2Z2DA

Solution structure of human macrophage elastase (mmp-12) catalytic domain complexed with a gamma-keto butanoic acid inhibitor
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
158
structure length
158
Chain Sequence
GPVWRKHYITYRINNYTPDMNREDVDYAIRKAFQVWSNVTPLKFSKINTGMADILVVFARGAHGDFHAFDGKGGILAHAFGPGSGIGGDAHFDEDEFWTTHSGGTNLFLTAVHEIGHSLGLGHSSDPKAVMFPTYKYVDINTFRLSADDIRGIQSLYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Macrophage metalloelastase
publication title Solution structure of human macrophage elastase (MMP-12) catalytic domain complexed with a gamma-keto butanoic acid inhibitor
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 25
structure length 158
sequence length 158
ec nomenclature ec 3.4.24.65: Macrophage elastase.
pdb deposition date 2007-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 2z2dA00
1QUAA 2E3XA 2OVXA 2XS3A 1IACA 2USNA 1DTHA 2A8HA 4DPEA 1QICA 1GKCA 1GKDA 3LQBA 4JQGA 2EROA 1K7GA 2DDYA 1H71P 3B8ZA 4J4MA 1FLSA 1Y93A 2JT6A 1R55A 1DMTA 3TT4A 1AKLA 3N2VA 4WKIA 1QJJA 2OW0A 1B8YA 4XCTA 2MLSA 3HBVP 3LE9A 4H49A 3TSKA 3EHXA 1HY7A 3NX7A 4IUWA 1G12A 3BA0A 1GO7P 3EWJA 4GWNA 1FM1A 3ZUKA 3LUNA 1BIWA 1SMPA 2MLRA 1K7IA 2X3BA 1OM6A 4I35A 1OO9A 966CA 1B3DA 1CAQA 3F1AA 4H2EA 2X3AA 1I1IP 3TVCA 1O0QA 5I4OA 1Q3AA 1MMRA 4IJOA 3U1RA 1ZTQA 1KUKA 1IAAA 2W13A 4JA1A 2O3EA 1ZXVA 5L7FA 2AYKA 3HYGA 1JANA 1JIWP 1KUGA 1CK7A 4HX3A 1IAGA 3B92A 1K7QA 1GE5A 1PWUA 1RMZA 1UMTA 3LQ0A 2DW0A 1EAKA 1Z3JA 1I76A 2JT5A 3KWVC 3HBUP 4AUOA 4WZVA 2J83A 1J7NA 1UMSA 4PKVA 2OVZA 2W0DA 3HY9A 1JKYA 3EHYA 1JAPA 4H3XA 3ELMA 4H76A 4G0DA 3RTTA 1RM8A 2W15A 1XUDA 1PWPA 3USNA 4GUYA 1PWVA 4H82A 3TS4A 2X7MA 4FU4A 2YIGA 1USNA 3EDZA 3AYUA 2CLTA 1YQYA 5BPAA 1MNCA 3B2ZA 3Q2HA 5D3CA 4AIGA 1BM6A 1WNIA 2WOAA 1IADA 3G42A 2OZRA 1CIZA 1L6JA 3EDGA 1IAEA 5I0LA 1GXDA 1BSWA 1HFCA 2MZEA 1MMPA 1EB6A 4H1QA 1D5JA 1GE6A 4WF6A 2OW1A 3N2UA 4Q1LA 3RTSA 1YCMA 4DD8A 2Y6DA 3HB2P 4GR0A 4R3VA 4G9LA 1CXVA 2CKIA 2YB9A 2TCLA 2O36A 4PKQA 5I12A 3F16A 3AYKA 1JAOA 1R1HA 1XFUA 4PKRA 1XURA 1XFYA 2K9CA 1YOUA 3LMCA 1OS9A 3LJGA 3LJZA 1BZSA 3LJTA 4AYKA 3EDHA 3SHIA 5D1SA 4H84A 3ZVSA 3LILA 4ON1A 3I7GA 1KUIA 2OY2A 3KEKA 2RJPA 1XFXA 2N8RA 3LGPA 2Y6CA 5CXAA 4WK7A 1BKCA 4FVLA 2FV9A 1SU3A 3DPEA 4GWMA 1BKCI 4A3WA 1JK3A 2Z2DA 2K2GA 1G05A 4EFSA 2W14A 2WO8A 4HMAA 1HFSA 5D2BA 4JIJA 5H8XA 1GE7A 3F19A 2V4BA 5B5OA 1Y8JA 1KUHA 1I73A 2SRTA 1CGFA 3KHIA 2HU6A 1HV5A 1HOVA 5BOYA 3KMEA 3L0VA 3LUMA 5CZMA 3HDBA 2OW2A 3G5CA 3E8RA 4AXQA 2RJQA 2D1NA 2OY4A 4GR3A 1CGLA 3DSLA 1C8TA 1G49A 1G4KA 2OXWA 3LKAA 1R1JA 3EDIA 3F17A 3HY7A 1A86A 1BUDA 2OI0A 2OW9A 2MZHA 3KRYA 1OMJA 3DL1A 3AIGA 1GO8P 1MMBA 3DNGA 3LIRA 3VI1A 3K7LA 1PWWA 3HDAP 2X3CA 4JPAA 3DWBA 4PKUA 4H30A 4XM7A 1XFVA 3KMCA 1O0TA 4IN9A 2PJTA 4XM6A 5I43A 4WKEA 1G9KA 3L0TA 1OS2A 4CTHA 3K7NA 2W12A 2I47A 1JIZA 3P24A 3DPFA 1PWQA 3I7IA 5D1TA 3CKIA 4L6TA 1IABA 3V96B 2XS4A 1D7XA 4GF1A 2JIHA 1ZVXA 1BKCE 5B5PA 1AF0A 2OXZA 2DW2A 1XFZA 1BUVM 3WV2A 1CGEA 4PKWA 1S4BP 1YP1A 3KECA 4FXYP 1KAPP 1AYKA 5JMYA 1JH1A 3WV1A 4DF9A 2JSDA 3O64A 1JAQA 3P1VA 1ASTA 3WV3A 3Q2GA 2QPJA 1BQOA 3ZXHA 1QIAA 4A7BA 3OHOA 2DDFA 1JJ9A 5CUHA 4FXQA 1SATA 830CA 3LK8A 1SRPA 2KRJA 1D8MA 1OM7A 2J0TA 5L79A 1SLMA 2JNPA 1Y0VA 4ILWD 1OM8A 2AIGP 4ZR5A 1QJIA 4GQLA 3GBOA 3KEJA 1ZXCA 1C7KA 1SLNA 1ZP5A 2D1OA 4GR8A 2MZIA 1EUBA 3O2XA 1ATLA 1MMQA 1HTDA 1UTZA 1UTTA 2WO9A 3UVCA 2ERQA 2DW1A 1ZS0A 4XM8A 2OXUA 2L0RA 4JP4A 2E2DA 5D1UA 1C3IA 4QKZA 1CQRA 2POJA 3MA2A 4PKSA 1R1IA 1KUFA 4L63A 1QIBA 1R54A 1UEAA 1BQQM 3VTGA 5LABA 3LEAA 3LIKA 2ERPA 4DV8A 1FBLA 1XUCA 3OHLA 4PKTA 5I3MA 1ND1A 1A85A 1D8FA 5I2ZA 2FV5A 1ROSA 4XBHA 5D7WA 456CA 3F15A 5BOTA 4I03A 3F18A 4L19A 1KBCA 1XFWA
chains in the Genus database with same CATH superfamily
1QUAA 2E3XA 2OVXA 2XS3A 1IACA 2USNA 1DTHA 2A8HA 4DPEA 1QICA 1GKCA 1GKDA 3LQBA 4JQGA 2EROA 1K7GA 2DDYA 1H71P 3B8ZA 4J4MA 1FLSA 1Y93A 2JT6A 1R55A 1DMTA 3TT4A 1AKLA 3N2VA 4WKIA 1QJJA 2OW0A 1B8YA 4XCTA 1XAXA 2MLSA 3HBVP 1XM5A 3LE9A 4H49A 3TSKA 3EHXA 1HY7A 3NX7A 4IUWA 1G12A 3BA0A 1GO7P 3EWJA 4GWNA 1FM1A 3ZUKA 3LUNA 1BIWA 1SMPA 2MLRA 1K7IA 2X3BA 1OM6A 4I35A 1OO9A 966CA 1B3DA 1CAQA 3F1AA 4H2EA 2X3AA 1I1IP 3TVCA 1O0QA 5I4OA 1Q3AA 1MMRA 4IJOA 3U1RA 1ZTQA 1KUKA 1IAAA 2W13A 4JA1A 2O3EA 1ZXVA 3DTKA 5L7FA 2AYKA 3HYGA 1JANA 1JIWP 1KUGA 1CK7A 4HX3A 1IAGA 3B92A 1K7QA 1GE5A 1PWUA 1RMZA 1UMTA 3LQ0A 2DW0A 1EAKA 1Z3JA 1I76A 2JT5A 3KWVC 3HBUP 4AUOA 4WZVA 2J83A 1J7NA 1UMSA 4PKVA 2OVZA 2W0DA 3HY9A 1JKYA 3EHYA 1JAPA 4H3XA 3ELMA 4H76A 4G0DA 3RTTA 1RM8A 2W15A 1XUDA 1PWPA 3USNA 4GUYA 1PWVA 4H82A 3TS4A 2X7MA 4FU4A 2YIGA 1USNA 3EDZA 3AYUA 2CLTA 1YQYA 5BPAA 1MNCA 3B2ZA 3Q2HA 5D3CA 4AIGA 1BM6A 1WNIA 2WOAA 1IADA 3G42A 2OZRA 1CIZA 1L6JA 3EDGA 1IAEA 5I0LA 1GXDA 1BSWA 1HFCA 2MZEA 1MMPA 1EB6A 4H1QA 1D5JA 1GE6A 4WF6A 2OW1A 3N2UA 4Q1LA 3RTSA 1YCMA 4DD8A 2Y6DA 3HB2P 4GR0A 4R3VA 1OZ9A 4G9LA 1CXVA 2CKIA 2YB9A 2TCLA 2O36A 4PKQA 5I12A 3F16A 3AYKA 1JAOA 1R1HA 1XFUA 4PKRA 1XURA 1XFYA 2K9CA 1YOUA 3LMCA 1OS9A 3LJGA 3LJZA 1BZSA 3LJTA 4AYKA 3EDHA 3SHIA 5D1SA 4H84A 3ZVSA 3LILA 4ON1A 3I7GA 1KUIA 2OY2A 3KEKA 2RJPA 1XFXA 2N8RA 3LGPA 2Y6CA 5CXAA 4WK7A 1BKCA 4FVLA 2FV9A 1SU3A 3DPEA 4GWMA 1BKCI 4A3WA 1JK3A 2Z2DA 2K2GA 1G05A 4EFSA 2W14A 2WO8A 4HMAA 1HFSA 5D2BA 4JIJA 5H8XA 1GE7A 3F19A 2V4BA 5B5OA 1Y8JA 1KUHA 1I73A 2SRTA 1CGFA 3KHIA 2HU6A 1HV5A 1HOVA 5BOYA 3KMEA 3L0VA 3LUMA 5CZMA 3HDBA 2OW2A 3G5CA 3E8RA 4AXQA 2RJQA 2D1NA 2OY4A 4GR3A 1CGLA 3DSLA 3DTIA 1C8TA 1G49A 1G4KA 2OXWA 3LKAA 1R1JA 3EDIA 3F17A 3HY7A 1A86A 1BUDA 2OI0A 2OW9A 2MZHA 3KRYA 1OMJA 3DL1A 3AIGA 1GO8P 1MMBA 3DNGA 4L7AA 3LIRA 3VI1A 3K7LA 1PWWA 3HDAP 2X3CA 4JPAA 3DWBA 4PKUA 4H30A 4XM7A 1XFVA 3KMCA 1O0TA 4IN9A 2PJTA 4XM6A 5I43A 4WKEA 1G9KA 3L0TA 1OS2A 4CTHA 3K7NA 2W12A 2I47A 1JIZA 3P24A 3DPFA 1PWQA 3I7IA 5D1TA 3CKIA 4L6TA 1IABA 3V96B 2XS4A 1D7XA 4GF1A 2JIHA 1ZVXA 1BKCE 5B5PA 1AF0A 2OXZA 2DW2A 1XFZA 1BUVM 3WV2A 1CGEA 4PKWA 1S4BP 1YP1A 3KECA 4FXYP 1KAPP 1AYKA 5JMYA 1JH1A 3WV1A 4DF9A 2JSDA 3O64A 1JAQA 3P1VA 1ASTA 3WV3A 3Q2GA 2QPJA 1BQOA 3ZXHA 1QIAA 4A7BA 3OHOA 2DDFA 1JJ9A 5CUHA 4FXQA 1SATA 830CA 3LK8A 1SRPA 2KRJA 1D8MA 1OM7A 2J0TA 5L79A 1SLMA 2JNPA 1Y0VA 4ILWD 2YUFA 1OM8A 2AIGP 4ZR5A 1QJIA 4GQLA 3GBOA 3KEJA 1ZXCA 1C7KA 1SLNA 1ZP5A 2D1OA 4GR8A 2MZIA 1EUBA 3O2XA 1ATLA 3DTEA 1MMQA 1HTDA 1UTZA 1UTTA 2WO9A 3UVCA 2ERQA 2DW1A 1ZS0A 4XM8A 2OXUA 2L0RA 4JP4A 2E2DA 5D1UA 1C3IA 4QKZA 1CQRA 2POJA 3MA2A 4PKSA 1R1IA 1KUFA 4L63A 1QIBA 1R54A 1UEAA 1BQQM 3VTGA 5LABA 1TVIA 3LEAA 3LIKA 2ERPA 4DV8A 1FBLA 1XUCA 3OHLA 4PKTA 5I3MA 1ND1A 1A85A 1D8FA 5I2ZA 2FV5A 1ROSA 4XBHA 5D7WA 456CA 3F15A 5BOTA 4I03A 3F18A 4L19A 1KBCA 1XFWA
chains in the Genus database with same CATH topology
1QUAA 2E3XA 2OVXA 2XS3A 1IACA 2USNA 1DTHA 2A8HA 4DPEA 1QICA 1GKCA 1GKDA 3LQBA 4JQGA 2EROA 1K7GA 2DDYA 1H71P 3B8ZA 4J4MA 1FLSA 1Y93A 2JT6A 1R55A 1DMTA 3TT4A 1AKLA 3N2VA 4WKIA 1QJJA 2OW0A 1B8YA 4XCTA 2MLSA 3HBVP 3LE9A 4H49A 3TSKA 3EHXA 1HY7A 3NX7A 4IUWA 1G12A 3BA0A 1GO7P 3EWJA 4GWNA 1FM1A 3ZUKA 3LUNA 1BIWA 1SMPA 2MLRA 1K7IA 2X3BA 1OM6A 4I35A 1OO9A 966CA 1B3DA 1CAQA 3F1AA 4H2EA 2X3AA 1I1IP 3TVCA 1O0QA 5I4OA 1Q3AA 1MMRA 4IJOA 3U1RA 1ZTQA 1KUKA 1IAAA 2W13A 4JA1A 2O3EA 1ZXVA 3DTKA 5L7FA 2AYKA 3HYGA 1JANA 1JIWP 1KUGA 1CK7A 4HX3A 1IAGA 3B92A 1K7QA 1GE5A 1PWUA 1RMZA 1UMTA 3LQ0A 2DW0A 1EAKA 1Z3JA 1I76A 2JT5A 3KWVC 3HBUP 4AUOA 4WZVA 2J83A 1J7NA 1UMSA 4PKVA 2OVZA 2W0DA 3HY9A 1JKYA 3EHYA 1JAPA 4H3XA 3ELMA 4H76A 4G0DA 3RTTA 1RM8A 2W15A 1XUDA 1PWPA 3USNA 4GUYA 1PWVA 4H82A 3TS4A 2X7MA 4FU4A 2YIGA 1USNA 3EDZA 3AYUA 2CLTA 1YQYA 5BPAA 1MNCA 3B2ZA 3Q2HA 5D3CA 4AIGA 1BM6A 1WNIA 2WOAA 1IADA 3G42A 2OZRA 1CIZA 1L6JA 3EDGA 1IAEA 5I0LA 1GXDA 1BSWA 1HFCA 2MZEA 1MMPA 1EB6A 4H1QA 1D5JA 1GE6A 4WF6A 2OW1A 3N2UA 4Q1LA 3RTSA 1YCMA 4DD8A 2Y6DA 3HB2P 4GR0A 4R3VA 4G9LA 1CXVA 2CKIA 2YB9A 2TCLA 2O36A 4PKQA 5I12A 3F16A 3AYKA 1JAOA 1R1HA 1XFUA 4PKRA 1XURA 1XFYA 2K9CA 1YOUA 3LMCA 1OS9A 3LJGA 3LJZA 1BZSA 3LJTA 4AYKA 3EDHA 3SHIA 5D1SA 4H84A 3ZVSA 3LILA 4ON1A 3I7GA 1KUIA 2OY2A 3KEKA 2RJPA 1XFXA 2N8RA 3LGPA 2Y6CA 5CXAA 4WK7A 1BKCA 4FVLA 2FV9A 1SU3A 3DPEA 4GWMA 1BKCI 4A3WA 1JK3A 2Z2DA 2K2GA 1G05A 4EFSA 2W14A 2WO8A 4HMAA 1HFSA 5D2BA 4JIJA 5H8XA 1GE7A 3F19A 2V4BA 5B5OA 1Y8JA 1KUHA 1I73A 2SRTA 1CGFA 3KHIA 2HU6A 1HV5A 1HOVA 5BOYA 3KMEA 3L0VA 3LUMA 5CZMA 3HDBA 2OW2A 3G5CA 3E8RA 4AXQA 2RJQA 2D1NA 2OY4A 4GR3A 1CGLA 3DSLA 3DTIA 1C8TA 1G49A 1G4KA 2OXWA 3LKAA 1R1JA 3EDIA 3F17A 3HY7A 1A86A 1BUDA 2OI0A 2OW9A 2MZHA 3KRYA 1OMJA 3DL1A 3AIGA 1GO8P 1MMBA 3DNGA 4L7AA 3LIRA 3VI1A 3K7LA 1PWWA 3HDAP 2X3CA 4JPAA 3DWBA 4PKUA 4H30A 4XM7A 1XFVA 3KMCA 1O0TA 4IN9A 2PJTA 4XM6A 5I43A 4WKEA 1G9KA 3L0TA 1OS2A 4CTHA 3K7NA 2W12A 2I47A 1JIZA 3P24A 3DPFA 1PWQA 3I7IA 5D1TA 3CKIA 4L6TA 1IABA 3V96B 2XS4A 1D7XA 4GF1A 2JIHA 1ZVXA 1BKCE 5B5PA 1AF0A 2OXZA 2DW2A 1XFZA 1BUVM 3WV2A 1CGEA 4PKWA 1S4BP 1YP1A 3KECA 4FXYP 1KAPP 1AYKA 5JMYA 1JH1A 3WV1A 4DF9A 2JSDA 3O64A 1JAQA 3P1VA 1ASTA 3WV3A 3Q2GA 2QPJA 1BQOA 3ZXHA 1QIAA 4A7BA 3OHOA 2DDFA 1JJ9A 5CUHA 4FXQA 1SATA 830CA 3LK8A 1SRPA 2KRJA 1D8MA 1OM7A 2J0TA 5L79A 1SLMA 2JNPA 1Y0VA 4ILWD 2YUFA 1OM8A 2AIGP 4ZR5A 1QJIA 4GQLA 3GBOA 3KEJA 1ZXCA 1C7KA 1SLNA 1ZP5A 2D1OA 4GR8A 2MZIA 1EUBA 3O2XA 1ATLA 3DTEA 1MMQA 1HTDA 1UTZA 1UTTA 2WO9A 3UVCA 2ERQA 2DW1A 1ZS0A 4XM8A 2OXUA 2L0RA 4JP4A 2E2DA 5D1UA 1C3IA 4QKZA 1CQRA 2POJA 3MA2A 4PKSA 1R1IA 1KUFA 4L63A 1QIBA 1R54A 1UEAA 1BQQM 3VTGA 5LABA 3LEAA 3LIKA 2ERPA 4DV8A 1FBLA 1XUCA 3OHLA 4PKTA 5I3MA 1ND1A 1A85A 1D8FA 5I2ZA 2FV5A 1ROSA 4XBHA 5D7WA 456CA 3F15A 5BOTA 4I03A 3F18A 4L19A 1KBCA 1XFWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QUA A;  2E3X A;  2OVX A;  2XS3 A;  1IAC A;  2USN A;  1DTH A;  2A8H A;  4DPE A;  1QIC A;  1GKC A;  1GKD A;  3LQB A;  4JQG A;  2ERO A;  1K7G A;  2DDY A;  1H71 P;  3B8Z A;  4J4M A;  1FLS A;  1Y93 A;  2JT6 A;  1R55 A;  1DMT A;  3TT4 A;  1AKL A;  3N2V A;  4WKI A;  1QJJ A;  2OW0 A;  1B8Y A;  4XCT A;  2MLS A;  3HBV P;  3LE9 A;  4H49 A;  3TSK A;  3EHX A;  1HY7 A;  3NX7 A;  4IUW A;  1G12 A;  3BA0 A;  1GO7 P;  3EWJ A;  4GWN A;  1FM1 A;  3ZUK A;  3LUN A;  1BIW A;  1SMP A;  2MLR A;  1K7I A;  2X3B A;  1OM6 A;  4I35 A;  1OO9 A;  966C A;  1B3D A;  1CAQ A;  3F1A A;  4H2E A;  2X3A A;  1I1I P;  3TVC A;  1O0Q A;  5I4O A;  1Q3A A;  1MMR A;  4IJO A;  3U1R A;  1ZTQ A;  1KUK A;  1IAA A;  2W13 A;  4JA1 A;  2O3E A;  1ZXV A;  5L7F A;  2AYK A;  3HYG A;  1JAN A;  1JIW P;  1KUG A;  1CK7 A;  4HX3 A;  1IAG A;  3B92 A;  1K7Q A;  1GE5 A;  1PWU A;  1RMZ A;  1UMT A;  3LQ0 A;  2DW0 A;  1EAK A;  1Z3J A;  1I76 A;  2JT5 A;  3KWV C;  3HBU P;  4AUO A;  4WZV A;  2J83 A;  1J7N A;  1UMS A;  4PKV A;  2OVZ A;  2W0D A;  3HY9 A;  1JKY A;  3EHY A;  1JAP A;  4H3X A;  3ELM A;  4H76 A;  4G0D A;  3RTT A;  1RM8 A;  2W15 A;  1XUD A;  1PWP A;  3USN A;  4GUY A;  1PWV A;  4H82 A;  3TS4 A;  2X7M A;  4FU4 A;  2YIG A;  1USN A;  3EDZ A;  3AYU A;  2CLT A;  1YQY A;  5BPA A;  1MNC A;  3B2Z A;  3Q2H A;  5D3C A;  4AIG A;  1BM6 A;  1WNI A;  2WOA A;  1IAD A;  3G42 A;  2OZR A;  1CIZ A;  1L6J A;  3EDG A;  1IAE A;  5I0L A;  1GXD A;  1BSW A;  1HFC A;  2MZE A;  1MMP A;  1EB6 A;  4H1Q A;  1D5J A;  1GE6 A;  4WF6 A;  2OW1 A;  3N2U A;  4Q1L A;  3RTS A;  1YCM A;  4DD8 A;  2Y6D A;  3HB2 P;  4GR0 A;  4R3V A;  4G9L A;  1CXV A;  2CKI A;  2YB9 A;  2TCL A;  2O36 A;  4PKQ A;  5I12 A;  3F16 A;  3AYK A;  1JAO A;  1R1H A;  1XFU A;  4PKR A;  1XUR A;  1XFY A;  2K9C A;  1YOU A;  3LMC A;  1OS9 A;  3LJG A;  3LJZ A;  1BZS A;  3LJT A;  4AYK A;  3EDH A;  3SHI A;  5D1S A;  4H84 A;  3ZVS A;  3LIL A;  4ON1 A;  3I7G A;  1KUI A;  2OY2 A;  3KEK A;  2RJP A;  1XFX A;  2N8R A;  3LGP A;  2Y6C A;  5CXA A;  4WK7 A;  1BKC A;  4FVL A;  2FV9 A;  1SU3 A;  3DPE A;  4GWM A;  1BKC I;  4A3W A;  1JK3 A;  2Z2D A;  2K2G A;  1G05 A;  4EFS A;  2W14 A;  2WO8 A;  4HMA A;  1HFS A;  5D2B A;  4JIJ A;  5H8X A;  1GE7 A;  3F19 A;  2V4B A;  5B5O A;  1Y8J A;  1KUH A;  1I73 A;  2SRT A;  1CGF A;  3KHI A;  2HU6 A;  1HV5 A;  1HOV A;  5BOY A;  3KME A;  3L0V A;  3LUM A;  5CZM A;  3HDB A;  2OW2 A;  3G5C A;  3E8R A;  4AXQ A;  2RJQ A;  2D1N A;  2OY4 A;  4GR3 A;  1CGL A;  3DSL A;  1C8T A;  1G49 A;  1G4K A;  2OXW A;  3LKA A;  1R1J A;  3EDI A;  3F17 A;  3HY7 A;  1A86 A;  1BUD A;  2OI0 A;  2OW9 A;  2MZH A;  3KRY A;  1OMJ A;  3DL1 A;  3AIG A;  1GO8 P;  1MMB A;  3DNG A;  3LIR A;  3VI1 A;  3K7L A;  1PWW A;  3HDA P;  2X3C A;  4JPA A;  3DWB A;  4PKU A;  4H30 A;  4XM7 A;  1XFV A;  3KMC A;  1O0T A;  4IN9 A;  2PJT A;  4XM6 A;  5I43 A;  4WKE A;  1G9K A;  3L0T A;  1OS2 A;  4CTH A;  3K7N A;  2W12 A;  2I47 A;  1JIZ A;  3P24 A;  3DPF A;  1PWQ A;  3I7I A;  5D1T A;  3CKI A;  4L6T A;  1IAB A;  3V96 B;  2XS4 A;  1D7X A;  4GF1 A;  2JIH A;  1ZVX A;  1BKC E;  5B5P A;  1AF0 A;  2OXZ A;  2DW2 A;  1XFZ A;  1BUV M;  3WV2 A;  1CGE A;  4PKW A;  1S4B P;  1YP1 A;  3KEC A;  4FXY P;  1KAP P;  1AYK A;  5JMY A;  1JH1 A;  3WV1 A;  4DF9 A;  2JSD A;  3O64 A;  1JAQ A;  3P1V A;  1AST A;  3WV3 A;  3Q2G A;  2QPJ A;  1BQO A;  3ZXH A;  1QIA A;  4A7B A;  3OHO A;  2DDF A;  1JJ9 A;  5CUH A;  4FXQ A;  1SAT A;  830C A;  3LK8 A;  1SRP A;  2KRJ A;  1D8M A;  1OM7 A;  2J0T A;  5L79 A;  1SLM A;  2JNP A;  1Y0V A;  4ILW D;  1OM8 A;  2AIG P;  4ZR5 A;  1QJI A;  4GQL A;  3GBO A;  3KEJ A;  1ZXC A;  1C7K A;  1SLN A;  1ZP5 A;  2D1O A;  4GR8 A;  2MZI A;  1EUB A;  3O2X A;  1ATL A;  1MMQ A;  1HTD A;  1UTZ A;  1UTT A;  2WO9 A;  3UVC A;  2ERQ A;  2DW1 A;  1ZS0 A;  4XM8 A;  2OXU A;  2L0R A;  4JP4 A;  2E2D A;  5D1U A;  1C3I A;  4QKZ A;  1CQR A;  2POJ A;  3MA2 A;  4PKS A;  1R1I A;  1KUF A;  4L63 A;  1QIB A;  1R54 A;  1UEA A;  1BQQ M;  3VTG A;  5LAB A;  3LEA A;  3LIK A;  2ERP A;  4DV8 A;  1FBL A;  1XUC A;  3OHL A;  4PKT A;  5I3M A;  1ND1 A;  1A85 A;  1D8F A;  5I2Z A;  2FV5 A;  1ROS A;  4XBH A;  5D7W A;  456C A;  3F15 A;  5BOT A;  4I03 A;  3F18 A;  4L19 A;  1KBC A;  1XFW A; 
#chains in the Genus database with same CATH topology
 1QUA A;  2E3X A;  2OVX A;  2XS3 A;  1IAC A;  2USN A;  1DTH A;  2A8H A;  4DPE A;  1QIC A;  1GKC A;  1GKD A;  3LQB A;  4JQG A;  2ERO A;  1K7G A;  2DDY A;  1H71 P;  3B8Z A;  4J4M A;  1FLS A;  1Y93 A;  2JT6 A;  1R55 A;  1DMT A;  3TT4 A;  1AKL A;  3N2V A;  4WKI A;  1QJJ A;  2OW0 A;  1B8Y A;  4XCT A;  1XAX A;  2MLS A;  3HBV P;  1XM5 A;  3LE9 A;  4H49 A;  3TSK A;  3EHX A;  1HY7 A;  3NX7 A;  4IUW A;  1G12 A;  3BA0 A;  1GO7 P;  3EWJ A;  4GWN A;  1FM1 A;  3ZUK A;  3LUN A;  1BIW A;  1SMP A;  2MLR A;  1K7I A;  2X3B A;  1OM6 A;  4I35 A;  1OO9 A;  966C A;  1B3D A;  1CAQ A;  3F1A A;  4H2E A;  2X3A A;  1I1I P;  3TVC A;  1O0Q A;  5I4O A;  1Q3A A;  1MMR A;  4IJO A;  3U1R A;  1ZTQ A;  1KUK A;  1IAA A;  2W13 A;  4JA1 A;  2O3E A;  1ZXV A;  3DTK A;  5L7F A;  2AYK A;  3HYG A;  1JAN A;  1JIW P;  1KUG A;  1CK7 A;  4HX3 A;  1IAG A;  3B92 A;  1K7Q A;  1GE5 A;  1PWU A;  1RMZ A;  1UMT A;  3LQ0 A;  2DW0 A;  1EAK A;  1Z3J A;  1I76 A;  2JT5 A;  3KWV C;  3HBU P;  4AUO A;  4WZV A;  2J83 A;  1J7N A;  1UMS A;  4PKV A;  2OVZ A;  2W0D A;  3HY9 A;  1JKY A;  3EHY A;  1JAP A;  4H3X A;  3ELM A;  4H76 A;  4G0D A;  3RTT A;  1RM8 A;  2W15 A;  1XUD A;  1PWP A;  3USN A;  4GUY A;  1PWV A;  4H82 A;  3TS4 A;  2X7M A;  4FU4 A;  2YIG A;  1USN A;  3EDZ A;  3AYU A;  2CLT A;  1YQY A;  5BPA A;  1MNC A;  3B2Z A;  3Q2H A;  5D3C A;  4AIG A;  1BM6 A;  1WNI A;  2WOA A;  1IAD A;  3G42 A;  2OZR A;  1CIZ A;  1L6J A;  3EDG A;  1IAE A;  5I0L A;  1GXD A;  1BSW A;  1HFC A;  2MZE A;  1MMP A;  1EB6 A;  4H1Q A;  1D5J A;  1GE6 A;  4WF6 A;  2OW1 A;  3N2U A;  4Q1L A;  3RTS A;  1YCM A;  4DD8 A;  2Y6D A;  3HB2 P;  4GR0 A;  4R3V A;  1OZ9 A;  4G9L A;  1CXV A;  2CKI A;  2YB9 A;  2TCL A;  2O36 A;  4PKQ A;  5I12 A;  3F16 A;  3AYK A;  1JAO A;  1R1H A;  1XFU A;  4PKR A;  1XUR A;  1XFY A;  2K9C A;  1YOU A;  3LMC A;  1OS9 A;  3LJG A;  3LJZ A;  1BZS A;  3LJT A;  4AYK A;  3EDH A;  3SHI A;  5D1S A;  4H84 A;  3ZVS A;  3LIL A;  4ON1 A;  3I7G A;  1KUI A;  2OY2 A;  3KEK A;  2RJP A;  1XFX A;  2N8R A;  3LGP A;  2Y6C A;  5CXA A;  4WK7 A;  1BKC A;  4FVL A;  2FV9 A;  1SU3 A;  3DPE A;  4GWM A;  1BKC I;  4A3W A;  1JK3 A;  2Z2D A;  2K2G A;  1G05 A;  4EFS A;  2W14 A;  2WO8 A;  4HMA A;  1HFS A;  5D2B A;  4JIJ A;  5H8X A;  1GE7 A;  3F19 A;  2V4B A;  5B5O A;  1Y8J A;  1KUH A;  1I73 A;  2SRT A;  1CGF A;  3KHI A;  2HU6 A;  1HV5 A;  1HOV A;  5BOY A;  3KME A;  3L0V A;  3LUM A;  5CZM A;  3HDB A;  2OW2 A;  3G5C A;  3E8R A;  4AXQ A;  2RJQ A;  2D1N A;  2OY4 A;  4GR3 A;  1CGL A;  3DSL A;  3DTI A;  1C8T A;  1G49 A;  1G4K A;  2OXW A;  3LKA A;  1R1J A;  3EDI A;  3F17 A;  3HY7 A;  1A86 A;  1BUD A;  2OI0 A;  2OW9 A;  2MZH A;  3KRY A;  1OMJ A;  3DL1 A;  3AIG A;  1GO8 P;  1MMB A;  3DNG A;  4L7A A;  3LIR A;  3VI1 A;  3K7L A;  1PWW A;  3HDA P;  2X3C A;  4JPA A;  3DWB A;  4PKU A;  4H30 A;  4XM7 A;  1XFV A;  3KMC A;  1O0T A;  4IN9 A;  2PJT A;  4XM6 A;  5I43 A;  4WKE A;  1G9K A;  3L0T A;  1OS2 A;  4CTH A;  3K7N A;  2W12 A;  2I47 A;  1JIZ A;  3P24 A;  3DPF A;  1PWQ A;  3I7I A;  5D1T A;  3CKI A;  4L6T A;  1IAB A;  3V96 B;  2XS4 A;  1D7X A;  4GF1 A;  2JIH A;  1ZVX A;  1BKC E;  5B5P A;  1AF0 A;  2OXZ A;  2DW2 A;  1XFZ A;  1BUV M;  3WV2 A;  1CGE A;  4PKW A;  1S4B P;  1YP1 A;  3KEC A;  4FXY P;  1KAP P;  1AYK A;  5JMY A;  1JH1 A;  3WV1 A;  4DF9 A;  2JSD A;  3O64 A;  1JAQ A;  3P1V A;  1AST A;  3WV3 A;  3Q2G A;  2QPJ A;  1BQO A;  3ZXH A;  1QIA A;  4A7B A;  3OHO A;  2DDF A;  1JJ9 A;  5CUH A;  4FXQ A;  1SAT A;  830C A;  3LK8 A;  1SRP A;  2KRJ A;  1D8M A;  1OM7 A;  2J0T A;  5L79 A;  1SLM A;  2JNP A;  1Y0V A;  4ILW D;  2YUF A;  1OM8 A;  2AIG P;  4ZR5 A;  1QJI A;  4GQL A;  3GBO A;  3KEJ A;  1ZXC A;  1C7K A;  1SLN A;  1ZP5 A;  2D1O A;  4GR8 A;  2MZI A;  1EUB A;  3O2X A;  1ATL A;  3DTE A;  1MMQ A;  1HTD A;  1UTZ A;  1UTT A;  2WO9 A;  3UVC A;  2ERQ A;  2DW1 A;  1ZS0 A;  4XM8 A;  2OXU A;  2L0R A;  4JP4 A;  2E2D A;  5D1U A;  1C3I A;  4QKZ A;  1CQR A;  2POJ A;  3MA2 A;  4PKS A;  1R1I A;  1KUF A;  4L63 A;  1QIB A;  1R54 A;  1UEA A;  1BQQ M;  3VTG A;  5LAB A;  1TVI A;  3LEA A;  3LIK A;  2ERP A;  4DV8 A;  1FBL A;  1XUC A;  3OHL A;  4PKT A;  5I3M A;  1ND1 A;  1A85 A;  1D8F A;  5I2Z A;  2FV5 A;  1ROS A;  4XBH A;  5D7W A;  456C A;  3F15 A;  5BOT A;  4I03 A;  3F18 A;  4L19 A;  1KBC A;  1XFW A; 
#chains in the Genus database with same CATH homology
 1QUA A;  2E3X A;  2OVX A;  2XS3 A;  1IAC A;  2USN A;  1DTH A;  2A8H A;  4DPE A;  1QIC A;  1GKC A;  1GKD A;  3LQB A;  4JQG A;  2ERO A;  1K7G A;  2DDY A;  1H71 P;  3B8Z A;  4J4M A;  1FLS A;  1Y93 A;  2JT6 A;  1R55 A;  1DMT A;  3TT4 A;  1AKL A;  3N2V A;  4WKI A;  1QJJ A;  2OW0 A;  1B8Y A;  4XCT A;  2MLS A;  3HBV P;  3LE9 A;  4H49 A;  3TSK A;  3EHX A;  1HY7 A;  3NX7 A;  4IUW A;  1G12 A;  3BA0 A;  1GO7 P;  3EWJ A;  4GWN A;  1FM1 A;  3ZUK A;  3LUN A;  1BIW A;  1SMP A;  2MLR A;  1K7I A;  2X3B A;  1OM6 A;  4I35 A;  1OO9 A;  966C A;  1B3D A;  1CAQ A;  3F1A A;  4H2E A;  2X3A A;  1I1I P;  3TVC A;  1O0Q A;  5I4O A;  1Q3A A;  1MMR A;  4IJO A;  3U1R A;  1ZTQ A;  1KUK A;  1IAA A;  2W13 A;  4JA1 A;  2O3E A;  1ZXV A;  3DTK A;  5L7F A;  2AYK A;  3HYG A;  1JAN A;  1JIW P;  1KUG A;  1CK7 A;  4HX3 A;  1IAG A;  3B92 A;  1K7Q A;  1GE5 A;  1PWU A;  1RMZ A;  1UMT A;  3LQ0 A;  2DW0 A;  1EAK A;  1Z3J A;  1I76 A;  2JT5 A;  3KWV C;  3HBU P;  4AUO A;  4WZV A;  2J83 A;  1J7N A;  1UMS A;  4PKV A;  2OVZ A;  2W0D A;  3HY9 A;  1JKY A;  3EHY A;  1JAP A;  4H3X A;  3ELM A;  4H76 A;  4G0D A;  3RTT A;  1RM8 A;  2W15 A;  1XUD A;  1PWP A;  3USN A;  4GUY A;  1PWV A;  4H82 A;  3TS4 A;  2X7M A;  4FU4 A;  2YIG A;  1USN A;  3EDZ A;  3AYU A;  2CLT A;  1YQY A;  5BPA A;  1MNC A;  3B2Z A;  3Q2H A;  5D3C A;  4AIG A;  1BM6 A;  1WNI A;  2WOA A;  1IAD A;  3G42 A;  2OZR A;  1CIZ A;  1L6J A;  3EDG A;  1IAE A;  5I0L A;  1GXD A;  1BSW A;  1HFC A;  2MZE A;  1MMP A;  1EB6 A;  4H1Q A;  1D5J A;  1GE6 A;  4WF6 A;  2OW1 A;  3N2U A;  4Q1L A;  3RTS A;  1YCM A;  4DD8 A;  2Y6D A;  3HB2 P;  4GR0 A;  4R3V A;  4G9L A;  1CXV A;  2CKI A;  2YB9 A;  2TCL A;  2O36 A;  4PKQ A;  5I12 A;  3F16 A;  3AYK A;  1JAO A;  1R1H A;  1XFU A;  4PKR A;  1XUR A;  1XFY A;  2K9C A;  1YOU A;  3LMC A;  1OS9 A;  3LJG A;  3LJZ A;  1BZS A;  3LJT A;  4AYK A;  3EDH A;  3SHI A;  5D1S A;  4H84 A;  3ZVS A;  3LIL A;  4ON1 A;  3I7G A;  1KUI A;  2OY2 A;  3KEK A;  2RJP A;  1XFX A;  2N8R A;  3LGP A;  2Y6C A;  5CXA A;  4WK7 A;  1BKC A;  4FVL A;  2FV9 A;  1SU3 A;  3DPE A;  4GWM A;  1BKC I;  4A3W A;  1JK3 A;  2Z2D A;  2K2G A;  1G05 A;  4EFS A;  2W14 A;  2WO8 A;  4HMA A;  1HFS A;  5D2B A;  4JIJ A;  5H8X A;  1GE7 A;  3F19 A;  2V4B A;  5B5O A;  1Y8J A;  1KUH A;  1I73 A;  2SRT A;  1CGF A;  3KHI A;  2HU6 A;  1HV5 A;  1HOV A;  5BOY A;  3KME A;  3L0V A;  3LUM A;  5CZM A;  3HDB A;  2OW2 A;  3G5C A;  3E8R A;  4AXQ A;  2RJQ A;  2D1N A;  2OY4 A;  4GR3 A;  1CGL A;  3DSL A;  3DTI A;  1C8T A;  1G49 A;  1G4K A;  2OXW A;  3LKA A;  1R1J A;  3EDI A;  3F17 A;  3HY7 A;  1A86 A;  1BUD A;  2OI0 A;  2OW9 A;  2MZH A;  3KRY A;  1OMJ A;  3DL1 A;  3AIG A;  1GO8 P;  1MMB A;  3DNG A;  4L7A A;  3LIR A;  3VI1 A;  3K7L A;  1PWW A;  3HDA P;  2X3C A;  4JPA A;  3DWB A;  4PKU A;  4H30 A;  4XM7 A;  1XFV A;  3KMC A;  1O0T A;  4IN9 A;  2PJT A;  4XM6 A;  5I43 A;  4WKE A;  1G9K A;  3L0T A;  1OS2 A;  4CTH A;  3K7N A;  2W12 A;  2I47 A;  1JIZ A;  3P24 A;  3DPF A;  1PWQ A;  3I7I A;  5D1T A;  3CKI A;  4L6T A;  1IAB A;  3V96 B;  2XS4 A;  1D7X A;  4GF1 A;  2JIH A;  1ZVX A;  1BKC E;  5B5P A;  1AF0 A;  2OXZ A;  2DW2 A;  1XFZ A;  1BUV M;  3WV2 A;  1CGE A;  4PKW A;  1S4B P;  1YP1 A;  3KEC A;  4FXY P;  1KAP P;  1AYK A;  5JMY A;  1JH1 A;  3WV1 A;  4DF9 A;  2JSD A;  3O64 A;  1JAQ A;  3P1V A;  1AST A;  3WV3 A;  3Q2G A;  2QPJ A;  1BQO A;  3ZXH A;  1QIA A;  4A7B A;  3OHO A;  2DDF A;  1JJ9 A;  5CUH A;  4FXQ A;  1SAT A;  830C A;  3LK8 A;  1SRP A;  2KRJ A;  1D8M A;  1OM7 A;  2J0T A;  5L79 A;  1SLM A;  2JNP A;  1Y0V A;  4ILW D;  2YUF A;  1OM8 A;  2AIG P;  4ZR5 A;  1QJI A;  4GQL A;  3GBO A;  3KEJ A;  1ZXC A;  1C7K A;  1SLN A;  1ZP5 A;  2D1O A;  4GR8 A;  2MZI A;  1EUB A;  3O2X A;  1ATL A;  3DTE A;  1MMQ A;  1HTD A;  1UTZ A;  1UTT A;  2WO9 A;  3UVC A;  2ERQ A;  2DW1 A;  1ZS0 A;  4XM8 A;  2OXU A;  2L0R A;  4JP4 A;  2E2D A;  5D1U A;  1C3I A;  4QKZ A;  1CQR A;  2POJ A;  3MA2 A;  4PKS A;  1R1I A;  1KUF A;  4L63 A;  1QIB A;  1R54 A;  1UEA A;  1BQQ M;  3VTG A;  5LAB A;  3LEA A;  3LIK A;  2ERP A;  4DV8 A;  1FBL A;  1XUC A;  3OHL A;  4PKT A;  5I3M A;  1ND1 A;  1A85 A;  1D8F A;  5I2Z A;  2FV5 A;  1ROS A;  4XBH A;  5D7W A;  456C A;  3F15 A;  5BOT A;  4I03 A;  3F18 A;  4L19 A;  1KBC A;  1XFW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...