2Z34A

Crystal structure of spcia1/asf1 complex with hip1
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
159
structure length
155
Chain Sequence
SIVNILSVNVLNNPAKFSDPYKFEITFECLEPLKSDLEWKLTYVGSATSQSYDQILDTLLVGPIPIGINKFVFEADPPNIDLLPQLSDVLGVTVILLSCAYEDNEFVRVGYYVNNEMEGLNLQEMIKKVKVDISKVWRSILAEKPRVTRFNIQWD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone chaperone cia1
publication title Crystal structures of fission yeast histone chaperone Asf1 complexed with the Hip1 B-domain or the Cac2 C terminus
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Chaperone
total genus 27
structure length 155
sequence length 159
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04729 ASF1_hist_chap ASF1 like histone chaperone
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1490 Mainly Beta Sandwich Immunoglobulin-like Histone chaperone ASF1-like 2z34A00
5C3IA 3AADB 2I32A 4EO5A 2IDCA 1WG3A 1ROCA 1TEYA 2Z3FA 5BO0D 5EIIG 2CU9A 4RRPM 5BNXD 2YGVA 2DZEA 2HUEA 2IIJA 2IO5A 4ZBJA 2Z34A
chains in the Genus database with same CATH superfamily
3FQTA 1EMTL 4Z95L 4YHYC 1CXHA 1F2XK 2C9UA 1Z9MA 3A24A 4Y4HB 3N0AA 3NACH 4XP4H 1JGDB 1YNKL 4OLVL 4BZ2L 1I7TB 1YEFL 3LZRA 5KOVC 2WCPA 1H3GA 1KV3A 3EOTH 4XOEA 4WJKB 5IB2A 1A8ZA 1VGEH 3KYOA 4B0MB 1E9QB 1TVBB 2NY0D 2W95A 1KZYA 1MOEA 1KLGB 2DBLH 2Q6WA 1EXHA 1DQML 1ZHKB 2C1OB 2F5BH 4PB0H 5EEUA 1RK0B 3IN2A 1PFCA 3SB3A 4XXWC 3CDGA 3N6YA 4O5LL 1Q9KB 2Z8SA 4RETB 1M7IA 4JR9H 5DJDB 4Q8BA 1BYPA 3BJLA 3U30B 4AY0A 2X4RA 2CDFB 3HG1A 4P46C 1BFVL 3C6LA 1V10A 3EGSA 3QG7L 4WRLA 2HRGA 4QHNB 1CGVA 4HXAL 3SE8L 4RAHA 2V7NB 4N2IA 3T2PA 1J5HA 4FLQA 3DVGA 2EECA 3N04A 1XAKA 4PD4K 1FE8L 1L5GA 2CE6A 3QUGA 3N2JA 3PL6C 3U9WA 1FCCA 1CD1A 4N25A 1T89C 3T3MB 3X1FA 1K72A 3AUVA 3HS0A 3HLKA 3RUGF 2QHRL 3W1ZA 1IJNA 1CFSA 1QACA 2ZKHL 1XF5B 3KAAA 5FCUL 2BJML 1QSFD 1W72L 4KMTH 3KE0A 2Z92B 4JL1A 3TM6A 2P3YA 3FTXA 3RHWF 4HSCX 4LOEA 1G7IA 5DR5H 3GBLA 1SEBA 3Q48A 1QVOA 3SIKA 4NAJA 3HVDA 4AX3A 1YEKH 5DC9B 3GMPA 2VERN 2NNRA 2MKLC 3V5KB 4BBWA 5D7KE 2H2SC 2W38A 3WOVA 3F7LA 4P4KB 1KIQB 1O9VA 1TYJA 2QVKA 1KTRL 4HUUA 5T1DH 5JHDD 4P59L 3MUJA 3DDGA 4L4JA 1WZ1H 4WO4D 4BK4A 2AK1H 2XZCH 4MNGB 4OZHA 4S1DC 1K9TA 3AY4A 2D0FA 2EO1A 3D3VD 4M7ZB 5DHYA 1QR4A 2NT0A 4OCYH 4NQUA 1KJ3L 1MFBL 2EIDA 4K71B 1D9KD 5IHHA 4LIQH 4MZIA 3WKYA 1R24A 3OLIA 4A7GA 1MAKA 5BV7H 3IDGA 3MV7D 4N2LA 4LPVA 3B3IA 5BUGA 3H9YA 4XNXL 3ARDC 2WXFA 4G8FB 1BVZA 4WHYH 3RJDA 4HEME 2LU3A 3TFKC 3FPXA 4LSQH 4GAAA 1USQA 2H2PC 4LL4A 1YJDL 4QDGA 4Y2LA 4OZFA 5HI5C 5JR1H 1QFHA 3O6MH 5F7NC 4PB0L 1OD9A 3WL9B 1SFHA 5CIPA 1AO7E 5D7IA 4XHQA 3CQFA 1DO6A 1I1CA 4Z7OB 4X6DF 4DKFH 4G1EA 3VXPA 4R0LC 5FYLE 3EOBB 3QEQB 4NKMB 2FIRT 4MCNA 4QT5B 3S3PA 3QFJA 4ZO6A 3ZRSA 1HOCA 2ZPKH 3NJXA 2X87A 2AJUL 1GSKA 4MQXC 2WN3A 2Y7QA 4JQXA 1QYGH 4ONHB 4KI5E 5GJSH 3VWJC 4OM0L 1KPRA 3VI3E 4FNSA 4KV5F 4J3UA 3IGFA 1UD2A 5A2LH 4EUPA 4KI5F 2HX7A 2VAJA 4ETYA 2VRAA 1E2WA 3TO4D 3HCVB 4E9LA 3MBEA 2XPZA 5G5DB 4YSEA 1MJ8L 4A1RA 4JO5A 1JNNL 2VT0A 3RIAK 3ZHLA 3P77A 1X5LA 1FVDA 1MI5A 4JCLA 5DC2A 2BNRB 1IM3B 2XIIA 2XWZA 3RBSA 3HJEA 3FONA 3X1NA 2QHLA 4MJ2A 1U58B 3L7EB 5EC2B 3ZDXB 3IMRA 4L5FE 3D39D 1S7WB 4FS0A 2CJSA 3GXFA 2ZTBA 4M93C 5D70L 3VX0A 1SHXA 4QF1A 1RZPA 3UZQB 2Z1PA 2I32A 4J3XA 4UAHA 1P5VA 3QUMA 5I16B 1QABA 2GY7B 2VC2H 3VFMB 2WNXA 5BS0B 5E6ID 2BIIA 2J8OA 4XO4A 5D5MF 4MTMA 1U4FA 5GISH 1ACCA 1I53A 2BXZA 1HAUA 1M7XA 3FN9A 1JDDA 2KHAA 4NZJA 1FFTB 2XA3A 1FO0H 5BV7L 1Z3RA 4DO4A 3RTQA 2OSLB 5DZAA 5HVWA 4N0CC 5FCSH 3GRWL 2WTRA 4QTFA 2O5XH 4YXLL 1MCPL 5IBUG 3O3EA 4GO8A 1URZA 3CFKB 2MTPA 4Z7WA 1KB5A 3QZWB 2NUPA 1G7QA 1KT2B 4EI0A 3T8MA 2VXQL 1G9NH 2NY6B 3NA9L 5IBTL 5TPWH 1U6AL 3VFTB 3MV9E 4TNGA 3DX9B 3KPNB 4FXKB 5GGSY 2BNUA 1CTOA 4QRUB 3BSHA 2HT2C 1TUPA 1FIEA 4GY4A 4GRWE 5K9QI 4JZOB 1T1ZB 3P4NA 1JYXA 1D6VL 2P5ED 3S35H 2KI6A 4HV8A 3C60D 2NLJB 4GW1B 3I9GL 1XX9C 3SZKC 1UXSB 5GJSL 1SMOA 3MODL 5D4IA 2ZCKL 4E2OA 1RJYB 5HGAA 5F7EL 3CZFA 3BC9A 1PLAA 1E4XI 4ODBD 5F7WC 3D25A 4AVJA 2FGWH 2FVNA 5DDHA 4F8OA 1TQUA 4OGZA 5CP7A 3UGUA 2C1PA 4PG9A 2F7RA 3HR5A 5FYLH 5KVDL 3W9EB 4IGBD 4UQAA 2DMCA 5DD1L 4NHCH 1H8LA 1PBYA 1KJMB 2W9DL 2OXHB 2ZNXA 3P9LB 1GSMA 2OYPA 4WI3A 3WSQH 3GSWB 3RWDB 4IRZL 1MJ7L 5IQNA 3MRKB 1BBJB 1QASA 3QRLA 4OF8A 4UT7L 1EUUA 4RA0C 4G8GD 3FU5A 1MVFA 2B0SH 1KGCE 1NCJA 3WFBL 4QJ4B 1OE2A 2V8MA 1KNOA 4PBDA 1LE9B 4DKAA 3MFFB 4LCWB 1HQRB 3ZRFC 1IIKA 2IBGA 2YUVA 2VN7A 3E6FB 3ABMB 5T1JA 4YBHA 1CLZH 4L4TD 4RFOH 1OLLA 2FECI 5DYOB 2A0LC 3LNEA 4M5YL 5DRWA 2ADJA 5TDOB 2YO3A 1E5UI 2VLMD 3L48A 3L45A 3A47A 3DJ9A 1NC4B 1AKJD 3HAEA 4R4NC 4L5FH 1TTBA 5GJTL 1A3ZA 4Z7UF 1IFGA 4WI0B 1IKOP 2XWTA 3MLUL 1S5IH 3R06B 3KPRD 3I75B 3S37L 1DZBA 4DT2A 1WAAF 3MYJB 5BRZD 1PY9A 1UACH 1NWOA 4ZQTA 2O5XL 4R83A 4HS3A 1PFOA 1V3KA 3DO3A 3OAUL 2Z93B 1SYSA 4BFIB 2JB5L 3DK0A 1YQ2A 3E2HB 3WY3A 3K6SB 2A6IB 4LGPB 2VQTA 3PWNB 4TN9A 1ILUA 1ZGLB 2A74B 3QORA 3ES6B 3MV8E 3ROOB 4DKEH 1LXMA 4KZCA 2ZIDA 1F3JB 3D50A 3HI6H 3FRPB 2WLHA 4NPJA 2DDQL 4GQPH 2UXFA 1C9SA 1OWRM 1KCBA 1KSRA 5CD5D 4LLMA 2R0LH 1J9TA 1GAFH 2VL5B 4WUUB 3SE3C 4K7FB 4IIQC 2J72A 3NFNB 3PIQB 4WLCA 3F6LA 3LCYA 4LNRB 3UJIL 2ZXEB 1J48A 4YDVB 1D7BA 4R97B 4OBSA 1OCWH 5JW4M 3VSTA 1WWBX 2Y5EA 2NTSP 2NRDA 1TVDA 3DX4A 1QNIA 4IBZA 5AOMA 2O26U 1IGTA 4JUSA 5ID1B 4GRWH 3VNZA 1BQLH 3DJZA 2NSQA 1M6UA 2ZWKA 2EVFA 1JHKH 5INCA 4FG0A 3LQZB 4FC3E 4ZAKD 2HYMA 1WUNT 2QPFA 3KVQA 4QRQA 4P5KB 4YHPA 5DQJA 2YIHA 5BCAA 5EZJB 2QQNL 1XH3B 5IVXE 1OK8A 4APQB 2OJEA 1O5PA 4YZWA 3ASOB 3PHOB 4G9FA 4P07A 1NGQH 4RFOL 4PS4L 4B5ZA 4XNDA 5CJOH 3UPRB 3FTWA 3K2UH 5CILH 1XH1A 1J5OH 2ENQA 1FZOA 3LKSA 5SWQB 2VSDA 4MMZB 5F3BB 1Z9LA 2F8OA 2Q7YA 3NCCB 4AJYV 2R2CA 5C0FA 1Y6KR 3T0EB 3K2IA 4HQQH 3PP3H 3GHBL 3ILQC 1R19A 1S5IL 3KJ4B 5D2NA 4OFQA 1M7UA 4KX8A 1A9EB 5IMKB 3SE9H 3DTXA 1EA9C 1IVTA 3BRFA 3LZLA 1PZSA 5DJYA 3HKFA 1HCYA 1JMZA 1Y1DA 1W16A 3I3BA 5CXPA 1IX2A 4N0RA 1BQHB 1N8OE 3K5SA 4Z3EA 5F1IA 3L3OC 5SWSE 4DKEL 3VFRB 1AR1D 4F8LA 5FLUA 1FLRH 4OD3L 5D7HA 4XB3A 1Q9WA 2K3HA 4XNYH 2WQ8A 2WTPA 5D72L 5EU5A 1AGEA 3Q43A 5D4QA 3P3UA 5FX3A 4PH8A 5GRUL 1I4FA 1JE6A 2PPEA 1E65A 5DK2A 2OW6A 4QRPB 2R0LL 3RVVC 3L7EA 5EWIH 5L2KA 2BC4B 4M61B 1NJ9A 3GSQA 4JVUA 5E5UB 5DCCA 2EKJA 4UMSA 3TJPA 5IEKB 4I85A 3FTZA 8CGTA 3BKML 2H3NB 5H2BA 1H3TA 4KO6A 4PPTA 3UTSE 4KHTL 3VFGH 3AG3B 3FFCD 3O2DH 3WS3A 4W6YB 4IQHA 5L88H 1E42A 1UWFA 1T6BX 3OHXC 4ZXBA 3UTQB 3HKZA 2VMCA 3NFSH 4JO2H 2VJ0A 5A2BA 3UMTA 3LSOB 4UV7L 3SD5A 3SO5A 3T1WA 4QHLB 2Q76A 2X6BA 4HGWB 2O61A 2HT3D 2DLHA 1IL1A 1ZHNA 1ZA3B 4F15B 1FFQA 4FKEA 4OCWH 5I6XB 3V4PA 1OB0A 5DFVC 5E8OA 1ZPLA 3GJFA 2OMUA 1JXGA 3IT8D 2I07A 5CJOL 2MQ3A 4MMYA 1VEOA 5LQBH 3SDDA 3RFZC 3K2UL 2VISA 4X7TB 1WWWX 4J4PA 4R4FL 1J5OL 4HLEA 4M8VA 4HHGA 3MHZA 3DYOA 5LGJA 2P24A 4YBQC 4FQPA 4RDQG 5EPMA 1XGYL 4E5XB 3WIAA 4HC1H 2EDQA 4HDIB 2OA9A 5HHOB 3LIZL 3EUDA 4OI8A 4KRMB 5KVEL 4QHMB 1NFDE 3NPZB 5EA0H 1SUHA 4HGMA 2LU5A 2BW4A 3QUHA 5IMMA 1D9KC 4N8CL 4FFVD 4UM8B 2R27A 2V33A 3CVBA 3F62A 4UMGA 2FD6H 1HNGA 3WKQA 2GAZB 4EO5A 4JDTH 5D93B 1IAIH 3EXLA 3QZPA 1TLMA 2VLJB 5E1AB 1JMXA 1YECL 3HPJB 3AJ7A 2W60A 1D5ZA 1FG9C 3WENA 2B2XH 1WS7A 5GGQL 5D1XD 2A6KB 2HKHL 1NIBA 2FH6A 3I9PA 2R59A 2ZX7A 1JGVL 1IAKB 3IDXH 4LHQB 3P3YA 1V7NH 1DDHA 3BW9A 1EEZB 1AGBB 4X5RA 3AG4B 2HJKA 4JM4H 5EWIL 1S7SB 3RPIA 1XZ0B 5LG1A 5A7BA 4UTAL 4NC1C 1X7QB 2YEVB 4UOJA 3GS7A 3M7OA 4KQ3H 4FNLL 3OKNB 1CICD 1NDTA 2J5LB 2XN9E 5A2KH 5I66B 1EFXA 4KDVA 2JKSA 4XNQA 1LQSR 4XWOD 4ALAH 1EBPA 2TRHA 2X1PA 3JWOC 1FN4A 4D0BB 2PW2A 1RLWA 2HKFH 4WI7A 1UD4A 5L88L 4Z77A 4AVIA 3BZEB 3TO4C 4X99B 1F3DH 4JO2L 2OQJA 1DYZA 4IRSD 1OANA 3ZHDA 5D6CB 1OT2A 4GSRA 4QHKI 3G5VB 1IZKA 4WI0A 4WY7H 5CCJA 1N18A 1IBZA 1E28B 1KUMA 4FG4A 2CR0A 2GJRA 3BCFA 3MLWH 3DOHA 1A1OB 3M1CA 3RWGB 4UIKL 3CC5B 1UJ3C 1ZT4B 1ZA6B 2MQGA 4TM9A 1RIUH 4F7EA 2Y25A 3PWUB 3CXDL 4ODHL 3MUHL 5ALCH 4KJPD 1DUZB 3ARFD 4FQ2H 3JSSA 3CFCH 1E4XL 2AK4A 2FR4B 5GS0L 4J8RA 2PPFA 5EOCJ 3VE0A 2AXGB 5E6IC 2BY2A 4HC1L 1FVEB 6PCYA 4TUOB 3B2MA 4BKLA 1OSYA 1YLBB 2V3DA 1V05A 5DD6A 2DWTA 5HDRA 3QUYB 4JW3A 1T6WA 4KY1H 3L16A 4NT6A 2PABA 2OMTA 4XNZB 3UTTD 5K39A 3H3BC 3MO1A 1L9OA 4WSGA 4FQHA 2AJ3A 1Z5YD 3GXTA 4LNRA 1E5YA 1HC1A 2DYSB 2OXGA 2G9KA 3RDTB 5FO8A 4LU5L 3G9AB 4OCLC 4YAQB 1GW6A 3JUYA 4FA6A 3FUJA 1LNUA 3BLPX 4PW3A 2CXGA 4UT9H 2O5ZH 1MFEH 4TVPD 2XQYG 2UUDK 2GUOA 1FFOA 4PUBL 4PRHB 4QTIL 2VDNB 1CDYA 5GPRA 5J6SA 3QZWG 3RU8H 4LE8A 2XBZA 4QXWA 5D1QB 3LQAL 2GJ6D 5HPMA 4MDIA 3T5WA 3RNKA 1J7VR 5E9AA 4UDUB 4PY8J 2ERJB 1P6FA 2BCKB 3C60C 1J11A 1WS8A 3CIAA 3GK8H 4YHIA 1KCRH 3U48A 3W0WA 4NX0A 4ALAL 2JXMB 3IPEA 4DK6A 3HC0B 1QMUA 2HKFL 2W8CA 3EYQD 4Z7NE 2ICWA 1A9VA 3T0VA 4R26H 1R0AH 5ESAB 4U6TA 4FQ1L 2QADB 1DQQB 1U4EA 4L0ZA 3TVMC 5I1IH 3OHMB 3VJ6A 2DF3A 4XNMB 4WY7L 5ADOL 3T0EA 3BE1L 1FVCB 3S88H 5DEGB 4D8OA 2UWEF 2AJZA 2CKNA 4OLWL 2MNWA 4OV5B 3NSCA 1A7OH 3IFNL 2NR6A 4ZFZB 3CSYA 2B5IC 4N6RA 1HZLA 1SXAA 4NBXB 1ZE3C 4ZYKA 4NENB 2FIKA 4CW1A 4X7DC 2VW7A 1ZGLP 4HIHA 1S7XB 2FT7A 1JSYA 5DLML 4NQEB 1WIOA 1P2CA 2VZ1A 3EO1A 4A68A 1PGRB 1QRND 3B9KB 3D87B 3PDOB 1XB8A 2B3IA 2H3XC 4HWZB 5JW4R 1TOXA 2GSGB 1SQMA 1ACYH 5CNHA 2BCMA 3VXNA 4HALA 1AD9A 2JF1A 3CVHA 5I1LA 4H8QA 4IBSA 1FNLA 4QXTB 4X4MA 3MREB 1BWWA 3RGBA 1GGIH 2ZZUT 4UZGA 1PNDA 3DBXB 5E99L 2XT1B 3OC8A 4TLTA 2R4RH 3ARPA 3BO8A 3FTYA 4FTVD 2XX0A 2VMJA 5KBNC 4NFBA 2ENYA 5TE6L 4HOWA 3D3VE 3ESUF 2H4EA 4DQAA 3M07A 5K59E 1E27A 1I1YB 3BGAA 3OZLA 3D18B 3VFWA 4DP4X 5K59F 3WXWL 4FXGB 2FQGA 4P0DA 2O5ZL 2XWEA 1MFEL 3VNYA 3GZPA 4Z7QF 5E2JA 1NM4A 2ZOLB 1CFNA 4KQ4L 5I17B 1I9IH 1I8MA 2H5UA 1HIMH 2G9HA 1KN2H 3LSOA 1JGLL 4ZPVA 1JCVA 1SN2A 1ZSHA 1IEBB 1AZZC 2NX5D 5E9DA 4Z7AA 5IQOA 2QTVA 1AOZA 2C8NA 4CC4C 3NIGE 3Q6GH 3FUEA 1P1ZA 1HXYB 5CD5C 2XVKA 4ZS6D 4MS6A 1T66C 1SDAB 3GK8L 3D2UD 3FRPG 3OQ3B 4FYRA 3MRMA 1K6QH 1WFIA 4YDKH 1T0OA 3TV3L 4NRZA 2XG4B 4LZKA 4ANWA 3Q5OA 1S9XB 2ZWSA 4NC1E 3VG9C 4DEPB 3CU1A 5F7KC 3QRGL 1EO5A 4PWJA 5IEHB 1R46A 4YC2B 1RUPH 5DK0B 3RGVB 2F54D 4R5VA 5IB1B 2JE8A 1KTDB 1EGJH 1VGKB 3IJHB 1U92B 5I8KL 4HVBA 4MNQA 4X7SH 5HD8C 1IC5H 3ESNA 4MXWL 4EVNA 5IGXL 4W70A 2FBJH 2HT4D 2XXCB 5LN8A 1X5XA 4UQ2B 5I1AA 1AC6A 4AYID 1YMMA 4ZAKC 4FKKA 2KLSA 3D9AH 4C56B 3RPBA 2XCMC 2OSWA 2DJ4A 2YPVA 3WE1A 2P5WA 2V7HA 2B1OA 4ODWB 1J0YA 1V55B 4PSPA 4ZZKA 4TRPL 2GAZA 4CSPA 5B1JC 1UOVA 1W0YT 4UNVA 3NG5A 2X4NB 1LJMA 2EVHA 1F1GA 2P80D 4JL2A 4P2CG 5JW3H 2CH8A 1HHKB 4G7SB 4PJDA 4KROD 1IKNC 4HJ1A 1MLCA 4BWUA 2NZ1A 1TZHB 5LCVA 4K8RC 4F80A 3B9VA 1ZLWK 3SKJH 1AXTH 4B3EA 4G82A 3CLFH 1ED3A 4HJ0D 3HC3H 4GB9A 1X7QA 2NYYD 3IWUA 5HDBB 3DRTB 1DVFA 3H9HB 3O3BB 4GKOA 2OW7A 3B2UD 3SY0B 5MP6H 3WBDA 5DEZA 4XH2A 1U2CA 1GOGA 3H2QA 2WBXA 1L3NA 1F58L 4PJ7B 4EI5D 4QNPF 5F3HA 4GXUN 2WKGA 3O6FB 2JIXD 5FYJL 5F0JB 2OL3H 3DTDA 4FHBD 2ZXQA 2XZQH 1YMHB 4HAGA 1AR1C 3FZUC 4PJHF 1BQHG 2D31B 1ECZA 4NHUB 1QG3A 4OIFA 1NGXA 4M7LH 3GXDA 4DPAX 5IJKC 1U8KB 2VDQH 4M7JH 2J8UB 1UVQA 2NYKA 3K6NA 5EIQA 3H7BB 1MFAH 1MQ8A 2E9WA 2EXYC 4MB1A 3CLWA 3IDMB 3ZL4H 1ZT7A 1ZANH 2H26B 3ZQWA 2IPKA 2WXLA 2Z4QA 3KLLA 2CPCA 4QUOA 1JV5B 4JFDD 4KKQA 5DA0B 1XF1A 5L6YL 5DSCA 1AQKH 2XKUA 3L5XL 1MF2H 4FJYA 2Z1KA 3QUXB 1RKRA 2DM4A 4I3SH 5CLXA 1RUPL 3AS2A 3OTTA 5KYXA 5JO5B 1AG6A 4DW2L 4B9GA 2R29L 2DH2A 3RIAF 2B1HH 3IXTB 2WKLA 4X7SL 1RZJL 5K9OB 4ZUVA 2VITB 5CJXC 3LIUA 5F93C 3SKMB 1MRDH 3IETB 15C8H 4E41D 1Q4NX 2YKKA 1F42A 3KPSE 4PJ9B 3MGOA 4H1LB 4JBSA 2HT3C 4WJ5B 2UXTA 3EJUA 4G59C 5AOIA 1CF8L 4RGNC 2DQUH 2OMNA 2E6JA 2EDKA 5T33H 2GSMB 4YR6A 4AV4A 1UA7A 5IW1B 5GGTA 1T83C 1IJ9A 4BSVB 2BSSB 2VOTA 4XCEA 5EIIG 2F7PA 3JWOH 1IM9D 3BWAB 4WFFD 3ZKMD 1OAZL 1X5KA 4P3CH 1CR9H 1GPOH 2E86A 4PRPA 3BAIA 1T0NB 2KL6A 5DHVB 4BH7B 1A6AB 5C0AB 3ML9A 3Q8CA 3MRRB 4HCRA 2C26A 3TN0B 3U9UA 2EIZB 3CLFL 3VSVA 4L4TE 4ZNEA 1QFUL 3STZA 1N64L 4E5XG 2ZF8A 4Y2DD 3I50L 2A38A 1MZZA 4EBQH 5KS9A 2G4GA 1MCJA 3IDNB 3TZVB 4FFVC 2QDVA 4GG6E 5GSRA 2CD0A 4NC0B 1P7QD 4M48L 2P49B 1TQBC 3QIBA 2QEJA 4WQOA 4GQ9L 1A14H 3J27A 4PV9A 3KPRE 4DKDC 3EJRA 5FF6A 1NKRA 2CKBA 4RAVB 2WBJB 2XZQL 1MCQA 5EUKB 4ES9A 5BRZE 4WW2B 4OZIA 5TK4A 4X7FC 5CR8A 4M7LL 1ANUA 2V5SA 4M7JL 5D1XC 4EEEA 2VDOL 1QO3A 2NY7H 4V1DD 1CTNA 5HHME 5F1NB 3ZL4L 5CHNB 4OTXL 2H8PA 4JQIA 3L17A 1WCBA 3I6SA 5B38A 2IGFH 4XPBH 4P5RA 2XXGA 4NQDB 4LLVA 1VZIA 1L0YA 4ZFZA 2PPAA 4AQ1C 1S78C 3DO7A 4E9WA 4FFYH 1VAHA 1CICC 2FX8L 3T2QA 4AJWA 5DQ9B 3RVUD 5TE4H 4AXWA 1A02N 4LLDB 2NNFA 4XWOC 3T08A 3C6SB 4NLHA 4LCIL 4PJCB 3FUNA 1G7HB 3L4VA 2C3XA 4W1TA 1HINL 2OMZA 3FC8A 3ARSA 3LB6D 4Y4HD 2AC0A 2X05A 4KOCA 1UB5B 1JZFA 1FL6A 4IRSC 3FQNB 4NQSB 5A3IC 4WV1B 4ZX5A 2RGSA 2BPBA 3R19A 1DR9A 1S9VB 5TF1H 2H9GB 4MA1B 2GK0B 1U3JA 3LXAA 4AGNA 3GO1L 2LOEA 1B0IA 2DQUL 4TSAH 4HD5A 4Y2NA 2M83A 2VXSL 4JFSA 4NNXB 2F1AA 1HEHC 4F5CA 4ELMA 4F7MA 1YYCA 1RPQA 3FU7A 4YZFE 2K0RA 3ARFC 1QLEL 3QR1A 1D6EB 3UJJL 1AGDA 5B3SB 1F4XH 2Y4SA 3STBA 1E40A 4F7KA 3BXNB 4PJIE 3VFVB 4Z76B 3EH2A 4BUHA 2A9CA 4PJIF 2EQDA 4LVEA 5L8JB 1EDHA 3ZQXA 3BVDB 4PJEA 1Z5HA 4YPGB 3SKOB 2BINA 1BVNT 1MHHB 2AJYL 4DTGL 3ARGA 1KC5H 1V7ML 4IEFB 4KUCF 1YZZA 3RZWA 3NP3A 1E3FA 4M4RA 1A14L 4WI9A 3U9PH 1MHEA 1ZE3H 3IJYA 3VWKB 3VCLA 1AQ8A 2YXVA 2XG4A 5E8EA 4DVRH 3QNXB 3U4EB 1HHHB 2L7QA 2BVOA 6TAAA 1IQDB 1KIPA 2ZXCA 3V6FB 2J44A 3VI4E 5I18L 1UYWH 1E9PB 3O9WA 5CO1A 5LBGA 3VI4F 5CCGE 3H0TA 3DUSB 1I7UA 3TC9A 1ICTA 1HKLL 3ISWA 2YPLB 1J8HB 1LK3L 1RHHA 3C5JB 2WAHA 5KSBE 3FSVA 1ONQB 5DJXB 5KUKA 3MNVB 4ZSOE 1SYVA 4U1SA 5KSBF 2GY5A 5T1MB 5TE4L 4P4KD 4U3SB 4WNJA 1WHOA 5HDLA 3B83A 3E8UH 4Q52A 1QOKA 1U8OB 1MAJA 2XG5A 2FLRT 2GTZB 3PAZA 2BFVH 1ZSDB 5TDNB 2VLKE 4TNEA 4J8QA 3EYQC 5E4IA 1INEL 1U3ZA 5EBGA 3VRIB 3UMNA 3CQPA 4U33A 4BCZA 1CBVH 4N8VB 4JFXB 1TEYA 3E8VA 1BZEA 3CVIH 2ZYHA 5TF1L 1HZKA 4XMKH 4JN2A 2IGTA 2AQQA 1JPST 4AKPA 4TSAL 1U8HB 4GEIA 5GZND 3QRFM 1I1FB 1J9SA 1UQSA 4P2QE 4QY8A 3HE7A 3RA7H 2Y1VA 4TUJA 5JIQA 2KMWA 5CF3A 1AQHA 2NY5L 1Q0YH 3MUGA 3QNZB 3KR3L 4AK1A 4B7IA 4F9LC 1JN6A 2KKQA 3V79C 2LE9A 3QEQD 4RGNE 2CUHA 5F0MB 3C9NA 1A6VL 3V0VB 4KFZC 5E51A 2AW2A 2HLEB 4PS7A 4XE5B 2EE6A 3FQUA 3JV6B 2J1WA 2Q87A 3SGEI 2R7EA 4C4BA 5DWUL 3DC0A 4YO0B 1S8DA 3MJ9L 3QA3B 1DVXA 3GMOB 2E7LC 3IDMA 3LNHA 5CBEB 1JV5A 3STLB 2QGEA 5J6GA 4HFWB 4OKDA 3MLYL 5AYUH 1FIGL 5K1JA 3LKOB 1J9QA 4N2NA 1TJMA 2V8LA 4YSQA 4HUXA 3CWGA 1HNFA 1G6RH 1R34A 2WCSA 3RI5K 3L3HA 4WCYL 2Y7OA 1X5YA 1ZTXH 5DMYA 2C9RA 5HHXH 2BNRD 3FT4B 1IM3D 3ALWA 3QPQC 4LLYA 4OZGB 5JQIB 1FAIL 3NCBB 1UT1A 1UYWL 4HOZA 2HCZX 1FJ1A 2JCCF 3AROA 2DI8A 4M8UA 4HUKB 1ES0B 2JKJA 3LKRB 5DI8B 3LJ3A 5KJRH 5DMKB 4QI3A 1DJHA 4FNTA 4QXVA 2X9WA 4RNRB 3NN8B 4H1LA 1XD0A 2FHCA 3GMMB 3U4KA 5KSAA 5D1XE 4TSBH 1CJYA 3HC4L 5BS0D 4GQQA 1ZLDA 3HPLA 1PYWB 1VFBA 5I30H 3MSPA 4JPSA 2BFVL 4WFEE 2F53B 1GVIA 3UYOD 2FLBT 4UBDD 2PWHA 4ANVA 3ZIMA 1B0GB 1TG8A 3V8OA 3U7YH 1TYRA 5CUSL 1X4ZA 2AXHA 4FEIA 1CBVL 3ZYOA 4R9HA 2WZPA 5DHVA 5MEPA 2KT6A 5D2LE 1BMZA 2PCFB 1V54B 2XPGB 3FRUA 3HUJE 3LS5H 5L0QB 2RACA 1I3RB 3QO1B 2CO2A 4FQQB 4OD2A 4PJAE 3WEXB 1JZ4A 3HUJF 2GSIB 2AP2A 3FSZA 2Y1ZA 4MMXA 3KYAA 3VXOA 1H5BC 2AKRB 2J1ZA 3KD4A 1UC6A 1TPXB 3QQ4A 5SWZB 2WLYA 1CURA 4TLKA 4GH7B 3ULUD 3FUIA 2ICEA 2NY6D 4NDMA 4X5LA 3KPOB 4K23L 1HZHH 5ABZA 3P4MA 3C8HA 2BP5M 4A2HA 5ECJE 2MPAH 2JQZA 1B9KA 3ZO0A 4M6OL 1OE3A 4EIBA 2HX9A 3O45B 5JOEA 3FHAA 4AL8L 3HHRB 4ZPTA 2WUBL 3SZ6A 1YEGL 3IPBA 1SVBA 4M1DH 5CFHA 2CHXA 1JXJA 3VXMB 4UAOB 4OJEH 4KKCD 4M7KH 2NYYC 2OP4H 1CLVA 1NPUA 3TT3L 5IW6B 3B2UC 2EDYA 5DQDH 4RRPG 1AMXA 1ZTXL 3OJ2C 1PSKL 3KZ8A 1ZV5A 4LVHB 4X6CB 1JYWA 1CO1A 3X12B 5L2JB 4EI5C 4R3SA 2AJVH 4HEPA 3SKUD 4ZI8A 1YCSA 3UTTE 4KJQD 1IEHA 1FHNA 1CGWA 3OKEB 1LWJA 4JHAL 1DQVA 4ZT1A 3V4VH 1NIDA 3P0GB 1TCMA 3PJSA 4XMWA 1T04B 4LCWD 3G5XA 3FU9A 1BVLB 1UA6H 2P7TB 5PAZA 2P47B 2G2RA 2FHFA 3GLEA 2DBJA 5IFHH 3TBTA 2ZNWA 1HNYA 3N44F 5AW0B 5H4ZA 1HHIB 3U2JA 2JKRM 4O9HL 4PJXF 5DTFA 1TJIH 2EDBA 2E9GA 4L9LC 5ESVB 4PU2A 2IAMB 3FN0H 3NIDE 1JERA 1I9JH 1PX4A 2GJ6E 1NC4D 3U7YL 4ADGA 4L8CB 3JTTA 3US1A 3MRIA 3F01A 1KB9J 1LO2L 1MWAB 1K2DB 1UM6H 4PWKA 2FL5B 5FWRA 2FWOA 3TTYA 5JZ7D 4M8QA 5C0BB 2ENPA 2ATPB 4ZDHA 2OFQA 3WAJA 5DJ0B 3PJNA 4PGCB 4PV1C 1CIUA 5FOBB 2HLAA 3WIIH 1EXUA 1OTSD 4XN2A 4YLCA 3VQMA 1VFUA 1R3HA 5IHZA 4N28A 3NABL 3IGLA 5KYWB 1HZHL 2X12A 1LEIA 1XR8B 5FA4B 1YN7B 5LHDA 3A67L 1V5JA 3ZE0F 1T7ZA 3HG2A 3L9BA 5FGBA 3U4EA 1O7SA 4X98B 2YFOA 4Y89A 3EH3B 4XXCA 5IM7B 1QZNA 4GP8B 3QIWB 4KKBC 2YLKA 2HUEA 2B7DT 2DQHH 1TXKA 3ZKMC 4LCCC 3EJSA 3FBKA 5EF2A 2CPUA 2EDRA 3QI9A 1IKFL 3MI6A 4OGYL 5DJZA 4WUUD 5JPNC 3PABA 4P2OB 2YXWA 3FQ2A 5HBBA 5HYJE 4FL4B 5JW5A 3FO0L 2DLIA 4Y2DC 2ADFL 5BO0D 1GHFL 3PWPA 5C97A 5AUMA 2VR9A 4DF9A 1QFWM 1Q9LB 4GT0A 3LXUX 1Z9NA 2UWEA 3CN0A 3QJRB 5GRVL 4C54A 2AJVL 3GBNL 4X6BB 4XX1G 3G04B 3K72B 4OGQC 4S0HA 4W9CC 2F61A 4HKXA 3F00A 1QEWA 4FTVE 3DA0A 5HI3D 1NSNH 2H0JA 4N8VA 3V4VL 1MN4A 4IBYA 5FIEA 4KKPA 2XLLA 3IE9A 1AH1A 1X5AA 3QSKB 1T5WA 1YEDA 4APQD 1SJMA 3GKWH 3I6KA 4L9DA 1KIUB 3SCMD 4Z7VF 5E95B 3BVNA 4HPYH 5C3LD 2E4FA 1K4CB 3QEHB 3KLQA 5I15L 4S0SD 3RAJL 3QC5X 4X9HA 5DRNA 5A6MA 1KTBA 5CD3A 2P1YA 1I9JL 2WIIB 2NX5E 5DS8B 3RVUC 2F08A 1PW3A 1I7ZA 1UURA 5F72S 2CJUH 3N55A 3P0VH 4XCCL 1CDUA 4X83A 3DECA 4HIXL 1E4HA 4YXKH 3TBBA 4Y4HC 2E8YA 4JRYA 1GJIA 3IGUA 4LSUH 3MCKB 1NCAH 3UYRL 3BAXA 3JVGA 2G0LA 3WIIL 5T5FH 5IMLB 3VQ2C 5EIVA 2ZOKA 4PJ8A 4D7PA 4FCHA 4AM0A 1TQWA 3QQ3B 2X4QA 1EERB 1NDGA 2I7SA 2XN1A 2EDLA 5E6ZA 4GLRH 3NGBB 3ARBC 4LNVA 4NJ9H 3GUTB 2WXPA 2A5UA 2BNQB 1KDIA 2EICA 2YAEA 4F3FB 3HE6B 1E5CA 5DF0A 1S46A 1ZLVK 3W57A 2NSMA 4LRNH 3PLYA 2DQHL 3CCHA 1TU2A 3ZYIA 4JY4B 4QRPD 2WWMD 2AHIA 3IBEA 4RSYA 1S3KL 4W9FC 2HPTA 3D4GA 4ZD3L 3U30C 4EIUA 3QYMA 1F45A 3JV0A 5DI8A 3FO1A 2OZ4H 4IHOB 1ZEAH 4AMKL 1CL7I 4N0UB 2F15A 3AREB 4V2BA 4X6FA 3U36B 2QLVB 5HJ3A 3VD3A 5DJAB 5J3HC 2EXSA 5AKVA 5CSZA 1OB1B 1H6UA 2AV7A 5H37A 4IRJB 3B7SA 5HP5A 4POZC 1CGSH 2C3WA 2DLFL 4X0KB 1FH2A 1FORH 1M7DA 4Y9GA 3JT2A 3H6JA 1OAJA 4S2SA 3HNTL 4KVNL 4NO0B 4I48B 5LAXA 5BVJA 1AZCA 1N2RB 1ZIBA 3MKGA 4M43L 4UINH 2H41A 4PJFF 4PRDB 1MCKA 1XR9B 4FYTA 1M6OB 2ZCHL 3AM8A 3L4UA 3OKOA 5GGUB 4W68A 1XF2A 4L2YA 4OGAD 4FQQA 3LPGA 4RMBA 4HF5L 2BOBB 1FGVH 2O5YL 1OGAB 4MD0B 3LMJL 1F1DA 1A1MB 5GGRA 1M4KA 1PIGA 4D0CB 3M1BA 2JELH 3P69A 1LMIA 4MX7A 1JHLL 5HHOD 1RZGB 3PXJA 1IT9H 1BVKB 4IS6B 4KAQL 1CLYL 3CX5J 4JFDE 1LP9B 4DVBA 4S1QH 2YBRA 1WHPA 4POUB 5LXGL 5DZPA 4HUWB 1MVYA 5I0WA 4K71C 3O45A 1N12A 1TO5A 1EAJA 4FOMA 4P3DB 4TVPL 3QCUL 3IDJA 4H44C 4AQAB 5AB2A 4HJEA 5I1CL 2A83B 4LEXH 4J3VA 1DFXA 4XO5A 3ZTJG 1JPEA 2E7MA 3QJSB 4Y5YB 4XBPA 4RMUA 2W0FA 2VLJD 4Y16A 3S3JA 3WNOA 1NCGA 3GWJA 1BF8A 1DVTA 3O3UN 3P9MB 2X10A 4E41E 2BY1A 2XVLA 3C2AL 3O8XB 4I2XA 5GSVA 3V7AG 1FLTX 3GSNL 1L0QA 3OWRA 5K5YA 1NMBL 4Y4FA 1WFNA 3BPLC 4A37A 2B9AA 3S7GA 4MA8L 4GAJL 5TFSL 2OZ4L 3GZOA 3ZKSD 3QUZC 4UUJA 2VXVL 1UM4H 1ZEAL 3E9TA 1BVLA 2LABA 1KPUB 5BZXA 5GIRA 2ZP9A 4HZ1A 4WFFE 1FG2A 2JI2A 1UCTA 2IH9A 3N3EA 4ZUSA 2Y1YA 4G6AC 1P69B 2JJWA 5KVFH 1GZHA 3QH3A 4GRLB 1NGPH 4X8GA 5FA3A 2D0HA 4I0CC 2F7IA 4UINL 4OUOA 3L3KB 4BFFA 5CINL 4C4KO 1TJGH 4KTDH 2VDLH 3ZRCC 5IFJA 2E3VA 4MJ4A 3VFNA 5DJ0A 1WBYB 1I3GH 1U2HA 3IAQA 2DQCH 3V7MA 3SN6N 2R2EB 4L8BB 5J4MA 2PW1A 4KC3B 3M17B 3F65A 4V1DE 4BFRA 1EXGA 1TLKA 3C5XA 3SDAA 3U83A 1JK9A 4F7PB 2V5YA 2UY7B 5CCKH 3MU3A 1G7PA 1IGCH 2R56H 4DZ8A 4P23B 1IT9L 4U6HA 5I1HL 1F6LL 2GHWB 3REVA 3QUYD 4UBDC 3FF8A 2K7PA 4G8IA 3T0DA 5G4OA 3VXTB 2M1KA 5J12B 5J1SC 4KTGA 1IC0A 2ED8A 4UM9A 1FV1B 4HKZB 4FA7B 4YMPA 2Q86B 1D5MB 3INOA 3EYFB 3U0PA 3HJ0A 3BIKA 3TCLB 1UCBL 2I24N 3A23A 1Y18A 3QBTB 4L3EA 1M05A 2PP9A 1RUQH 3PGDA 2ZX5A 5C92A 3RDTD 1U8CB 2CUIA 1XGUB 1U9KA 1H9VA 3S34H 4B9KC 2X4UA 3NJKA 1XD1A 4IW4C 2FJFA 2N0KA 4JN1H 3S4SB 2XI9A 3LDBB 3Q2CA 3E1F1 1LD9B 1T0MA 4YHKH 3OJVC 3BFOA 5IJVB 3LNGA 3ULUC 5FS5A 3FT2A 4PRHD 2FDBP 5BO1H 3KPLA 1YYMH 3NZ8B 4M56A 4FXKC 2YD6A 5D1QD 3RWIB 5CJQH 1Z9SB 4NXKA 3RP1A 3WKNA 1TZAA 3NCWA 1OEZW 1XGRA 4Z0BH 1PZDA 4PGEB 1BX2A 3CN1A 3LHPH 4JHZA 3IFOA 4BZ1A 1DBBH 5JPMA 1RJCA 1VRSA 1FYTA 3NJNA 1XCTB 4TUUA 1ZVYA 4JFQA 5T3XD 1MQKH 1U8PA 2J3SA 2JLLA 4ZUTA 1JRHI 2WXGA 1ZXQA 4KHXL 3HVNA 4KKCC 4BQ6A 3AXLA 3SDCB 5KVFL 5C1MB 4L4VB 2CIKA 5GRJH 2QADD 3ROLA 2Y2YA 1BZ9B 5ETUB 4Q6IA 4F92B 3TESA 4WU5A 5KYNA 1QBBA 1ZLUH 5T3ZE 1UZ6E 4N2FA 4PJBB 4JJ5B 1M57B 3AZUA 3OB8A 2ESVB 4KJQC 3LPOA 3MRHA 1UZ6F 3RVWC 1THAA 3R0MA 3TA3C 4LVNB 2NY2B 1OSPH 3SDXA 3G5WA 1BZOA 1UM5L 1CFQB 1FL3B 3BSGA 1VPOL 3T8VA 3BP4B 3BUQA 2LU7A 4WIQA 3ULVD 1WBZA 4LK4A 5ICYB 4LLQA 3MOBL 2IXQB 4NQED 3GI8L 3B9KD 4D9QD 1U2YA 1P84K 1KELH 2VLLA 3PWJA 3CUPB 5C2BH 4HS6A 4F9PC 4HPHA 2NNAB 3BAWA 3KL0A 3RGHA 3KJ6H 4ZOBA 5FM8A 1W8OA 1W0WB 3MRGB 4U3CA 1KPVA 3WKMH 1Q9OA 1KG0B 4OT1L 5HHVH 2EO9A 1RUKH 1DCEA 3RWFB 3EAKA 3SD2A 5BQ7B 5ID0A 5MENA 1BD2B 2MCMA 4E9YA 1S9WA 1A7NH 2E27H 2HFEA 3BDYH 4Q0XL 4P2AA 1V27A 3QDGB 1QA9A 2KPNA 4Y1AD 3LEVH 1OW0A 2P8LB 4P06A 4A67A 3IM1A 5JZ7C 2WXOA 3DMMA 4JM2A 4MNGE 3UYPA 1JZ6A 1ECYA 5GRVK 1G5GA 4N0UA 5LXVA 5H94B 4FQXA 2E8ZA 5E03A 3MV11 2HB0A 3OAYH 2WQAA 3E2HC 5KYYA 1SJEA 1HXKA 4YHKL 3MUUA 2YC1A 4XXDB 4UZSA 4RA3A 1E67A 1PL3A 1FGNL 5DD0L 1FF5A 4ELKB 2X0VA 4B9ZA 3G6JE 2ATKA 1IIIA 4ODVL 5EO1B 2FYYB 3FO9A 3LHPL 3BKYH 3G6JF 1TTCA 1DBAH 1GIGH 2VNCA 4JX0A 3TYGL 2APFA 5BJTA 1W9XA 5E5LA 1B2WH 2DEXX 4Z7OE 1MQKL 4PW9A 2WW8A 3QEQE 1PDKB 3BESR 5DUBB 4C4UA 3GSVB 1DJYA 1WIPA 3EYOA 4BZ2A 5HHQB 5MEOB 1LL1A 3NA4A 3RGVD 1MCOL 3HAEG 1BG1A 2LU4A 3WTWA 3PPSA 5A2CA 2K6YA 4DO6A 3N41F 2A9BA 4PRIB 3RUGB 1B4JH 3CFJB 2F68X 1FZKA 4N90D 3NUKA 2DIAA 2P46B 1FNEA 2YD3A 1KCUH 5HYQA 3WNLA 3THMH 1RZFL 4U1KA 4C56D 1CDCA 1VDGA 1WITA 3AU1B 3N1MC 4GKSA 4I1PA 3J07A 4C4KT 3BPOC 3PREA 3OKDA 3UDWA 1HEZA 2DQGL 1S9YA 3M8OH 1NLBH 5HGDA 4APQC 1T1WB 5BZWA 5KYUB 2X4OA 1CL7L 3F7VB 1UA3A 4HHWA 4O2FB 3SCMC 3ZDXE 4XC1H 1N5YL 3TJHD 1YUHA 3IJEB 1BZ7B 2R1WB 1ZJBA 4I18A 3C2SA 1L9RA 1KB5L 4Y9FA 2A6JA 3DX8B 4Q9BA 2J12B 3QIUA 5IWLC 5IOKA 3SDYH 4NNPL 4MMZC 1VACA 2DM3A 5LKNA 2YMTA 3RX9A 4HSAC 3KJ4C 3QEGH 2DICA 5BS0E 2A73B 1IBHA 4I4WA 3KW8A 3EO0B 5DJ8B 3WHXB 5ISZA 2X7LA 1SDDB 3L9RA 3GM8A 4JPIA 4M1CC 4RESB 2Z35A 1VCAA 3OZ9H 1R5WB 4RBPK 3QQNA 2V0AA 3D08A 3CXFA 4UILH 2X2HA 4UWQB 1SMDA 1N19A 2MEJB 3O6FD 4DUVA 2HAZA 1JK8A 1KXHA 5GHWL 4UYQA 5A2JH 4F8PA 4X6DB 5EEYA 2B1AL 3X17A 1FBIL 3QE5A 4LSSL 1LE5B 2WZ5A 2GTWA 1THCA 5I8OH 2XTJB 2XWBA 1NAKH 4P5MB 1KYOJ 4PVLA 4F2MA 3D30A 5AAMA 4YK4B 3ULUE 4KITB 1YPZA 1B2WL 2PWDA 4JUTA 3BQUB 4Y7MA 1JWMA 1Z7JA 2HRPH 4XRCA 4GT7A 4BH8A 1A4JA 1MJUL 3QUXD 5AAPA 4WWKA 2QKIB 4XCFH 2XNAB 1O6SA 4ETQA 2XFXB 1QD0A 3SQOL 3C12A 3L8QA 1EZVY 2E59A 4JFPA 5F96L 1MIEH 4QEGA 4R2GB 4F7PA 4NO3A 1DBKL 3SPVB 4P5TB 4L8SC 4A6YH 3RI5F 2VERA 1M2OA 2PYEA 2PXYC 2PTTB 4JY5H 1XGTB 3O4LB 3EO9L 1TMQA 5EUOA 1PZUB 2VUYA 3T65B 1I85A 43C9A 3TF4A 4PJ9D 1KCUL 2J71A 4TULH 4ESKA 4N9GB 2AV1B 3QO0A 5C07A 3WCYA 2V17H 4P4RB 1J1OL 4ODXB 5AYTA 1GY2A 1KTLB 1E50A 3CSGA 1SDYA 2YUZA 3BZ4B 2EXWC 3AY2A 2BVPB 4GAYB 4PBWD 1PG7W 4OLYL 1NOLA 1BOGB 1M71A 3B43A 1SJHB 3CK0L 4TKWA 4UQDA 3WJLC 5JOFB 3BH8B 3CFDA 1J10A 2A9NH 5C0CE 3IK2A 1K8IB 2ICWI 3FQRB 2CDGB 4P8QA 1CD0A 5D5MB 4YHML 3CXHK 1U30A 4ZFOB 5C0AD 2ZWYA 1EV2E 2GJJA 3LD8B 3TN0D 1SJVA 2YR3A 3KDMB 2PWFA 3T77A 1SF3A 3ZDYE 1W6LA 3OPZL 3TIEB 1LTXA 1MEXH 3CPLA 2IWGA 3U7AA 4F58H 2YOAA 3O6KL 4FG2A 3ZDYF 2NY3C 3VFOA 3TZVD 3VD2A 4W4OC 4UNUA 3B5HA 4XVUC 5T1LB 5JMRA 3T0XA 2BVTA 4BFGA 4FDWA 2V5MA 4ACTA 2WBJD 3WNJA 5IIEA 2UYLA 1G94A 2BP0A 2RHEA 3T4YB 1IAOA 3VFSB 5T5NG 4Y4KB 3QP3A 2YRBA 3X14B 3MV9B 1CE1L 1JD7A 1AHKA 2Q3XA 1Y0LA 3RB5A 3U1SH 4NQDD 4W9LC 3NJIA 3SPCA 3X2QB 1YYLH 2OPCA 1EIBA 5AB0A 1ZRUA 3BHBB 4WNSA 3BYTA 2F1BA 4KGLA 1MCLA 1QPKA 2YEZA 1R5VB 2BW5A 2DI9A 3QFDB 5F7LB 4K7PL 2H0PA 2EIEA 4J3SA 4TPRL 4MAUH 3DUUA 1E4WL 2BMKA 3FH8A 1R5IA 1E8WA 2PYFB 3C5ZA 4FABH 1CGXA 2IH3A 3GRWA 2O72A 4JKWA 3V6OA 1HHJB 2HWZH 4PWIA 1C8PA 3ULUH 4AW4A 2DLTA 2VN5A 4KZDH 4TULL 5E6SB 2Y07L 4XN8A 3KG5A 3TIDB 5JQ6H 5D7JA 2P8PB 2JKWA 1CC3A 4NPKA 1PIFA 5DUMH 3PL6B 4XCNA 2YKLL 3BEVA 4M6MH 4PSRA 1UUNA 4G6JH 4BE5A 2AAVA 3NZHH 2EIJB 2PN5A 4KKNA 2F6AA 2LQRA 1MJJB 1CDIA 3HR6A 4WI6A 3BKCL 3K2KA 1JRHL 1WCQA 2EXTA 2W07B 2HLFC 4Y8DC 4DN3L 1N9PA 1GW0A 4GMTH 3D0LA 3O2WH 3JTSA 1OP9A 2JK5A 3RWJB 4KK9D 1G9ML 3MJ8A 1XIWA 3HRZA 2IH1A 1QHPA 3V5HA 4Z7UB 1A64A 1MRFH 4NZ8A 3QUYC 3B37A 4V33A 4F58L 3AAZA 5IJDC 3K8LA 3F05A 1XT5A 5F9JB 1NFAA 3WJJA 4LLWB 3H9SA 1YEEH 4ZFGL 2X1QA 4LT7A 4JZJA 3DOIA 3C8DA 4GSUA 4Z5RA 1N7MH 1QATA 4K3DH 2HJLA 2R4SL 3FFDB 3GPSA 3L3DB 3TPUB 3VWKD 2WINB 2CJ3A 1KEGL 2HTLC 2VQ1B 1EFQA 1OGTA 1XDTT 3RDTC 2EP6A 3FUMA 1NC2A 5MEOA 4DPBX 4MS8D 3EZJB 1N0LA 2ZSWB 5FB8B 4F8NA 3ZKXB 4X4XB 4NUGL 3ARDB 4JG0H 1RJZA 2IPTH 5IK3A 3WS6A 4G7QB 2VAAA 1GGBL 4OF0A 2J5WA 4YHNA 4MB4A 2Y5TB 1T7YA 3UFIA 3S4SG 2ZE0A 4N3TA 5D1QC 1QNZH 2YPLD 4WUKH 1HSAA 1J8HD 2FHBA 3CSTA 4MKMA 3CHRA 4LP4A 3I2CH 5C0JB 1BFOA 1G7LA 1KCVL 4Z8FH 4R0LB 1U8JA 1FO0A 3V4PL 3LVTA 1P9MA 4QRPE 4DH2A 1PLGL 3MRDA 5EO9B 4RWHA 3TBCA 2B14A 2W94A 1VLXA 1X5HA 1WEJL 5K93A 1PZBA 2DQJH 1NMCC 3VTAA 2E74C 1A6WL 2D7TH 1J8RA 1J1PH 3KNBB 5JQ6L 5DMGC 2L3BA 4PRBA 4IK7A 3MRNB 5FHAL 1QKZH 4JO3L 1XXDC 1UKQA 3FN3A 2CNYA 2VM4A 1AXIB 1QBLH 1ETJA 1EDQA 3M86A 5BUPA 2WXHA 5KSVA 3QZNA 5E2UL 4DK3A 3K8KA 1R5WA 4OFYA 4HFUL 1RZIB 5IV2B 1MW3A 1U3HA 2WC7A 4LSTH 4KJYA 4MCYA 3SO3C 4A2GA 3B9KC 1ML0A 1PU0A 4URTB 1IBGL 2J43A 3K71A 3LH2H 3CMGA 4L3FA 3BDXA 5FO9A 1WVZA 4LRIA 4M93B 4KTEL 3I3EA 4G6ML 4GS7B 1AO7A 3IJ7A 1F5WA 4BFJA 7FABH 3EF7A 2LVCA 1H15A 1QBML 3KW7A 5FEBA 3EBAA 2RA1A 1A1NB 3GLAA 3VD1A 4NNYA 5C0IA 1JDCA 4QPEA 1A6TA 4FAAB 1T3FB 2X89D 5SV3A 1AS8A 1OCCB 2FO8A 5HJBA 5HHOE 4OFIA 3APFA 2P5PA 3OR6B 4RFEA 2KH2B 2R1XB 5FFOA 5FUZL 5IUCA 4JO8A 3TXAA 3QJXA 3WMPA 3T3PF 2R69H 1DQLL 3VI3A 2Y36L 3US0A 4PJFA 2WKOF 4FZEH 4I0PA 2XN2A 5EC1A 5SWSB 2OJZL 3WHE1 4JG0L 5GRYA 4PTTA 1SXNA 1K4DA 1T22B 4U6XB 4Y19E 2Y22A 2FGZA 1SEQL 4ONFH 1RIHL 3PG2A 1VFOA 5E5MA 4AT6B 4ZFFB 1A4KA 3UAJA 3MA7A 5L4IA 4D9RD 3RYMA 1Z3GH 3IE4A 4G5ZH 4PGBB 3GINA 4D0DA 3SJVE 1S7QA 3ULSA 1DJIA 4GSDL 4K15A 3KL3A 3N85L 4TSCL 1J0KA 3F6IA 3EFDL 2X4TA 1ETZB 2F53D 2EDDA 2I5YL 4N1HB 2OK0H 3UTSB 2XWXA 5B8CA 4OGXL 2FZ3B 1MCHA 1CFBA 1H3PL 4PTUA 3T1FB 1DQTA 2Z31B 1Y7VA 2DQJL 5IB3A 5J9PB 3CDZA 1MRCL 2CIIA 2D7TL 4NUQA 1A3LH 5MI0C 3UTPD 1C5CL 1AZBA 3TO2B 3OMNB 1UWEH 1CUOA 2OMYA 2WYTA 2YK1H 3IF1A 3PFUA 3DDFA 2EVIA 2CK0H 4JHWL 1GCYA 5SWZD 1NAMB 2HFTA 1IARB 4AQEA 3DUHA 1MIMH 3WFHB 4XC3H 4OCXL 2AI0H 3MCYA 2EDOA 2IALB 3A6CH 5E1IA 3D05A 1I82A 7FABL 4A04A 2XV3A 4WKZB 5L7XH 2P8MA 1JOIA 2IWKA 1HILA 4EDWH 4QRTA 3UADA 5I5RA 4CVZA 2WHVA 1NFDB 3VXMD 1JZ8A 1ODUA 3C75A 1C5BH 1B3IA 4OLZH 4UZUA 2CDEB 5LUMA 4UQCA 1LO3L 3N50A 3CN4A 5DD5L 3QDJE 3K6DA 1T20B 1U91B 5EBWB 4IMLB 1Q0XH 2OX5A 3WEOA 3BZ5A 3B6SA 4K5OA 4P46A 1X3DA 4BSWA 4DGYH 5IMOA 2VIRA 4K94C 4S10A 4JHBA 3M1OA 1SPDA 4ONFL 3KLDA 2XVGA 5LNGA 5LG6A 1KENL 4YSOA 3IBOA 1AS7A 2CLRB 4I9XA 4IKJA 1U8QA 1Z3GL 3UAEA 4IU2B 1JGEB 2A6DA 3MBWA 3BOVA 2EC9T 4GRMB 4XVSH 4BK5A 1T89A 5AKRA 1JZHA 5B39A 3DHJA 3MX0A 4GW5A 2CO1A 4Z3JA 2IAMD 4UDTA 5D1QE 3U4BH 5DS1A 3QUXC 3UBXA 3X3GL 1ZCRA 4IU3A 3Q1EA 3MACH 2ZUVA 2X88A 3RPKA 1NCIA 2BDNL 5ENWB 2YN5A 3NCMA 1DQKA 4OUUB 3SQBA 2LFEA 4LBEB 3RL2B 4TS6A 5C0BD 5T3XE 3AG1B 3I02A 5HYEA 1BSIA 2EYTA 3JTBA 4K5MA 1CE6B 2BHFA 3S8GB 3CVHL 4MJ6A 1FNSH 2YEQA 5IQMA 3MRPA 4PJ9C 4AENB 5FK9B 4UIMB 3PNWA 4GIPD 4DP0X 3MOQA 4IJTA 3VFPB 1YQVH 4FXTA 2J2ZB 3MNZB 1MCIA 3DRQA 3KWTA 4BDVA 3WO3B 4UTAA 2XXFA 1AD0A 2FSEA 1LO5B 2FO1A 4YXHH 5I1DB 3QIWD 4ZTOH 3ZL2A 1S5HA 1JGUL 1HYRC 1SOXA 1U21A 2FX9H 43CAA 4IBTA 4NQCB 3MV8A 2DMBA 2PR4H 1HXMB 5IJCC 3ULVE 4F1SA 4JKPL 4WGKA 5KVGL 2B16A 2X3AA 4P2OD 5D1ZA 4H25B 2ZUWA 5IT2H 4H0GA 4BXSV 1RURL 3ZZ1A 4GBXC 3TZVC 5BW7A 3GIVA 3WIHH 4CU8A 1A8JH 4JFOB 3ZW3A 3DSNA 3FSWA 3UABA 4FQLL 1AI1H 2GJZB 3S2AA 3LHAA 4Y1AE 2WBJC 3VXRE 1BXVA 1R3JB 4WW2C 3PDGA 3FMGH 4RGOH 1I9RH 5C70A 1FRGH 1MNUH 3VWJA 2Z8WC 1JZ5A 5JDSA 4UNTA 1OM9A 2VXTH 4N2BA 4DEWA 3L3OB 1GYWA 2WSKA 3D7PA 4K9JA 3ERXA 3U0TA 4HC1A 4K3GA 4KK8C 5DVOA 2O93L 3VXSE 3DIFA 1MDTA 2F8VA 2YJQA 1TSHA 1KBGL 5TQ2H 1HTYA 3R0NA 4HX1B 4EDXB 1PZCA 2YPVL 5IVXA 4H88H 3IDYB 4XI5D 3VH8A 1EAPA 1F4WH 5KEZA 2WZ6A 4J12A 5I0VA 3QHFH 3DXAB 2VDMB 1PZ5B 4KO9A 4UV4L 4Z7NB 4IKLA 1PEZA 5EU3B 3MYZA 4R7DA 3O11B 1KTJA 1BVNP 1KY6A 1AZRA 1BQ5A 4IKNA 2WLZA 3IN0A 3KYNB 1CYGA 5C7ZA 5TF0A 1XH0A 1BLIA 2GITB 3N9GH 2B15A 4YGVB 1ND0B 2VDNH 2CO6A 4A2DA 1RU9H 1SN5A 2AEQH 3P4OB 4MA1C 1JF1A 5EZPA 3V6BR 1TETH 3OHXB 5G55A 3L3GB 2Z0UA 3ZSTA 4AC4A 1YQVL 4JPQA 2B20A 4N2HA 4KGJA 1NM9A 2BNQD 4W9HC 3SOBH 3L2NA 5F6HI 3AABA 5J89A 3HE6D 4XP6L 3DX3A 1TNNA 2C9XA 1EBAA 1QQDA 5T3XH 1YEHH 5DJ6A 2DM7A 1LILA 2HA1A 3M46A 2N7SA 4H8UA 4X4ZA 3FU6A 3MR9A 3OF6A 5K69A 4U1MA 1S7TA 5AWNL 4KDTA 3BUYA 4JHVA 1KGXA 3FOLB 3SGJC 5AVSB 3EUUA 4M6NH 4OFKA 4PCKA 3QZMA 1FFNA 4ZX3A 4RLDA 2YQ2A 3BEWB 3ARED 3GJFK 4BWWA 4ZMYA 4I3RH 4JB9H 1FL5B 2VDQB 3BGMB 4R5TA 1BQUA 4N22A 2LTQB 2XN0A 3L3IB 4FE9A 4DN4H 3BGFC 5EF3A 2VDPL 4IRJD 4JPWL 2MHAA 5IVOA 3WLBB 1JUFA 3WEMA 1SN0A 3ZDZF 1JTPA 3ULVH 2HFGL 4HIEA 4NO0D 4Z7QB 5HDBE 1XL4A 1OP5H 3PS6A 4PAZA 3GMRA 4DUXA 2ORBL 1SVCP 4PJ6A 3APNA 3T09A 1FHGA 4PJ7E 5ERWB 3BH4A 5KBPA 2BSED 5K9KA 5MERA 2QSCH 3VSUA 2EH7L 1H0DB 2X4PA 5ELIA 3OBAA 3BVWA 4Y2OA 1OGAD 4ZS7H 3VMPA 4DO5A 4R90H 3MA9L 3PHQA 3W81A 3RY4A 3QWOA 1P4IH 2J8UE 5IVZA 4D9LL 4CU6A 5J0BA 3BMWA 3C6LC 3W39A 3CMOH 3L2MA 4E0RB 3GSRA 2AZUA 5D7LA 3ZHFA 4XB8A 5FECA 5CEYA 5E56A 4G9DA 1TFPA 2EVGA 3V8CA 3QVAA 4LGRB 2Z0BA 1FFPA 4PJGE 1A7BA 2CALA 1Q8MA 3VB9A 2UZIH 3UO1L 5DT1H 5BMFL 4PJGF 1JWUA 1TYEB 1A21A 1RU9L 2LT9A 3HLAB 4H5SB 1DLFH 1S7UB 4UT9A 3HS0C 2X41A 3FU0A 3TBYB 1OF2A 4ZZFA 1OPOA 5C0NC 1JPGA 3DBSA 1JXDA 1RZ8B 2YAHA 2PMZA 3FU8A 3KWXA 3O8XD 4GKNB 4JDVA 1IBYA 4Q4EA 2N7AA 4HH9B 3U2IA 3HZVB 3RWCB 2R0KH 5EF0A 1IILE 1HAWA 4G42A 2CKBL 1YUKB 4Y5XB 3ZKQD 2AZAA 3RWHB 1WZAA 5ITBL 1NUDA 2ID5A 1T1XA 4PP2A 4KMLB 4BK8A 2QVMA 3G3LA 4X5QA 4HU8A 2IV9A 2E7CA 4JG1H 2CUMA 5C8JB 5HSFA 1GH7A 1KBPA 4P05A 1T03H 3VXUA 4JB9L 1FPTH 3IFLH 4EIZC 4OI9A 5I1EL 4JQIL 3AY4C 5IFAH 2K3TA 4JKLA 1DEEB 3CFEA 2XBTA 5C0AE 5HGHB 2L7EA 2XN9A 3EYSH 4WU7B 3TV8A 1OWWA 3F7YA 1YVLA 2FJGB 4GRLD 4UANA 2V2WB 5F9WC 3RWEB 3SKNB 2BVEA 3HNVL 4AQ8A 1C12B 3LKPB 4PBVC 3APDA 4XX1E 3GLZA 5A6LA 3DVNA 4PJHB 3KXFA 3SE3A 4NKIH 4YSSA 4YIQA 4IIQA 2E7HA 4IOSD 1NKGA 4JAMB 3GNMH 4JO4L 3WJMA 4OJCA 1NL0L 1S9KC 5DC4B 4FZ8L 1NGWB 2X53A 1CLOH 1YEWA 4JRXB 1M1XA 4FNQA 3WGVB 1JZGA 3KYMB 5DXWA 1MLBA 3CMOL 1C08B 2H47C 3F12B 4OCSH 4E42A 2EDJA 1WAPA 2KERA 4I8DA 2EUXA 4P23D 3HS9A 4NQDE 1WUZA 2ZKWA 3P73B 4JQXC 1TJHL 4XMPH 3TH3T 1LK2A 1LO0L 5TE7H 1KZQA 5AL0A 4ANUA 3DURB 2IAAC 2FATL 4X6EB 4NSKB 2ZSVA 3LOWA 4YHZH 1OO2A 3PGFL 4K94H 4GAGH 4TOYL 5GGSA 1JDAA 4FG6C 5J8OA 1A2YA 2CHZA 3MLVL 5IHUH 5HGBA 3KPSB 4GW4B 4U3HA 4AW7A 2OTWA 3FCSB 4XN9A 1UJTA 4GMSL 1OV8A 4J3OF 3TVMB 3GIZH 5CR1A 1GJWA 4U0RC 1MZYA 4MNHB 3VRLE 5FYKL 1SGKA 2R0KL 2PLTA 3Q06A 2DH3A 2B5IB 1BBDL 2V3FA 3VRLF 3FB5A 5EV7A 1U8NA 1OF0A 3U6XS 2GQHA 3G5ZA 4JG1L 4P9HC 2XQBH 3W37A 1UXWB 5C0RH 3FTVA 2XA8H 4QXUH 3MKKA 3FO2B 3DHUA 5F89A 4TTGA 2WVVB 3NJVA 4TVSa 2RB8A 1DVSA 1CFVH 1FNHA 1OP3H 1R3LB 2BHUA 1KJ2B 1EH9A 3EYSL 2VL4A 3SDCD 2DLGA 1NEZB 4L4VD 4QCIB 3L3JA 2ZF9A 2A2QT 4X5XB 3GJEB 3REWA 2WNWA 2OCFD 3INUH 1LM8V 2RH0A 4QIRA 2GFBA 1ET5A 3KWWB 3V4UL 2J6EH 5AQ0A 2WO4A 3KPMA 4JLRA 2ESVD 1PJ9A 3IVKB 3CLEH 3L1FA 2NY2D 2XY2A 1ZY9A 5HHMB 5ESQA 2X38A 5FAAA 1O5DT 3IXAB 5EORH 3VA2C 1L7IH 3GGWA 5E2VL 3UP1A 1F0LA 2X9YA 2I9LA 4K7PY 1CLOL 2WQSA 4BELD 2QQKL 1AXSB 1EJ6A 3RKDD 4OCSL 1IE5A 5ADPH 1NBYA 4J3TA 1GZPB 4R6UA 1VKXB 4HIQA 1N5AB 1BM3L 3OG6B 4ZMZA 2W0PA 3BVVA 4TXVB 4XMPL 5I5JA 4S1RL 2YPLE 1J8HE 1WH0A 3FL7A 3QJQB 4MQ7B 1PLCA 1BD2D 3HFFA 1IMHC 1QSFA 2BSDA 4BA8A 2YAOA 2YD1A 3HMWL 4ZO7A 1EAOA 3MLTB 1IQWH 2Z91B 3QDGD 4NAMA 5LDUA 3CFQA 1P6WA 2BIQA 3VG9B 2OL3A 1HX0A 1P4BH 1ZT1B 3RFZA 3MGTA 3VG0L 2HVKA 1YN6A 4MXVE 2QSQA 5DZ9A 3TF7C 5JHDA 1MCWM 4WO4A 3T6ZA 1XEUA 3D3VA 4YEEA 3CSFA 4LVOB 3QAZC 4WGWB 4U6YA 4FFWD 5JXAL 4ZAKB 2YSSA 1W0VA 5KBLA 1QX1A 1D9KA 3QIWC 4PJIB 3MV7A 3QULA 4PV8A 4JFZH 3OAZH 3SHSA 4LQFL 2CGRH 1SLUA 4I9WE 1CYXA 4PVBA 5LDSA 3MLZH 2WSPA 3EH4B 1RLBA 2A4EA 5I0DA 3Q1SL 4HUCA 2F9BT 1KXVC 3FYIB 3QPXH 4KTYA 4P2OC 1DCLA 4PRNA 3KPPA 3FKUS 3PU7A 3QG6B 4HUMB 1MFCL 3L4YA 2MSPA 5ACZB 1FNGA 4AGMA 3VRJB 3GSUA 3INUL 5KJ7E 1E90A 5JNYA 4OZHE 2G3XA 2BWIA 4PWHA 5A43C 2TAAA 1IGFH 4M7LT 4PRID 5EBLA 2VM9A 4ZG1A 3MRQB 1P4LA 1WBXA 2J6EL 4OZHF 3LX9A 1HJBC 1ZHBA 4KKLD 4JPVL 2BVQB 3PGCA 4AK2A 3T2NH 3CLEL 3F7KA 5J1AB 2V2TB 1UHVA 4HGKC 1X5GA 3VI4B 3FB8A 4A7GF 3QORC 2A77L 4JGNA 4JDEB 4NUJA 3TNNA 1KGWA 3OGCB 3DPBA 4L23A 3QJVB 2RALA 4H5SA 2N4IA 3WLWD 2N1KA 4GG8A 3A4AA 3TO4A 2PETA 1GGTA 4AJ0A 4KK6D 5ADPL 5I28A 5KSBB 3KEHA 5AVZB 3ZYJA 1IAMA 4BKSC 4ZSOB 1CU4H 2GBUA 4OSUH 4YX2H 3CZLA 1HKFA 5D7IF 4LDOB 2C3HA 4M5ZL 1XMEB 3JV4A 4L18A 1XHHA 2YS4A 4ZW7A 2VLKB 3L9YA 3TX4A 2DWEB 3D39A 3LEXA 1U8MB 1IQWL 4R96A 1N3NB 1UJ3A 1DEDA 5CWSB 5L4JA 5EO0A 4CNIA 2D2OA 3PY9A 2IDSA 4NUPA 2VZOA 5BOPA 5K33A 4NJAL 1DVUA 5E6IA 3E38A 1R6VA 1H3XA 4CMMB 2MRYA 5DRZB 1M3JA 4IDLA 1MDAA 5A16A 4P2QB 4J27A 3NGBC 3V2AR 4MD4B 4ODTL 4OKVA 5ALBL 1DLHA 5F9OH 3V0IA 2IWFA 3LNDA 5IR1B 1UD6A 5MEQB 4LP8A 4QHUA 3HE6C 4FFYA 4X8JB 3L7FB 2JB6A 2VDRH 2XTJD 2X6AA 3EGDB 5AW5B 5E08H 3X13B 5SWZE 3DV6A 4RGNB 2K9FB 3U7WH 3ILPB 2CGRL 4WEMB 1KIRA 3BQUD 3IJ8A 3UL4A 4BGLA 3OKKB 3ZTJH 1T2XA 4XPTH 4N0YL 1NICA 5GGVL 4KI5D 3MCLL 3AREC 1UB6A 2DJMA 1XF4A 1HH6B 2WIMA 4NIKB 4OBRA 1ACZA 3O3DB 3OAWA 4R2GD 1YEJL 2EZ0D 4P5TD 3W9DA 5KANI 2CO7B 1MPAL 4PJ5B 5FO7B 3VXME 3O4LD 2B59A 2DWYA 3QR2A 2XRAH 1ZHLA 2WWOA 1U8LB 4FNPA 4BHUA 2C7UA 1MCDA 1OAQL 2X40A 3MMEA 1W72B 3POHA 4EQ3A 4HHAA 2P5EA 3DHPA 2COQA 2JCCB 3C60A 1JYNA 1TQBB 1QR1A 1A4CA 5HTSA 4GFXA 4IYKA 4O2EB 4X6CE 2OR7A 5FM4A 4JRFA 1JPTH 1Q90A 3N1QC 4Z7WE 4AZ8B 4RRPM 4OIIL 3PAYA 4Z7WF 4KXZI 3EYVA 3MROA 4IGBA 3W11D 4MA7H 1UWXK 1G0YR 3HI5H 4YX2L 4OIBA 1DN0B 2H6PB 4EN2A 3LQMA 4AEIH 2FBOJ 3JZ7A 3Q6FA 3BLBA 3MJ7A 4G8GA 1RK1A 2NNCA 3LN4A 5D8JH 3BIAX 4ZXBC 1U95A 5D2LB 2G4EA 3VVWA 4OD1H 3IKCB 3IMBA 1VZGA 3HUJB 4WW1B 4L4TA 3CFIC 4ODUA 5T1LD 4RMTA 4L8DB 1AFVH 4Z78B 5C0BE 4AGLA 1II4E 4QYOA 3TNMA 5IESL 4DQOH 3U0WH 4GG6A 2OCCB 4ZOAA 1AKJA 2AMUA 4Y4KD 2GC7C 5DRXA 4ZUWA 4CU7A 3O8XC 3KPRA 3MV9D 4JGUA 1VB9A 4UB0L 1H19A 4MLSA 5KBKA 2BOCA 3S96A 5CBAA 4X80H 5BRZA 4OR1A 1G7MA 2A9ML 2I60H 4J4PC 2HMIC 1FZJA 1O7DE 5KW9L 1KB3A 3LKQA 3OB0H 1BIIA 2ADIB 4HAFA 4YHLH 3C6EA 3UC0L 3KL5A 1JNJA 3NESA 2R1YA 3Q2NA 4WHTB 3RILA 1UFUA 3NQKA 5DZNA 2FB4L 5ILTH 1X4YA 2PP7A 4LAQL 4KZ0A 1KEMH 1OPGH 3V6ZB 1A7QH 1P5UB 3T8XA 4X7EC 4PREB 4TQHA 3H42H 3CH1A 2APXA 3Q05A 4GRLC 2BHYA 4QXGL 5D96C 3FQYA 4CC4A 2IOMA 3QFGA 4NPYB 1MNNA 2O5NA 4B27A 3TPKA 3WGUB 1GS8A 2F74B 4LHUB 5DFTA 4AITA 5TDPB 1MVUB 3QUMH 4LGSB 5AOKA 1SOQA 3PL6D 3LPWA 1BV8A 5L8LB 1F8TH 3OJDA 5E00B 2EIBA 1FSKB 1QSEB 1HK6A 2AGJL 4HT1L 4P9HH 1U93A 4M9OA 4JFEB 5AENA 3QXVA 3GF8A 4ZBJA 2V5RA 3N44B 1XCQB 4O02B 1HJCA 2M8XA 4PJXB 4CADB 3R18A 1HDMA 5L4FA 3L6FB 3NEXA 1RV6X 4LDLB 4P23C 2Q8AL 4ZAKA 2OMXB 3IU3B 4AEIL 1ZLSL 1A3RL 1KLFA 3CFTA 5HY9B 3DV4A 3V5DB 1T5KA 3BRGC 3B5GA 1OSZA 2NUTA 1NGYA 5J12C 3L5WB 1G6RA 5D8JL 5LBVA 1F13A 5I1GH 4ORZC 1Q38A 3BH9A 4OD1L 2YAMA 3PQYB 3FQWB 1T0PB 3A21A 5E8DH 5B1JA 2D73A 4PLNC 3TT1H 4APXA 4JJOA 3RL1A 1SJXA 3HOGA 1ORQA 3IFPB 1AFVL 4XAWL 4WEEA 5FKAB 3S3CB 4PY8I 3LN5B 4FJ6A 4ONGL 3FSAA 5EFIB 4QO1B 3PWVA 4EJ1C 3CZEA 3ZE0B 3LDBC 1IGIL 3ARDD 1IC4L 4XMLL 1N68A 5F9AC 3E6HB 4OLUL 3MRLB 1NEUA 4NZRL 2A99A 1MUJB 2JI1A 2H2PD 2I60L 2WLNA 4XPHH 5HI5D 4XB7A 1TO4A 5J11B 4RISH 2R0WH 1A9BB 2WM0A 4PY7B 1MWAH 1NCCH 4JFFB 4Z7IA 3VW3H 2ZKMX 5FLVA 1Y1UA 1JWSA 1WA2X 1EO8L 2DWDA 4N2AA 3QWRD 3UEQA 2OMVA 3OQRA 4X5WA 5HYJB 1C1EL 5KAQF 4OM1H 5IJKA 2R2BB 4DPRA 2GVYA 1CZ8H 3JWDC 2D8KA 1PMYA 3HHSB 2ZUTA 3QJFB 2R2HB 1E3XA 1BA9A 2G3ZA 4JE4B 3F84A 3EH5B 1HH9B 1CCZA 4GIOA 1Z9PA 1PAMA 3G08B 2VABB 3RY6C 5I76A 1WSST 3BX7C 1SRDA 1NEZG 3S36L 1O0VA 2XKSA 2DQTH 5AB1A 3MGAA 1QLFA 1DBMH 1INQA 4PWGA 1L9MA 4LVNC 1I9EA 2NY2C 4DKTA 1QLRA 2N3JA 3S5YA 1G5AA 5KTEL 2ZG1A 8FABA 4NO5A 2H32B 3FFCA 4Z7VB 3KHQA 1HQ4B 5KUMA 7TAAA 3DX6A 3HAEH 4JCWA 2FYVA 4OW6A 1AJ7H 4XCYA 3QCTL 5E6YA 3SBRA 4ODSH 3MXWH 5BRPA 1NGZB 4M62H 2EYRA 3RVXD 5GZOD 3ABZA 3L1OH 3KCPB 5FUCC 4ZK8A 5FKPB 4HXBL 3B7RL 3A6BH 4GXVL 4ENEC 1VADB 1BEYH 4XP9H 4AGPA 2XWJB 3L54A 4FLRA 5KN5B 2OJ1A 3ECBB 4G43B 5I2IA 4FNRA 5HHPB 2L7JA 3WDIA 1DE4A 1ZK5A 3U2SB 1WTGT 4Q89A 3DOSB 3GI9H 4TQ8A 1G87A 1BG9A 1HI6A 2HJFB 2B8OT 4P2YA 4PG2A 3V4VA 3CZNA 4DAGH 1MFNA 3LRSB 4HWBH 5SWSD 3VGAC 4BUGA 4K2UL 1E5ZA 4O2CB 5M94B 1CD8A 2X2UA 2EILB 4PLJD 2YQBA 3N43F 1IC7L 3ARRA 1DFBH 1WYJA 4WDIA 4FFWC 3FTSA 4LMQE 4BYHA 2PCYA 3PDDA 2J4WH 1EZUA 4Z9KB 4GUPB 5C9JA 3KGRA 4K4KA 3TWCH 2XWRA 4R84A 1R3IL 2OCJA 3EFFB 1Z5LA 2C9PA 3IGAA 1ZVNA 1VSCA 2VZVA 4KUZH 1ZWIA 3BUTA 1T21A 2HT2D 2VE6B 4MJ5B 4YPJA 3UTSD 2ADGA 1KXQE 2VDLB 1O9WA 1PKQB 3D1MC 5D1XA 5IG7B 2X2YA 3B8YA 2OMWB 3ARQA 3K80A 2Z31D 3AQZA 4LSPH 3WKPA 2DL2A 3QJHA 1PY4A 1NCTA 5AZEH 3MLSH 3FHQA 4HWUA 1Q72H 3SBQA 3VU2A 3ZR6A 4UQBA 4AQ1A 1WTLA 2R0ZL 3GSXB 1IGJA 2HVJB 4LOFA 1XCXA 4P5SA 3AWFA 4LCVA 1CICA 4KKLC 2WUCL 3WO4C 4G8EA 4HKJB 2WB7A 4EN3B 4KPHH 4YQXH 4M3KB 5CZVH 5F7HA 2P4AB 5D2LA 2DQEH 3GXMA 5E70A 3U6XA 5I8EB 2ZICA 4XBEH 1L9SA 1QAWA 3WLWC 4R7NA 4PJAA 2NTFB 4MJJA 3VXQA 2H6OA 3W2DH 2A4CA 3UIZA 1JPFA 2K6ZA 4I89A 2AEWA 2XWDA 3QEUA 4IRSA 4MAYB 2DM2A 2VDKL 3L1OL 1RIVH 1BLNB 3ALPA 3WIFA 1DN2A 1BEYL 4LDEB 4ZUUA 1G7JB 4ZO8A 2HG5B 2XZAL 4C8XA 3I9IA 5IB5B 1HSBA 5SX4H 1MCEA 2A0LD 1L6XA 3X1EA 4ATTA 3LZFL 1DVZA 1HU8A 2DQIL 4U3XA 4XVOA 5AW1B 2ED9A 4BRJA 2AXJA 4BFEA 4R4ND 3ARFA 4BZ1L 1H8SA 4ZO9A 2CA3A 3GB7A 4G6KL 2FX7L 2ZX6A 4Q58C 5PCYA 2R8SH 1I8IA 4LPYA 3H4HA 3B7UX 4MWFB 1JFHA 4MCZB 2IADA 4UI2A 1IFRA 2WVUA 4MDJA 4XZUA 3BISA 2CWRA 1MREL 1T5XA 3VGDA 3UZVB 3ETSA 3FF7A 4NQXA 4UOQA 3H3PL 3H85A 4XVJL 1LDPL 1O6TA 1QUNB 2XTJC 3UTTA 4E68A 4FF9A 3LZPA 2BP8B 5FW7A 4NYLA 1WT5C 3ZT7A 1TZGH 4KNQA 1F2QA 4CAGA 2VJ8A 2XACC 3HI1A 3K91A 4DZBA 2UZXA 5CKGA 3BZDA 5LGHL 4H26A 2AK4E 2YUXA 2QKIC 3QNYA 4A55A 5CEXA 1RZKL 3TBSB 1JI2A 5GRWA 2IQ9L 5DURB 5T5FA 4MYPA 4LSPL 5EMYA 3L95B 4F33A 5JPNB 4O58H 4CVXB 5EOQH 3BAKA 5TGBA 2ARJA 1KJVB 1TDQA 1AKPA 2GJ6A 4JZNA 1AIFB 3GMLB 3VVVA 4BFKA 5CLWA 3O6LH 3WHE0 5I75C 4ZQKA 1F4HA 4U7KA 5DJ2A 5INDA 3U1PA 1UT9A 1N0XH 3EG9B 3ZE1F 5BOZG 2I9TA 5C86A 2FCBA 3E3QC 5E8NB 3NEOA 4PRAB 4PJBE 3CGTA 2AFNA 3HNSL 4FQCL 2QJDA 2ESVE 1ZDSA 5AEAA 2OZ4A 1G0DA 1JJUA 2YRPA 3HC2A 3BT2H 4NQCD 1RJLB 4U1JA 5DUJA 4O51A 1FDLH 3IDIB 4Z3HA 3NSFA 3WTVA 1E9OA 4ABWA 1JBJA 2VH5L 5EOCL 4JKNA 1JNLH 2G2NA 3H3KA 5I8CB 5ITFA 2ITDA 5BXFA 1A0QH 4YGAB 5KOMC 3BPCA 5KSUA 2DN7A 2CAKA 2VR6A 3FB6A 3BWUF 5E7FA 1QRNA 1BD2E 2XU9A 1JVOA 5C0GA 4HK0A 5DZVA 1I8LA 2IANB 1S7VA 4NKDA 5EU4B 2MCPH 3DSFH 1WC7A 3KPTA 1CG9B 3LRGA 3QDGE 2R83A 1E4KC 5D9SA 5CLYA 5EZLA 5CZXC 2WBWB 4R4BB 2V5TA 4JANA 1NUNB 4Y4KC 3G6AA 1YEIH 5DUPH 4ENZA 2HG0A 3ZOAA 3FT3A 1E3ZA 3P40A 1F6AA 1WV7T 1LVEA 2GK2A 2RFXA 2YGNA 3ARBB 4DETA 4FTVA 1A5FH 1N6QL 3PV6A 1WRFA 1S7RA 1RZ7H 3U6RB 4KNTA 2XWCA 1JVKA 1QW8A 1TMCB 2YPKA 3WD5H 3EFOA 1T4WA 2EINB 1GZQB 1JV2A 1W80A 1IBBA 3RVVD 5IOPA 2CM6A 3DXAD 2O30A 4XMXA 1Q0EA 3MJGX 2V6HA 1KY7A 2MNUA 2X0UA 3CBJB 1UASA 1E8XA 2FJHA 2NX5A 3QXAA 3TH2T 3QIBC 5EU6B 1YHPA 2WYZA 2EDHA 2OSYA 4NRYA 1KLUA 5F6HJ 4LKCB 2YLHA 1MH5B 1RUAH 2C9VA 4FYQA 5D71H 3D2UA 3D69A 3FTGA 1I8KA 2OS7A 1N0XL 2IO5A 3ORJA 1K5NA 32C2B 4PB9H 3V0FA 1PG7X 4ICWA 1QPPA 2Y7NA 4F7TB 4PRIE 3RUGE 4LHUG 5H35B 2JFCA 2JMRA 4MA3A 1D5BB 1HS6A 3LS4H 2F54A 1NDMA 4PM1A 4YSTA 2KPWA 4AYFB 3AC0A 1BZQK 3BP7B 4OJFH 1IGYB 1FDLL 1RAMA 2DQDL 3D0VB 5DFVD 2CLZB 4Z3IA 5E9DE 4XBGA 2WLLA 3TBWA 3VGGA 4YLQT 1H5BA 2UZYB 3RZCB 4XMTA 2L0DA 2IFFL 3T4AA 4YBQD 2FH8A 3TBVA 1CT8A 3EYUH 3P0YH 5IB4B 1Q1JH 4EOWH 4Y8AA 1ORSB 4XBMA 3FHEA 1P7KA 5MHSD 4HPOH 3SYQA 5J6HA 5B3NA 3D06A 4KZEH 1ROCA 3G5YB 2P80A 3DROA 3NACL 1WPCA 1JTTA 2IFGA 4XP4L 1LEGA 2IF7A 4X2UA 1MCWW 4LCUB 5FDWB 2D4DA 4NOFA 2VZUA 5C0EB 3EOTL 3CSBA 5CMAA 1TZIB 3ZKXC 1VGEL 2G5RA 4QRSB 5DUPL 4GYBA 3X11B 1NBCA 4LF3A 2ZXAA 5AD0B 1YMME 2X1XR 4JE0A 2DBLL 3EW3B 5E4EC 1ZVHA 2FK9A 4E9XA 3KGTA 1A5FL 3G6JB 1AZNA 4FJZA 4A6YB 3LEYH 2F5BL 4BRVA 5JW4N 5F0LB 2BRQA 4X6DE 3NIFE 5GXBB 3KLAA 4RMRA 3AQXA 2EKSA 3DPDA 3QW9A 3WD5L 5KBDA 3PV7A 3MRCA 3OX8A 3NIFF 4OAWB 4JR9L 4EI5A 2XTJE 3OMAB 5EBMA 2D9CA 5FC9A 2JIXA 4OLXH 3L5JA 3RY5A 2EYSB 3BPLB 5C09B 2E7BA 4XGZA 5T1KA 4ZX6A 3ARGC 4NZUH 5F7UA 4G7YH 2OBGA 3DJSA 4D3CH 3QUZB 4JFUA 4ISVB 4PJDF 4AI7A 3ARWA 2QQQA 3N41B 2IQAA 4KV5E 3H54A 1YY8B 3DARA 3ZTNH 5C3IA 2IBZY 4JFDA 3PWLA 4JY6B 1XGPB 3WUWA 4JG5A 4LCYA 4TUKH 2J1KA 4L9LA 1G1OA 1VIWA 2PP8A 3NT0A 2HH0H 5AVRB 1NFIB 3O4LE 3O9WC 2IPUK 3LY6A 1OCZB 4K3JH 2VYRE 1Z0NA 2P43B 4FA8A 4MJIB 5AW7B 1FZMB 3GSOA 4OJFL 4YL9A 3UBXI 4KMTL 5EH1A 1K8DB 4X8XA 3E3QE 5DR5L 1H6FA 4E41A 4EQ2A 1OP4A 1YEKL 4QYAA 4GS7C 4YUEH 3RVXC 4HH8A 3WV0A 5GZOC 5EHFA 1NZRA 2ZUQB 3FB7B 4QRRB 3VMOA 2BWDA 3DGGB 4L37B 3P0YL 5T1DL 2FO4A 5D5ME 3AT0A 3MTRA 1WZ1L 3OXRA 2AK1L 4TL4A 2XZCL 4HUVA 2X1OA 3RDJA 1NBZB 5C9KA 3ISRA 4OCYL 2FJUB 1MAMH 4GPVA 1A6ZA 1IM9A 4CKQA 4LCCA 4LIQL 4NKOB 4W81A 3FOMA 5DHDA 1CGTA