2Z2ZA

Crystal structure of unautoprocessed form of tk-subtilisin soaked by 10mm cacl2
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
395
structure length
389
Chain Sequence
NTIRVIVSVDKAKFNPHEVLGIGGHIVYQFKLIPAVVVDVPANAVGKLKKMPGVEKVEFDHQAVLLGKPSWQPAQTIPWGIERVKAPSVWSITDGSVSVIQVAVLDTGVDYDHPDLAANIAWCVSTLRGKVSTKLRDCADQNGHGTHVIGTIAALNNDIGVVGVAPGVQIYSVRVLDARGSGSYSDIAIGIEQAILGPDGVADKDGDGIIAGDPDDDAAEVISMSLGGPADDSYLYDMIIQAYNAGIVIVAASGNEGAPSPSYPAAYPEVIAVGAIDSNDNIASFSNRQPEVSAPGVDILSTYPDDSYETLMGTAMATPHVSGVVALIQAAYYQKYGKILPVGTFDDISKNTVRGILHITADDLGPTGWDADYGYGVVRAALAVQAALG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Four new crystal structures of Tk-subtilisin in unautoprocessed, autoprocessed and mature forms: insight into structural changes during maturation
pubmed doi rcsb
source organism Thermococcus kodakarensis
molecule tags Hydrolase
molecule keywords Tk-subtilisin precursor
total genus 133
structure length 389
sequence length 395
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 2007-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.80 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Peptidase S8 propeptide/proteinase inhibitor I9 2z2zA01
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 2z2zA02
1SUPA 3DVSX 1V5IA 1SBNE 1MPTA 3A3OB 3GCWP 1YU6A 4RYDA 3BGOS 1GTL1 1AV7A 3OSZA 3D43A 1THMA 3L1KA 1PEKE 3PRKE 1Y3BE 1SBCA 5ARBA 1S02A 5B1DA 3WQBA 2SBTA 3DYBA 3BPSP 3CO0P 2HPZA 2Z30B 1OT5A 2G4VA 5AVJA 2PQ2A 3WHIA 3CO0S 1A2QA 4K8RA 4OV6A 2W2NP 2ZRQA 4OMCA 3A3NB 1GA6A 1C9JA 2Z57B 1SBTA 4FONA 1SCNE 1SUEA 3DVRX 3DWEX 5FBZA 1HT3A 1PJ8A 1GTG1 2SICE 1BFKA 4ZARA 3BGOP 1Y48E 4I0WB 4DZTA 1R0RE 3DW3X 1SCDA 5CW1A 1Q5PA 5JMOA 4YN3A 4CG0A 1EA7A 3DVQX 2Z56B 3TECE 1SCAA 3GCXP 4JP8A 4DWWA 5JXHA 2WWTA 4NE9C 1TMGE 1SPBS 1WMDA 3DE5X 1KDZA 2DQKA 1EGQA 4OMDA 1Y3DE 2W2NA 2Z2YA 4BWGA 2PYZA 5JXGA 1UBNA 4MZDA 5FAXA 2WV7A 2PWBA 1YJBA 2Z2ZA 2ID4A 1C9NA 4YN3B 3QMPA 2W2PA 1DBIA 1YJCA 1T1EA 2W2PP 2QTWA 3LPDA 1TM1E 1P7WA 3LXUX 2XTJA 2W2OP 1IAVA 1Y33E 4LVNA 3A3PB 2WUWE 1SUCA 5B1EA 1SIOA 2IXTA 3HJRA 4NE7A 4NMXA 2V8BA 4GI3A 1SELA 1SCBA 2PMWB 2ZWPA 1OYVA 3ZXYA 3EDYA 1PTKA 3Q5GA 2GKOA 1AQNA 4C3UA 1NDQA 5FFNA 2SNIE 1T1IA 1SBHA 3T41A 1ITPA 3F49S 1P7VA 2X8JA 3GCXA 1KDYA 2W2MP 3P5BA 2IY9A 1TM4E 3P5BP 3F7OA 1BJRE 1WSDA 1AVTA 2PRKA 1OYOA 2PKCA 1Y3CE 1TECE 3F7MA 1AK9A 4K8RB 3AFGA 4NMXB 1TM5E 1NDUA 3I37X 2Z2XA 3DDZX 5JXJA 1SN7A 2DUJA 3CNQP 1TM3E 1WMEA 3VTAA 1SVNA 3I2YX 4CFZA 3GCWA 3DE1X 3H42A 4J94A 4Z2AA 3DE7X 1WMFA 2WUVA 1P8JA 5AQEA 4OV6B 3I30X 1KE2A 1TM7E 1Y9ZA 5AVKA 1WVMA 4H6XA 1SIUA 5I9SA 5JXIA 2PMWA 2ID8A 1ZVJA 1SH7A 1YJAA 4B5LA 1Y1KE 1SBIA 1BE6A 1Y4DE 1ST2A 1V5IB 3VHQA 1BFUA 2P4EA 1GA4A 1T1GA 3CNQS 1R64A 1ZVKA 3DE3X 2W2QA 4AKTA 3ZXXA 1TO1E 1GTJ1 1PFGA 3WIVA 3VV2B 3D9QX 1C9MA 1BE8A 2QTWB 2W2QP 3TI7A 4DJ5X 2Z30A 3VYVA 3LPCA 3H42B 4H6WA 1CNMA 2DP4E 5ARCA 2Z56A 3DE0X 4KG7A 4HVLA 2Z57A 1BH6A 3BX1A 4LVOA 2Z58A 1DUIA 3AJ8A 3VV2A 2ZWOA 4AKSA 4KB5A 1GCIA 3VV3A 2ST1A 3EIFA 3DE2X 3I34X 1AF4A 3QTLA 2Z2YB 4C3VA 1SUAA 2E1PA 4HX2A 4ZOQI 3QFHA 2W2OA 1JEAA 1Y3FE 3AJ9A 3A3NA 1SCJA 4KPGA 1AH2A 1SUBA 1SIBE 2X8JB 3SQOA 3PTLA 1VSBA 2Z58B 1KE1A 1Y4AE 3UNXA 1C3LA 5K7SA 3BPSA 5ARDA 1XF1A 1ST3A 2SECE 1S2NA 1LW6E 3TI9A 1TK2A 3A3PA 1SCJB 2XTJP 3DW1X 1GNVA 1CSEE 1IC6A 1Y34E 3GT4A 3LPAA 2XRMA 3DE4X 3VSBA 4M1ZA 1GNSA 2W2MA 4WOCA 3GT3A 3EE6A 1GT91 3DE6X 1V6CA 5SICE 1R6VA 4CFYA 3A3OA 3Q40A 4H6VA 5AMXA 1AU9A 1S01A 1NLUA 1SUDA 2PWAA 1SPBP 1TO2E 3WIUA 4WOBA 1GA1A 4NE9A 2HD4A 1KDVA 2B6NA 3SICE 2TECE 1MEEA 3SQOP
chains in the Genus database with same CATH superfamily
3OT1B 1RT1A 1UPAA 3FWPA 2G9VA 3JD3A 3L93A 4OLBA 2OQIA 3RVRA 1L7BA 3EGVA 1J5EF 3C6MA 4BAGA 1ESCA 1WLSA 2UXCF 3H83A 4OX6A 5BV0A 4ND5A 1CF2O 4YALA 1J39A 4FUTA 2AG6A 4ZKAA 4LNHA 2PUWA 4ED0A 1YR1A 4JBIA 2M3DA 1QAYA 4E46A 2J07A 4LSZA 1LPBB 3GEHA 1QVVA 1H73A 2A9JA 3KHKA 2JATA 4ALZA 1NNLA 5LKRA 2CJPA 3GFQA 4TKMA 2BGJA 2G08A 4BPBA 3K0EA 1X13A 2VF5X 1JV2B 4Y00A 2H29A 3AINA 5GAHI 1N7GA 1NYLA 1FRLA 1TIBA 4PGGA 1E4EA 1A97A 3V32A 4Y7DA 2DNYA 3L7DA 4M7RA 3O8CA 5CCXA 5E3RA 4BB6A 4FCVA 4JL6A 2J32A 5K6TA 2LA4A 1S0VA 3ESQA 3I5YA 2HXGA 1HWYA 1H0HA 4F4YA 3H17A 1EFRD 1KAQA 5DWDA 1XD2A 2XNQA 4F3TA 1I5RA 9RUBA 3RJMA 4DIDA 4WFJA 2FMIA 4LRSB 1FPQA 3A8TA 1ZVVA 1FJGB 1YS9A 2C5BA 1J27A 1G63A 1NJGA 4TSFA 1EUDB 5ELMA 1P7WA 3PUXA 4FT4A 1LDMA 2C8KA 4X9XA 3EAFA 2CPIA 3EXEA 4CLRB 3I05A 1SOWA 3WQSB 2FTKE 3C6XA 4JI0F 1TZ0A 3I04M 1HNIB 2FFJA 4RQAA 4AK9A 1OILA 2R25B 2ZJ0A 5E8JA 1IR2A 3H04A 1CY7A 1OC4A 3ZW8A 1FLVA 2KSQA 4C3UA 2E6KA 4JUZA 3OU2A 1EQ2A 3KTAB 4GDFA 1LXNA 2BVZA 4WFBQ 3SCJE 2QVLA 4C6TB 3CBQA 4G4IA 3UDEA 3T1HB 4D96A 4J9MA 1KZYC 4JIGA 3DMDA 4WCFB 4IFTA 1M8PA 3FNFA 2G28A 5J59A 3NGTA 4J1TC 1WE2A 1JEYA 1HTBA 2H16A 2QYCA 3T7EA 4BXOB 4AL6A 3FMBA 4K4WA 5D6NA 3RQIA 3N4WA 4YDQA 2DGDA 2XRYA 1Z7GA 5DYIA 1KMCA 2XMZA 1K9VF 1IQPA 1XR3A 3RYCA 3IX7A 2H52A 3VTAA 3IDFA 2I54A 4UOEA 2BE2B 2BFDA 1UJ5A 2Y0BB 3EASA 4IWNA 4JI2B 4RNOA 1WVMA 3BYPA 4DSFA 3JWJA 3RVDA 2Z9BA 3VPCA 2XHCA 1VR6A 2F62A 1A8SA 5E33A 3GH1A 3C97A 4LY6A 3U6BA 3I5MA 4KL8S 4BEJA 2TSYB 4N7BA 4O4RA 2V1XA 3CRRA 2BYCA 2E5LJ 1N5JA 1PR4A 4FWTA 1G3UA 1R8AA 1PFGA 2O6HA 5KYUA 2QTWB 1SVLA 4CM1A 2CNDA 3GN1A 3VA7A 3OL9A 4KLAA 2CV0A 4C0KA 1BMFA 3CJ0A 3OJ0A 1JXAA 5U1PA 4TL7A 2R5FA 1K8ZB 1SXJB 3SZ3A 3R5XA 2VR1A 4EYSA 4UNRA 1WP4A 1CFZA 2VKRA 1ABFA 4K86A 4QSMA 3SOZA 1W581 4HLUC 4E12A 1V37A 3F1LA 1OBOA 4RKUC 3IN5A 3WK7A 5CT4A 3PEYA 1WACA 3ON5A 3WO1A 3EW7A 3REOA 1IMOA 5G1OA 1EQAA 2O0JA 2N4CA 3SVZA 3ASYA 4N3BA 3IPRA 1D6MA 3IUJA 5KTRA 1Z38A 2YFHA 1IMJA 2DRDA 2C7VA 3SDEA 4DNFA 2AS0A 4DX7A 4HI0E 3W2VA 3GP5A 4QBFA 1SU7A 2KPOA 4GVLA 2QV6A 2H6EA 3QEMB 3TJ9A 7MDHA 2VZEA 3MEEB 3NKYA 1GNSA 2Y3IA 3URMA 2RH3A 1NJ8A 2Q9CA 3EEBA 3GFSA 4PLCA 4XJXA 3SBDA 4GZMA 4EY8A 4OYXA 2H2HA 1J2EA 2EFHB 4IZ6A 5IW8A 2YBVA 1B6TA 1QG6A 1ZZFA 1FD8A 2XXJA 4TOIA 2FUCA 1SCQA 3W3AA 3W9BA 3ZGNA 2GTPA 1N0UA 1R8HA 4JOSA 4NFHA 4RIHA 5BN5A 1R8CA 4LC9A 1DIRA 3GFPA 4BMNA 1S7CA 3MTAA 1LPNA 4DY6A 3TNYA 1V1JA 2IZOA 2WG0A 1WUHS 5C46F 1P4JA 1CR1A 4YEAA 1OPXA 1P4GA 4MVJP 5HILA 4KN6A 5DNCA 4UQGA 3IA2A 2O8CA 2H5IB 1REQB 4NCKA 5JDIA 10MHA 3DEIA 2EARA 4ECZA 3KCQA 4BLQA 2O2YA 1IOZA 4EPWA 2A8YA 4MK7A 4X3CA 2DO4A 4QUJA 4ILKA 3NYQA 3EA4A 4RM3A 4KSBA 3IEKA 1MN9A 2ZRNA 5G4DA 1B3BA 1LW2A 3T9ZA 4IJWA 3ZW9A 5TGTA 4G8CA 4BBPA 4CM3A 2ZUEA 4KX5A 1IRXA 1OY6A 1J8VA 1KFDA 1JP7A 3OHMA 1WF2A 3DHWC 2NTNA 4WBXC 4W63A 3RVNA 1N34F 2OPSB 1PEAA 1PFYA 2XHZA 3B9BA 2RHHA 2OO7A 1RYFA 5FLEX 1UEUA 4D0RA 4LQCA 5D01A 4RZHA 2DFVA 4GPD1 4BWGA 1VI2A 5EJ4A 5LB2A 2I2BA 2EIHA 3KLBA 4LE1A 1B8UA 3WISA 2J9DA 3H4IA 2QVXX 3IVAA 1MOQA 2JDJA 3TLZA 4IH4A 5JNRA 1DC4A 1Z25A 3R9WA 1UKZA 5JE8A 1NVAA 3LT4A 2N75A 1RCXB 3D8TA 4N47A 2D4AA 4UM8B 3HHLD 2ZBGA 4ND6A 2A35A 3DLPX 2UKDA 3I23A 2NLOA 2AHOB 3ICOA 1K0FA 5FTJA 4K4YA 1MV5A 2C57A 2VHYA 1JA1A 4ZREA 4TYYA 3PCOB 1F2TB 4QFBA 4EY4A 4KQ6A 3DFUA 1VQLS 3C98A 3UWPA 3ISNC 3GLVA 2SKDA 5ALMA 2W9XA 1QYWA 3B2EA 2MXYA 2NTJA 1XKXA 3PG5A 1BCSB 4FWBA 1FCAA 3HJTA 2H31A 5KMGB 4TKTA 3AVPA 3GR6A 1AVTA 1D2GA 4HDSB 3BGRB 2NO7A 3CCSS 3CUNA 5THWA 3L8HA 5C7OO 3WX4A 3NU1A 4YXFA 3M8ZA 4OCZA 4KPUA 1NBAA 5KYTA 2YWEA 3VSDA 3A9TA 4O3OA 4I6GA 3EYAA 1ECPA 1QK4A 3CMCO 2FA9A 5JYBA 2L9WA 1X7XB 4DZ6A 2QRZA 3KJHA 3SEQA 5L3ZA 3GCWA 1MRSA 1YRBA 3CR3C 1NRKA 4LDZA 2G5PA 2G1DA 3REGA 3OIFA 2M1ZA 4QJ4A 1U25A 4L5CA 4V38A 3KJNB 4OKNA 1HZJA 4E08A 2IDZA 1RTDA 4M9XA 1Z5PA 5HUQA 4ZVNA 3B2NA 4YLYA 1KMMA 1NXXA 4GVBB 5IAJA 1H3NA 1S97A 4D4IA 2PVCA 2WKRA 4B87A 3DDSA 5A02A 2OXIA 1ENYA 1H5QA 4REQA 4EZ9A 2C31A 3ILHA 1WV1A 3KJGA 3K20A 4ADSG 1JK9B 3PV8A 1GGMA 3F46A 4LBZA 4Y2XA 4KBYA 3N5FA 1NWCA 3WNDA 4OVKA 2UUBJ 4DJJA 1FWPA 5FLXU 2QSWA 5CA1A 1ZPVA 1LRLA 1TZ2A 4U2CA 4V0NA 3D0IE 4TTRA 4MO9A 4OFBA 5JY1A 3P9ZA 1EBBA 1Y6JA 3MGBA 1T0JB 1J1ZA 3ZLBA 3FYCA 4X54A 3C1OA 3OHAA 1RRGA 4EYOA 1R7RA 4WXYB 3QMQA 2BHNA 1JGTA 1X31C 16PKA 1U8EA 1QU3A 1BHO1 2FGJA 5KTMA 1YJWS 2Q6IA 2JGFA 3L7NA 1VFJA 3UZUA 3JZFA 4YRQA 4FFLA 2RI6A 4ZT2A 3NMRA 5IX8A 3UJHA 1N5DA 1FVFA 2CQPA 3P0IA 1ZONA 1BE4A 1K6EA 3GA5A 4W90B 2P5VA 2PZGA 1ETUA 4GUAA 3WDLA 3BJRA 3BIXA 1IK6A 2PX8A 2OV4A 2XCUA 3KCNA 4D92A 4LNUA 4KC5A 4KQJA 5EWJB 4HLBA 1JQ5A 2EJVA 3GT3A 4B8ZA 2HN9A 2ZI3A 1RTJB 2W6ID 3BYRA 4HAIA 3WFJA 3SHQA 2I4OA 2C2GA 1Q7BA 5KOWA 4EW2A 3V1TC 4F0JA 2BKPA 4IR1A 1SZPA 3SLRA 1PQUA 1FSFA 4FTWA 3QFRA 3KLIB 3IAS6 5ITZB 3H11B 2Q7OE 4MGIR 5C7LO 4K9DA 4WX2B 3AF4A 4GZ5A 3M6UA 3FTFA 3VPGA 2YNIB 3C16B 5IOLA 1PR2A 3TVDA 2YQ4A 4DG1B 4D4HA 4JOBA 3GP8A 5FD1A 2NSHA 1A9TA 1TMOA 5H4HA 4KGXA 1NVWQ 2HYDA 3LT1A 4WNAA 1VK8A 2JFPA 2JB9A 5ESRA 4N6GA 4OYHA 4MRRA 1S9FA 3VC7A 1IJBA 2I8AA 3CPHA 2OCXA 1U3TA 5JWOA 3WGJA 4R9SA 3F2IA 2MHNA 4USUA 3MWDA 3SV3A 1CUHA 3W4JA 1WKVA 2J7WA 1VTKA 1BX1A 4GMDA 2MCFA 3OI7A 3ORSA 4MA0A 4UHBA 4MQMA 1D04A 2QPAA 3HBAA 2PMDA 4YUWA 2GLTA 1SCDA 3KLPX 1KQKA 1PJLA 3IUNA 4CRWB 3NWGA 3G82C 3UQSA 4CLOB 4F8JA 2GGPA 2B61A 1T0HB 2K4MA 2H0AA 1IHDA 4TX1A 3TZYA 3TVYA 1MDBA 1DTTB 1NF8A 4UBLA 5JROA 5FWYA 5THXA 3LP0B 4Z3DA 1F4PA 1HG1A 4JC4A 1ZSVA 4QO7A 2VJAA 1XROA 2OMEA 3GFBA 1HBUA 3HV0A 3ZHXA 2BKXA 4L75A 3T7CA 3HVTB 3FZEA 2OGTA 4RW9A 1KLNA 5AVOA 2H4ZA 3IO5A 3ZJTA 3F1KA 1MB3A 2D2IA 2DIUA 4UHKA 1SVWA 1C8LA 1Z4PX 4OJHA 1ZMBA 2VZLA 2FVSA 1YDHA 2VHVA 3PA8A 4MMXB 1AKQA 4FHEA 3EF0A 2W22A 4CIWA 1V6HA 5FFNA 3AYZB 3ENAA 1QC5B 4MRMA 4RHXA 3UKOA 4OK5A 4I3GA 5DLPA 1IDOA 1ZM3A 1RI3A 4B3GA 4DRXA 2W8BB 5K20A 5LJ3Y 4DVGA 1YDMA 3C14A 2GAOA 1U8YA 4BRUA 3W5XA 1DQNA 3JZMA 3KHRA 1JHZA 2IPXA 3F9RA 4LCBA 2LTAA 1KKUA 1RWMA 1DCTA 3PGVA 5LM3A 2ZVIA 5B37A 1YRQA 5IJZA 4CN9A 4KYZA 1ZLYA 1V8FA 1FSGA 1QRDA 3QATA 1MRZA 3R7NA 4DJAA 4JEMA 4OOEA 5G0VA 2AD1A 4B8WA 2HC9A 4FNGA 1GZDA 3B89A 5DIZA 1E3MA 1M83A 4RD3A 4I81A 4MLDA 4IJUA 4PCVA 3K9NA 3U19A 3MOZA 1X4DA 5ALQA 3PVCA 5THQA 1TVRB 2IM1A 5CDFA 3IAAA 5EQTA 4FEEA 4E07A 5DQHA 4UARA 5IUNC 3QHPA 2YW9A 4M6WB 1XNJA 1M7GA 1JR3D 1TR0A 2J3LA 4LY3A 3AMVA 2Z8YM 2HF7A 4E5PA 2V97A 4YQYA 4Z4EA 4FFMA 2EG1A 3OAAD 2UZ1B 3RYFB 4MX8A 4QFMA 1Z15A 1KZ9A 3EARA 1D6JA 1G60A 2CY0A 3RW6A 1Y4SA 5DM0A 1Z2OX 3ELBA 1CB0A 3LNTA 3F90A 3A26A 2X40A 4UT4A 3E3OA 4WGFA 4QXPA 5CB4B 1SBYA 1MORA 2VJMB 4HFJA 3CSSA 3FBWA 2XAAA 3UD3P 1IKWA 3TARA 4PIMA 2QMWA 2XHEA 1U6IA 1RQ2A 2MSLA 1TZJA 4ZXFA 4PNZA 1D0VA 4IGFA 3GVHA 2GMWA 2DSTA 4DPLA 4X66F 2RU9A 1VHWA 2HB6A 3CJKB 1KS2A 2W9CB 3KHHA 4B33A 3AY0A 4M99A 3DGPA 4KWHA 3QKTA 5H70A 1RWVB 4MP8A 4GOOD 2LXNA 4XWOA 1SCUA 1Z26A 2MQPA 3K5MA 2OL4A 3K1AA 3L41A 3QO9A 1MO6A 4Y2AA 5BXYA 3OUUA 1QXSA 4W9NC 3TSYA 1RWKB 2NZUG 1H2WA 1W76A 1OTHA 4PZ0A 2WSLA 2NZ4A 4P4UA 1S3SA 4RKRA 2RARA 3EDQA 3JQAA 1H2ZA 3GQVA 4DV2F 4BMXA 5AHWA 3B52X 2W43A 3BFKA 4RHFA 2JFBA 3N5KA 3P4UB 3M5WA 2XT6A 1WCYA 1RWWB 5ITHA 4MJ7A 3ELHA 4JI4F 2PUFA 1BQMA 1HBMB 4YRAA 4IIHA 5EUMA 2AWNA 1Q1GA 2ZXEA 2P5SA 3Q6MA 4C88A 4KRXA 1T5BA 1BC5A 5HZKA 3IOYA 3O4HA 2LEPA 2V7TA 4BQNA 4OXXA 3OKFA 2V9PA 4DMRA 1XZDA 4LYFA 2FVYA 4I8IA 2K3KA 1SURA 3AY6A 3DWEX 1R5OA 1G20A 3UG6A 2Q3FA 1X7VA 4RE5A 1YR8A 3PFFA 5I45A 3COJA 1HKAA 5CURA 1ML3A 4Y18A 3ZK9A 1RWXB 2R8EA 1T7PA 3KXKA 2XF2A 3EIUA 1JR2A 3R9IA 3EULA 1DQPA 3UUWA 2VK1A 4B1FA 2KI2A 3SQDA 1FNMA 1FQKA 3W6ZA 2JJMA 1TL7C 4BN5A 4DJBA 2EIXA 4DLTA 5CGZA 3N2GA 2BGIA 4P08A 2XXAA 4TTIA 3C16C 4J1QA 4EG6A 3CEMA 5CT6A 1UUFA 5FYDA 1WS6A 1L7QA 1FU4A 2H63A 1HW8A 2R9LA 4EJMA 1R0AB 2ANBA 4RDXA 2UYHA 3OO0A 4Z9BA 4KSYA 4I4NA 4ALMA 4OGLA 1NXWA 2O7VA 4YRLA 3R40A 4BMOB 2JZOA 5JAHA 3AGQA 5I7OA 1IQUA 3R6DA 2CJXB 4KAFA 2BRLA 3GA7A 3L49A 2O5VA 3R3JA 4AT1A 3K30A 4UM7A 3BH6B 1NU8A 4NZOA 2IZ1A 5ECDA 3CWJA 2YX1A 5I7WA 1NVXQ 2JHEA 2X0FA 3KOYA 5GVQA 2HGZA 3T3GA 2QN6A 3Q6IA 2D59A 4V2UA 2MLYA 1KXJA 4OYWA 1QYCA 1XTRA 2G6TA 4TWRA 1YG0A 1PIWA 3AY3A 1VZ2A 1SXJA 3LPEA 3S1AA 1D9AA 2G5GX 3QG5A 3VTIA 2GRAA 4F60A 1Q86T 5CXTA 1G5FA 3U6KA 3AJ1A 3TLMA 1WF3A 2HJHA 3W9IA 2PKCA 2WRZA 1R00A 2WMYA 4BZZA 5U47A 4O5OA 3H9QA 5AOCA 3IEUA 1EVKA 3ZWYA 4R2KA 3OFND 4JJAA 2D3UA 1B0AA 1VLOA 2Y05A 4ND2A 2QYGA 5J2MB 1V2HE 1O0SA 3B9PA 3G85A 1MZVA 4ZV7A 4GP9A 3GRVA 2VDLB 2C2ZB 2OWDA 3BZBA 3SCIE 3FPEA 3VAGA 2X86A 3CEJA 1I8TA 2NO0A 3FLBA 4CMJA 5C5IA 1WG5A 1CBKA 1EG7A 2CLOB 4YCDA 3GK3A 1PSDA 3LGHA 3PUZA 4Q48A 2FK8A 1HKHA 5CK4A 4DU8A 9ATCB 4CG3A 2CL0X 4GRIA 3M9LA 2JGMA 3WTCA 1NW5A 3PNBA 5DTEA 2FN9A 2C3OA 3NGKA 1DTTA 3AVTA 4S35A 4FXVA 4IH6A 5EFOA 3JQFC 5EVCA 1C4AA 2WB2A 1Z2EA 4E4RA 4DPOA 2LQ9A 3ZTOA 2OMOA 4CL8A 1XCLA 3HZEA 4TYBA 5D0RA 4XA8A 4BUJA 2R79A 1J5PA 2J76E 3PR4A 3FVYA 2ECQA 2JK1A 2JRSA 3DUWA 3ZDYB 3N3BC 3C8HA 3THYB 1KU0A 4QQRA 3HDJA 3LKBA 5CNKA 5FCDA 4F4CA 4RTSA 4C0SA 1XJWA 3VDMA 5IC6A 2R8PA 1ZAYA 4A5OA 1LX7A 2ZG6A 1VJ1A 4CKXA 3W6PA 1WD5A 5BR8F 1V39A 1XSEA 1NW9B 4UE3S 3TOVA 4DHWA 5KOHB 4CQMD 3GQBB 2RS8A 1YVEI 1UVIA 3PLNA 5F9NA 3W8PA 2QDKA 5J2NA 5U9CA 5D15A 1UP1A 5DYWA 5CLHA 3C6ZA 1ULRA 3K2EA 2AK2A 2ZREA 2MQOA 3TNJA 2WYWA 2H48B 3SS7X 3M9MB 1RADB 4QC2A 1EAMA 4G2TA 5E7JA 2IY5B 5LIPA 3NQ41 5I9TA 5GIPE 1Z75A 5DX8A 2QRUA 1O89A 4OIMA 1DFIA 1EFRA 2FQWA 4ECEA 3B5EA 2Q7DA 3CE9A 4B4UA 4FLFA 2WV9A 2NXCA 3NZEA 3H2UB 4FIZA 5A0TA 4BUZA 2WWYA 3NDIA 4U5QA 1DTWB 4RIGA 4FUQA 4FX5A 4D02A 1UW9A 1NPRA 3Q10A 1S3GA 4NL4H 2FFAA 1MAAA 5BR1A 2HBZB 3TLAA 5K0NA 1E6VB 2L17A 5DP2A 2CQ0A 4AF7A 1N34B 4FFNA 4XFKA 2W7OA 1JG6A 4W9MC 1NB7A 5TPZA 2NQ2C 2HCFA 1C1XA 1T8EA 4DQIA 4DSKA 1HEIA 4JITA 4K6GA 3PO4A 3BPSP 1JJFA 2G1JA 3ORRA 1FJ2A 3WZMA 1LS6A 3D6JA 3M2RA 1SUFA 4XQGA 2DKOA 2PS3A 1HT3A 3CC8A 4PAOA 5C53B 1GIAA 2C22A 5KMGA 1JFTA 5A4KA 4GT1A 3VR6A 3BGOP 1JI3A 4PC3A 3FEYB 3I4LA 1EFHA 4EM6A 4NXMF 4H27A 4M5DA 5G02A 2DKOB 1CR4A 2ZZMA 3JRWA 5E5NA 3D8UA 2VQDA 5C80A 2GYWA 3TZXA 4YT2A 1ZJJA 2D2XA 3S70A 4H60A 4GMGA 1R27B 3J7AN 4FS8A 4JU9A 2ZIAA 2X6TA 3V4LA 3ZV6A 1BUXA 5EP3A 4L08A 1CDEA 4Z0NA 1Y1PA 2ETVA 2DKNA 3ZBQA 1ULHA 3QMPA 3OBBA 3EVAA 5CT8A 5CXXA 4MV8A 1QGZA 4BNTA 3SJBA 2DYKA 1FDNA 3R9LA 2XSZA 1KKMA 2QQ5A 5DK4A 4CMEA 2C88A 1OMSA 2IKSA 1YMVA 4A2CA 4JJ4A 3X1MA 1BQ4A 2H5EA 4N8DA 3ZH9B 3RUHA 1Q5YA 2OCYC 3TANA 1H9AA 1OFTA 3A32A 2HBZA 4RZIA 3QWHA 1D8YA 1TVKA 2HMWA 4RTQA 4GKBA 4KNVA 2YNMC 1U2FA 1X7WB 1EFVA 1WDMA 4M1KA 2JJYA 4BTLA 1URPA 3I6PA 3UB2A 3OOHA 1KH2A 3WIBA 1TC2A 3L4EA 3FK4A 1NKSA 5DHTA 1OH7A 4DV5B 3AV0B 4XM2A 3PNKA 1VCTA 2ZAGA 5FP0A 1ODCA 4XVQA 4BKQA 1JSXA 4FD2A 4EO6A 1JIUA 3NHUA 3DCJA 2FEAA 1Y6ZA 2ZK7A 5DB4A 4QJIA 2NIPA 1P9WA 1LEHA 1TM3E 2I7XA 2JCSA 4CFZA 4Q4AA 2AXEA 4Q19A 5DKFA 4TXSA 2Y0PA 4OV6B 5RUBA 1NPKA 3UCFA 4F4UA 3QLUC 2QF7A 2CPZA 1IBSA 3U1VA 4GMFA 3H98A 4DIMA 4C4SA 4Y30A 2H3HA 2Q1SA 2GCIA 4LXYA 4HNVA 2ZFUA 3A0UA 5JV5A 4HDGA 2A57A 1YJXA 3DOFA 4FYDA 1GAQA 4BWMA 5REQB 2QIFA 3WIVA 4GXTA 4A8JB 4UAJA 3OP4A 2O8FA 3GARA 3H2LA 5IC6B 3I62A 4MXDA 5FHQA 4MR9A 2VFAA 1NMZA 4O2AA 4E5DA 5DE3A 3C1AA 4CM9D 5ADUS 5CVCA 5IFKA 1W35A 4TWJA 4DN9A 2WOOA 3OF3A 2EF0A 3D4NA 2O4UX 4GI7A 2X7JA 1AF4A 1P0MA 3OJUA 4K40A 3PNYA 5C2JB 5KTTA 1E6EA 1E2MA 2EKPA 1Q2XA 1T9XA 3EPPA 1G6BA 5IVIA 2JEYA 5TQ2B 4RHCA 3LY9A 1Y1RA 4KN9S 1Y7HA 1I2DA 2B25A 4TRNA 2W6IA 3BL5A 2QL5B 2B1IA 1D4OA 1YU9A 2AJQA 4XASA 5CCEA 2J0VA 1TQDA 3ZVLA 5JTTA 4F0HA 1SXLA 4DR6F 4E6PA 1FP7A 2WD9A 5BUSA 2ZAIA 2LD4A 1GMWA 1REGX 4PLHA 5KFHA 3KG2A 2C99A 3LUFA 4NOHA 2BGRA 1WEZA 3AI2A 2G0JA 3C4QA 1B23P 2PTGA 4P7KA 4CFYA 4RZ3A 1CJUA 5AVWA 5A2QU 4QDTA 4UMEA 1YJQA 3GFOA 2ODQA 1ZD4A 2D8AA 3VO1A 1V11B 9LDTA 2A1UA 1ENOA 1S1VA 2CDRA 3NG1A 4IQ0A 3HVRA 3SQGB 2KXHA 2HHQA 4LQLA 3ZOZA 3IC1A 2G1PA 4OXRA 5B0CA 5TPZD 2UXBB 4KW7A 4ZCQA 3BIWA 4U2FA 3CWQA 4TYWA 2CXXA 2DR9A 2RILA 5CU7A 5C5DA 4B2LA 3JTOA 4QGGA 1GUAA 2QUJA 3FOAA 2BLLA 3SYZA 1M6VA 4D3DA 2WTAA 2SBTA 3IBTA 2FPPB 1Y63A 2P79A 1TE2A 3GY0A 4QYRA 3RVLA 5HJEA 4X7PA 1MMDA 1FNCA 3CWCA 5HATA 3DVLA 3LDGA 1RAHB 3SIXA 4M5GA 1ZRMA 3OFGA 3OTBA 4DUGA 3M33A 1PJ8A 1XVLA 2X4GA 4QREA 1JG1A 5FTLA 1CJKA 4F4IA 2HY7A 4X44A 5F7OA 5FOXA 1C0EA 2QZZA 1C9DB 3LCJA 3EMTA 3JQEA 1VYTA 2QL9A 2JGDA 5GONB 4QIVA 4PTYA 2J46A 3ELYA 1MU0A 2ORVA 3DZHA 5JW6A 5KYUB 5LPNA 1KRHA 4BC7A 3FKSD 4EEZA 4OHZA 3IT1A 4MIEA 3A3KA 4KN5A 4X1YA 1MTZA 3OEHA 3Q9NA 4LZLA 3OLBA 1JLCA 4MV4A 5KG6A 4FS3A 3KJEA 2QTWA 3NWJA 1P3JA 4OK6A 2WT9A 5EJ8A 1DMSA 3BKTA 4O59O 4UCWA 3RIGA 3NBQA 3NL0A 3IQGX 4GMHA 3U81A 3UQYS 4ENTA 2Z3WA 1UEXC 2A5JA 2QW1A 1OZHA 1J70A 4ARIA 5FJIA 3NCPA 3RRJA 1XTJA 3T7IA 4PC1A 4ECAA 4IQFA 2KVQE 4C7OA 2OUKA 4TROA 2HRRA 4X5OA 1L8OA 3AFHA 4CTAA 5FL3A 4LYEA 3STHA 1FESA 2UVPB 1RABB 2AC4A 1G41A 2MYTA 4D4MA 3PENA 3DPIA 5DNVA 1X77A 3QLEA 5JVDB 1IJKA 4DUZF 1O94A 4NCBA 2G76A 4RPLA 4LJ4A 2NSJA 1J7KA 3JWEA 1CDOA 1Q77A 3U80A 1VC6A 2QX0A 1H93A 1CJSA 3T9BA 3O2SB 4OJQA 1CG2A 5KJFA 3FWNA 4RPJA 4C1BA 4Z4GA 5DHSA 3I0SA 4Z2AA 3OFNA 1O5TA 5MF6A 1GAEO 1P75A 1N5QA 4MS1A 4UUNA 3C7TA 3M9OB 5D3GB 2YIVX 1SIWB 4KVFA 2Q62A 5IASA 2LCIA 5ECWA 3LJKA 1ZOLA 1SC3A 2BHLA 1IBMB 4DSTA 4IPTA 1ZAKA 4I36A 3UVJA 4OB8A 4NLUA 1TCAA 3E23A 2PPVA 1M34B 4BMYA 3M5PA 3ZHTA 5IEBA 5B58T 2PH1A 3WB9A 3ZXXA 4ZJYA 2SCUA 4GEGA 3I9V9 1K2VN 3NV9A 3H1PA 4DNXA 4OHKA 3GP3A 2B82A 1EXDA 3LPCA 5C18A 1QVAA 1GXTA 4D3FA 2F9DA 3KFWX 1J0CA 2PBZA 4YJGA 4ZEVA 1DJQA 3KJQB 2RGUA 3LQYA 4H3HB 1ULSA 1JDSA 5CFNA 1WX1A 1T0IA 3IB3A 5BUZA 4JI3J 1UDRA 1N6PA 1BQMB 3ECCA 3EPIA 4G41A 3Q7RA 2CJKA 2G0AA 2JANA 3CMES 1S2IA 1BWQA 5I5EA 4GRAA 1PWXA 2VK2A 4CLYA 5KOXA 2Q43A 4P84A 4YRMA 1G1MA 4FXPA 4XYEA 1L4GA 3OOEA 2HJ9A 1VKRA 3DULA 3QX7A 2DY1A 4U9RA 3DE4X 2CDRB 3ZWXA 1IBLB 5BMVF 4EPXA 4QYZJ 1T8TA 1K6MA 3DRRB 3IESA 3G2NA 3RWBA 3HZOA 2OXCA 3FZQA 5CFLA 4PXCA 1YBVA 7MHTA 1Y5RA 1B76A 1YQXA 3NTRA 3EXFA 4WW0A 3HXTA 4QOFA 4DOZA 4P3YA 3OKCA 3PFCA 2J4FA 1KDOA 3FF4A 4EPRA 2UUAJ 2JZ5A 5IJXA 4R9NA 4OYLA 2HLPA 4OHRA 2AU0A 3TAUA 4LJ5A 4IIEA 3V7NA 1A27A 3I9LA 2DR7A 3DLEB 4QD3A 2DR8A 3G5MA 2WG1A 1F12A 4J5OA 4DV5F 4YCCA 4CETA 3EF1A 4GFDA 4M1QA 3AUYA 2UU9J 4RGBA 3H97A 4F9EA 2RGNC 3SI7A 2HSEB 5AXBA 2QRHA 3T9FA 4OF4A 1WR8A 3D2BA 4YNBA 5E6SB 4DN0A 3MRTA 1Y3AA 4E3WA 2DHDA 5A7HA 2W2TA 4JKYA 2FF5A 3OCZA 1M5HA 2X1HA 2V4ZA 2VHEA 5FA8A 2XA9A 4DYVA 1R0RE 3KZOA 3AH6A 4UEOA 5K8MA 2H92A 2OK7A 3E81A 3KWJA 2NZXA 3O1HB 5A3JA 3PW5A 2C61A 3KB8A 1UKVY 4KRFA 3T0GA 4LRWA 1XTIA 2AVNA 1FXUA 3WLSA 2HLUA 2C2OA 1KDZA 5F9LA 4J0DA 2IA0A 3NHRA 1W88A 2IDMA 3OZCA 2J33A 4IDEA 1QR6A 4IRXA 3HDQA 3TFQA 1ZZGA 3VKHA 4XAKA 3EVMA 3ZTPA 4YHHF 5TQ2A 2CQ3A 5KFRA 2ZJ4A 4XJTA 1NVKA 4AP6A 3G9XA 1IVZA 1R6BX 1PWYE 2B9EA 3W2WB 1FXLA 3BH0A 1UXIA 1ODSA 4L3WA 2LXFA 1ZHHA 1T3ZA 2XZPA 3NVAA 3GILA 3ZYZA 4MKZA 2CZCA 4O4JA 3T12A 1PCXA 3A2LA 4HLDA 3WL4A 3NB0A 3P45A 4UTNA 1Z7WA 2WSMA 4L95C 2BR4A 2WT8A 3U4IA 4LFCJ 1K7XB 3DPUA 3ND7A 4U7WA 4LJMA 3H20A 4KPCA 4GBGA 5G0UA 2OYSA 1UDAA 5LA6F 2BGMA 4MI6A 1CKEA 3CF2A 3QJPA 5AXNA 4KO4S 4B9NA 3DZFA 4FSDA 2FETA 2H1WA 1LF5A 3ER9A 1W0CA 5FEMA 2YKNB 2IH2A 3K0CC 2MSDB 3N87A 3FLAA 4XAQA 4PPDA 3X1WA 3KYJB 4MTPA 1E1RA 3GYNA 3SR3A 3V2UA 3L79A 1YZGA 2P6TA 2E4ZA 4LF8B 1X7GA 4B3TJ 1GU7A 3KLGA 4COOA 3PC4A 1E1QD 1DAPA 4WZBA 4JI8F 3OM8A 4ZTBA 2J1LA 4IO0A 5IEJA 4OQDA 3O0TA 1CBUA 1OFUA 4ZC1A 4QYWA 1YJAA 1XKTA 5EFZA 3GG2A 4BX9A 1ST2A 3C6UB 1XPJA 2FE4A 3TZ6A 1I51B 1EM8B 2W4QA 4QBIA 4XRRA 3I04A 3UAVA 4IVRA 1FUIA 5EIFA 5BQ5A 2NQ8A 1JLGA 1P4HA 3R09A 2JH8A 1L5HB 4P31A 4R6WA 3X3HA 5M2QA 5HKLA 1SAYA 5KFZA 2Z30A 4MTLA 2YJNA 4F3MA 2PVPA 3LIPA 4EKEA 2F59A 1QH0A 2YASA 5DIFA 4HHEA 1TF7A 4ZKEA 5ARCA 1FEZA 1PAUB 4RK6A 3ZTTA 3PWSA 4HLQB 4N0PA 4Y6SA 1U8UA 3EZUA 1ZUNA 1VRCA 1F8XA 2DO0A 2W2OA 4D9NA 1D7OA 3A6FA 2J5KA 4ACBA 2FC8A 5FDLA 1S4FA 4DI6A 4MR8A 1L4UA 4YB6A 4DUYF 5CCDA 1HNXB 1UA1A 1C1XB 1QFYA 2FUEA 4S1NA 5F1YA 5L6MB 1H8EA 3JD1A 2XKKA 1E2FA 2YV4A 3QITA 4OH1A 3L7BA 1EVLA 1R66A 5C0OE 2WU8A 3ZHSA 3D7SB 2E9ZA 2WTEA 1VL1A 3N86A 2HHWA 3I6BA 2QTZA 2VNIA 1KAHA 5KX5F 1C4CA 1P5FA 4LF9J 3TAHA 2PC6A 3IC5A 4B80A 4CZ2A 5BPHA 2CF5A 2QZ9A 4ICLB 1MQ8B 1FRIA 2CFOA 2XNDA 4XUGB 3C1UA 2DF8A 3HHEA 1ZNZA 5AW5A 2BFPA 4R8VA 3MM7A 2IDKA 4TQAA 5L9AA 4JBGA 4IYJA 3ORYA 5EINA 4HPJB 2XCAA 3R3SA 3OL6A 3KJVA 3PTZA 4ZVSB 2JLAA 3C6YA 1W1UA 1R3NA 4R7GA 5DRTA 2VXBA 1J0AA 3K92A 2J9DE 3DQPA 3MECB 3CB2A 2NADA 1KQFA 3K1TA 4DCNA 1P0PA 1VXRA 4UTRA 5I8ZA 5KG0A 4ZFNA 4KAXA 2BMVA 4AC9A 1JLKA 3A1FA 3U1BA 2BGNA 1ZFNA 3PGMA 3BSYA 2O7QA 4FKBA 4RWXA 1T03B 2WYHA 4MYHA 3VPHA 2JHGA 2QYSA 1M66A 2YWGA 4E5KA 2LVBA 5KNDH 2IM0A 4H9GA 3RRZA 4LBVA 2BR0A 5IMSA 1X5SA 4WU3A 5HROB 5JI3E 3AUJB 5D4PA 5EJGA 3A28A 4ILMA 1UBMS 5EQDA 5I7FA 5AT1B 2X9NA 3U1NA 4MPPA 2GEVA 3EMBA 2CCKA 2ERCA 1YX2A 4PSVA 2IY7A 3WICA 4LF4B 5H68A 3DD5A 3VU9A 4HPXB 1H85A 5TDHA 1F0YA 2YKAA 1M8KA 2QLTA 5KKNB 2R7AA 1D2HA 3LQRA 5C5JA 4ALJA 2QXTA 5GMEA 2GCGA 2V74B 3MTBA 5ED0A 2ATLA 5DXJA 2UXBF 4DDKA 3EAQA 4RJKA 4TQUS 1TYBE 4YBZA 4O4JB 2MSNA 1XTZA 1UPXA 1BWSA 4DR6B 3PI7A 5KCMA 1LK7A 1PJAA 4ZVGA 5IHPA 3DOKA 1IK4A 1NONA 1FK9A 4OL8A 4RORA 1NH7A 1SIOA 3IIEA 1MGOA 2HLNA 4H7KA 4ZIWA 3QKRA 1RYHA 2J8ZA 4G4JA 4R01A 4K9RA 1N5YA 3GIKA 5E6RA 1EETB 3FNBA 1P33A 2ORIA 4B82A 1VQ5S 1JIKA 3PV0A 3D7RA 3L46A 3EC2A 4NJMA 3M2UB 3NGSA 4YJFB 1ZOIA 2QQGA 3RC1A 4YJ3A 5IH7A 5ALFA 2PRKA 4CEIB 5EWMB 3EZ5A 3E7PA 2HMTA 3K8OE 4NJEA 1HLDA 3T1QA 3C3BA 5T67A 4TMWA 5E1OA 5D4OA 1X87A 5ALNA 4C9BA 4AROA 2VFSA 1M5TA 1JRLA 2I6FA 2P8IA 1UFQA 4ANFA 3K6SB 4QBUA 2YXLA 2PTHA 2EZUA 2WJVA 2GHVC 4Q24A 1J1UA 3IPLA 4OQNA 3WBZA 1NE2A 1JVSA 5SY9A 2OC9A 1JFFA 2A1IA 3AT1A 1S4QA 3V42A 1H66A 5A4IS 1REQA 4AQYB 3HCRA 5K0LA 3P2IA 1XN4A 1K9MT 2VD3A 5JCXA 1GU1A 3DKKA 3MEGB 4U3JA 2FN3A 1K1SA 1R0ZA 3SS8A 3QYPA 4RANA 1G17A 4BGDA 1VQ7S 2NU8B 5IUJC 2IY8A 3AZOA 3GZJA 1QYRA 3EGCA 4LOHA 1TYZA 1QIJA 3WNCA 4AO6A 3D8SA 2OPQA 1EK2A 5HSGA 3BH7A 4IIXA 2K7KA 4DSIA 4WLUA 3NAIA 1WABA 1UJ4A 2XGQA 1G7SA 4QW8A 2DR6A 4Y9DA 1RT2A 3AJDA 2J9FA 3OQ6A 2XWYA 2H1LA 1N7JA 3IBSA 3ENZA 3ACBA 5EP2A 2NTEA 3RVQA 1FSSA 3ZWQA 1NK6A 3F74A 4F12A 1AH2A 4QRHA 1Z8FA 2GVNA 4BIIA 4YP9A 1YI1A 1DADA 2WHYA 1I0IA 2FSPA 1G5QA 2CFCA 2ZDPA 1SC6A 4K88A 2YNGB 4PZVA 5HM6A 3KZKA 3TEHB 1Y00A 2JFUA 3Q9SA 3FVTA 4YBRA 3WFZA 4JLUA 4TRRA 4O4LF 3VDRA 4X65B 1IXRC 3N0TA 2SCUB 4P35A 2RGWA 4BVHA 4MOWA 3LWMA 2O9JA 3B1WA 4XWYA 4CIAA 1R6VA 1VC0A 4HWTA 2B8NA 5AMXA 5EN4A 3MIIA 4R2IA 3RTAA 5LXTB 4F0KA 2QBYA 2VP4A 3V2UC 2CZVC 3RSOA 1UFVA 3PHGA 2JJ1A 1ZD8A 2ZYDA 2Q0HA 3RAQA 1J8MF 2VYVA 3Q3GE 2B8TA 3WWPA 4JJGA 2XGOA 1DG1G 3OHSX 4DB2A 4EA7A 5IT5A 4LGVA 4QWDA 1KC8T 2PZ8A 4GBMA 4OUDA 2P6SA 2LZ0A 1D9ZA 4K0KB 3JTMA 1C0LA 3DEFA 1I6LA 1M9NA 1ZRSA 2ONYA 4NONA 3PKMA 4Q45A 2ZI6A 2VHTA 2BFBA 2XE8A 1GPDG 4OZ0A 4HUJA 2PM8A 1JILA 3MWYW 2QS9A 2RGBA 2JEIA 4MINA 1XYVA 1YL6A 5JPDA 4IDOA 5JD5A 2P27A 3PJGA 2TYSB 4WE1B 3EGXB 2L0XA 3MT0A 1L8AA 3VYSB 5F3ZA 1Y5NA 3ZHQA 4LV6A 4LREA 2C0CA 3NORA 3TSAA 2ZUGA 4C7OB 3SBEA 2GM3A 1NNDA 4YN3A 1TO6A 2BTQA 1X7ZB 3X3UA 1AZWA 1NRIA 1U7TA 1KYXA 2IVMA 1Q95A 2COLA 1RABA 5FQNA 3EXG1 1C1CA 1J5OB 2K5UA 4JJFA 5K5EA 1QSYA 2QGFA 4ZIVA 1IUOA 2WAQD 3C39A 1WAMA 3L0YA 4DIUA 2G0CA 1ZYUA 4EMUA 1PNVA 2YICA 4YRSA 4QXQA 3TN7A 4C7QA 3VR3D 4V1CA 5LP1A 2C3MA 1UXJA 1ZXBA 4D41A 3P9CA 2RE1A 2DH9A 3JATA 2YZNA 4M88A 4P3OA 2XYPB 2B8EA 4W92B 4IRCA 3EJMA 3OW2R 4FC6A 1SY7A 5EMNA 4A15A 1LPPA 1ISFA 1Z5NA 4CF6A 5K20B 4IIFA 5KTQA 1NZJA 2I8LA 4B4OA 4KBFA 5AI4A 1HNZF 1V1RA 4CIOA 2WWRA 1BYIA 1G5HA 3KJIA 1UMDA 3K6SA 5A1JA 1K8QA 4EL5A 5IKEA 4NWBA 1T2VA 3KVNA 3RZAA 3BDAA 4FNHA 2QMHA 3SNHA 3IAM9 1VFPA 3R7AA 4EP1A 3N2YA 3P94A 1RWMB 2CFRA 3X1ZA 2GERA 3QSYB 2IY9A 1KOGA 3PQ8A 2NR0A 3OC6A 4I4BA 3W77A 2C5HA 4JA0A 2G09A 4FYYA 4EYHB 1C7ZA 1YZUA 1MC5A 5B57C 2X7HA 1XK6A 2JEJA 4QWWA 2PFFB 4D8TA 5FIIA 3LVRE 3KU1A 1Q1ZA 3KBBA 2Q4EA 3MAAC 2Z4RA 1OPZA 3AETB 4BL5A 1IN7A 2AFVA 5LB4A 2OMKA 3SFUA 4RTRA 1RHKA 2VODA 3K70D 1JTVA 2ZIGA 2WFMA 4WZMA 2OH2A 1CX9B 4RS3A 2HHTA 3ES9A 1TYAE 1VLVA 1W6UA 4Y9TA 2HW3A 1IOWA 1ZOSA 2D5CA 4ZP6A 2EERA 1DV2A 3FYTA 3FTDA 3D1JA 3CSKA 1V5EA 4Z8YA 1ZD5A 5CVJA 4DUTA 1GQOA 3CXRA 5LZ8A 3R3XA 2Y9MB 5AXAA 5JSKA 1ZMXA 2QGNA 2NUAB 3ZU3A 1A1SA 4RF3A 3JQ9A 5T4HA 3EWGA 5L95A 3UT5B 5ES3A 2BKAA 3MRXA 4EGAA 3GV7B 2R66A 3BAFA 3L8GA 4DV6B 4CNQA 2VNHA 1SB8A 1S1TA 1U2EA 5MDHA 2YHIA 1NQ5A 3A2KA 1CNMA 2FJDB 2OLEA 2ZJOA 5ALIA 2IE0A 1DUIA 2ZT6A 2VQ6A 1ISSA 2XNCA 3PEUA 3V4ZA 1EX7A 3H3JA 3TEGA 1A9NB 4LMZA 1BWVA 5AO9A 3TCKA 3M0EA 4U7HA 3CCRS 4B9MA 5ETRA 2P5UA 3G2IA 2YMPA 3FCOA 2Y99A 5FBLB 3MFYA 4BRWA 3M4NA 4YAJA 1LBQA 1VGRA 2C97A 2QOEA 1NHGA 2JLQA 2CZGA 3DMGA 1WG8A 4G2NA 3CF4A 1RTHB 1FTSA 3DI6A 3ZNPA 3TZCA 1LWXA 4KGXB 2GK4A 5DPMA 3JQGB 4DT1A 5TIIA 4L02A 3DFEA 2EL7A 1QMPA 1U63A 3TLJA 3LY5A 1G21B 3C14B 3MCOA 5JWHA 4RPIA 3M8RA 3KK3A 4HNTA 3UCEA 4NESA 3PUHA 3R5SA 4ZP7A 1AMOA 4F5EA 4WYLA 4QICA 4IDKA 4PYNA 1N88A 4X97A 3F5FA 3CNHA 1T26A 1AKYA 2XI4A 4C0BA 4EY3A 4P7GA 3L92A 2AZXA 2OORA 4HZGA 3Q6NA 1QHFA 3ABRB 4D1YA 4LY9A 5ABPA 1S8FA 1EFVB 4DCPA 4FX2A 3ROZA 3C8DA 3L7MA 4DBVO 1HR0F 4Z6KA 3PRKE 2WSSD 5M5BA 3EPGA 2CJAA 4D3HA 1UH5A 1C3JA 1K89A 3DLLQ 4Z49A 2I38A 1TMJA 3RYHA 1NK9A 2Z30B 1CUJA 1KP3A 5CM9C 4BO7A 4KAIA 2UVQA 1TJYA 4A8HA 3G96A 4ZICA 2NV0A 3BWDD 3CLSD 1ZD9A 4YRRA 1AUPA 1GCOA 2LEBA 4HQRA 1PAUA 3LBYA 1JTFA 4O0MA 4QECA 4MFBB 1JHVA 1KYVA 5IMBA 3OLAA 4FKMA 3J7YU 4OLHA 4RE6A 4C0WA 1OH5A 4I46A 3ADOA 5IJ0B 2E7ZA 4NG4A 4K28A 4KGDA 1THGA 1KYQA 1KI7A 3A14A 3K70C 1KDTA 4MR8B 3GJTB 3EQ2A 3EGWA 1S1CA 2WVGA 3WWCA 1CULA 1IB0A 3DAYA 2FGCA 3E0QA 4JUFA 4RJJA 2ZYAA 1AKNA 1YR2A 2QAGB 3H2KA 1QO7A 3FGVA 4RZ2A 4DQLA 1YOVB 2I9KA 4ARUA 3OM9A 1JLBB 1YR6A 3T8YA 3S8SA 1LF0A 2QI9C 3VUEA 2WZDA 4GOXA 1KJ8A 1GCGA 4BC0A 4ELUA 2BSQA 1GNTA 4YX9A 2WM2A 5AXLA 1B64A 2KT5A 4BWYA 5AK0A 2HFJA 3K0AA 2JKVA 1UC9A 2O2SA 2FWAA 2VJCA 1QAQA 3HXLA 3L0BA 1DCKA 1XOIA 3AI3A 2Z09A 3IP8A 4ASUD 4BS2A 1FTYA 2DSNA 3AHIA 1E3QA 1TD9A 2F7SA 2BMDA 4QIHA 4UKDA 2I4TA 4XX1A 1WSDA 1EAYC 1J90A 1S7IA 1GL9B 4EPTA 1KVRA 3I5UA 4Q0BB 3KYLA 2XUFA 3D3QA 4B3TB 1KYYA 5KG5A 1JLFB 3T95A 2OT3B 4H0NA 3M6MD 4KOEC 3AB8A 2EFDB 2VQEB 5KQGA 3W3ZB 3I0RA 1DXHA 3GE9A 1H42A 3LGSA 5BV1A 3W63A 4PG5A 1XZHA 2FEMA 2YJ5A 3IIKA 3V8MA 3FDFA 2AHOA 1B99A 2EBFX 3NCHA 1XNQF 3ANLA 1U0LA 4W5JA 1GFWA 1BZYA 4RCZA 5C8XA 2ZKLA 4F6RB 2IXDA 3O8OA 3C19A 2OBFA 4P80A 4UTOA 1HSZA 4M89A 1X92A 5KNDD 1US8A 2WSYB 3PE3A 1PT8A 3GZ4A 4M49A 4WPAA 2ZXFA 3F4KA 3GFYA 3NT4A 1CY2A 4CT8A 4FFDA 2F17A 4KAAA 2CD7A 4A16A 4RY2A 3VV2A 5JVGQ 3L9ZA 4JB0A 4IDQA 3FPKA 3UCXA 3O4RA 3W5UA 3CUYA 4PBTA 4XUDA 2WBLC 2CLIB 4B48A 4ZDJA 1NOJA 4XIYA 1JKIA 2UVRA 2ZBFA 4JYAB 1E2PA 4WQMA 2BVNA 4RQBA 2CV1A 2I8CA 1FF9A 2DULA 4DR1J 2KJQA 1SHUX 1BX0A 2AVDA 4X64F 3NBPA 3OX2A 5HBMA 5CNIA 3Q3VA 4ES1A 3HWX1 2P0EA 4TWZA 4B4VA 5DI3B 3BM5A 4RA6A 4FYPA 2P2GA 4R3WA 4MVYA 5FI5A 1G1AA 4I55B 1ISHA 3OQBA 3MLEA 4WKNA 1ADGA 1CQIA 1NNEA 1ZSYA 1CHNA 3MR7A 4AF8A 3QIPB 1NXPA 4JJKA 2LDXA 1E99A 3MEEA 2WICA 1EESA 3UJ9A 3MMAB 5IDQA 5MFPA 3VX3A 4NLSA 4JBWA 2CHUA 1X8JA 1YVFA 1UKCA 4H4MB 1HETA 4C97A 1KVSA 3IOBA 2O01C 5H82A 5JT1A 3V1UA 2OPSA 3BO2A 2MR5A 4PVCA 5KNLA 4AECA 2Z8XA 3JQMA 1FDOA 2FZEA 2OZKA 3ESDA 2YNMA 1C0TB 3HEAA 1YZ6A 5KSYA 4H7HA 2JPDA 3LF1A 3ZIAD 3HMQA 2H7CA 4FGUA 2WF7A 1KSJA 1AKWA 3VHRA 1C9JA 3RO7A 5HDQA 3I0ZA 1XQ9A 2PCLA 4ME6A 4U5XA 3UGTA 1V45E 5CTAA 2HYIC 3FPCA 4JDUA 3HSJA 4CIYA 5LMUB 4ZYUA 1UBCA 1TKTA 4IM7A 4JXJA 4B3DA 1GTHA 1XJ0A 3V2GA 4RPKA 3EVOA 3UATA 4ZLJA 2WQ6A 1XMQB 4D4KA 3GLGA 3IMFA 1EX8A 2I6GA 1OAKA 2GZRA 3MURP 5D3GA 4C5CA 2J5AA 1EDBA 2FVCA 5TJ9A 2C07A 2BC9A 1TMGE 4LFBF 1SUSA 2OAUA 3RHZA 2QSFA 4ZOSA 2XQVA 1PUJA 1HM5A 1P17A 2WIKA 4WWHA 1Q22A 5IVDA 3OD1A 4P6VF 4O2AF 1M34A 2G07A 2C20A 3UCUP 2LKDA 1Q83A 4URQU 4OIFA 1IOVA 1M8JA 1VS3A 4IGAA 4L9RA 4XOIA 2D3ZA 3H2GA 4JLDA 1VIVA 4EF6A 4BAUA 2HXYA 4AXIA 5FLKA 1WELA 4X6LA 3F3MA 2Q3JA 3E6AA 3HHLA 2X2EA 1USIA 4FE7A 3U7RA 4BLUA 1GEGA 5DN6A 4B6RA 3P9NA 1QAOA 3PC6A 3K32A 1W5BA 5DYGA 1L7EA 2XYGB 2ARKA 1P7VA 1JDTA 5EKUA 1S0UA 4J0KA 4NYIR 1T3LA 2XMPA 2RFLA 3IHWA 1KDYA 1E20A 1G8SA 5BUCA 3JZAA 5ILGA 4ZQIA 4EEKA 1LC0A 4RABA 3KB2A 3SZLA 1C0TA 2QUIA 4S1PA 1YS7A 4IH7A 1QH1A 1UK6A 1TECE 1XQIA 2A18A 3A8JA 3DJFA 5JU6A 1O96A 5FFFA 1FUKA 3H0CA 5AHKA 3G5AA 2UYYA 1WC5A 4PYIA 3I37X 2GN4A 2ASYA 5E95A 1ZEJA 3MPUB 2ZB4A 3STXA 3OTOF 1T8YA 3KK0A 2QLFA 4E2WA 1NMQA 2PZMA 1XMOF 3OQVA 2DYAA 3R7WB 1RQNA 1IBKJ 1ZESA 2IIPA 1VBMA 1Q7GA 1W5AA 2BUNA 2JJ8A 4C0JA 4C6TA 4Q3BA 5HF5A 3O2QB 1T9BA 1JH8A 2IS2A 3PW2A 2ZBUA 1H0RA 4H3VA 3SEOA 2IEBA 3ESBA 5L3SB 4BCAA 3OTOJ 2W9CA 1YO6A 3ETCA 1E5LA 5HK4A 5TF0A 2I2AA 1NLYA 2Y0BA 2ZBPA 1DEXA 3FDJA 2PX3A 3MR5A 4B6OA 3QE9Y 3SFGA 4YDXA 1VRTA 4QE3A 1MAHA 3MD0A 1A5TA 3TI7A 3G7SA 2YZ7A 2R7KA 3W9HA 1E61A 4E5MA 2YKQA 1LI4A 2VG7B 1EB8A 1AMNA 2ZRGA 1C5KA 2J9XB 5JQGB 2G5TA 2NN3C 4QTYA 3ZE1B 2ZPAA 2RHWA 3VAFA 4LISA 4WFQA 3CH7A 1U98A 3AKDA 3F0NA 3KOOA 3BIOA 1WNTA 2V7PA 4KP7A 4U9IS 2V7XA 4KPGA 5GP1A 4MQBA 5AKXA 1MVNA 2RKOA 1DLOB 4MICA 5LZ4A 1T3HA 2UVVA 4MP3A 2HF9A 1U9IC 3C3CA 5KTPA 4TN5A 5DGAA 5IXJA 2DUNA 1WW8A 5BNFA 1LQUA 2U1AA 3EE3A 1PYOA 3CYFA 3WKCA 4AQYJ 5ERXA 4Y6IA 3U2QA 1XIVA 4GLOA 2EWHA 2VVTA 3MWJA 2GVDC 1G3MA 1X1SA 3CCES 1E1LA 5ELLA 1T5DX 3O73A 5JIBA 1ECJA 3MMAA 2GHQA 3JRNA 1R5JA 3FCEA 3MBIA 3CPSA 1IWAA 1KKHA 1U24A 1E6CA 1B7YB 3DXXA 5AW1A 5JALA 2VA2A 2OPRA 3WIUA 4KRWA 5A8KA 3TRDA 1Q3TA 4KQWA 3H13A 3RB4A 4HGRA 4JLPA 2MZTA 4JYMA 3F6YA 3OF2A 1I2AA 2RRNA 2RJNA 4J9OA 2VJDA 2UZ1A 3V1MA 3LLUA 1NAQA 3LUYA 3PDNA 2VJKA 2ZUTA 3JVUA 4Y2UA 3HB0A 1JBQA 4MNTA 1R15A 1JEOA 2JC3A 3BFXA 1LA2A 4DMUB 5IZCA 2EI5A 2VUHB 2X3DA 2DPIA 1EFTA 3PQ7A 5JDIC 4NCGB 2EK1A 4Q00A 3RGGA 4TVOA 4OMCA 2IDLA 2CVFA 4KGMA 4QGHA 2XUHA 5T5QA 2MKKA 4GYKA 2M98A 5JI2E 3KJVB 3KVRA 4TU8A 2IYWA 4OYZA 3WLOA 3NRCA 5E7IA 3EZNA 3H9JA 1T8WA 4LF4J 5B53A 4DXDA 1SUQB 3KSUA 1T03A 1W36B 3G0HA 5JZVA 2YYAA 1N6QB 1TZCA 4ZI2A 4NXNF 4C3KA 1BGVA 4DZZA 2AQIA 3HKZD 1QP8A 3MEGA 1S1XA 4YB8A 3OCYA 3LUCA 2PMCA 4XWAA 4PXSA 3K2YA 4RLFA 1FFWA 2CKWA 2HPAA 3HMJG 4RTMA 2VSXA 2L19A 1T5OA 2JAHA 2ODEA 4M7OA 4S1TA 1DBIA 5D78A 3VGUA 5HROA 2A10A 4G25A 1WZEA 1G42A 1IXYA 4IG3B 1QSLA 1WDDA 3MWGA 4OK3A 3HM2A 3KLFA 2XGSA 2GMHA 1UCFA 4DY4A 2HT6A 1N75A 3PXBA 2GTHA 4P7BA 4EJSA 3HRKA 1I9CA 2HSDA 2ID7A 4RL4A 3CCMS 3QUSA 2XV1A 3W9YA 1IBRA 1HYHA 5I4MA 2NYUA 2QMEA 2OGWA 1QLHA 2QVYX 3AFMA 4OD0A 1OV6A 2R1VA 1OA0A 3GVXA 3UYLA 4JN6B 2JGAA 3PVXA 3HADA 2OAQ1 3U02A 4ROSA 4LZPA 3MGKA 1JJBA 3IDAA 2CXSA 2FHJD 4G86A 4M9SA 2J6UA 3RBEA 4D9HA 4W5OA 1X60A 4PHCA 2GN8A 2ET6A 3BMOA 3FSGD 3MUFA 1HBUB 4WE3A 3JXEA 4DLZA 3ZIUA 1PS9A 2FN8A 3ZFVA 2A9VA 4P22A 1KIMA 1KA9H 1SQSA 5HIJA 2WNHA 3F9IA 2YBEA 3K9HA 4MKBA 4FS2A 3OIDA 3DDNA 4BFSA 5IVPA 3S3TA 2RI0A 2YWHA 2Z5GA 3PE4A 2H4FA 4BLVA 1XF9A 2H1YA 2C4VA 1ACJA 3F3KA 5ETOA 3TOZA 5K51A 2C3PA 2LVWA 1MDFA 6FDRA 1VLJA 3FDZB 2BACA 2JCVA 1BXKA 4O2BB 2RDDA 2OSVA 5E2AA 1BS1A 1N33B 2B78A 3ZV5A 5IWCA 1LKZA 3BM7A 2EX4A 3R8FA 3MPWA 5DWQA 1K3TA 1G21A 3P0JA 3CONA 2IBSA 4B9AA 2UYGA 1UFOA 2JSXA 3E7XA 3WRYC 3TD6A 3T9NA 2Q50A 4TM8A 1G16A 2Q3PA 3N8GA 4KEAA 3LS2A 1E9DA 5JS2A 1XTKA 4ARAA 1B93A 4KWIA 1KJ9A 1N6NA 3MIZA 2KBEA 3K94A 2GPTA 1TQLA 4EO4A 1TQ2A 3AXSA 2DWQA 2PIAA 5KTKA 1NJSA 2N7YA 1CUXA 1IKVB 4N8SA 4EH1A 3AX6A 2C28A 1HNWF 2ZYHA 3CW2C 2QAGC 1FLDA 1X8DA 4OOFA 2HCRA 5K05A 4XCXA 2PD4A 3NS6A 4AN1A 3PVZA 1VI6A 4HGPA 1E5VA 1DC3A 2ZTLA 4DCPB 3JQKA 3DT8A 1TT5A 3RE1A 4O25A 1X80A 8AT1A 2AYBA 2P0AA 2VWHA 2JVOA 3LTOA 2JOQA 4BQIA 1RMTA 2QL7A 421PA 1JAZA 1I14A 4YRGA 2VFUA 5KFBA 3BKWA 3RI3A 3QBEA 2I87A 1I3LA 1GQFA 3UHOA 1AW0A 4AXBA 3O31A 4JD5A 3C70A 3K0SA 1ZPWX 1A04A 2CKMA 5BMVA 2Y0SD 1TK0A 3USZA 2HQGA 2OD2A 3M2TA 4EFNA 1C7IA 1C4XA 4J7XA 2GBPA 3MD1A 3LD9A 3VNAA 3LDUA 5LN1A 1LPOA 1E3SA 4X62F 1AHNA 3SX0A 4WKOA 4RKEA 1IG0A 2ICAA 3QGHA 1MV8A 3E4DA 4D9KA 5DOVA 4OYRA 1K86A 5B4TA 4OHMA 3A8EA 4R1OA 1DO8A 3IO3A 3WLPA 5FI0B 4ARZB 3COVA 3ZG6A 4HDAA 5CW2A 1RA6A 1EJ0A 2WU4A 4GC7A 5CIQA 4GNKA 1QOPB 1PEKE 3EXCX 5I9LA 1D8TA 3K5PA 1WOSA 1DKUA 1GPJA 4ZAWA 3A0RB 1IBKF 5JNWA 3GLIB 3Q0EA 1SUQA 4EYKA 2VS1A 5ETLA 1SC1A 3HKCB 2UXCB 1A2QA 4ZQFA 4DX6A 4TLMB 4LHYA 4W7IA 3ETHA 4MJXA 3SYLA 1XMOB 2K1RA 3SGLA 1VM6A 4YMVA 4X8HA 4FEGA 3OT4A 3KK1A 3THTA 4RNFA 3RAFC 5E9QA 1T0PA 1E4YA 4RNDB 1OHHA 2H9IA 2R4QA 3EQZA 5CLFA 1C8BA 1I3KA 2J3JA 2HNYB 3UXYA 1G7RA 2NU9A 1P72A 1OY9A 1Z22A 4O29A 1TEHA 1VQPS 4GE0A 5JAOA 2FDCA 4ML3A 3P9XA 1M1GA 2GXAA 1Z34A 3VAAA 4M87A 2GN2A 5DOZA 2CJYA 4I1OA 2ZTSA 4OXQA 4HI2A 1U1FA 2QPTA 4K3UA 5KYVA 1K1QA 4PLTA 4LI3X 2Z4SA 5HG0A 4TZ6A 4LZJA 2BANA 3HGMA 2C82A 1KHVA 3MS7A 5AH0A 3FCVA 1ZEMA 2G7MC 2O7SA 4BMSA 2VASA 1XRSB 4CLLA 1RWPB 4E32A 3N2KA 2H7VA 3IGNA 3RBDA 3W2VB 1G2PA 1MWYA 1O1YA 2HQBA 1AFJA 4RW7B 2CL6X 4GC6A 4IMPA 2UDPA 3QT6A 2AMVA 2V8DA 3GLFE 5KDDA 3EVTA 4NCHA 3TKAA 1XR5A 4LF7B 3TPZA 3BJYA 1K4KA 2Q6OA 2JVKA 2NS1B 2PD1A 3UMFA 3BICA 4HH4A 1TQ8A 4ZCTA 4NENA 3P9YA 1PR6A 2HF2A 3RVKA 4NCAA 4Q4LA 4UW9A 2UXDB 3JQ8A 1Y3IA 3ER8A 1G3IA 2FEPA 2FH5B 1NSPA 6PFKA 5KQSA 5B0DA 3UMSA 4M37A 4F4ZA 5B4VA 3Q7IA 1R9JA 2HVHA 2C5EA 3PYEA 1UDBA 4ZV9A 4JOQA 3GLJA 3U4QA 4RMNA 1IWGA 5BNWA 1Y8AA 3J80U 4QRIA 4O4HA 4Z8XA 1HE2A 1CZNA 3TFOA 3S1AB 1KQGB 3VRHA 4Z51A 3ZXUB 1L8QA 2QB5A 3FPLA 3G59A 1Y9AA 4JA2A 1WB9A 1Z6TA 3MYRA 4HYEA 2CPXA 1S6QA 4G1CA 1N3BA 3L9XA 2W4IA 2Q3MA 1I4EB 2BEFA 2MYFA 5MN4A 3PS9A 3U7GA 4R3NA 4U1RA 3GR0A 2YY7A 3DE3X 1QAJA 4XGNA 1YCDA 3GDOA 1DTEA 3N7TA 3IMCA 2RAVA 1PJ7A 4MUMA 1NZDA 3WLTA 2WVBA 3F5SA 1X14A 4QXRA 1QKJA 2EFQA 3SC4A 2XO7A 3FNIA 2VDWA 4CTJA 5FORA 4B08A 5CNJA 2WUGA 3GNLA 2ZBVA 1HNZB 2QKYA 2ZM5A 4WK4B 3R0ZA 2B98A 3KYBA 1T02A 1VP3A 3QK7A 1LGYA 3AI7A 1WBBA 3TEJA 2WVEA 2Z4PA 1D6NA 1MT3A 4WXEA 1LQ2A 5A5EA 4IG0A 2YNHA 3LMKA 2DVMA 4O1IA 5JASA 3WOHA 2WUDA 5KWSA 3NO4A 2OVFA 4V0ME 1E1CB 1SB6A 1E18A 4E98A 1PL8A 1S2MA 1H2VZ 1NBEB 4AWBA 1SA0B 3OBIA 3GT4A 5BN1A 4JV2A 1UAAA 2FPKA 3MUVP 5IJWA 5KFUA 3QX3A 5DDRC 4ZPWR 3AUSA 4V3BA 1GT91 3TIIA 1L1RA 2ECFA 1LRJA 2LPMA 2WIFA 3P9PA 1B3RA 4MTCA 4ZDIA 4FE4A 1KONA 3H6GA 3NYRA 4JUAA 4S1OA 1SJRA 1RA7A 1N54B 5COQA 2H54B 1M2EA 1DWQA 3KVOA 2IH5A 1DBPA 2OAEA 3H2ZA 1OVMA 2Q5LA 4HAUA 1KN6A 1F20A 5BURA 4XX0A 3IE1A 4BU0A 4B6SA 2Q7XA 2QUZA 3HA3A 4MV3A 5MHTA 2NVBA 3O75A 4C8NA 1KVQA 3BDPA 3PE6A 5CA1F 1U5CA 2VH7A 1W44A 4KIUA 4GLLA 4YAOA 4LGYA 3O1JC 3PCXA 1E2HA 2PQ2A 3O9MA 1T9WA 5CG1A 2J0UA 4HMPA 4B47A 2IIBA 1KMNA 4ELTA 3NT5A 1H4SA 2XMJA 1VBZA 2OXTA 3Q8PB 1JHAA 1S8NA 3VOSA 1M33A 1DAEA 1EUZA 1R1DA 3CY6A 3F6PA 4D25A 3R5BA 2VKTA 1FTQA 4UATA 4PSUA 3FOZA 3X44A 1TTHA 3BK1A 2DK2A 3SG0A 4BDSA 2KHCA 3JZIA 3GX1A 2II6A 2FWIA 3RH0A 3S1TA 2NNWB 4B3TF 3G5TA 3DU6A 1ILEA 3W1WA 4USVA 2Z9CA 2VYND 4UHEA 3G6XA 2BZSA 2R2RA 4ZHRB 1FKOB 1BEEA 2Q0QA 2D06A 3E3LA 2ZIVB 4WEOA 3I9MA 4DAOA 1WXXA 5DEOA 2A67A 1K97A 1UZLA 3LXUX 2VL1A 1YONA 1D2EA 2QA4S 3WO0A 4TTVA 3L4JA 1AX9A 2Y1GA 4Y6PA 3L4KA 4F1JA 4QOTA 1UBJS 1Q84A 2WILA 2DEJA 2PMWB 4LHSA 3GWGA 5K3SA 4GHWA 1OASA 2RHTA 2XEXA 1NDQA 3AHFA 4ZDWA 2SNIE 1QFSA 4JBXA 3SN6A 4WFIA 3OLQA 4GGPA 3NGMA 2AR9A 4FQ8A 1KHTA 4G9BA 4ZT3A 2ZIEA 4DFKA 3W2HA 1BS9A 1EP9A 1GN8A 4I7FB 1TCUA 3U5TA 3D4PA 4D98A 3FIUA 4S2UA 1WSWA 4PLZA 1Y6FA 1OI3A 4O4IB 3D02A 3FFTA 3M8KA 4G4GA 4L4SA 5CFQA 2HA6A 8ABPA 1W4BA 4LFAF 3UJ3X 1G8KA 3MT9A 2Z95A 1FVOA 2E4UA 5B3JC 3H5SA 2PS9A 4N6OA 1XYYA 3IH5A 4I55A 3ILOA 2XJ4A 4J7CA 4RF5A 4TWIA 4B3MJ 1Z16A 3SXUB 5K0GA 2RHLA 5T8KA 1QIHA 1RTIA 3UHFA 1JB1A 4ILLA 1BE0A 2Y1RI 3QVJA 4X4NA 1JLCB 4MKGA 5KNBA 3J7A1 4ZQCB 1P5JA 1PGQA 5F4BA 2B4KA 1VL8A 3QQPA 5ALVA 2J0SA 1TU4A 2DHXA 3OPVA 3QHQA 1RXEA 3U3RA 1T5IA 4KFUA 2WM9B 4PQEA 3LRPA 3BBFA 5F33A 1F9EA 2MZJA 2IVFB 2VSOA 3NNCA 1AUVA 5BWNA 1FRMA 2IJFA 2YHAA 4O1MA 4I50A 3ZUPA 3H4MA 1KYTA 1XZCA 4C6HA 1LBTA 1UM9B 3ZEIA 4JJZA 5G3ZA 1W5FA 1RHMB 4Y7CA 2PAFA 2JLEA 1GCIA 1RXUA 2HUPA 3EGNA 2DUWA 3G2MA 2QTCA 3VFDA 2FX2A 2PR2A 3PX2A 2D9PA 1SXJC 2P1RA 3AJ9A 2NG1A 1DQAA 4MKRA 2H4YB 5KQRA 4EHFA 3IT3A 3A4VA 2HA3A 2G2ZA 2YC2C 3MSXA 4Z54A 3Q86A 1HLWA 1EDZA 1R4NB 1RXSA 2OFFA 3CJ3A 1X7DA 4X94A 4ZK2A 4P2FA 1QWSA 3GUZA 2FR1A 3ZGXA 2E9SA 1K1EA 1U11A 4G3XA 4FMBB 4KYTA 4TUYA 3GJTA 1UT5A 3SSRA 1P1FA 5AVXA 2O57A 4F04B 4A6EA 1DIBA 3G2JA 4NY1A 4U8VA 1J22A 2I2WA 2WJIA 2CXQA 3LLVA 2WMNB 4BZPA 4M53A 1XERA 4GL4A 2EQ5A 4YPVA 1BOFA 3DV9A 1AU9A 4A47A 4DCUA 1UF9A 3P9RA 4BP8A 1IEXA 2IV7A 5BR4A 2GWRA 1XLTA 4UOZA 2B7CB 4MULA 1DAIA 3GEPA 3MMJA 2DR2A 1HT2E 3ZY5A 2ZYUX 2ZJ1A 4R2WA 1CV2A 2D7JA 4MQFA 5CLJA 5A8RA 2X2PA 1NVBA 4C76A 3G2XA 5T64A 4DDWA 4CM4B 3VNUA 3V46A 4BS9A 4FN4A 1SHKA 1MXHA 3KVVA 5C52B 3HVAA 5AW3A 4O2LA 3POTB 5KFXA 3U7EB 1QQ7A 2QEXS 2RHOA 3P19A 2A5LA 3ZU2A 4ID5A 4L5BA 5HF6A 1T3SA 1QMGA 1QZUA 1GYQA 3V7WA 3QVUA 1FEHA 2HHAA 2I67A 4BVEA 1XK8A 8AT1B 3X2SA 5DI9A 3EGDA 5B09A 4ZVLA 3JR3A 3HWRA 3P45B 1S4EA 5AKIA 1PHRA 4EHJA 1NOKA 1SKBA 2P2SA 1PWZA 4JSYA 7REQA 4NQRA 2J6SA 2CCGA 4W4MA 1L7MA 3MQ4A 3NVKI 4Q3DA 1YRLA 1I2ZA 2HFOA 2EXUA 1WMDA 2X0IA 2CDCA 5LBIA 3MUTP 1VA5A 3CVUA 1WCV1 3PIOQ 3OE7A 1H5NA 2IPLA 2ZQYA 2F4FA 1PDVA 3ICLA 1H2UX 2FZCB 4AU1A 4DCMA 1VDZA 4F84A 1YQUA 2QJOA 1P19A 4WK3A 5DBEX 1GV1A 2I3BA 1IG3A 3D3WA 5F8JA 3ED5A 1YS2X 3JU3A 4J2HA 4ECQA 1PAEX 2BDEA 1U28A 2BI8A 2DXDA 4XZ3A 3I1JA 4WSOA 3KRTA 4M21A 5AW9A 2E5JA 1K8RA 4GP7A 3RSSA 3NH9A 3KOAA 1OPIA 4DV3B 4CKZA 1UXHA 2TMGA 5LQNA 4L8WB 1E6YA 3EDYA 3ZE0B 4NU6A 1ZY2A 5F2KA 2ODAA 2HWIA 3VAZA 1B16A 4E2FA 5CM2Z 1HPZA 3OY2A 2XCQA 4E5UA 3OA2A 4FEAA 3VCDA 4G0ZA 3DMHA 1V41E 1AO3A 2IC3B 2OAGA 4BNZA 4E5YA 1MAUA 3KUEA 1PJCA 3TEMA 2XBPA 1P39A 4HQ6A 2EZ4A 4LFBJ 1Y3CE 4EKDA 5KOJB 5FPTA 1Y9EA 4PAGA 3KJXA 1AK9A 4NYIQ 1HE3A 5CB6A 2PE5A 3RG6A 1BX3A 2IU0A 3WSWA 3IAFA 2H4WB 3M32A 4NIMA 4YHHB 2HO5A 2VP6A 1FMCA 1O2DA 4OFWA 2R6DA 4NLLA 1MJGM 4N3CA 2IHR1 2GW8A 3QELB 1SKMA 3U7IA 3H5IA 2XDQA 4EJSB 5IT4A 2GT1A 3DDKA 3DOCA 2VB6A 2YY5A 4XIFA 3PEVA 4LF6F 3OTOB 5KYNA 1T2NA 2MMYA 3OTIA 4X7RA 2CADA 4C9DA 1G55A 3WGHA 4MYUA 2OCLA 2R65A 1F14A 2OP0A 5EJ6A 4UUAA 1TO1E 5KVAA 3D8RA 3HKDA 4WCFC 1GTJ1 4IR7A 1KZHA 4MA5A 4OQXA 3Q41A 1SWWA 3NGXA 3CEPB 2AOWA 3F5MA 2ZANA 4KNWA 3QWBA 4UTZA 4MVXA 4OL0A 4BNGA 4YUZA 3IQDB 4D0LB 2ZH4A 1VIYA 3JQPA 5HANA 3RK0A 3TP2A 2WD7B 3GJRA 3SJZA 1M2VB 3G88A 4FNMA 3RAXA 5JISA 1L5FA 3HBMA 2BF7A 3RVJA 1R8YA 1AKVA 5DP1A 4BTVA 2P2LA 3ZO7A 4PGMA 2Z2YB 1DXOA 3M6VA 4HX2A 2ZH7A 5T41A 1XKQA 3ONFA 3ZS8A 2D7DA 1E8DA 7AT1B 2O8NA 4NZPA 4DE5A 2FP4A 5EZYF 3HSGA 3GGJA 3CVOA 4XJSA 2PGIA 4KGZA 3G0DA 3KV3O 1R18A 3UGJA 4ZCMA 5EIWA 5K0EA 3RC8A 1E9SA 3K8VA 5JZOA 2L48A 2VG5A 4Y2JA 4YRZA 3W60A 3VJLA 5B36A 3MR2A 2HMAA 2ZH6A 1M1ZA 2ZRCA 4LFAB 3QYJA 2OHOA 3O9VA 2QMQA 1DTWA 4P52A 2X2OA 1FD2A 2AXQA 2GA8A 3I2JA 2A78A 1AGXA 2NZJA 2AE1A 1K3FA 4OATA 3VZCA 1NMSA 1OIXA 4MRSA 4USMA 3M3DA 4B3FX 4PXEA 4CCSA 2HNBA 3KQOA 2Q5HA 2EC2A 1AUXA 3G2OA 1G8AA 1WDWB 2J3HA 1JG4A 2O8BB 3DRYA 3RBZA 2IXGA 3ILVA 3QWFA 3AXKA 1F0NA 2CUYA 3EPJA 3TLBA 4U39A 3LKDA 2B99A 1YQWA 1S1UA 4P7FA 5DCLA 5FR2A 5F0UA 1EE2A 4BNYA 4M60A 1YU6A 4TS4A 3PKYA 4C8OA 5K6AC 3U27A 4K6HA 2NYIA 3IM8A 3CZ4A 2R8YA 3K4QA 4MRVA 2JFVA 2XT9A 1FTGA 5D6OA 4KO3S 2Q4BA 3DYBA 3EPKA 5MLCV 1L7AA 2NCKL 1DZIA 4HNQA 4R2LA 1C3EA 4ILEA 5KAMA 1ZUIA 2ZCVA 1HBNA 1R12A 2REOA 3CS3A 3FGZA 5AK5A 2Z57B 5K0SA 1DU4A 4Z5XA 3J7AC 3GYGA 1TUIA 1XEWX 3UG7A 1ZWLA 4MR7A 4BFYA 4I0WB 4TKVB 2PPLA 2Q6VA 3OM0A 1GNKA 1P7ZA 1NZ8A 3EFEA 3B6ZA 1XLUA 2Y0DA 1ZH2A 2RK3A 4Q1VA 2Y6UA 4P3XA 2Y1LA 1HFEL 2KRRA 1HI1A 1ADFA 4NV0A 4M98A 3QJ5A 2F5GA 4ZTZB 1Y7IA 3O4FA 3JATB 1HDEA 2OEMA 1QGED 2NMVA 2CPFA 3RYFA 1IXZA 3CC7S 4ABYA 1HMVA 2RB5A 4TGLA 4FOTA 1I6KA 2PKWA 4YXWA 1W29A 2P2DA 5LDDC 4MARA 3LPDA 5A2QA 3SEFA 3FCXA 4WP9A 3DXZA 2PIIA 1ZI9A 4KKVA 1SV5B 3Q0IA 1CPYA 1GG9A 1XRMA 3ZX4A 1V16A 1LV8A 2OUGA 4AM8A 5JLJA 3OCWA 3HWSA 1VMDA 5H3CA 1TIKA 3QP9A 3X1XA 1HBOA 2W6JD 2VBYA 2NU7A 3W6NA 4XWGA 2ONJA 3T3PB 2EFGA 4F06A 3GQCA 4DIKA 2FQXA 2X13A 2KXNB 3W2TA 1V8ZA 3JYTB 1H2BA 5DHAA 4QBTA 1E1NA 2RDMA 3NBYC 4K0KF 1UT8A 4IQ4A 3ZD6A 2GX6A 2YKOA 4Y28C 4IIVA 1KEZA 2HT1A 1KAOA 4POOA 3AONB 2FP3A 5L51A 2OPQB 1PYOB 1JIXA 1Q8BA 2MZ1A 2V4QA 4RF4A 4MWEA 3U0BA 4UUOA 1NW7A 2LFVA 2NGRA 3WLLA 2IZ5A 2R1UA 3GB0A 1F60A 4X4RA 3I6IA 1SEVA 1RXYA 2V2KA 3GPIA 1MFPA 3M4JA 1NJZA 3GDHA 4Y0FA 1ZCFA 4KKXB 1MJHA 1GQEA 4NOMA 1X1EA 2ASLA 3Q5DA 1W34A 1Z2NX 2XMUA 1SA0A 5J5AA 1N1MA 3PT5A 4MW4A 4BXOA 4E1BA 2IV3A 5GMOA 1NQWA 3M9XA 4CRJA 3FUTA 3GJSA 1E9AA 1EUYA 1JHPA 5K0BA 1JLQB 5F3DA 4XR9A 4C4PA 4H4MA 3EFHA 1S9GA 3RUEA 3H59A 3SF8B 1VP9A 4DV4B 4IUYA 4M1SA 1D07A 5I7SA 3H2VE 3S0JA 3SLGA 4GXNA 4BP3A 4ENWA 3BTOA 1ISPA 4ETIA 5L3VA 4KOAA 3VYVA 2RGGA 4E13A 3RRHA 3ZE7A 4J9KA 4ODIA 2CV2A 1TEXA 1VG8A 3A6EA 5KT5A 1FTNA 3QGIA 1YE5A 3AJ8A 1C9KA 4O4LA 5ECYA 4DV1B 4QPPA 5HXAA 1JU3A 2IXAA 3VISA 4HVTA 2GN9A 1OX4B 1DFDA 2DB3A 4DKXA 4DX5A 1PNOA 4YI3A 1JFFB 2CVPA 3WR5A 3GRAA 3RSHA 3VR0A 4PY2A 1RMYA 4L7QA 1S1UB 3E9MA 3GLIE 3IBCB 1CZHA 1VCIA 3R7NB 1R43A 2ADMA 3R2CJ 5ALZA 1U0SA 5KFQA 1YCHA 3MJFA 2CWDA 4MS3B 2FF7A 1ZPDA 1ZWKA 4W5NA 2KHDA 3OOYA 2JBWA 4X61A 4MDYA 4U2EA 1CJVB 3PITA 3J81j 3FVWA 4OQJA 3HK2A 3MUMP 1RRMA 1TVKB 2E87A 2J9RA 1NKCA 5DNYB 2YJTD 4NBVA 4YJHA 2OA0A 3NOXA 3DOLA 3SYMA 5EJAA 3CUEF 1TO2E 2E49A 2N3ZA 2IEGA 3LLMA 1KFSA 5GPBA 5DO2A 2BCGY 2O1PA 2F90A 1FWLA 1IATA 2OHGA 4FDUA 1QZZA 1JKJB 5D3ZA 2JI9A 4RAOA 3ZHVA 5BYAA 3KOMA 3KZXA 4V19X 1W0JA 1POWA 4X8LA 2U2FA 4G3IA 3FCCA 4HP8A 5A9SB 1CP2A 3MAJA 3II6X 3ADAC 2MINB 4RZSA 5DWVA 2VHWA 1TP7A 2CXTA 3CVJA 4TKVA 3O7WA 3PFGA 2FCRA 3UDLA 3D67A 4G1IA 2M1XA 1XQ1A 1XXHE 1JEJA 5F3TA 1S0MA 1JR4A 2GCFA 3TM5A 3W04A 1JXVA 1JNRB 3CJ5A 2P67A 3G7NA 4C04A 3NAQA 1V9CA 1EKXA 2GBFA 2QIPA 3IRXA 3U7JA 3U3DA 3T4PA 4ZOAA 5IBPA 3RS5A 2PT0A 1YRAA 4UBJA 3PHLA 4FILA 2RKBA 1RM5A 1FVXA 4W6QA 3IJRA 1H1LB 3CV3A 2W7AA 3RHTA 3KQHA 2GN6A 4HEJA 2PBFA 2O1SA 4HNHA 4DDUA 4L27A 1RI7A 1RT9A 3TK1A 5IT9Y 2LLZA 1ANKA 2G9UA 3AM4A 4G89A 1FX0B 3T1YF 4Z1OA 1F9HA 2OCBA 5F8GA 3EZOA 2Y0CA 5FWXA 2OCGA 3QOWA 1F1BA 2QLMA 4TLAA 3VPFA 2C4WA 4ZYTA 1OYWA 1C29B