A;  3VLU A;  4AB6 A;  1H45 A;  1OVT A;  5AA3 A;  3THI A;  3DP4 A;  4MLV A;  4NWC A;  1GVC A;  1SW2 A;  3OMB A;  4XXU A;  4YB5 A;  4DLD A;  3VV5 A;  1H76 A;  3KN7 A;  4TLM B;  1DTG A;  2Y7R A;  4G8N A;  5HBC A;  3IOW A;  2M8C A;  4NMY A;  5I58 B;  4Z7E A;  2CZL A;  2OJT A;  2O7U A;  2YPN A;  4NF6 B;  4F2Q A;  3G3F A;  2AIX A;  3O6G A;  1B7Z A;  4LZ7 A;  4PFU A;  1MQH A;  2I58 A;  4U1O A;  3RNN A;  2ZYO A;  1Y4C A;  1URG A;  3W9W A;  3Q25 A;  1MDQ A;  1MG1 A;  2XXP A;  5DEX B;  4YKJ A;  3TAJ A;  1EU8 A;  3IL1 B;  4G68 A;  1R1N A;  2X7P A;  1ZBM A;  5ICT A;  1QUL A;  1JVX A;  4O3B A;  2F35 A;  3M8U A;  4PP0 A;  3KG2 A;  5I57 A;  1LLS A;  3MZ1 A;  2Y7W A;  3RLF E;  4F3B A;  5AE4 A;  1B1H A;  1O63 A;  4UAC A;  5H8Q B;  4KFQ A;  3ECR A;  3FAS A;  5CMC A;  1YTV A;  3TYH A;  1OLA A;  4LZ8 A;  3Q29 A;  3O9P A;  5TU0 A;  1Y3N A;  2GFE A;  3I5O A;  1MQD A;  4U4S A;  4RY1 A;  4G8M A;  1FW0 A;  4P11 A;  1OIB A;  3K6W A;  2IEE A;  3PD8 A;  4U2R A;  1IQ7 A;  4C0R A;  3A3U A;  1HSL A;  3B6W A;  1N3X A;  3MQ9 A;  4MF3 A;  2NWJ A;  2Z22 A;  3CR9 A;  1XT8 A;  3G3I A;  4ZS9 A;  3D4C A;  1IXI A;  3IB1 A;  3IJX B;  1USY E;  2OK2 A;  1LFG A;  4YIC A;  5AA1 A;  3N94 A;  1LGB C;  2UXA A;  2ZNS A;  3CFZ A;  3ILU B;  3IOR A;  2DWA A;  5JTY A;  1ZU0 A;  3WAE A;  3C9H A;  5I58 A;  3GBA A;  4R6K A;  3PPO A;  2HCA A;  3ZKL A;  1GTK A;  1LB9 A;  1SBP A;  3OSQ A;  4ELP A;  1NNT A;  3MBP A;  1ZKB A;  2DQV A;  2VD3 A;  2XXR A;  2ZMB A;  4OMB A;  2I3V A;  3KJ7 A;  4G8H A;  4X9T A;  3SDF A;  1SW4 A;  2VP1 A;  4YZZ A;  5IAI A;  3MP8 A;  3SKP A;  3PUV E;  2F6P A;  5CI5 A;  3FXR A;  1US4 A;  1SW1 A;  5J1D A;  3KZG A;  4H8J A;  1MQG A;  3EF7 A;  3RPW A;  3I3V A;  4DXU A;  1M5F A;  4KYS A;  3FVN A;  4LQ5 A;  1MM7 A;  1QVS A;  1B05 A;  4M1V A;  4YAH X;  5JTY B;  5TP9 B;  2DWI A;  2RC8 A;  2ZNU A;  3DP8 A;  3IB0 A;  4QSD A;  5H8Q A;  3RGY A;  3CI8 A;  3HN0 A;  3HST A;  4ZDM A;  5A5X B;  3PUX E;  3SEW A;  3TCG A;  5ITO A;  4R2B A;  4R9G A;  1B46 A;  4OZ9 A;  3SEU A;  1FQB A;  1PB8 A;  3O66 A;  1I69 A;  3C36 A;  4YMB A;  1Y9U A;  2X26 A;  2XX9 A;  2R9J A;  3C35 A;  1NNP A;  3GBB A;  1N04 A;  3B6Q A;  2B65 A;  3FV2 A;  3RT8 A;  1LBC A;  1QUJ A;  4QFO A;  4RPO A;  5FHN A;  4OXV A;  4R75 A;  3OO8 A;  3PGF A;  4EXK A;  3PV0 E;  4F1U A;  4F18 A;  3TTK A;  2NOO A;  1A8E A;  4PFW A;  4RXL A;  4ELO A;  1LBB A;  4HCW A;  1JEV A;  4ZED A;  1H44 A;  4RA1 A;  2RCB A;  2O84 X;  4ZEK A;  3OO6 A;  3TTN A;  4FAT A;  1N84 A;  2V25 A;  1ELJ A;  3LSL A;  5KZT A;  1MPC A;  3MZB A;  4XKR A;  3H7M A;  3TDJ A;  1O64 A;  5A5X A;  1BKA A;  4I9D A;  3FD3 A;  3TEP A;  1SQY A;  2KLF A;  4N13 A;  4ZE9 A;  3K1P A;  3O6I A;  3BFT A;  3RUM A;  4OER A;  4EUO A;  1R6Z A;  2Q88 A;  3MP6 A;  1MQJ A;  1XC1 A;  2HAU A;  1ZMG A;  1B4Z A;  3BKI B;  4QFK A;  5L9M A;  5LOM A;  3G3J A;  1VR5 A;  2V3U A;  3RT6 B;  4OEN A;  3H03 A;  2LAO A;  3KN3 A;  4GXA A;  1ANF A;  4OHN A;  3U93 A;  2QS4 A;  3IJO B;  1ZJL A;  3KOT A;  4ONY A;  3TCH A;  1N3W A;  3U94 A;  3VE1 B;  4NED A;  2DP8 A;  3G3H A;  1N7X A;  1MPB A;  4H6D A;  3JYR A;  1SYH A;  2D3I A;  1IXH A;  5CMM A;  1QJM A;  3FV1 A;  3VLW A;  4ECF A;  3JV9 A;  4YB6 A;  4OQO A;  4RYA A;  1B32 A;  3LSW A;  1FTM A;  1MY1 A;  1N76 A;  2XXQ A;  4L17 A;  4DE8 A;  1T0K A;  4M4G A;  1O7T A;  3W15 C;  1UQW A;  2QPQ A;  4R72 A;  4E0X A;  4UA8 A;  2DVZ A;  4F29 A;  3JZJ A;  1B3G A;  3MC2 A;  1SYI A;  4WED A;  1TFA A;  4U1Z A;  3V83 A;  1AH5 A;  3FJ7 A;  4U23 A;  4DCY A;  4K3F A;  5KCJ A;  3IX1 A;  2HXW A;  2F78 A;  2UVG A;  1J1N A;  2B3F A;  5H8H A;  3O29 A;  4MH5 A;  1PDA A;  2UVJ A;  3R7X A;  5CBR A;  1FTO A;  1WOD A;  4KR5 A;  3C34 A;  1QUI A;  5KDT B;  4HW8 A;  4YMA A;  5I84 A;  3H06 B;  2ANJ A;  5H8F B;  3HHG A;  3FVK A;  1GGG A;  1VE4 A;  1B5J A;  1Y4T A;  4FEB A;  1LCT A;  4IGT A;  3PMV A;  2AYS A;  1IXC A;  3VXB A;  4OES A;  3T9X B;  2XHD A;  1FQD A;  4HTG A;  1B4H A;  3IOT A;  1UTH A;  2H4I A;  2REJ A;  1S9T A;  4RPN A;  4KD5 A;  2VOZ A;  4Q30 B;  4YU0 A;  1B40 A;  4OFJ A;  3W9V A;  4F22 A;  4NF8 B;  2UYF A;  3MZ9 A;  3KBR A;  1DOT A;  1VFE A;  3L6H A;  4FIM A;  3USD A;  1MM6 A;  2A5T A;  3OEL A;  3RTW B;  3TQL A;  2VGQ A;  4R74 A;  2DE3 A;  4KYE A;  2BJJ X;  2F7A A;  3LSF B;  1DPE A;  3MWB A;  4RNS A;  3UGW A;  2R6G E;  2V84 A;  1D9V A;  4NE4 A;  3WAF A;  3G7W A;  1DPP A;  1B0L A;  2CMO A;  3N26 A;  1P1N A;  4ZZE A;  1MH4 A;  3S9L C;  4QRZ A;  5DVJ A;  3KN8 A;  1D9Y A;  1B52 A;  4DDD A;  4C1T A;  2ESN A;  4H1X A;  3ONM A;  2FYI A;  2QS2 A;  1B7U A;  2Y7K A;  3FJG A;  3MJN A;  5I2K B;  1B1X A;  3ODB A;  2F34 A;  4H0W A;  1Z7N E;  4FAJ A;  1B2H A;  3C31 A;  4WKM A;  2Q9T A;  3FJM A;  3MPK A;  4JB7 A;  4ND9 A;  2QRY A;  1DTZ A;  4JXI A;  1AMF A;  4IY6 A;  4OEV A;  3VDF A;  1YPN A;  1RKM A;  3CSG A;  3DLN A;  1M5E A;  2Q89 A;  2VHA A;  3C32 A;  5AA2 B;  1P1Q A;  3LUY A;  1Y1M A;  3V89 B;  5EHS A;  4N6P A;  1PBP A;  1A99 A;  2GHA A;  2XD2 A;  2XXU A;  4HCY A;  1MXY A;  3MPL A;  1I6Q A;  3PPQ A;  1LST A;  4QFP A;  3S9E A;  2F97 A;  3VVF A;  1B51 A;  1MY2 A;  2Q2A A;  4NF4 A;  5AA4 B;  3K02 A;  4H67 A;  1Y1Z A;  5CM6 A;  2Q8J A;  3GLB A;  1NH8 A;  1VFD A;  4YB7 A;  3TCF A;  2RCA A;  3TPA A;  5DYH A;  3TFL A;  4QFL A;  3V8X B;  4OFO A;  4Q0C A;  4BDO A;  1EH3 A;  2Z8E A;  4OWD A;  1H3D A;  3MVY A;  1LCF A;  2YLN A;  1R9Q A;  3I6V A;  3MW0 A;  1XVY A;  1AL3 A;  2QL3 A;  3IAZ A;  1A40 A;  2P1S A;  4RJZ A;  3M3L A;  3CG3 A;  1ZIU A;  4NF5 A;  2O1L A;  4H8I A;  5AA2 D;  3EPE A;  3SEX A;  5B7D A;  1MRP A;  3TZA A;  1YAE A;  4EQ7 A;  4ZEC A;  5HPQ A;  4JSO A;  3H3G A;  1IEJ A;  1OMP A;  1TXF A;  2PVU A;  2E1S A;  3FVG A;  4TLL B;  5ICQ A;  1USY H;  2P2A A;  4ESW A;  3PPR A;  2UVH A;  3OO7 A; 
#chains in the Genus database with same CATH topology
 1PEB A;  1XI6 A;  1DMB A;  2XXW A;  2ZYM A;  2O68 A;  5I3S A;  3K0V A;  4U21 A;  1B5I A;  4H5G A;  3IFA A;  3PUW E;  4XF5 A;  4PAK A;  3SZP A;  3T93 B;  1OQH A;  3KFM A;  4GQO A;  2XD3 A;  4XKQ A;  1B6H A;  4F3S A;  3N6U A;  4GL8 A;  1QW0 A;  3QAX A;  4R73 A;  4IY5 A;  3IR1 A;  1A8F A;  3OXN A;  5TPA A;  4AS4 A;  1B7H A;  1NFT A;  2HEU A;  3CIJ A;  1FTK A;  4R9F A;  4PFI A;  1EYJ A;  5H8S A;  4N4U A;  2ONK E;  1LFH A;  1GV8 A;  3U65 A;  4PFY A;  3SET A;  2HPG A;  1UIU A;  4NWD A;  2FIX A;  1K9Z A;  4OET A;  1URD A;  1FQF A;  4Q5T A;  4PBH A;  1MS7 A;  4KCD A;  5LTC A;  3P7I A;  2VD2 A;  1Z7M E;  2VT5 A;  2XXX A;  5BUU A;  3S9N C;  4GXS B;  4QSC A;  2I4C A;  1LAF E;  5IGA A;  1I6B A;  5DVF A;  2Q2C A;  2ABH A;  4KCC A;  1QKB A;  5DVI A;  3MP1 A;  3U92 A;  4EQB A;  1FPL A;  3Q28 A;  3IFC A;  4NF4 B;  3FUZ A;  4H5F A;  3OO9 A;  5KDT A;  4DXC A;  1SPI A;  2UVI A;  1SI1 A;  1Q35 A;  2F7B A;  3IK6 B;  3IOV A;  5TP9 A;  4IB2 A;  2QMX A;  2X7Q A;  4EF1 A;  3C33 A;  4PF6 A;  4JWX A;  2HQ0 A;  2XA5 A;  4ESX A;  1UIV A;  2DVC A;  4JSD A;  4JWO A;  5L9S A;  5BWJ A;  4LA9 A;  3QIM A;  2Y7I A;  2ZNT A;  4P0G A;  4QHQ A;  5FTH A;  1G0H A;  4XFE A;  1SD3 A;  3RTF B;  1M5B A;  4MLQ A;  1BTJ A;  2NVU B;  4THI A;  4JVI A;  3S9M C;  1PC3 A;  3VFJ A;  1FBP A;  1B5H A;  1FSA A;  4O3A A;  5AA2 A;  2WBD A;  1KWH A;  1NMU A;  2GH9 A;  2WKY A;  3G3G A;  3CRB A;  4PAF A;  1Y3P A;  1JQF A;  4NF0 A;  1URS A;  4N6K A;  5CC2 A;  4IO3 A;  2PT1 A;  2A5T B;  5L9O A;  3O28 A;  2PFZ A;  4GOT A;  3LSX A;  1IMA A;  1FPI A;  4BDN A;  5K2Y A;  3TEL A;  1XVX A;  4QFN A;  2DWH A;  2R8T A;  4QF9 A;  3CVG A;  1JNF A;  4X1B A;  2OCU A;  1IIW A;  1LBY A;  2ZXT A;  3CG1 A;  4PQJ A;  1S50 A;  3TQW A;  3IB2 A;  1MPD A;  3PMX A;  2PBW A;  3UOR A;  1B3E A;  5F24 A;  4X1D A;  3GZG A;  2PMS A;  1MXW A;  3MVX A;  3OEK A;  4AB6 A;  1H45 A;  1GVC A;  2XXK A;  5HBC A;  4Z7E A;  2YPN A;  4NF6 B;  1B7Z A;  2FIE A;  1MQH A;  4QBA A;  3T0J A;  2I58 A;  2ZYO A;  1BK4 A;  3W9W A;  3TAJ A;  2F3B A;  1EU8 A;  1ZBM A;  5ICT A;  3RYD A;  3KG2 A;  5I57 A;  4KFQ A;  3FAS A;  1YTV A;  3TYH A;  5TU0 A;  2CZH A;  1MQD A;  4RY1 A;  2IEE A;  1AWB A;  1IQ7 A;  1HSL A;  1N3X A;  3MQ9 A;  3G3I A;  2XWO A;  1IXI A;  1LFG A;  4YIC A;  3N94 A;  2UXA A;  3IOR A;  2DWA A;  4PCD A;  1NNT A;  2XXR A;  5ESY A;  3KJ7 A;  1SW4 A;  2VP1 A;  5IAI A;  3MP8 A;  3SKP A;  1MQG A;  1M5F A;  5ET5 A;  3FVN A;  4IR8 A;  5JTY B;  2ZNU A;  3DP8 A;  4PFB A;  4PTK A;  2OWZ A;  3HN0 A;  4ZDM A;  1JP4 A;  3HST A;  3SEW A;  3SEU A;  3O66 A;  4N8G A;  1NNP A;  1N04 A;  3FV2 A;  5FHN A;  1QUJ A;  5J16 A;  4EXK A;  3PV0 E;  4F1U A;  2NOO A;  4PFW A;  4HCW A;  4ZED A;  2O84 X;  2QVV A;  4I9D A;  4N13 A;  4ZE9 A;  4C0R A;  2Q88 A;  1XC1 A;  2QS4 A;  3IJO B;  4ONY A;  3TCH A;  1N3W A;  1Q9D A;  4NED A;  1MPB A;  3JYR A;  2D3I A;  1QJM A;  1LEV A;  3VLW A;  4RYA A;  3LSW A;  4L17 A;  1O7T A;  1NV3 A;  2XWI A;  4R72 A;  4F29 A;  4UA8 A;  3ROJ A;  1B3G A;  4WED A;  4U1Z A;  2OX3 A;  5KCJ A;  3IX1 A;  2UVG A;  5I59 B;  1QUI A;  3H06 B;  2ANJ A;  4PE3 A;  1GGG A;  4FEB A;  5ET6 A;  4HTG A;  3IOT A;  1KZ8 A;  1NUZ A;  2H4I A;  1S9T A;  4OFJ A;  3W9V A;  1IMB A;  3L6H A;  1MM6 A;  2VGQ A;  3FXB A;  1DBZ A;  4KXP A;  2R6G E;  5ET7 A;  2V84 A;  1D9V A;  3G7W A;  1DPP A;  3N26 A;  4FBP A;  3KN8 A;  1B52 A;  4C1T A;  4H1X A;  3LV0 A;  3MJN A;  1NV2 A;  1NV6 A;  3MPK A;  1FBF A;  2QRY A;  3VDF A;  3CSG A;  3KBZ A;  4XEQ A;  5AA2 B;  5I7I A;  2GHA A;  2XD2 A;  3RPL A;  1MXY A;  3MYU A;  4QFP A;  3VVF A;  2B4M A;  1B51 A;  1MY2 A;  4NF4 A;  3TPA A;  1NH8 A;  3V8X B;  4OFO A;  4Q0C A;  4BDO A;  1EH3 A;  4N91 A;  5LDZ A;  1LCF A;  1AL3 A;  2QL3 A;  3IAZ A;  4P9K A;  1G0I A;  3CG3 A;  4OVR A;  4NQ8 A;  3EPE A;  1MRP A;  3TZA A;  4EQ7 A;  4ZEC A;  4JSO A;  1NV1 A;  1USY H;  2P2A A;  4ESW A;  5I2N A;  3OO7 A;  1M5C A;  4RK9 A;  1PBQ A;  4MJO A;  3HCQ A;  3K6U A;  3EKI A;  4ELR A;  5H8H B;  2V3Q A;  3E3K A;  2I0B A;  4O8M A;  1FPG A;  1DCU A;  2HFB A;  3S4U A;  4GWO A;  4PFR A;  2RF1 A;  2ONR A;  4R6H A;  3QK6 A;  1UTH B;  4X8R A;  1MY4 A;  3QUJ A;  3MVZ A;  2HZL A;  2FHY A;  4G61 A;  2XXT A;  3MVW A;  4GIZ A;  1N7W A;  3ZS6 A;  2H99 A;  2O7I A;  2KQZ A;  1FQC A;  3L6G A;  5DTB A;  4F1V A;  4ELQ A;  1IMD A;  1D4N A;  3RPL B;  2ZYN A;  1LAG E;  4E0W A;  2DS9 A;  2XX8 A;  3D4G A;  2FA7 A;  2Y84 A;  2H9B A;  2Z23 A;  4P0I A;  1P1U A;  4GVO A;  3IO6 A;  5H8F A;  3LBS A;  2RC7 A;  4KPT A;  3HV1 A;  1PB7 A;  4ZE8 A;  2ZZV A;  1ATG A;  5EQ8 A;  2ZYK A;  3PU5 A;  3K1N A;  2QMW A;  3KJT A;  3PMW A;  3U1O A;  1NKX A;  3TOD A;  4BDQ A;  2Y7P A;  2G29 A;  4MBP A;  4JVC A;  2F36 A;  4FOR A;  5AA4 A;  4PET A;  1MY3 A;  4ZZA A;  1CE2 A;  1IZ1 A;  1M5D A;  4PBQ A;  2FVZ A;  4WEP A;  3H6T A;  1IXG A;  1NI9 A;  2HHM A;  3C4M A;  3A09 A;  3DEL B;  1B9J A;  4OAN A;  4I1D A;  5M2V A;  4F19 A;  4OTE A;  3Q27 A;  3FIR A;  3SER A;  2E0S A;  3FZV A;  4AQ4 A;  3E9X A;  3SEY A;  5HM4 B;  1VDW A;  3SEV A;  3T9H B;  1MY0 A;  4PF8 A;  4NF8 A;  3V5A A;  5ITP A;  4NF5 B;  1LFI A;  4LZ5 A;  3T9U A;  4F2O A;  3NOH A;  2V4C A;  1AOV A;  3B7D A;  4PGP A;  3KOS A;  3S2V A;  4IO4 A;  4WXJ A;  3E13 X;  4YKI A;  1XHY A;  2DWJ A;  2F5X A;  4U4X A;  4PAI A;  1JVY A;  3UP9 A;  1B58 A;  3KC1 A;  1L5T A;  4LUB A;  3ZKK A;  3FGS A;  2DE4 A;  2UYE A;  4DXB A;  2RKM A;  1NNF A;  4G68 C;  5DT6 A;  4OVJ A;  3VVD A;  3LUZ A;  1PB9 A;  4G4P A;  4Z0I A;  5I2K A;  3VLV A;  3TTM A;  1NUW A;  4FE8 A;  4BDR A;  1UTB B;  3K6X A;  4C1U A;  1LAX A;  2B4L A;  3UN6 A;  4OFL A;  2I4B A;  4NAP A;  1EZP A;  1YCJ A;  3O2A A;  3H6W A;  1SI0 A;  2ONS A;  5CMK A;  4LP2 B;  4MNI A;  4HE2 A;  3OEN A;  1EYK A;  1A54 A;  1OLC A;  4OVT A;  2PT2 A;  2CEX A;  3VLU A;  1OVT A;  4NWC A;  3OMB A;  4YB5 A;  1H76 A;  3KN7 A;  4TLM B;  4G8N A;  2CZL A;  4LZ7 A;  4U1O A;  1URG A;  3Q25 A;  1MG1 A;  1YZ0 A;  4YKJ A;  3IL1 B;  1R1N A;  2X7P A;  3M8U A;  3MZ1 A;  3RLF E;  5AE4 A;  3ECR A;  1OLA A;  3BIG A;  4LZ8 A;  1Y3N A;  3I5O A;  4U4S A;  4G8M A;  3PD8 A;  4U2R A;  3A3U A;  3B6W A;  3CR9 A;  2WYK A;  3D4C A;  3IB1 A;  3IJX B;  2OK2 A;  2ZNS A;  3ILU B;  4I3Y A;  5I58 A;  4R6K A;  3ZKL A;  1GTK A;  1SBP A;  1CNQ A;  4YZZ A;  2F6P A;  1US4 A;  4P8B A;  4KYS A;  1MM7 A;  1B05 A;  5TP9 B;  1FBD A;  5H8Q A;  3B8B A;  4JVD A;  3TCG A;  4OZ9 A;  1PB8 A;  3C36 A;  1Y9U A;  2XX9 A;  3B6Q A;  2B65 A;  4GWU A;  4RPO A;  3OO8 A;  3PGF A;  4F18 A;  1NV5 A;  1LBB A;  3OO6 A;  4PC9 A;  1N84 A;  2V25 A;  3MZB A;  3H7M A;  3TEP A;  1SQY A;  2KLF A;  3O6I A;  5L9M A;  3BKI B;  4QFK A;  3ISP A;  3KN3 A;  1ANF A;  1FPE A;  4N81 A;  5IZZ A;  1IXH A;  4OQO A;  1B32 A;  2XXQ A;  3MC2 A;  1SYI A;  3V83 A;  1FBH A;  4K3F A;  2Q74 A;  5H8H A;  3R7X A;  1VE4 A;  1Y4T A;  4IGT A;  4MMP A;  1LCT A;  2AYS A;  1B4H A;  4MNC A;  2WYP A;  4Q30 B;  1B40 A;  4NF8 B;  4FIM A;  3USD A;  3RTW B;  3TQL A;  4HE0 A;  4KYE A;  2BJJ X;  4RNS A;  1LBW A;  1P1N A;  4PGN A;  4DDD A;  3ONM A;  5I2K B;  4NN3 A;  4OA4 A;  3C31 A;  4WKM A;  4JB7 A;  4ND9 A;  4IY6 A;  4OEV A;  3DLN A;  1M5E A;  2VHA A;  3C32 A;  1P1Q A;  3V89 B;  1PBP A;  2XXU A;  3MPL A;  3PPQ A;  1I6Q A;  1NV7 A;  1Y1Z A;  5CM6 A;  3GLB A;  4YB7 A;  1RDX A;  2RCA A;  3TFL A;  4QFL A;  1RDY A;  4O7M A;  4OWD A;  2QVR A;  1FBG A;  1R9Q A;  1XVY A;  1FJ9 A;  1A40 A;  2P1S A;  4RJZ A;  4OVQ A;  3M3L A;  2O1L A;  1NUX A;  1IEJ A;  1TXF A;  3FVG A;  3PPR A;  4BDL A;  1XOC A;  1OVB A;  4BLA A;  3A3C A;  4RPN A;  3CSB A;  2PX1 A;  3AXF A;  3GXA A;  3SES A;  4POW A;  3G3K A;  5F7V A;  5F1Q A;  1TWY A;  1YXI A;  3A29 A;  2GRV A;  3QYT A;  4ZEI A;  1F9B A;  1LAH E;  1OQG A;  3UK4 A;  1S7Y A;  2THI A;  3DM0 A;  3QXM A;  1FTA A;  4KQP A;  4RK2 A;  3MUQ A;  3Q26 A;  5H8N A;  2O6A A;  1NUY A;  3KC0 A;  2Q8M A;  4GFR A;  4MNP A;  2DXY A;  4GX4 A;  2OZZ A;  3EQ1 A;  2H5Y A;  5DEX A;  2F6G A;  5K2X A;  4EQ9 A;  4FEC A;  4NTL A;  1D3K A;  3TMG A;  4GWX A;  3EN3 A;  1A7L A;  4P47 A;  4GWS A;  3T22 A;  2B3B A;  1Q1K A;  4JWY A;  5H8N B;  5CMB A;  4TOZ A;  1I6A A;  3O97 A;  1JET A;  4N17 A;  2VPO A;  2XX7 A;  1EZ9 A;  4FED A;  4O3C A;  1MXV A;  4KHZ E;  2NUV A;  3PPP A;  3IO4 A;  4IO6 A;  1CB6 A;  1NH7 A;  1ZLQ A;  3R26 A;  4GWW A;  1INP A;  1US5 A;  3TKD A;  5FHO A;  1IUD A;  3PPN A;  1WVJ A;  3H6U A;  1JW1 A;  3U8Q A;  4I62 A;  4JDF A;  4JBZ A;  2DSF A;  1DSN A;  3BBR A;  3OEM A;  4F1Y A;  3K6V A;  3KSX A;  2A5S A;  4XTC Q;  1JEU A;  2G93 A;  3U72 A;  3M3K A;  4YKK A;  3VVE A;  2R71 A;  5IM2 A;  5EQA A;  3TTL A;  2PYY A;  2DXR A;  5ELV A;  1FPD A;  3TUS A;  1P1W A;  2V93 A;  5I57 B;  1KA1 A;  1VSO A;  2I49 A;  4I40 A;  2I3W A;  4IO2 A;  3TTR A;  2VPN A;  3OOA A;  5EQ9 A;  5IZ1 A;  1UTB A;  3B50 A;  2F8D A;  4ISU A;  3KEI A;  5ISU A;  1R9L A;  2OWS A;  1AIV A;  2I0C A;  1MXZ A;  3S9L C;  1B3H A;  3EHT A;  2QS1 A;  1MQI A;  1HSJ A;  3VXC A;  2AL5 A;  1B3L A;  3N6T A;  3E4R A;  4XKP A;  1IME A;  4U22 A;  2HZK A;  2KR0 A;  3FAT A;  2F7C A;  3HO7 A;  3T96 B;  2GHB A;  3RN8 A;  5JK4 A;  3PUY E;  1MXU A;  3PD9 A;  3HPI A;  2QVU A;  3IOU A;  4X48 A;  1TFD A;  4LVQ A;  1POT A;  4NX1 A;  1Y3Q A;  3OD7 A;  3O6H A;  1BP5 A;  3K1M A;  1QUK A;  1XS5 A;  4O7I A;  3E78 A;  3UA8 A;  1LB8 A;  3ZSF A;  2AL4 A;  1RDZ A;  2IA4 A;  4LAT A;  2OBG A;  2O1M A;  2XXI A;  4MIJ A;  5JEI A;  1B0H A;  2CEY A;  2DDK A;  4NF6 A;  3KGC A;  1ZTY A;  5CBS A;  4GLI A;  5FTI A;  4KYD A;  2OWT A;  4Q8R A;  3DP4 A;  4MLV A;  1SW2 A;  3VV5 A;  1DTG A;  2Y7R A;  3IOW A;  4NMY A;  2ZZX A;  2AIX A;  3O6G A;  4P3L A;  1Y4C A;  2Y5L A;  5DEX B;  1MDQ A;  2XXP A;  5DW8 A;  4G68 A;  1QUL A;  4PP0 A;  2F35 A;  4GWZ A;  3CHG A;  1LLS A;  3GYY A;  1B1H A;  5H8Q B;  3Q29 A;  4P11 A;  1OIB A;  2NWJ A;  4H45 A;  4ZS9 A;  1USY E;  1LGB C;  3CFZ A;  5JTY A;  1ZU0 A;  4MX6 A;  3WAE A;  3C9H A;  3GBA A;  3PPO A;  2HCA A;  1LB9 A;  3OSQ A;  4ELP A;  1ZKB A;  1QGX A;  4OMB A;  2I3V A;  4X9T A;  3FXR A;  5J1D A;  3KZG A;  4DXU A;  3I3V A;  4M1V A;  4YAH X;  2FBP A;  2RC8 A;  3IB0 A;  3CI8 A;  5A5X B;  4LN5 A;  3PTY A;  4DI3 D;  5ITO A;  4R2B A;  4R9G A;  1B46 A;  2X26 A;  3C35 A;  3GBB A;  3RT8 A;  4QFO A;  5IZ3 B;  1A8E A;  4ELO A;  3MST A;  1H44 A;  4MHF A;  2RCB A;  4ZEK A;  4XKR A;  3TDJ A;  1BKA A;  3FD3 A;  2F3D A;  3BFT A;  3RUM A;  4EUO A;  3MP6 A;  1R6Z A;  1MQJ A;  3T1B A;  1ZMG A;  1B4Z A;  3D1R A;  3G3J A;  1VR5 A;  3RT6 B;  3H03 A;  2LAO A;  4OHN A;  3U93 A;  3KOT A;  1ZJL A;  2DP8 A;  3G3H A;  5CMM A;  3FV1 A;  4ECF A;  3JV9 A;  1N76 A;  1T0K A;  4M4G A;  2JJK A;  2QPQ A;  1AH5 A;  2HXR A;  1FPB A;  4OVP A;  2HXW A;  1J1N A;  4MH5 A;  1PDA A;  2UVJ A;  5CBR A;  1FTO A;  3C34 A;  4HW8 A;  4YMA A;  3HHG A;  3FVK A;  1B5J A;  3VXB A;  3T9X B;  1UTH A;  4YU0 A;  4MCO A;  4KD5 A;  4H46 A;  1IMF A;  3MZ9 A;  4GX3 A;  2A5T A;  2DE3 A;  4DI4 B;  1FBC A;  3WAF A;  2CMO A;  2ESN A;  2FYI A;  1B7U A;  1B1X A;  1Z7N E;  1B2H A;  1DTZ A;  4JXI A;  1YPN A;  5I5P A;  1RKM A;  2Q89 A;  4N8Y A;  2ZZW A;  1Y1M A;  1FPF A;  4HCY A;  2F97 A;  2Q2A A;  1FPK A;  3K02 A;  4H67 A;  1VFD A;  3TCF A;  1D9Q A;  2GQ1 A;  1H3D A;  2YLN A;  3I6V A;  5AA2 D;  4H8I A;  1YAE A;  3H3G A;  2E1S A;  4TLL B;  2CZK A;  1GR2 A;  2V3T A;  2YJP A;  3N5L A;  3CFX A;  4R2F A;  2W7Y A;  2P0S A;  2I6E A;  1RYO A;  1A55 A;  4DIG A;  2OLB A;  5CRY A;  4GL0 A;  2H98 A;  4PFT A;  1JW5 A;  5IKB A;  3B6T A;  1FJ6 A;  1RYX A;  1FQE A;  4F3G A;  1II5 A;  1P99 A;  1FQA A;  2RC9 A;  4EXL A;  3FBP A;  4XIG Q;  2O69 A;  5TPA B;  2DOJ A;  4F3P A;  5B70 A;  3RQT A;  4G77 A;  3BFU A;  3KSJ A;  3ILT B;  4F39 A;  4PE5 B;  4EDP A;  4IO5 A;  1FRP A;  1MXX A;  3R6U A;  1H43 A;  5EQ7 A;  3K2D A;  4AB5 A;  2FNC A;  3CFL A;  1Y20 A;  4IGR A;  4AS5 A;  4ZEF A;  2WX9 A;  1KA0 A;  4QSE A;  1FTJ A;  2NXO A;  3K00 A;  3LR1 A;  1BLF A;  4HE1 A;  4G2Z A;  2QS3 A;  5I56 B;  5I2N B;  1FPJ A;  1TT1 A;  5EYH A;  2BJI A;  1EZO A;  4NE4 A;  3H4Z A;  2I48 A;  5A5L A;  4PDH A;  3K4U A;  4N07 A;  4EF2 A;  3DP6 A;  5ET8 A;  2P3V A;  2D21 A;  1POY 1;  3K01 A;  2Z8D A;  4BDM A;  2Z8F A;  4GD5 A;  1SVX B;  4FJP A;  1FCK A;  1IIT A;  5FBP A;  5FHM A;  3FVO A;  1B3F A;  5KCJ B;  2QFL A;  5T3J A;  4R6Y A;  1BIY A;  4XKN A;  1K9Y A;  5L8D A;  4I8C A;  3M3F A;  1HSE A;  1JW4 A;  1SDX A;  2PFY A;  4HS7 A;  4NGU A;  3OSR A;  4TQU Q;  4GBV A;  4F31 B;  1QKA A;  5EHM A;  3EHS A;  3BIH A;  2QSX A;  4HXV A;  1NL5 A;  2ALU A;  1NV4 A;  1IMC A;  3LC8 A;  4N6D A;  3MAM A;  1WDN A;  2XXH A;  3RY3 A;  2HAV A;  5I56 A;  2REG A;  3PUZ E;  4ZEB A;  3QSL A;  1LBV A;  4KI0 E;  2H25 A;  5I59 A;  4YKP A;  4GRK A;  1MH3 A;  3QMF A;  2XXY A;  2RIN A;  2Y5K A;  3FXQ A;  2XXV A;  4MFI A;  3EHU A;  4DCX A;  4P1E A;  1NNK A;  4DZ1 A;  2DE2 A;  4OYV A;  4GBW A;  2P3N A;  3FXU A;  4LQ2 A;  4OEU A;  2O51 A;  2DYX A;  4H65 A;  4NHB A;  3T66 A;  1N0T A;  1MDP 1;  4LON B;  3HHF A;  2CZI A;  4POX A;  1P1O A;  1FTL A;  2D5W A;  3T9V A;  3QUF A;  3UIF A;  4IO7 A;  3H6V A;  1SW5 A;  3F11 A;  2QJE A;  4GF8 A;  4G68 B;  5EYF A;  5AA3 A;  3THI A;  4XXU A;  4DLD A;  4I3E A;  5EYG A;  2M8C A;  5I58 B;  2OJT A;  4F2Q A;  2O7U A;  3G3F A;  4PFU A;  2PCR A;  3RNN A;  1YYZ A;  1JVX A;  4MEV A;  4O3B A;  2Y7W A;  4F3B A;  1O63 A;  4UAC A;  3E79 A;  5CMC A;  3O9P A;  2GFE A;  1FW0 A;  4GWY A;  3K6W A;  4P1L A;  4MF3 A;  2Z22 A;  1XT8 A;  4QXD A;  5AA1 A;  1DK4 A;  4PDD A;  3MBP A;  2DQV A;  2VD3 A;  2ZMB A;  2L5V A;  4G8H A;  1EYI A;  3SDF A;  3PUV E;  5CI5 A;  1SW1 A;  4H8J A;  3EF7 A;  3RPW A;  4LQ5 A;  1QVS A;  5IZ3 A;  2DWI A;  4QSD A;  3RGY A;  3PUX E;  1FQB A;  1I69 A;  4YMB A;  2R9J A;  4P56 A;  1LBC A;  4OXV A;  4R75 A;  3TTK A;  4RXL A;  1JEV A;  2XWK A;  4RA1 A;  3TTN A;  4FAT A;  4GX6 A;  1ELJ A;  3LSL A;  5KZT A;  1MPC A;  1O64 A;  5A5X A;  3K1P A;  4OER A;  2XWV A;  2HAU A;  5LOM A;  2V3U A;  4OEN A;  4GXA A;  3U94 A;  3VE1 B;  4H6D A;  1N7X A;  1SYH A;  3HFU A;  4YB6 A;  1FTM A;  1MY1 A;  4DE8 A;  1LBZ A;  3W15 C;  1UQW A;  4E0X A;  2DVZ A;  4OVS A;  2WEF A;  3JZJ A;  1TFA A;  3FJ7 A;  4U23 A;  4DCY A;  4X04 A;  2F78 A;  2B3F A;  3O29 A;  1WOD A;  4KR5 A;  5KDT B;  5I84 A;  5H8F B;  3PMV A;  1IXC A;  4OES A;  2XHD A;  1FQD A;  4NG7 A;  2REJ A;  4F22 A;  2VOZ A;  2UYF A;  3KBR A;  1DOT A;  1VFE A;  3OEL A;  4R74 A;  2F7A A;  3LSF B;  1DPE A;  3MWB A;  3UGW A;  1B0L A;  4ZZE A;  1MH4 A;  4QRZ A;  5DVJ A;  1D9Y A;  2QS2 A;  2Y7K A;  3FJG A;  3ODB A;  2F34 A;  4H0W A;  4FAJ A;  4O94 A;  2Q9T A;  3FJM A;  4N15 A;  1AMF A;  3LUY A;  5EHS A;  4N6P A;  1A99 A;  4UAB A;  3S9E A;  1LST A;  5AA4 B;  2Q8J A;  2MKZ A;  5DYH A;  2Z8E A;  3MVY A;  3MW0 A;  1NV0 A;  2WBB A;  1FBE A;  4MAG A;  1LBX A;  1ZIU A;  4NF5 A;  3SEX A;  5B7D A;  5HPQ A;  1OMP A;  2PVU A;  5ICQ A;  2UVH A; 
#chains in the Genus database with same CATH homology
 1M5C A;  1PEB A;  1GR2 A;  1XOC A;  2V3T A;  1OVB A;  2YJP A;  3CFX A;  3N5L A;  4R2F A;  4BDL A;  3A3C A;  2W7Y A;  1DMB A;  1PBQ A;  2PX1 A;  2XXW A;  2ZYM A;  3AXF A;  3CSB A;  3GXA A;  2P0S A;  3HCQ A;  3K6U A;  2O68 A;  2I6E A;  3SES A;  1RYO A;  1A55 A;  4DIG A;  4ELR A;  2OLB A;  3G3K A;  4POW A;  5F7V A;  5CRY A;  4GL0 A;  5H8H B;  2H98 A;  2V3Q A;  4PFT A;  3K0V A;  5F1Q A;  1TWY A;  3E3K A;  1JW5 A;  2I0B A;  3B6T A;  1B5I A;  4U21 A;  2HFB A;  5I59 B;  5IKB A;  1RYX A;  4H5G A;  3RY3 A;  3S4U A;  3PUW E;  1FQE A;  2GRV A;  4GWO A;  4F3G A;  2RF1 A;  3QYT A;  4ZEI A;  3T93 B;  1OQH A;  2ONR A;  3KFM A;  4R6H A;  1F9B A;  1II5 A;  3QK6 A;  1LAH E;  1OQG A;  1P99 A;  1FQA A;  1S7Y A;  2RC9 A;  1UTH B;  2THI A;  2XD3 A;  4GQO A;  3UK4 A;  4XKQ A;  3DM0 A;  1B6H A;  4F3S A;  4EXL A;  1MY4 A;  3N6U A;  4GL8 A;  4XIG Q;  2O69 A;  5TPA B;  3QXM A;  1QW0 A;  3QUJ A;  2DOJ A;  4KQP A;  3MVZ A;  2HZL A;  4F3P A;  5B70 A;  3RQT A;  3QAX A;  4RK2 A;  4R73 A;  2XXT A;  3MVW A;  3MUQ A;  4G77 A;  4GIZ A;  4IY5 A;  3IR1 A;  3BFU A;  3KSJ A;  1N7W A;  1A8F A;  2O6A A;  3Q26 A;  5H8N A;  3OXN A;  3ILT B;  5TPA A;  3ZS6 A;  4F39 A;  4PE5 B;  2H99 A;  2O7I A;  4EDP A;  1B7H A;  4GFR A;  1FQC A;  2DXY A;  2OZZ A;  1NFT A;  2H5Y A;  3EQ1 A;  3L6G A;  2HEU A;  5DTB A;  5DEX A;  4F1V A;  2F6G A;  5K2X A;  4ELQ A;  3CIJ A;  4IO5 A;  4EQ9 A;  1FTK A;  1D4N A;  4R9F A;  2ZYN A;  4FEC A;  4NTL A;  1LAG E;  1D3K A;  5H8S A;  4E0W A;  3TMG A;  2DS9 A;  1MXX A;  3R6U A;  2XX8 A;  3D4G A;  2ONK E;  1LFH A;  2FA7 A;  1H43 A;  3K2D A;  2Y84 A;  3EN3 A;  4PFY A;  2H9B A;  1GV8 A;  3SET A;  4AB5 A;  1A7L A;  2FNC A;  3CFL A;  1UIU A;  1Y20 A;  4NWD A;  2Z23 A;  4IGR A;  4P0I A;  3T22 A;  2B3B A;  1P1U A;  4GVO A;  1Q1K A;  3IO6 A;  4OET A;  5H8F A;  1URD A;  1FQF A;  4JWY A;  4QSC A;  3LBS A;  4Q5T A;  5CMB A;  4ZEF A;  4TOZ A;  5H8N B;  5I2N A;  1MS7 A;  1I6A A;  2RC7 A;  3O97 A;  1JET A;  4KCD A;  4QSE A;  4KPT A;  3HV1 A;  1PB7 A;  4ZE8 A;  1FTJ A;  2NXO A;  3K00 A;  3P7I A;  2XX7 A;  2VD2 A;  1ATG A;  1BLF A;  1EZ9 A;  3LR1 A;  4FED A;  4G2Z A;  1Z7M E;  2QS3 A;  2ZYK A;  4O3C A;  1MXV A;  4KHZ E;  5I2N B;  5I56 B;  1TT1 A;  2XXX A;  3PU5 A;  5BUU A;  3S9N C;  1EZO A;  4GXS B;  2I4C A;  1LAF E;  2NUV A;  2QMW A;  1I6B A;  3H4Z A;  1CB6 A;  3IO4 A;  1NH7 A;  3K1N A;  2I48 A;  2Q2C A;  3PMW A;  4IO6 A;  5DVF A;  3U1O A;  1NKX A;  2ABH A;  4RK9 A;  1ZLQ A;  3K4U A;  3R26 A;  4N07 A;  4EF2 A;  1US5 A;  3DP6 A;  3TKD A;  5FHO A;  1IUD A;  3PPN A;  1QKB A;  1WVJ A;  3H6U A;  4KCC A;  1JW1 A;  3TOD A;  4BDQ A;  2D21 A;  5DVI A;  3U8Q A;  2Y7P A;  2G29 A;  1POY 1;  4I62 A;  4JDF A;  4JBZ A;  4MBP A;  3K01 A;  2DSF A;  2NVU B;  3MP1 A;  1DSN A;  3BBR A;  3OEM A;  2Z8D A;  3PPP A;  2F36 A;  3U92 A;  4EQB A;  4BDM A;  4F1Y A;  3Q28 A;  2Z8F A;  3K6V A;  4FOR A;  4GD5 A;  4NF4 B;  5AA4 A;  1SVX B;  2A5S A;  3KSX A;  4FJP A;  4XTC Q;  1FCK A;  4PET A;  1MY3 A;  4ZZA A;  1IIT A;  1CE2 A;  1JEU A;  3FUZ A;  1IZ1 A;  1M5D A;  4H5F A;  5FHM A;  2G93 A;  3OO9 A;  3U72 A;  5KDT A;  4WEP A;  3FVO A;  3H6T A;  3M3K A;  1B3F A;  1IXG A;  4YKK A;  3VVE A;  5KCJ B;  2R71 A;  4DXC A;  3C4M A;  3TTL A;  2UVI A;  3A09 A;  1SI1 A;  1Q35 A;  2F7B A;  3DEL B;  1B9J A;  3IK6 B;  3IOV A;  5TP9 A;  2PYY A;  2DXR A;  4R6Y A;  1BIY A;  4I1D A;  5ELV A;  1P1W A;  3TUS A;  5M2V A;  2V93 A;  4XKN A;  5L8D A;  4IB2 A;  2QMX A;  4F19 A;  5I57 B;  2X7Q A;  4OTE A;  4I8C A;  4EF1 A;  3M3F A;  3Q27 A;  1VSO A;  1HSE A;  2I49 A;  3C33 A;  3FIR A;  4JWX A;  1JW4 A;  3SER A;  2E0S A;  2HQ0 A;  1SDX A;  3FZV A;  1UIV A;  4AQ4 A;  3E9X A;  4ESX A;  3SEY A;  4HS7 A;  5HM4 B;  3SEV A;  3T9H B;  3OSR A;  4TQU Q;  1MY0 A;  3V5A A;  4NF8 A;  4F31 B;  2I3W A;  4IO2 A;  1QKA A;  5ITP A;  5EHM A;  3KJT A;  3TTR A;  4NF5 B;  3OOA A;  2DVC A;  3EHS A;  1LFI A;  4LZ5 A;  1UTB A;  2F8D A;  3T9U A;  4F2O A;  4JSD A;  2QSX A;  4JWO A;  5L9S A;  4ISU A;  5BWJ A;  1NL5 A;  4LA9 A;  3QIM A;  2Y7I A;  2ZNT A;  3KEI A;  5ISU A;  1R9L A;  1AOV A;  2ALU A;  3B7D A;  3KOS A;  2OWS A;  1AIV A;  4P0G A;  4QHQ A;  5FTH A;  3S2V A;  2I0C A;  3LC8 A;  1MXZ A;  1SD3 A;  3MAM A;  1WDN A;  2XXH A;  4IO4 A;  4BLA A;  3RTF B;  1M5B A;  4WXJ A;  3E13 X;  4MLQ A;  1BTJ A;  1XHY A;  2DWJ A;  1B3H A;  3EHT A;  2F5X A;  4YKI A;  4U4X A;  2HAV A;  4THI A;  2REG A;  5I56 A;  3S9M C;  1PC3 A;  1JVY A;  3UP9 A;  3PUZ E;  3VFJ A;  2QS1 A;  4ZEB A;  1B58 A;  1L5T A;  3QSL A;  1MQI A;  4LUB A;  1HSJ A;  3ZKK A;  3VXC A;  2AL5 A;  1B5H A;  1B3L A;  3FGS A;  3N6T A;  4O3A A;  3E4R A;  5AA2 A;  4XKP A;  2DE4 A;  4KI0 E;  2H25 A;  4U22 A;  5I59 A;  2UYE A;  4DXB A;  4YKP A;  1KWH A;  4GRK A;  1NMU A;  2GH9 A;  2RKM A;  2HZK A;  1MH3 A;  3FAT A;  2XXY A;  1NNF A;  2WKY A;  4G68 C;  3G3G A;  2F7C A;  2RIN A;  5DT6 A;  3CRB A;  3FXQ A;  2XXV A;  4OVJ A;  3HO7 A;  4MFI A;  3T96 B;  3EHU A;  4DCX A;  2GHB A;  3VVD A;  1PB9 A;  1Y3P A;  3RN8 A;  5JK4 A;  3PUY E;  1NNK A;  4DZ1 A;  2DE2 A;  1JQF A;  1MXU A;  3PD9 A;  1URS A;  3HPI A;  4G4P A;  4OYV A;  3IOU A;  5CC2 A;  4IO3 A;  4Z0I A;  2PT1 A;  5I2K A;  4X48 A;  2A5T B;  1TFD A;  3FXU A;  4LQ2 A;  4LVQ A;  3VLV A;  3TTM A;  4OEU A;  5L9O A;  4FE8 A;  4BDR A;  1UTB B;  1POT A;  3O28 A;  1Y3Q A;  2O51 A;  3OD7 A;  2DYX A;  3O6H A;  1BP5 A;  3K1M A;  3K6X A;  4GOT A;  1LAX A;  4C1U A;  3LSX A;  4H65 A;  3UN6 A;  1QUK A;  1XS5 A;  4BDN A;  5K2Y A;  3TEL A;  3UA8 A;  1XVX A;  1LB8 A;  3T66 A;  1N0T A;  4OFL A;  3ZSF A;  2AL4 A;  4QFN A;  2I4B A;  1MDP 1;  2IA4 A;  4LAT A;  2OBG A;  4LON B;  2O1M A;  2DWH A;  2XXI A;  4QF9 A;  3CVG A;  3HHF A;  1EZP A;  1YCJ A;  1B0H A;  4POX A;  3O2A A;  5JEI A;  1JNF A;  1P1O A;  4NF6 A;  1FTL A;  2D5W A;  3H6W A;  3T9V A;  1SI0 A;  3QUF A;  2ONS A;  3KGC A;  1ZTY A;  4X1B A;  5CBS A;  2OCU A;  1IIW A;  4GLI A;  4LP2 B;  3UIF A;  2ZXT A;  5CMK A;  5FTI A;  3CG1 A;  4PQJ A;  1S50 A;  4KYD A;  3TQW A;  3IB2 A;  1MPD A;  4IO7 A;  3H6V A;  3OEN A;  1SW5 A;  3F11 A;  2QJE A;  2OWT A;  2PBW A;  3PMX A;  3UOR A;  4Q8R A;  1B3E A;  1A54 A;  1OLC A;  4X1D A;  3GZG A;  4GF8 A;  2PMS A;  1MXW A;  2PT2 A;  3MVX A;  4G68 B;  5EYF A;  3OEK A;  3VLU A;  4AB6 A;  1H45 A;  1OVT A;  5AA3 A;  3THI A;  3DP4 A;  4MLV A;  4NWC A;  1GVC A;  1SW2 A;  3OMB A;  4XXU A;  4YB5 A;  4DLD A;  3VV5 A;  1H76 A;  3KN7 A;  4TLM B;  1DTG A;  2Y7R A;  4G8N A;  5HBC A;  3IOW A;  2M8C A;  4NMY A;  5I58 B;  4Z7E A;  2CZL A;  2OJT A;  2O7U A;  2YPN A;  4NF6 B;  4F2Q A;  3G3F A;  2AIX A;  3O6G A;  1B7Z A;  4LZ7 A;  4PFU A;  1MQH A;  2I58 A;  4U1O A;  3RNN A;  2ZYO A;  1Y4C A;  1URG A;  3W9W A;  3Q25 A;  1MDQ A;  1MG1 A;  2XXP A;  5DEX B;  4YKJ A;  3TAJ A;  1EU8 A;  3IL1 B;  4G68 A;  1R1N A;  2X7P A;  1ZBM A;  5ICT A;  1QUL A;  1JVX A;  4O3B A;  2F35 A;  3M8U A;  4PP0 A;  3KG2 A;  5I57 A;  1LLS A;  3MZ1 A;  2Y7W A;  3RLF E;  4F3B A;  5AE4 A;  1B1H A;  1O63 A;  4UAC A;  5H8Q B;  4KFQ A;  3ECR A;  3FAS A;  5CMC A;  1YTV A;  3TYH A;  1OLA A;  4LZ8 A;  3Q29 A;  3O9P A;  5TU0 A;  1Y3N A;  2GFE A;  3I5O A;  1MQD A;  4U4S A;  4RY1 A;  4G8M A;  1FW0 A;  4P11 A;  1OIB A;  3K6W A;  2IEE A;  3PD8 A;  4U2R A;  1IQ7 A;  4C0R A;  3A3U A;  1HSL A;  3B6W A;  1N3X A;  3MQ9 A;  4MF3 A;  2NWJ A;  2Z22 A;  3CR9 A;  1XT8 A;  3G3I A;  4ZS9 A;  3D4C A;  1IXI A;  3IB1 A;  3IJX B;  1USY E;  2OK2 A;  1LFG A;  4YIC A;  5AA1 A;  3N94 A;  1LGB C;  2UXA A;  2ZNS A;  3CFZ A;  3ILU B;  3IOR A;  2DWA A;  5JTY A;  1ZU0 A;  3WAE A;  3C9H A;  5I58 A;  3GBA A;  4R6K A;  3PPO A;  2HCA A;  3ZKL A;  1GTK A;  1LB9 A;  1SBP A;  3OSQ A;  4ELP A;  1NNT A;  3MBP A;  1ZKB A;  2DQV A;  2VD3 A;  2XXR A;  2ZMB A;  4OMB A;  2I3V A;  3KJ7 A;  4G8H A;  4X9T A;  3SDF A;  1SW4 A;  2VP1 A;  4YZZ A;  5IAI A;  3MP8 A;  3SKP A;  3PUV E;  2F6P A;  5CI5 A;  3FXR A;  1US4 A;  1SW1 A;  5J1D A;  3KZG A;  4H8J A;  1MQG A;  3EF7 A;  3RPW A;  3I3V A;  4DXU A;  1M5F A;  4KYS A;  3FVN A;  4LQ5 A;  1MM7 A;  1QVS A;  1B05 A;  4M1V A;  4YAH X;  5JTY B;  5TP9 B;  2DWI A;  2RC8 A;  2ZNU A;  3DP8 A;  3IB0 A;  4QSD A;  5H8Q A;  3RGY A;  3CI8 A;  3HN0 A;  3HST A;  4ZDM A;  5A5X B;  3PUX E;  3SEW A;  3TCG A;  5ITO A;  4R2B A;  4R9G A;  1B46 A;  4OZ9 A;  3SEU A;  1FQB A;  1PB8 A;  3O66 A;  1I69 A;  3C36 A;  4YMB A;  1Y9U A;  2X26 A;  2XX9 A;  2R9J A;  3C35 A;  1NNP A;  3GBB A;  1N04 A;  3B6Q A;  2B65 A;  3FV2 A;  3RT8 A;  1LBC A;  1QUJ A;  4QFO A;  4RPO A;  5FHN A;  4OXV A;  4R75 A;  3OO8 A;  3PGF A;  4EXK A;  3PV0 E;  4F1U A;  4F18 A;  3TTK A;  2NOO A;  1A8E A;  4PFW A;  4RXL A;  4ELO A;  1LBB A;  4HCW A;  1JEV A;  4ZED A;  1H44 A;  4RA1 A;  2RCB A;  2O84 X;  4ZEK A;  3OO6 A;  3TTN A;  4FAT A;  1N84 A;  2V25 A;  1ELJ A;  3LSL A;  5KZT A;  1MPC A;  3MZB A;  4XKR A;  3H7M A;  3TDJ A;  1O64 A;  5A5X A;  1BKA A;  4I9D A;  3FD3 A;  3TEP A;  1SQY A;  2KLF A;  4N13 A;  4ZE9 A;  3K1P A;  3O6I A;  3BFT A;  3RUM A;  4OER A;  4EUO A;  1R6Z A;  2Q88 A;  3MP6 A;  1MQJ A;  1XC1 A;  2HAU A;  1ZMG A;  1B4Z A;  3BKI B;  4QFK A;  5L9M A;  5LOM A;  3G3J A;  1VR5 A;  2V3U A;  3RT6 B;  4OEN A;  3H03 A;  2LAO A;  3KN3 A;  4GXA A;  1ANF A;  4OHN A;  3U93 A;  2QS4 A;  3IJO B;  1ZJL A;  3KOT A;  4ONY A;  3TCH A;  1N3W A;  3U94 A;  3VE1 B;  4NED A;  2DP8 A;  3G3H A;  1N7X A;  1MPB A;  4H6D A;  3JYR A;  1SYH A;  2D3I A;  1IXH A;  5CMM A;  1QJM A;  3FV1 A;  3VLW A;  4ECF A;  3JV9 A;  4YB6 A;  4OQO A;  4RYA A;  1B32 A;  3LSW A;  1FTM A;  1MY1 A;  1N76 A;  2XXQ A;  4L17 A;  4DE8 A;  1T0K A;  4M4G A;  1O7T A;  3W15 C;  1UQW A;  2QPQ A;  4R72 A;  4E0X A;  4UA8 A;  2DVZ A;  4F29 A;  3JZJ A;  1B3G A;  3MC2 A;  1SYI A;  4WED A;  1TFA A;  4U1Z A;  3V83 A;  1AH5 A;  3FJ7 A;  4U23 A;  4DCY A;  4K3F A;  5KCJ A;  3IX1 A;  2HXW A;  2F78 A;  2UVG A;  1J1N A;  2B3F A;  5H8H A;  3O29 A;  4MH5 A;  1PDA A;  2UVJ A;  3R7X A;  5CBR A;  1FTO A;  1WOD A;  4KR5 A;  3C34 A;  1QUI A;  5KDT B;  4HW8 A;  4YMA A;  5I84 A;  3H06 B;  2ANJ A;  5H8F B;  3HHG A;  3FVK A;  1GGG A;  1VE4 A;  1B5J A;  1Y4T A;  4FEB A;  1LCT A;  4IGT A;  3PMV A;  2AYS A;  1IXC A;  3VXB A;  4OES A;  3T9X B;  2XHD A;  1FQD A;  4HTG A;  1B4H A;  3IOT A;  1UTH A;  2H4I A;  2REJ A;  1S9T A;  4RPN A;  4KD5 A;  2VOZ A;  4Q30 B;  4YU0 A;  1B40 A;  4OFJ A;  3W9V A;  4F22 A;  4NF8 B;  2UYF A;  3MZ9 A;  3KBR A;  1DOT A;  1VFE A;  3L6H A;  4FIM A;  3USD A;  1MM6 A;  2A5T A;  3OEL A;  3RTW B;  3TQL A;  2VGQ A;  4R74 A;  2DE3 A;  4KYE A;  2BJJ X;  2F7A A;  3LSF B;  1DPE A;  3MWB A;  4RNS A;  3UGW A;  2R6G E;  2V84 A;  1D9V A;  4NE4 A;  3WAF A;  3G7W A;  1DPP A;  1B0L A;  2CMO A;  3N26 A;  1P1N A;  4ZZE A;  1MH4 A;  3S9L C;  4QRZ A;  5DVJ A;  3KN8 A;  1D9Y A;  1B52 A;  4DDD A;  4C1T A;  2ESN A;  4H1X A;  3ONM A;  2FYI A;  2QS2 A;  1B7U A;  2Y7K A;  3FJG A;  3MJN A;  5I2K B;  1B1X A;  3ODB A;  2F34 A;  4H0W A;  1Z7N E;  4FAJ A;  1B2H A;  3C31 A;  4WKM A;  2Q9T A;  3FJM A;  3MPK A;  4JB7 A;  4ND9 A;  2QRY A;  1DTZ A;  4JXI A;  1AMF A;  4IY6 A;  4OEV A;  3VDF A;  1YPN A;  1RKM A;  3CSG A;  3DLN A;  1M5E A;  2Q89 A;  2VHA A;  3C32 A;  5AA2 B;  1P1Q A;  3LUY A;  1Y1M A;  3V89 B;  5EHS A;  4N6P A;  1PBP A;  1A99 A;  2GHA A;  2XD2 A;  2XXU A;  4HCY A;  1MXY A;  3MPL A;  1I6Q A;  3PPQ A;  1LST A;  4QFP A;  3S9E A;  2F97 A;  3VVF A;  1B51 A;  1MY2 A;  2Q2A A;  4NF4 A;  5AA4 B;  3K02 A;  4H67 A;  1Y1Z A;  5CM6 A;  2Q8J A;  3GLB A;  1NH8 A;  1VFD A;  4YB7 A;  3TCF A;  2RCA A;  3TPA A;  5DYH A;  3TFL A;  4QFL A;  3V8X B;  4OFO A;  4Q0C A;  4BDO A;  1EH3 A;  2Z8E A;  4OWD A;  1H3D A;  3MVY A;  1LCF A;  2YLN A;  1R9Q A;  3I6V A;  3MW0 A;  1XVY A;  1AL3 A;  2QL3 A;  3IAZ A;  1A40 A;  2P1S A;  4RJZ A;  3M3L A;  3CG3 A;  1ZIU A;  4NF5 A;  2O1L A;  4H8I A;  5AA2 D;  3EPE A;  3SEX A;  5B7D A;  1MRP A;  3TZA A;  1YAE A;  4EQ7 A;  4ZEC A;  5HPQ A;  4JSO A;  3H3G A;  1IEJ A;  1OMP A;  1TXF A;  2PVU A;  2E1S A;  3FVG A;  4TLL B;  5ICQ A;  1USY H;  2P2A A;  4ESW A;  3PPR A;  2UVH A;  3OO7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...