2Z34A

Crystal structure of spcia1/asf1 complex with hip1
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
159
structure length
155
Chain Sequence
SIVNILSVNVLNNPAKFSDPYKFEITFECLEPLKSDLEWKLTYVGSATSQSYDQILDTLLVGPIPIGINKFVFEADPPNIDLLPQLSDVLGVTVILLSCAYEDNEFVRVGYYVNNEMEGLNLQEMIKKVKVDISKVWRSILAEKPRVTRFNIQWD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of fission yeast histone chaperone Asf1 complexed with the Hip1 B-domain or the Cac2 C terminus
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Chaperone
molecule keywords Histone chaperone cia1
total genus 27
structure length 155
sequence length 159
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04729 ASF1_hist_chap ASF1 like histone chaperone
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1490 Mainly Beta Sandwich Immunoglobulin-like Histone chaperone ASF1-like 2z34A00
2Z34A 5BNXD 4ZBJA 3AADB 1TEYA 2CU9A 2HUEA 4RRPM 2IDCA 4EO5A 5C3IA 1WG3A 2IO5A 2I32A 2Z3FA 2YGVA 2IIJA 1ROCA 2DZEA 5EIIG 5BO0D
chains in the Genus database with same CATH superfamily
5IFHH 4DZ8A 4OB5L 5E9DB 3TEUA 1BDYA 4MJ2A 5GS2D 5D6DA 3T3ME 5LB1A 4APQA 2ICEA 2VUOA 5KVGE 1V3MA 3UTPD 5IGXH 5E08L 3EH4B 3IM1A 4HIEA 2DICA 4OUOA 3MJ7A 3Q5OA 4AM0A 3QIUA 5TF1H 5IW1B 1F2XK 3ESOA 3U2IA 1MCOL 4FXLA 4FL4B 1QA9B 2QVFB 3SPVB 3QULA 1F58H 3PWUB 4ZDHA 2PCPA 1DVFB 1A14H 4K3DL 5FYKD 3I2CL 5I1GH 3EYOB 3WMPA 2ZD0A 4D0CA 5BMFL 2I9LB 2X1XR 2Y23A 2OPCA 5CAYB 3DYPA 4ZW3A 3NCWA 1NGPH 5AW3B 1T83A 4UB0L 1C5BH 2W9LA 3D2UB 5FYKE 3RIFK 1ORSA 3T4YB 3AG3B 2CK0H 1SUJA 2X10A 1A6AB 3M1BA 3QJFB 5AB2A 3JUZA 3ZO0A 5ITFA 1EWHA 4YDZA 3F8UB 1PKOA 1RZPA 1CGSL 4Q9BA 2A9NL 2ZOLA 2XN9A 1ET8A 2F54B 3IMTA 4JG5A 2J3SA 2O5YL 1IGFL 4LLYA 4UM9D 4GRMA 4DVRL 4X9BA 4UT9H 3IAGC 5CZRA 1H3VA 3VD3A 1L0PA 1XCQA 3OLGA 5AOMA 5KSBE 1NGXB 4K94C 3EJCA 4XNUL 1A3ZA 3RUGF 2YC1A 4AEIH 1KT2B 1YJDH 1ZVSB 4X9HA 5HSFA 3GEFA 2P47B 2YPLD 3CD4A 1IGJA 1MCSA 2Z7WA 2PYED 4TQPA 3ZE2E 2D3NA 4JO4L 1NUFA 4I77L 4HIEB 4WU7A 4AYEC 2Y3NA 3OB0K 4F5CE 1KPRB 3FOLB 3MU3A 4N2NA 2OMVA 2PYEE 4ZFGL 3O2VL 2R2EA 2JB6B 2HWZH 4B97A 2YPKA 1N5AA 2N0MA 1CT8A 4DAGH 1BXVA 4PJ8C 5ADPH 5JHLA 1RLWA 5DLML 4OZHA 4JN1L 4XGZA 1L0QA 3FQ2A 1ZMYA 4YNYA 4ZXBC 4BZ2H 2BVPB 3TWYA 4XBPA 3G5XB 1IL1B 1WBZA 2IAMA 2W8CA 4XMKH 4MDJA 4NDMA 3MBXL 2AF2A 1G1KA 3H4HA 1E9PA 2OJEA 2ADFL 1N8OE 1ZRUA 4FCAA 5AVVB 3G04B 3EJZD 1A7QH 2AQ3A 4PRIE 3ARBC 2VTFA 3BPCB 4Z8FH 5IP4A 5CEXA 3X1NA 5MP6H 2QTVA 1HT6A 2RFXB 4Q6IB 5FCUH 1T1XB 2IV9A 4RQQB 3TBVA 4G8EA 3OC5A 3TN0B 1HINH 2X1OA 3MZGB 1J8SA 1GGCH 3UAJA 5J6GA 1R3IL 2VDNH 4MS8C 4ZNEA 4G83A 2VERA 1ZE3C 4IKKA 3WTXA 1ZWIB 2GI0A 1X9UA 2XN0A 4Q2ZA 3K5SA 4RWYH 4RX4D 4QHKJ 3O4LA 3B2UC 4JFQA 2G5BA 3FRPA 5DHXB 2PP9A 5EPMB 2VJ8A 1QHOA 4X9FA 3AB0B 1TPXC 1SXSA 4FQ1L 4LVEA 5FYKH 1TOXA 2EC8A 1WZMA 4G80A 3TBCA 3O3DA 4RIRA 1C8QA 5CM1A 4IBZA 1D7CA 2HFTA 4V11A 1XBDA 3GIZL 5SWSB 4ZFOA 1N12A 1NJ9B 4JO3L 4IJTA 1S9WB 4RMUA 1AQDB 3KGTA 2OSLB 1BOYA 2YRZA 4F37F 2XN9E 4WV1C 3LN5A 3HW7A 4W9CC 1OV8A 2P49B 3GHEL 4U1IA 3MJGX 3S3BB 5IB5B 3MRPB 4JHZA 4LSQH 4TTDD 3TBTA 4CADA 1AY1H 4D8PB 4ANVA 4EI0A 4PLKC 3Q2CA 4QOKE 3SGDH 2WPGA 3L16A 4MAUH 3O2DA 4N1HB 3JWOC 3SQBA 3FH8A 5AW6B 2Z7UA 5BW7A 2V5RA 5BW7C 2PR4H 1ZT7A 1MW1A 4ODVL 4KK6D 4XE0A 5LGJA 4AYGA 1AQKL 4JM2A 2EYTA 2EXYD 3MRHB 4FFWD 1TCRA 1BZ7B 1N4XL 4PBXA 3EKCA 2A6IB 5EBWB 5AVSB 3KYNB 2FX9H 2JI3A 1KNOB 2LOEA 2PW2B 2ZUYA 3T0WA 4Z77B 4F58L 4GH7B 1K85A 4DVBA 8FABB 1EZLA 4BFKA 2CJUL 4FA7B 4LSSH 1KJ2H 2YAMA 1ZIAA 3UYPB 1TT6A 2X6CA 1HI6B 3GINA 4G8GA 4PRNA 3MCLL 4IKIA 1EEZA 1F3DJ 3ALXA 1QFHA 4LDEB 1IKOP 2Y5TA 1V7NL 4YBQD 1JK9A 5L8JB 5AAWC 3DIFA 3U2SB 3LNFA 4BK5C 6PAZA 4J4PD 1DVUA 2ID5A 4L4TA 2ZAGA 4WUUA 5F71A 1DQTA 5C08B 2NUTA 3EYVA 4LPXA 5ESAB 3RNKB 4A2HA 3L3IB 5TK4A 4DKFH 3C5ZC 4C4BA 1FIEA 4FFYA 5E2JA 1BM3L 2P8MA 2NYYC 3RFRA 1WFOA 2C7FA 4R4FH 4ZS6C 2EDKA 3GSUA 3UTZB 3G7TA 3SBWA 3AQXA 3E8VA 4R5VA 4HUKB 3ZTJH 1WAPA 4G11A 3FTUA 1NFDF 1YMMB 4XAKE 3T77B 3VM7A 4Z7IA 3HOGA 3OAYH 1TLMA 3RWJB 2HVBA 5EU7E 3AJ7A 4XWOC 4HWZA 3AT0A 4PJGB 5E2TL 1MJ8L 1PYWA 5ADOH 3NPZB 1KEGL 4JKNA 4MLSA 3KGSA 3MNMA 3QPQD 4PVLA 5C0ND 3CSTA 3PJSA 5CZVH 2G9HA 4MMYA 3SDXB 2EKSB 5GGVH 1UCBL 4QWWC 2R0WH 2Q76B 4UYPA 5GGSA 3ZE2B 3TVMD 3TTYA 5KOMC 5ANMB 4ONGL 2EC9U 3QFDA 1HCYA 3T0BA 1IGIL 2WLHA 2AV7B 4TL5A 3CVBA 4F15C 3BQUC 4KROB 5T1KD 3KVDD 5JR1H 5HHXH 4ELME 3X11B 3LD8C 5FGBA 2Y0SA 4PY8J 4WW1A 3QYNA 2K4WA 4YDKL 2ED6A 5T1MB 1W6WA 4AG4L 4KV5F 1Z5LA 5EOQH 5JA8B 3ZHKA 5BO1H 4GI9A 1YMMD 4AOFA 1UCTA 2YN5A 1ZV5A 2JXMB 1FZKA 3D05A 3BZ5A 2EXWD 3UZVB 5LNGA 1INQB 1DVFD 1IQDB 1V54B 3FOMA 3GI9H 4IMKC 1Z3GH 4NM4H 4QTIH 5C07A 3TO4B 5JORA 2CBPA 1DJIA 3HKZA 1BM7A 1PZDA 2K7QA 5CZVL 1GGIL 4X0NA 2H8PA 2VH5H 4PY7B 1H0DA 3P3UA 4ETQA 4P3CH 1JI2A 1BQLH 1OK0A 3BKML 3CHRA 5ACLA 4DQOH 1TPXB 1IM9A 1G9NH 1AO7D 1UWXK 2VKWA 3DJZA 3GLAA 3X13A 2BHZA 1GMEA 4HFWA 2NSMA 1L7TL 4M8QB 2D3JA 2CHNA 2MJWA 3OKEA 1KIRA 1NFKA 4J3OG 4OZHE 1WFTA 2UX6A 4OIAA 3V10A 4DOHB 3O0RH 2P5EE 4F8OA 4L0PB 4PWHA 5EIQA 1T21A 4H8UA 3WN5B 2UZIL 3OR6B 1OANA 4N0CC 2ADFH 1PZCA 1SQMA 2XA8H 3D2TA 3ML9A 4RSVA 5ALCL 3L8QA 5D1ZD 3EADA 2DBJA 1RULL 3P3YA 3QUYD 1VGKB 3G5VA 4YSRA 3DX0A 4LSPL 1ZOXA 2W92A 3LXBA 2EIEA 1FFNA 4MD5A 1AG0A 2OMZB 1R3KA 4LCCB 1U8NB 4KK5D 2DM3A 3RHWK 4YN3A 1G9NL 1VFBA 1O5DT 1QFWL 2YMXH 2GSGB 3BW9A 4IGBD 5EA0L 1XGRA 1MCRA 2KQMA 4KRLB 4L8DB 1M3IA 3W5MA 2EO9A 2G0KA 3DJSA 2NNXA 4P46B 3O6FC 4APXA 1LDPH 1LMIA 1QPPA 4G6ML 4OGAC 3QPKA 4PRBA 2CNZA 3L3OC 3OKDA 2X2IA 2PO6A 1E40A 2CBTA 3DVIA 5FUZL 1OCRB 1IZJA 1YEIL 3PIQA 4K5NA 2BY3A 2W9EL 1BMZA 1NDGB 1CXEA 2ZP8A 4P23D 1IBDA 4WKZB 1O7DC 5CR1A 2Q5BA 5DA4A 1TQWA 3LV3B 4OCNC 4UQ3B 1KGIA 1IGFH 2O5YH 5K33A 5KSUB 3K46A 2VABB 4S0SD 3EJJX 2AK4B 4RETB 2VSDA 3KYNA 2AXFB 4KY1L 4P4KB 1UM4L 1MNUH 4CVZB 5EIIB 4PJBB 5MEPB 4XTRC 5I1LB 5EUOE 4ELDA 5CKGA 4OZ4B 2RH0A 2YXMA 3EJSA 4GKNB 5HGHB 2EXSA 4WFFD 3A3YB 1JPGB 1LM8V 3BUDA 4ATWA 1KWGA 1E5UI 3CH1A 2FWUA 2PCFA 3U6XS 1BBDH 3GHPA 2E7LC 2PPCA 1R3JA 1EEQA 3UG3A 4I3RL 2R0KH 1A14L 2BSCA 2R0ZH 4MAZA 1YC7A 3OXRA 5CGYC 1FBIL 4KH9A 1M7DB 2YD7A 4EO5A 4JO3H 3IGFA 3IS1X 3ARTA 1GCFA 4F8QA 5EO1A 1TLKA 1YECL 5BOPA 4LCUB 4PGCA 4RAVA 5H37A 1BPLB 2KZBA 4UTBH 1HYRC 4ZMPA 4XAWL 4FQXC 1IU1A 4ZXBA 4NHCH 2QQLH 5DC2A 4UTBA 3FAWA 4FL4C 2IGFL 4R4ND 1CYWA 1J9TA 1E6OL 2FHFA 1BWMA 3RDJA 3QCVL 3D30A 4V33A 2GTWB 3IJHB 4LPCA 4XPFH 3B37A 4PJBE 4YXHL 4EXKA 1C08B 1CLZH 1G7PB 1V05A 3DRQA 3EGSB 4LLVB 4WUKL 5EBLB 4PPTA 4BZ1H 3RUGE 5I16A 1XR9A 1GGCL 1KBKA 3VXUE 4WFEE 4F7PA 2Y22A 3L4UA 4JFQB 1XH2A 1Y18B 3G08B 3VCLB 3NVQA 3RRQA 5FB8B 6PCYA 5IJVB 4JQIL 3PDOB 4WCYH 2ATKB 5GS1B 4H1LA 3DMMA 3VRLF 1DLHA 1QLFA 4UZGA 5D1XA 4OLXH 2O5ZH 4UV4L 3WBDA 1X5MA 5KEZA 1FFPA 1FN4A 1OD9A 3C8HA 4PLOB 3H9YA 4Y4KB 4LSSL 3VNZA 3BPCA 4X99B 4KXAA 5DC0A 3N44F 4NRXA 2XC8A 3QQ9D 5IW6B 4KOBA 1R75A 2QSQA 5EU5B 1FL5B 3QDMD 4JDZA 4PJ5D 1AZUA 5F9JA 3K91A 3RHWF 4NPYA 4XBGA 1TVBB 2JB5L 2WINB 2ZX6A 3L95B 4PCKA 5E2VH 4Y16A 4C55A 4EPSA 3WNPA 5GPRA 5ERWA 4YAQA 4FLOA 3ZK0A 1TKWA 4K07A 2PP8A 4JG0H 1QABA 3QDJE 5DJ6B 3VJ6A 4B9YA 4GQRA 3B9DA 3OKLA 2VRQA 1B3JA 3HZYB 4MYPA 4S1RH 1I8AA 1UXLA 2FJUB 2K70A 5DZJA 4XNUH 3WXWH 4DW2L 4QRTB 4B7IA 1OTUD 4OZFA 2N01B 5I66A 2GW5A 3MV7B 3RPBA 5A3ID 1KC5L 3K6DA 2D03L 2TRYA 2WQVA 1XGQB 3WTTA 3T0DA 1U8LA 3QQ4A 3DX8A 4BKTC 1R4XA 2YEZB 2M2DA 4JMXA 2Q7YB 3WE1A 3MGTB 2VDRB 1XF3B 2NTSP 1CXIA 4XHQA 4FADA 3T3MF 5DSCA 5EDXA 4D7PA 2E7DA 1U8IB 3V4VH 1JTPA 3QORC 5J0BA 1BF5A 1CDJA 5L6YH 3HAEB 4QRSA 1GW0A 1KIPB 1O9WA 4DO4A 4NYLB 1CFVH 5E6YA 3QNZB 4AXWA 4L8SB 4GXUM 4ZW5A 2RD0A 3FONA 4JL2A 4N8VB 1HJBC 4N0UB 4AYSA 3L9RA 4IBWA 3MACH 5SWSD 3UJTH 3RTQA 3M6DA 5JW3H 4X7DC 4AQEA 1MCPH 4LASH 4DP7X 1DE4B 4NN6B 3K2UH 1UACL 4U33A 1D6VL 4OZIF 2D3LA 4G9FE 3ZT6A 3UROR 2WLLA 1KGCE 4PD4K 3RGBA 3QBTB 3ZDXF 4I18B 1IBGL 1GH7A 4OSUL 3DSFH 3L4TA 1V7MH 2R69H 2WC7A 1I7TA 2WO4A 1A7QL 1IC1A 2I07B 1LEGB 1SDDA 3V4LA 2DLEA 2V9UA 3A4AA 4JHBA 4APXB 5ICZA 1BQHG 2L3BA 5KJ4A 5EN3A 1TZHA 1GMIA 2HT2C 3C9NB 5GGTH 3DX4A 5GSRA 4WDIB 2WNKA 4XP4L 4ESKA 4G70B 4NUGL 3K80A 3TASA 2WLZA 3BW9B 4G5ZH 4NO5B 1Z66A 2AS5M 4XPFL 4K15A 1FL3B 1ZVNA 2W07B 2HWZL 4PREA 4W9IC 5MERB 1R5IA 3S3DB 3JV4B 4WI5A 3PGFL 3S8FB 2E5EA 2J2ZA 3WMQA 1E27A 1GY2A 2DL9A 5AKRA 3TJEL 3MLRH 5JIHA 3A24A 4JFZL 1DN2A 3UTSA 4FLHA 4HFUL 2CDEA 3TPUB 4D0BA 3V0AC 4U49A 3ZZSA 3CMGA 1P6WA 3ULAB 1ZLUK 1DE4A 1M1XB 1OW0C 3R19A 4ES8A 3W2DL 5D4IA 4HEME 1FZOA 3D39A 2HRGA 3KLSA 1KIRB 2Z64C 1QBLL 4K7PX 2NY1B 4F2EA 5SV3A 5DHMC 4FLQA 2R23B 2W94A 4LLUA 2QV2A 3QEGL 3ZJAA 3BGFC 3W0WE 1CGSH 3IGUA 1HQ4B 3VYPA 3HE6B 1KB3A 2ARJQ 2EXWC 4JPVH 5HDBB 1DQLL 1X6LA 4QRQA 1JJUA 1TVHB 4Y0GA 3NZHL 2D4FA 5I82A 1XF3A 1E8ZA 4YSDA 4QCIA 2OL3A 2QQLL 4FXGA 1KCBA 3IJ9A 5B38A 3QIWC 1R5VB 2AJSL 1HL5A 1WISA 1G6RA 2EEFA 1H8SA 3V8OA 3L9YA 3MVSA 4NBZB 3RUGB 5I66B 4HUCA 1JYVA 2EVIA 5JDJA 1BJ1H 1EMTL 3ESVF 3NSCA 3QRGH 3X11A 3MHZA 4GBXA 5C6PB 1QOKA 1IAIM 2WOBA 1G4MA 1TJMA 3HNSH 3OG4B 2XNAA 3T4AB 4PJ7E 1VCAA 2BFVL 3QIBA 1G9HA 3NJJA 4UT9A 5H4ZA 3BAKA 1XGYH 2NNFA 4B3VA 4DN4L 5CP7A 1AQ8A 1PG7H 3GSNB 1CL7I 4C58B 2AJXL 1C16B 3BD3A 3BT2L 4HU2A 4RSYA 2CR3A 3DPDA 5FGSA 3UAFA 2HJFB 5HDBE 2NXZD 1B2WL 4LQFH 2HTKD 5GS2H 1F4AA 2KYIA 3GPSA 1WFJA 4EUPH 4YHML 1HDMB 2VR6A 4ODHH 1U0QA 4I2XB 3KYMA 3TO4D 1PYWB 2JK5B 4WW2B 1GZQB 2BZ7A 5E6UB 4Y89A 3BH8B 2B0SL 3K6FA 4NZ8A 2WSPA 4DKTA 2EE9A 4R4BB 3SOBH 5IWLC 1UD6A 4Q4EA 4R7XA 5KZCB 3A21A 3ZBMA 4LOUC 4RMVA 4NQSA 5D7JA 5J06A 1JZ6A 3PDOA 2R4SL 3B2VL 2Z91A 3F3HA 2J56A 5HYJA 2ITEA 3FTVA 3BWUC 2VC2H 4JFPB 3U83A 4G6MH 3KPSD 1CQKA 1S5IH 3QG6B 3AG4B 4ZTPH 2ZNXA 1NEUA 1ZTXL 1NLBL 1CGWA 4U1HB 4K4KA 1M6OB 1RSYA 3KWWB 2F7OA 4OCRL 3EDDA 1I1AD 4MCMA 3BEVA 4QHMB 3TA4D 1XAUA 4S0TD 2ZX7A 3NIFE 3D39E 3VD7A 4JQVC 4YGAB 2Y2WA 3CFEB 1PSKL 1RERA 4PGCB 3I50L 1BZ8A 4HV8B 4IEFB 4FYTA 1R3LB 3NCYP 2C9AA 4WY7H 4XP5H 5F7WC 5C09E 4CU7A 5CEZE 4MJ4A 4OKDA 1A7RH 1CG9A 3ZR6A 5BUGA 2PXYC 2H9GB 1OF2A 1E28B 2AQQA 5K9KB 3PFUA 4GJTB 5F7YC 2MTAA 3TJPA 2X4QA 3SDAA 4OM0L 1XMWA 2XWBA 1U8CB 2LFGA 5EC1B 4D0DB 1QI3A 2AQSA 2CRYA 4U6YA 4ZSOE 2FR4B 2G5UA 1OOWA 3AM8A 1CD1B 3RPIB 2XI9A 2MSPA 4LDOB 3HB3D 5DD3L 3VAEA 4Y1AA 2FYVA 1KENL 1JWSB 3IS0X 2ZKHL 1UD2A 2HRLA 1Q0XH 3LTVA 1GYAA 3CFDB 1J8HA 1DN0A 1B90A 3KJ4B 4I13B 3VX1A 2FO4A 3VFWB 2GJZB 4NBYB 3BUYA 4XRCA 4AYFB 3STZB 3QUXB 5D1QE 3TBSB 3MQIA 3LB6D 2OQJA 2FB4L 1WD9A 2WXKA 4PRDB 2BVUA 4ZD3H 3R06B 3NEOA 4YIQB 1AQDA 2XVGA 3KPTA 4YDKH 1I1AC 3ZQWA 2FE0A 4HWBA 1NAMB 4Z7QB 1OPOA 2VLME 4BQ9A 3FB5B 4JN2A 4BDVB 4WI3A 1ZLSL 1OAZH 4YBLC 3F7KA 4XPTH 5FUOL 3EXLA 3CC5A 3ARFA 1LJMA 2WMPB 1RUPH 2IQ9L 2NQDA 3D12B 1IBHA 2MNWA 2DRUA 2GIMA 1PZUB 4MCYA 5J9PA 4BWTA 3MFFA 1AZZC 5FO7B 1CXLA 2ZJSL 3HRZA 1EANA 5FF6B 5F6IB 3ZT7A 2WUBL 1IC4H 1UB5B 3KPSB 4N2EA 4TULL 4WW2F 4F8TA 1Z1WA 5KBKA 3MBWB 1JNLL 1IAIL 1QBMH 4IK6A 1M56B 3WTWA 3RILA 3T2PA 2ENJA 4LPVA 1T7WA 2FHBA 4XPAH 1ZA3B 1VKXB 5A7EA 3IBOA 1PG7X 4LHJB 3VI3E 4P9HC 1KCSH 1W72L 1Y07A 1JGLL 1RJLA 3MRRA 1H3PL 5HVFB 3ARGD 1JXFA 2MPAL 4WI2A 4MA1B 2JH2A 5GGQH 4AQ8C 1JHLL 4OVUA 5T1JA 3CHQA 4YBQC 1W0YT 5DMJB 4GKOA 4TKWA 4TXVB 3G6JE 1LE9B 3ETBJ 3FW6A 3VFSB 5JXAH 3T0EB 1VZIA 2ESVB 2AW2A 4N24A 4NKMA 3IJYA 4W93A 4YPGB 2JB6A 2G5RA 2XPGA 5C0GA 1R9FA 3STZA 4IRJC 1AD9B 1DQIA 1BYPA 4UQDA 5L4IA 4KTGA 5C0BD 2FO4B 3MUJA 4KDTA 4YDIL 2EIKB 2J8UE 2WBJA 2Z35B 3D06A 1LQBC 3LY6A 4P2QB 4U6XA 1FHGA 3K2KA 5KTEL 3NSJA 1R5VA 5GISL 3CCHB 3DMMD 3QIWB 4XCFH 1ASOA 2IADB 4OIFA 3S35H 3QA3A 3R18A 3QUYC 5C0DB 3VYOA 4G6KH 1J0JA 1J8HE 4N5ED 1M9WA 3FO1A 4F33A 2FX7L 3CZEA 1PLAA 4QJ5B 2DQIL 2DJMA 1KF9B 1JIBA 4PUBH 5D1QA 2HB0A 2DYPA 5DEJA 5F7HA 3DO4A 4Q14A 4MFHA 3UG5A 2AK1L 3BMVA 3HI6H 2F54A 1XZWA 3T0EE 1UXSA 3PPSA 4XXWC 5F3BA 2A6JA 5C6TH 4M5YH 3U36A 2Q76A 4TRPH 4X42A 1XH1A 4UQAA 3PQYA 4KPHH 4R96B 4LLAA 1K4CA 1TCMA 3UAAA 1FA4A 4F3FA 1AIFA 1NH6A 4AZ8A 4NZRL 1OY3B 1JZEA 1G6RH 5IVXB 3B3IA 1AY1L 4WSKA 2DQJH 1T66C 4OW6A 1NUGA 1HWGB 4GAJL 4IDJH 4D9RD 2CDEB 3TPUA 3FU8A 4D0BB 1I1RA 1LO5B 1T89C 4JO2L 1CE1L 2DQGL 4PJGF 4DQAA 5I1KL 4F9LC 2BOBB 1S7XA 2W81C 3KXFB 3TA3B 4Z8FL 3SPVA 4Z7QF 4TOYL 5I24A 2PW1A 3ELQA 3DPBB 4NKOA 3AQZA 3C12A 5L7XH 5LG6A 4OV5A 4GXVL 2I9TA 4HLZG 1J5OL 4DUWA 1FC1A 3A6BL 4AM0B 2XXGA 4ZOCA 3ZDZB 2BIPA 1NKGA 2H2PD 2KKQA 3V5HB 2OM5A 3W3BA 5HYJE 4HPHA 1ZPUA 2XHNA 5DQDL 4N6QA 2Q7NA 2KPNA 3L17A 4MA7L 3RWFA 2JK5A 4WW2A 4WFFE 3DV4A 2V6HA 2YSTA 4HX1A 1V3LA 5FHAL 4TSAH 2Z1KA 2IH3B 8PAZA 3HLAB 2XA3A 3HG1D 5IT2L 2BDNH 2C7UB 4QWWD 2ADGA 1EEZB 1YYLL 4ZTPL 4PJFF 2AMGA 2KUTA 4EZJA 1OSEA 5FCUL 3MV9B 2PO6D 3B2VH 1JPEA 2BMKB 3APDA 1D9KC 4WSGA 1R5WA 3ROLB 1K5WA 2D7TH 4RFNB 4F33B 2E7CA 3QC6X 5HTSA 3CFIC 2G60L 4TUJA 1UACH 4EIZC 2PCXA 2V2TA 4I87A 4LAQL 5I76B 3SY0A 5CCKL 1XHHA 3KBHE 4GMSH 2NR6A 4YSUA 1T0NA 4CNIA 3RZCA 5B38B 2AEPL 2YD1A 4LBAA 3DTXA 4BFGA 5D93C 1IKFL 5L2KA 5H37G 4UB0H 1OSYA 4P5KA 4DEUA 4K7PL 3U1QA 3F62A 2VDNB 3ZKNC 1LO4L 3MUZ1 5JIPA 2YEVB 3MLUH 2FX8H 4XMUA 1I3UA 4FQXB 4GKZA 2W60A 3SYQA 3PV7A 4ZUWA 2CLRA 1JK8A 5HGAB 3KDPB 3RWIB 2VXUL 2R1XB 1ZHBB 1T22B 1FPTL 5TGBB 5KBMA 2L7UA 3VFSA 2V5YA 3L08A 4YSEA 5AG8A 7CGTA 1AAJA 3HZYA 2ZKMX 2VZ3A 3IJEB 5IW3A 4ZMLA 5E8DH 3OKNA 3W11D 3W11C 2D9QB 2EAEA 4NI3A 2VDMB 5E6ID 4K9EH 3GMPA 5E95B 4Y5VB 4NZDA 2QPUA 1RKRA 3MROB 4IBVA 2IAND 1PS3A 3MLZH 1MREL 2GK2A 4HCIA 1XH0A 4NPYB 4P2RD 1YCSA 1DFBL 4N25A 4DGYH 2BM3A 2DQUL 4RGMB 4M4RB 5E99H 3KS0J 2WIIA 2B1HH 4U7KA 4ZFFB 4HUVA 1GPOH 1L4IA 2ICWJ 5F9AC 3R0NA 4NRXB 5EOTA 1PNDA 1TSHA 1LXMA 2BIHA 4I9XA 5F6IC 3HHRB 5IB3B 4EE2A 5K1JA 4UTAH 4F7MB 1JDAA 4JRXB 3ZRCC 3QUML 2DEWX 3KVQA 4N86A 5J5EA 3CBJB 2NTFA 1TJGL 4R7DA 3UZEA 3HG0A 4PJ7F 1HHGA 2NLJA 4Q9QL 3HNVL 2QVKA 3L3OB 4PJ9A 5CZKA 4QKXB 3FBQA 4FAAB 1KYFA 1A1MB 1BVKB 1U8KA 4GAYB 3RPKA 2B9BA 3S8WA 3GZOA 2FTAA 2DH2A 1IE4A 2ADIB 2QQKH 5F96L 2LE9A 1IM3B 1J87A 1YQ2A 1JHKL 3CSGA 4ES9A 2RGSA 4GIAA 5IHLB 3CFKB 5IVOA 2E0PA 1PD1A 3PDDA 5C09B 4YE4H 3SB3A 3QUXC 4HZAA 2HH0H 3BUYB 4Y7OC 3T65B 3OR7B 2GJZA 4XE5B 1RIUH 2QVIA 2X6UA 4LOEA 1RZIA 1KPVA 3MNWB 1S7SA 4XWOD 5IB1B 3RVXC 1J9QA 3FCSB 3U7WH 3NAAL 3UMTA 3S5LA 5FO8B 2Y6SC 1KXQE 4DP0X 3BRFA 4MA3B 3ZX1A 1KFAH 4BWUA 5C0RH 3X3GL 2A6DB 4L8SA 4DP2X 4G8GE 3CK0L 1U30A 5TPWL 3C8KA 1A4CA 2BIIA 2XFXB 3ES6A 3D5OF 1R19A 3CHSA 4JANA 3I02A 4AV4A 3A23A 1L6PA 2ZX9A 4UWQB 4XVJL 3H9SE 4XC1L 4Z3GA 1PCXA 2Z93B 4H5SB 2KLSA 4UNUA 2APVA 1F4YL 2CBOA 3C5ZD 1U2HA 5JW3L 3LRKA 5HXMA 1CCZA 3ME0A 5D7IF 2OLDA 1EDQA 2LGNA 3CDGA 1BLNB 3KZ8A 3QJHB 2AK4A 2B3RA 3QRFM 2Y72A 4I0PA 4H0HB 4EQ3A 1J5HA 3OKLB 4PCTA 5FC9A 1GRWA 4DP8X 4O9HH 5GZNA 1WC7B 2X09A 4G7VH 4WKZA 5FHBL 1I7RB 4Y9GA 2RALA 4OGAD 1JF6A 3FO1B 1OTSC 2A9ML 4GUCA 1EO8H 4Z7VB 1J0KA 1Q38A 1WCBB 3RVWC 5HHMB 2XWCA 1N2RA 4OCMC 3LD8B 1KJ3H 1QEXA 5HI5D 3B2DC 2IADA 4NWUH 4OF7A 4WENB 3MLYH 3V6BR 3O2DL 4LCIL 3BQUB 4TYUA 4NGHH 5HJGA 1BYNA 5K9JH 1HHGB 1JDDA 5A43C 1C9SA 3H9HB 3ABZA 1YQVL 4P2QA 2GJ6E 1VLXA 4R4BA 1JCKA 1UA6L 4L4TE 4DEPC 1MI5D 3ZZLA 4M7LT 3VGGA 4LLMA 4I8DA 1NPJA 2WBKA 4OZGE 2CDFB 2CIIB 3DK2A 3UBXG 3K4ZA 1HHKA 4IKJA 3BZ4A 4R97B 3G5VB 3SKJL 2XZCL 3FQTA 4ZFFA 1TFHA 2C1PA 5C0FA 3LVTA 3EYFB 3LKRB 3NQKA 3F7YA 3T3PF 2WVTA 2X44D 1QTSA 5DVLA 4NUJA 3QZBA 3JVGA 1X5HA 2YGQA 5JOFB 3T3MB 4XN8A 5F1IA 4JGMA 3FSAA 2N1TE 5H94A 1XB3A 2AEOA 1CFTB 3E2HC 3GMPB 4YUEH 2D73A 2FNBA 2XXMB 5EORH 3D07A 2XCMC 2FJGB 2A74C 4KTDL 4U1SA 4WIQA 1J5OH 3CFCL 5IHZB 4YDJA 3T8MA 5JDSB 1PGRB 4KRPD 2CHWA 3MXVH 1ZHLA 1JGUH 1W6LA 1FLRL 5I0ZA 5LXVA 4MGXA 1RZ7H 1JZDC 4PY7A 1A47A 4U1LA 5KJRH 2CLRB 2OSYA 3DI2B 3HRZB 4EZMA 3JWDH 5J9PB 1BQRA 4Y2DC 4BZ1L 3FQYA 3NA9H 3HPJB 4MS8D 2DWEB 4E41E 1CDGA 3NEEA 3JWNG 5E6RB 4CSSA 5KVDE 5L2KE 4A6YA 1JYXA 2F1AA 2JCCB 3VQLA 1KXHA 1KTJA 3VB9A 3HI6L 3FQ1A 4IOSA 3MBEC 3ULUE 4OV5B 4AV5A 5KS9A 3DPBA 1X5JA 4NKOB 4LEXH 3VGAB 5C86A 5JIQA 3RDTD 4MD4A 3KPOA 3KWVA 5KYWA 3LIZL 2XTJB 2GPZA 5HD8C 2DQIH 2HT3C 4I89A 3PWVA 4L4VE 4YHIA 5GGTA 1E0OB 4DK6A 1LO5A 1QYGH 1JTTA 2DI7A 5DA0B 3TH4T 2FQEA 2JI2A 4MSWA 1G9EA 1VERA 3SCMD 3IDGA 4RFOH 4R83A 5DGQA 1BVNT 4XRCB 3S3SA 3DIVA 3OQ3B 1T1WA 4HA1A 4E42A 4ERSL 1ZA6B 3VXNB 2BWDA 3BAJA 4NM8L 2G75A 3STBA 1B4RA 2MCAA 4M29A 4HX1B 5E0FA 2P80A 3ZE1E 4G6AC 2B4CH 3QJUB 3ARQA 3EUUA 3MCKB 1W80A 3GBEA 5CEYB 1NIEA 4XR8C 1FNFA 1A4JA 5DI8B 3TYFA 4K8RH 3BAEL 5EH1A 2J88L 4PREB 1AHKA 2Z65C 2O5NA 3H3PL 1SEBB 4HZ1A 1XGRB 1T2QH 5HPMB 4LZKA 4HJSA 3QI9B 1DEDA 1Q9OB 2X9YA 2NMSA 3V5HA 3MNVA 3GK8H 2IQAA 3WDIA 3EFOA 2KBGA 4KHTH 1JZ5A 1U8NA 1GIGL 1BG1A 5FDYA 2IH1B 1I8IB 5C3IA 2VMJA 1AHWA 1CTNA 1NAML 3CPUA 3ILPB 5DU7A 2I07A 1H9DA 1WA0X 2IAMD 4PVMA 3TA3A 4KQ3L 3CFEA 3SJVD 5CN3A 1PPIA 1F56A 1WZ1H 4HKZB 1G7HB 2R0LL 1GAFL 4NO2B 2BVOB 4OCXL 1IGTB 3SBWC 2MWCA 4FN0A 1AD9A 3QE5A 3BEVB 2QT6A 1QG3A 1UASA 5FKPA 4HOMA 1NCIA 1QBML 1QSED 4NN6C 1CD9B 2GY5A 2NW2B 4YFEA 4LU5L 3SCMA 1ETB1 3OAWA 1L9MA 2BY0A 4YL9A 4F3FB 5IVXF 3TLRA 5I19L 1BJ1J 1UVQB 4PWKA 3UAJD 2AABH 4JFSA 4AVHA 5DURB 3S2CA 3L9RB 1IX2A 3PY9A 2KL6A 4GSXA 4PJXA 5HVHB 1RP8A 3U0TB 2JJSC 3F5WB 3ABMB 5HYQB 4G3YH 1VA9A 2APXA 4EI5D 4M43H 4NQSB 4IRSB 2BSDA 4AH2B 2EIZB 4LVNC 1J1OL 1J0YA 1MW3A 5FYLD 4DNLA 1WBXA 1UG9A 5EUKB 1LWJA 2R39A 3WKNA 3VWJA 5CJ5A 4W9ZA 1UQSA 1C12A 3KM2A 5I6KA 1G7MA 4EIGB 3M1OA 3R8BB 4W6WB 2WP3T 1IGMH 3WYRA 1YPZF 1RZGA 3IJSB 4JFDA 5DMKA 3MV7A 4PWFA 4POUB 3TX4A 3GZQA 2J7LA 4XCYB 1S8DA 2WB7A 4NNYA 3B1TA 3VI4A 4KOCA 5DFWH 1N0LA 3FO2B 1RJYA 3SJVA 3F7PC 4QXWA 4MS6A 1FRGH 5JHAA 5D4JA 3B2XA 2NDGA 1HVXA 4QRPE 4BYHA 1FQ9C 5ABAA 3TV3L 3W5NA 2X88A 3N1FC 4H8VA 1KTRL 4WV1B 3NH7H 1AGEA 4OT1L 2QR0B 3Q48A 3D85D 4FKKA 4Y16B 5KG9A 1TYEB 3MRCA 4OGZA 3F00A 2HT3D 4POYA 4UCFA 4AIEA 1MLCA 4K73A 3CU7A 1X7QB 2DOCA 4MMYB 4JM2D 4X4YB 5IW6A 2Y2YA 4S1QH 4D9LH 3WJMA 2KLTA 4K8RD 3RX8A 3TXAA 4DCQA 5EO9B 1FFPB 5ITBL 1BAWA 2A77H 3DXAE 4HDIB 1MQKH 1L9NA 1T89A 2NNAB 5LG1A 5BCAA 2NCMA 1FFOB 1IC0A 1IGIH 2XDHA 1PFOA 1AI1H 1JWSA 2X4UA 2FO1A 5JUEH 1HH9B 1TZOA 3C2SA 3MV7D 4AUUA 2WCSA 4R84A 1TJHL 3CBKB 3EXJA 1UCBH 3IFLL 3PWJA 5HGDA 1M7IA 3L81A 4NQEB 2V9QA 4OLUH 4HJIA 2P7TB 1N0XL 2WXOA 4ZYKA 2C3VB 3FQXA 4GKSA 4P4RA 3MLXH 3L7EA 4U4BA 1C5CH 1UZ8B 2OMTA 1HINL 3P0YH 3FSWA 3QT2A 4M62H 4P99A 5E6IC 1NCJA 3H9ZA 5F9WB 1Q1PA 2AGJL 3C60B 4EN3B 1FVEA 5IESH 4L37A 3KPRE 1CICA 4LL9A 1SZNA 3WLBA 4PU2A 3KCPB 1BW8A 2F53E 3CXDL 2BNRA 4X98A 1FVEB 3L4VA 4G8GB 2Q8AL 1A1OA 3CSYA 1QHPA 1YNLL 2IDTA 1FSKC 5JQHC 5E1HB 1PNCA 1DVSA 5CD3B 5FYKU 5JLZB 3AQDA 3KWWA 2C8NA 2KDGA 3NJIA 2ZF9A 4R3SA 3WFCH 5IQOA 1CTOA 4YGVB 1FH5L 3LAFA 1B2WH 1KXTA 4WU7B 5AYQA 5B4MC 5CGYD 5KSBF 4O51B 3H2QA 3NIDF 4FQLL 1IGJB 2HN7B 4Z9KB 3OV6A 5HJDA 2WQRA 2CMRH 3IDMB 1WPCA 3LEYH 4MXVF 5BV7L 5B1JC 1OZUA 3LRGA 2I60L 2WXPA 3D9AL 1G1CA 3Q3GA 2P52A 3VXMA 2FR4A 4FF9A 3IDXH 3OX8A 3KPQB 1HZLA 2CPCA 1DUZA 5DJ8A 3WGUB 5I8CA 4R90H 2AI0L 4G6AD 4A2MA 4LXFA 4KKBD 1OF2B 2C5DC 3I3EA 4N0CD 1KCVL 2VAJA 3QRGL 2XVBA 1MCLA 2B20A 1O7DE 2R83A 4FA8A 4CMHC 4G42B 3SKMA 4HV8A 2HT4C 2H26B 1CYGA 4MD4B 1J11A 2VDPL 5TFSH 3QZLA 4LAJH 2WKOA 5EZIH 2NRDA 3W9DA 4JGNA 4Z3TA 5CJ8A 5I1AA 2W0LA 3EBHA 4FMFA 1D5ZA 3HI5H 2X4RA 3QDGE 1IFHH 3QNZA 2NY6D 4FXGC 4TTGA 4WU5A 2J55A 1I31A 4ZPVA 2R29H 1Q4NX 3ESMA 3PQYD 1HHIB 4XPGH 2VXTH 5J13B 4N2OA 2K0RA 2AEQH 1DVFC 3M86A 4QNPF 1NGZA 5DD0L 3UTTE 3WY4A 4JREC 3D6GA 4M7KH 4XWGL 1IBZA 3PQYE 4WLCA 1A8JH 1AXTH 2VDOB 5DMIL 2NY1D 4NJAL 3FFDB 2JV6A 4OCXH 2EIDA 2IFFH 2YOAA 4G7YL 1GAFH 1U91A 2OYMA 4XCYA 2A6KA 4XHJD 1INDH 2VW6A 1PKQA 1VGKA 3NACL 2CJ3A 1I4FB 4JHAL 2KZKA 4MAYD 1KOAA 4L3ED 4GG6A 4OBSA 4WHYG 5A3IC 4KTYA 3DJTA 1FIGH 1DFXA 2BNUB 1J1PH 3GK8L 4TLKA 4YH6A 5E9DD 1JZ4A 3ARBA 2X2YA 5E6ZA 7PCYA 2GCYB 3I3DA 1TEGA 1E4XL 4HGKC 5BS0E 2IBZY 2VLRE 4IRZA 2XQBL 4UV7H 2EVJA 4LLUB 4NDMB 3VGHA 4EN2A 2KHAA 4PJXB 1TVDA 3GJFB 4N8CL 4WWOA 1ZVHA 2BWQA 1HEHC 1IM9B 3EDEA 4GUPB 1JRHH 3QWRA 1RVFL 2BNRE 2GFBA 3UGEA 4YFLF 2H8PB 1QAWA 5CFAA 2IGLA 1EA9C 2YPKB 5FW6A 2Z31B 2PTVA 2VMDA 1MHPL 3L9EA 3Q5TA 5ELIA 4R26H 1XF5B 1CXFA 3LZFH 2R8SH 1XH3B 2ZP9A 3MLTA 4R7NB 3X14B 3ZMRA 2QDVA 1MHEA 5INDA 4BA8A 3BDXA 3BQUA 5FHBH 4P59H 1KT2A 4JS7A 1FFTB 5JPMB 4QCIB 2OA9A 2SEBA 1E5CA 4KROC 3NG5A 2HLAB 2CO1A 2R9HC 1KN2L 3CFNA 5ADPL 1REIA 2WWNA 1OB1B 1OTSD 1ZS2A 5J1SC 3EFFB 3EIFA 3KGRA 3GBNL 2PPFA 2Z0BA 1FRGL 1QSEB 2DDQH 3JYCA 1DANU 1F4WL 5F44A 4HMCA 3V9FA 1IM3D 1JS4A 3VTTA 3WNOA 3Q6FB 2A73B 3IKCA 3L1OL 4PJXF 3TBWA 4RMQA 2DQFA 1NCTA 3IMUA 4PRPB 3GLZA 1S2EA 3VM5A 1RPQA 1RZ7L 4FA6A 4JR9H 4M93C 3HMWL 2WLLB 2QBWA 2OJ1A 5MENE 3H42H 5DUMH 4M6ML 1OP4A 4OI7A 1JF5A 1IAMA 3ARGC 3VE0A 5FS5A 5DVKA 3BN9C 3AY4C 4YSTA 2WM0A 2ALAA 4ZUTB 1RUQH 2FIKA 2OMXA 2J2ZB 4QXTA 4N0UA 5AZ2H 5FCSH 1BBJA 3DLQR 1BIIB 3NFSL 5IW1A 4G59C 4WI9A 3GBNH 2A9NH 4OZ4A 4BHUI 2CRZA 3NOIA 4NOBA 4L9DA 3NJXA 4PCYA 2CGYA 5AOLA 5T8IA 2F53B 4EN3D 1Z9PA 5IROC 1IE5A 4QRPB 1KPVB 3BFQG 4PLKD 1Q0EA 5ETUB 2H7WA 5HHME 1L3WA 2OS7A 3O6ML 4RAUB 3IFNL 3WJLA 3DHPA 4OD3H 4MHHI 4I0PC 2Z8SA 2FYYA 3T2OA 3G6DH 2W91A 4WK0B 2NYKA 4XP6H 5GXBB 1ZGLM 1E4XI 4H8WC 1U92B 2GB2A 3HNVH 4W6YB 4LSVH 2DD8L 3ZKMD 1IM3A 2GSIB 1MRFL 3VD2A 5AW7B 2F8VA 5E8OB 1F13A 4H0LC 4PJ9D 4JY6B 3MLYL 4LIQL 4WEMB 1YMHB 2BNQB 4U3SB 4L1DA 1HSAB 5H8DA 3KPRA 3MRLA 4X4XA 4X7TB 3LQAH 5F2FA 4NP9A 1EO8L 3SE3A 3LKNB 2DMGA 3GXNA 3TT1H 3BCFA 2XPZA 5B1AB 5D7EA 5DRXB 2NTFB 2WO3B 2KZ1B 1SBSL 3CLFH 3MRGA 2FK9A 2FSDA 35C8L 3NZUA 4X6CB 3PF2A 3DO3A 4JB9H 4PJFA 4YL4A 1TCRB 1YYCA 2AJXH 3D1MC 5BJTB 3QQ9C 2ADYA 4K3EH 5A2AA 1OK8A 4PWIA 4G8AC 1OAUH 5I18H 5I28A 4JPSA 5GRYA 4O58L 4NYLA 1KV3A 4QRSB 2GEEA 2Y1AA 3MRFB 3QUZA 4NQEE 3PL6B 1YEJH 8CGTA 2NQCA 2VZSA 4QR7A 5TQ0H 1MWAL 2WVVB 1OGAB 1F4YH 3B9KC 2BJMH 4HSCX 1KLGB 4PH8A 2YPLA 4XVJH 2PYEA 2MKWA 4XAWH 4NO0B 4UTBL 3MUUA 2X2HA 2ATKA 3BSHA 3PABA 3N41F 3LN5B 1T1YA 2AJSH 4B0MB 1CDIA 1E50A 3GJEA 5EBGA 2G30A 1JGEA 4PJHF 5K9QG 3HCVA 1GXEA 1NJ9A 1LO4H 1SDYA 4QDGA 2X05A 4L9LA 1PD6A 3UJJH 3MUGB 1E2ZA 1NC2B 3VXUB 2R1XA 5DD0H 1I3VA 1BJ8A 1AZRA 4LMQE 4XI5D 5IFAH 3TZVC 1OB1A 5ALBH 5F9OH 1ASQA 4G80B 4F1ZA 1TKWB 1N7ML 3BSZA 1OP3H 1IFHL 3MCG1 3OBAA 5C07B 2VLKA 3AXLA 3QZWB 1CURA 2GIXA 1VFAA 4J6IA 4RMTA 2PUQT 4UT6H 5AZ2L 1UM6H 4IRSD 5JPMA 4XCNB 4GBXC 1VPOH 4UZSA 3N0PB 1UM4H 5BO0D 4TF4A 3C6LA 4N0UE 3TH3T 3VI3A 5IFAL 2O6EA 1JUFA 3ETTA 1MHEB 1I75A 2QVTA 4EUPB 2JKTM 2J1XA 1Q9LA 1NGWB 2J1YA 1F45A 3REVA 3VDCA 4AGOA 3QQDB 3QUZD 5KYNA 1AFVL 3G6JA 4BKLB 2HT2D 1V27A 2MQ3A 4KXBA 1PKQE 4QRAA 3RFZC 3MI6A 5F1KC 5F89A 4NQCA 5ANMA 2KT6A 5BV7H 2W95A 3MX0A 1XF2B 3GSWA 4G71B 3DO7A 3SDYL 1UGNA 2WKOF 3RX7A 1NDMB 4KMTL 2TSAA 5D5MB 5AUMB 1FVCB 2Q1EA 5FYJH 5IWLA 1DDHB 1QSFA 2PPDA 1CN4A 3TS8A 2GUYA 4D94A 1J05B 4LVOC 4MCZB 1WA2X 1DP0A 2EDTA 1YNLH 5LAPA 3MRLB 4X7TA 1OAKH 4MQSB 3QC5X 3VG0H 4ZFOL 5E24E 1SY6A 4MTMA 5HYFA 1AE6H 1I8MA 3ABLB 2VQTA 1ET7A 2HG5A 2Z8VC 3CZLA 1Q0YL 2GJRA 3T77A 2F1BA 5AAWA 1ROCA 4K9EL 1WSST 4LRNL 5D4HA 4JDVA 4LEBA 1AR2A 1EJOL 2QZQA 2R8SL 3LZFL 2WYZA 1FNGA 1SQ2N 5F1OB 1VEOA 2EH8L 1DBKL 4PBVC 5FYJE 3J2PA 1OE1A 4J1UA 5E4EC 1S7XB 4X4ME 2Q20A 2NY3C 4FEMA 3KH4A 4ODUB 5AYUL 4ZTEA 1HHIA 1M4KA 3S3PA 1KJVB 5HYSB 4PV9A 2Z1PA 2FECI 1KB5B 1NC4A 3CH1B 3HE7A 5G2NA 5C9KA 3QAZB 1OGSA 1IFRA 2LV4A 1IEBB 1ES0B 4MJIE 4DQOL 1FE8H 2C3GA 1CFSB 2F7IA 4ZG1A 1QZNA 2MNUA 2F7PA 1DUYB 4UINL 1I9EA 5I1LA 4ZUSA 2Y5TB 2ZIDA 1YYMH 3LNDA 2VDRH 4RH4A 3DNKA 1RI8A 4X5XA 2XY1A 1NM4A 1QFUH 3IFPB 3L4CA 5L8LB 2VXQA 2EC9T 4JE4B 4LRIA 1HI6A 3FUFA 3I9GL 4JVUA 1Z32X 4KHXH 5SWZE 1QNZH 1MCKA 2Q2LA 3ASOB 3ECWA 3ULUH 3NACH 1KJMA 2E56A 5I8CB 4OUUA 1MZYA 3RU8H 1A22B 2BNQD 2DPKA 2CO7B 4MDRA 4C8XA 1S3RA 1AXTL 4HFWB 3LH8A 3GSXB 4LGRB 2V7NB 5FOBB 2WXFA 1CDUA 5EZPA 2WZ0A 3GUTB 2H0PA 2MCMA 3HC0A 2XZAL 2DIBA 3M8OL 1K5NA 1L3NA 4H8WH 5LCVL 2W60B 2VL5B 5DJDB 2B08A 4BFIA 2A0LC 3VXRE 3DUSA 4R3SB 1TXKA 4ILDA 2BW5A 2IDSA 3BLKA 2V2XB 3H0TA 5C0AE 3MRPA 2P24B 3JWDC 2IH9A 3HFMH 12E8L 4RVBA 2OYLA 4CNIB 2WXIA 1FNSH 4I48B 2YGPA 4YE0A 4CU6A 4A2LA 4K7FA 5IM7B 5I17A 4HCRH 3UAJC 1GA2A 2E4TA 3ATEA 1IT9L 2VITA 3CLEL 5CIPH 2JKSA 5D96B 4P5TA 3DROB 1A7NL 1MI5B 4QNPE 1UZGA 1BZ9A 1IC4L 1BF2A 1V8HA 3CVHL 3T8XA 4RGMC 3QWOA 2H32A 5JTWA 5DJZB 4R26L 5ABDE 4GUOA 2DLTA 4Y1TA 5GGSB 5DT1L 3VFGL 3BQVA 3EO1B 4YBHA 4G6FD 2AABL 3QDJB 1U36A 4U1GC 5E7FA 3D4ZA 1PZ5A 2GCYA 4LNRB 4G1MB 1FFOA 2OYKA 3F65A 1Y7VA 3SKOB 5LVEA 2DQUH 2JLPA 4XPTL 4H7VA 1XR8B 1ZY9A 3TF7C 3G5WA 4HD5A 3ZO9A 2JJSA 1E4HA 3DX7A 3NRPA 4GG6B 4DPAX 3GXTA 3RWHB 1SGKA 3V5KA 2HX7A 4JDEB 1CR9H 4L5FH 2VW4A 1RK1A 4GKLA 3P0VL 5E8PB 4X4YA 2A6KB 2FB4H 1E4KC 3GRWH 4QYOA 2NYYD 4X7FC 3RZCD 1SJEA 1WD8A 4Y5XA 1HWHB 1NCOA 2LVEA 2X70A 3DXAD 5IHUL 4R2GB 3Q9QA 5AOZA 1INDL 4GEIA 2P5WA 2AV7A 1M2VB 2LTQB 4TM9A 4PG2A 2HAZA 4J4PC 4XNZB 1E67A 5C0EA 3UYRL 4P5TD 1WT5C 4B53A 1QPXA 3N1QC 1IC5H 5I6XC 2L7EA 2NY0D 2WD0A 3DKHA 2NY7H 3BSGA 5L4FA 4PLJC 4Y9FA 1J12A 4HSQA 5AKSA 4F8PA 1NZRA 1RJZA 1VF5C 4AV0A 3M7FB 4F93B 3CX5K 5JXAL 5TDNA 4HETA 1JVLA 2CRMA 2M26A 1QZ1A 2OMYA 4MRBA 4U1NB 3SDCA 1JN6A 1PZSA 3FT4B 2K3TA 5AVYB 3HS0B 4POZC 3VWJB 4PRID 4IBYA 3PP4H 5EU3A 4AY0A 1Z3RA 4E9TA 3A6OA 5KYUB 3FK3A 4MJ6A 1K6QH 2AI0H 5I74C 5JIDA 4KJPD 4MNQE 2WNXA 4WHDA 4RISL 4NC0B 5IV2A 2OXHB 4NEHB 5D8JH 2ZONA 2NXYB 5ANME 4MASA 4KKQA 2ZYHA 4K3HA 1P5UB 4NC1E 3O9WC 2FHCA 4UAOC 4QHMA 2Q10A 1T0OA 5C0EB 3LH2H 5GRVL 2BVOA 4U1IB 3MOBH 1TEYA 3HR5B 3IJYB 1G5GA 2ZF8A 2ADJB 3BJLA 1FLRH 4F2MA 3BESR 3HI1A 2YWZA 1EHLH 5B3JE 5D2LA 3V7AG 3ARDC 1R3IH 2VDNL 4MQXD 5JQ6H 1MY5A 1JBJA 4GXVH 1CUOA 4YEEA 2XX0A 3ILQC 3Q1SH 4DO6A 3EO0B 4LRNH 2ZPKL 3T6VA 1L6XA 3B9KD 4LARL 2B1OA 3O3BB 3UEZA 1EHLL 3SDCD 5I23A 2ICEB 2OMBA 2XFGB 2DQGH 4LFHG 1NGQH 2WXJA 1QX1A 4IQHA 3FN0H 1ZA3A 3GSRA 5DWPA 1L7TH 1KCUH 2MTPA 3RJDA 1WEJH 1ZANL 2DQJL 5B1JA 3MDJA 2JKLA 3A6CL 2C3WA 4WO4B 4BZ2L 2W9DL 5CCJA 1Z2KA 3T2QA 3FUJA 2XZZA 2HCZX 4HIXH 5A2KH 3U4BL 3UIYA 4GO8A 4JFYA 4FKEA 3T08A 4KPHL 5IJCC 4S1DD 1LNUA 3JBG7 5EU6A 3RA7L 4AW4A 3SE9L 5ACZB 3V4UL 1UYWH 1GCYA 3TBVB 3LXUX 4PGBB 5IOKA 1CZ8H 1MIEH 5EO9A 1A3LH 4WSJA 4KXCA 3VXMD 5KBLA 1AGDB 4QKTA 5FYLH 4J3OD 3SDXF 4YWGH 5L0QC 1X7TA 3L3JB 4K3JL 2BY2A 4P5TB 4HOZA 3FO0L 4FYQA 4KKCD 2YAFA 1GYCA 1SJHA 3WIHA 4XOAA 2CU9A 1FGVL 4IRJA 3UBGA 5ITBH 5HHNB 3VXME 4Y4HA 2OW6A 3GHBH 4OIBA 4L9LC 1FC2D 4P8QA 3D52A 1ETJA 1A7PH 2X89A 3RUGA 5DHYB 3I50H 3O6FD 1MNNA 5FO9B 4KJQC 4ELKB 1T2QL 4F1SA 2K1MA 1OT4A 3FJTA 5AZEL 3V5KB 1N5AB 1MXGA 3DOHA 4M9OA 1E8YA 1TZGL 1WAAA 2J5LC 2QMKA 2OSXA 4KJYA 5GRUH 3VO0A 3IE4A 2WGNB 4TQ8A 1XR8A 4TVPE 4Q97A 2GI7A 4ZNEE 4LHUB 4X7SH 4ADIA 1QRNA 4OCRH 3BH4A 1ZWIA 3BGMB 3UYOD 4QRRB 2Z7YA 4QTHB 5DR5L 4Z7UA 2O1AA 4LSTH 2RMNA 3E1F1 3ASNB 4G8EB 3AS2A 1CK0H 1MCHA 1NGXA 1T1XA 1E9QB 2JKXA 5KSAB 1AKJB 4K3DH 3APMA 1W91A 2WTOA 3U9UB 1JGDB 3VVVA 3D0AA 3JUYA 1YEDB 4U1KB 2Z34A 3G04A 3FT3B 4BZYA 2VXQL 2EDNA 3LIZA 4BUGA 4N90D 3CZJA 3OD3A 2CUHA 2DY2A 2V2WA 4IHBA 5I17B 2UWEB 5TE7L 2ZOLB 2QHRL 4JZJA 2FIRT 4M43L 4XBEL 2OMWB 1KB5L 3MGAA 1DUYA 1ORSB 3PWNA 3T4YA 5I18L 1HHKB 5DGRA 3S88H 1BPVA 3VD0A 4QLRA 3SE4A 1R5IB 2Y1VA 5CWSA 1CO1A 4YE4L 4NLHA 5B1BB 3H0TB 5D2NE 4DN4H 4AL8L 3CDYA 3EYQD 3IWVA 3BHBB 4OLZL 4ZOAA 4BCZA 2FRGP 3LZRA 4OIIL 5IHWA 4LLWB 4WGVB 5D7JC 2DQCH 3BYTA 3JSSA 3RTLA 4HUMB 4P9MH 2WV3A 3CHPA 1HILB 4WJ5A 5LGKA 3VRJA 4LO9A 1JXKA 3HVNA 4ZMQA 2BRRL 2CM5A 2HZHA 3GSXA 2YPVA 1P4IL 4FI6A 4JFPA 4NUPA 4XMZA 4LSUH 1MEXH 1JVKA 3KL0A 4M3HA 2Y7QA 1MRFH 3T6WA 3MNVB 5D7JB 1FH2A 1J5DA 4X6CE 3MUHL 3TCXA 2V17L 4NN7B 4UNIA 5SWZB 4Z7NB 5BQ7B 5D7LE 3JV0A 5HP5A 1LO2L 2XZQH 4BCXA 5T1KB 1S4IA 2XN9B 4L48A 5FKAB 3L4YA 3CDGB 3PREA 4QUOA 2CHXA 2AJUL 4QXUH 1RJZB 1J9SA 3LDBB 2G4EA 3H3PH 4I3GA 5ES4B 1QFWM 4ABWA 4JRYD 2Y3AA 5D2NB 4HS8L 2R69A 1CQYA 3EF4A 1W0VA 1A7OL 3L2LA 3KR3L 3K72B 4MAYB 4DK3A 3J27A 5HI4C 2I9LA 3KLLA 1MLBA 4MVBD 3WS3A 5KVEL 4KJPC 4PJBF 2V33A 5AVRB 2AV1A 3EG9A 5AW8B 4CBPA 3BIKA 5DMGD 3B6SB 4J7RA 3MV8E 3ZHLA 1TZ8A 3ZUNC 4J3WA 1S7VA 3CVIL 3U79A 1O9ZA 4NP4L 4HFUH 3DTUB 2XU9A 3EJYC 4EUPA 5TQ2H 2JCCA 3S5LB 3S4SA 5FO8A 1G6RB 1HHHA 4QHNA 4X5PA 3AAZB 3X1FA 4B0MM 1S7QB 2Y7MA 2ZXGA 2NXZB 4JLRA 3NCXA 2NY6B 4ACTA 1NC4D 3PXLA 1HIMH 1EXHA 3LN4A 1PG7W 5MEQB 2I69A 4G9DB 3ULVC 2ZKXA 1L9SA 1MH5B 2IANA 3NSDA 3G3LA 4G5ZL 4H8PA 3RVUC 4UDTA 5ERWB 3AROA 5IQ9A 1NLBH 3UTSD 3L3KA 3R1GH 1S9KC 5A40E 1U8KB 1DLFH 2A4EA 4YPJA 4KKLD 4C56D 5B7MA 4PJCF 5IR1A 3M17B 2XYCA 2AQ2A 3RWGB 5HYIA 5MP6L 4PB0L 4HIJB 4NRYA 4N2CA 4Y4KA 5BV7C 5KSVB 2B5IB 1L5GA 4QHLA 4EI6B 4AJWA 3CFCH 3CV5A 3D0VB 3FU7A 3GI8L 4XO3A 4KTDH 3U4AA 5DC9B 2XTJD 1DLHB 1MPAH 4PJAF 3OAUL 2BHYA 1JL8A 2F68X 5C0FB 2PETA 1N3NB 1OL0A 3EH3B 5GGVY 3O81A 4AVKA 4U7SA 4FXKA 4XX1E 5DLMH 1BOGB 5FW7A 2YHGA 4KMTH 4QRBA 1MFEH 4YZFE 5FECB 4O5LL 3P2DA 3GSRB 2HKFH 2DJUA 4WWKD 3KGUA 1J88A 3Q2NA 4BH8B 4X6CA 4M03A 3I84A 3P9LA 2NW3B 5ISZB 3VTAA 3N42B 3U2JA 1ETZA 1M9SA 3EOBB 4JO4H 1UTDA 3BKCL 2CHDA 4W1TA 1O75A 1ZSDA 3ARDD 1ODAA 3RVWD 1RFDL 5C3TA 3SE8H 1IIIA 2IEPA 1SDDB 1KLFA 3KPMA 4E0RA 3L3KB 2ZXDA 4PJCB 3V0WH 4KZDL 4NAMA 3DGGA 5CP3A 3HB3B 5GRJH 4UDTB 5I5RA 4UUJB 5IY5B 4E5XA 2HVKB 3FXIC 4ZUWB 4LCIH 4PTUB 4XNBA 3E7JA 5E00B 1UM6L 1AANA 2YPVL 1P5UA 1XIWC 1Y6NR 4JNXA 3P40A 3QXTA 3SGKA 2JVUA 2P1YA 3ME0B 4JPVL 4OFVA 1YAIA 4WTQA 3ROOA 2AHIA 2HRPL 1V5JA 1C5BL 2E47A 4QXGH 1EHXA 3S2AA 3GRGA 3HC3L 1LGVA 4KX8A 2KPWA 1RLBA 2J57A 3HAEA 4K9JA 3BIKB 1DJYA 3FU5A 3CN2A 3GMMB 4P2OD 5B22A 1E3FA 1KTDA 4HJJH 1FCGA 4A63A 2P4AB 1KGJA 1MJ7L 5IOPB 4UQ3A 1DEEB 1RK0B 4JY6A 5JZ7C 2WLIA 2WUCL 5AAMC 3VFRA 3S96B 4GP4B 5C8JB 4LLDA 3J07A 2ZG1A 4ZJ9A 1RV6X 3FCTB 2DMBA 1U92A 2DTSA 5AKTA 4F8NA 3WHXA 2L7QA 4NQUA 3H2PA 3ZDXB 1Q72L 5IEKB 4O5LH 4XNZC 1CGYA 5F1NB 1ZHNA 4LF3A 4G72B 1QSFD 3SE3C 3S88L 1ETZB 3K71B 1ECYA 3H9SA 4W70A 3UC0H 4ORGB 4CVXB 3GSVB 4ZMTA 4HUWA 4W9EC 4UQCA 1VFBB 1DDHA 1EJ6A 1QSFB 3QUKB 1Q8MA 4FNSA 2X38A 5ALCH 5DRZB 5CD5C 1T4WA 1TMCB 2AJ3B 4ZSOA 2VDKB 5SWZD 1U8PB 4NQCB 5EU4A 2YAOA 2OMXB 2R69L 4F7TB 4TMPA 1JMXA 3O6LH 1WP6A 1X5KA 3B2MA 3II1A 4LSVL 4U1MA 2WSKA 5KVFE 5EG6C 3X1GA 5GGRB 2GK0B 2BY1A 5DJAA 3GBML 3HLKA 2PWGA 3I6KA 4EZKA 1ZAGA 3EGXA 1F86A 4GBXD 4JRXA 4PJEB 1NGWA 2YQGA 1UB6B 3KCWA 4EI5C 4TSAL 5DK0A 2VH5L 1BECA 4L29B 4NC2B 1NCWL 2ZJSH 5I73B 4U3HA 1F0LA 1IC7H 3Q6FA 1SOXA 3MSPA 1U4FA 2XVKA 4NM4L 4LRIC 2WLYA 3RURA 3HS9A 1OCWL 4O2CA 2VLKB 1ADQH 4DWHA 1G4RA 3QR2A 5HPOA 5AZEH 4FQQB 4F7EA 2Z4TA 4K3GA 5D96C 5F88A 5KBPA 1CS6A 4BWWA 1DJZA 5F72S 3VFTB 2YAQA 5KSAA 2OTUB 3TO4A 2Z92A 1NC2A 3IJEA 3VYNA 3VXUA 2A77L 2F7RA 3L13A 1MREH 4W9KC 2BSRB 5ESVA 3AMKA 4IDLA 3NK4A 5C0DA 3L45A 3ATDA 1G1OA 1IJ9A 5LXGL 2E3VA 3WO3B 3GMQA 2ORBL 5HVWA 3FPXA 3II3A 4IU3A 5I8KH 4AITA 4N0FA 4ZD3L 3BISA 2W9EH 4I48A 1DVTA 3S4SB 3HB3C 3Q2VA 4M9PA 4DP6X 4PRIB 4EVNB 2DYPD 4M1CC 5E1AB 4ZX4A 1AMXA 2ZOWA 2F19H 4ONFL 3UPRB 2OR9H 4P5KB 1LO3H 1ONQA 5T1DH 1B0GA 1A6PA 2GJJA 3IK2A 5DRWA 1TTFA 5EIVA 1YNTB 2X9ZA 4GW5A 2F74B 4JZNB 4YDNA 5D7KD 3L5WB 1A7BA 2Y7NA 1EEUA 3L6FA 3LYRA 4K8RC 2VDPB 1H15A 3E6HA 1TTCA 4K5OA 1XGUA 2XZQL 4K7PH 4NQXA 1KCUL 2D7NA 2WNWA 4GXUN 3U4EB 1P9MA 1WFUA 4QJ4B 2NX5A 1THAA 4LHQB 5GS1C 4P9HL 1R24B 4N68A 3TEWA 3D08A 1RJLB 3MRRB 3QIBC 3H4FA 3WNMA 3RWEB 4L4JA 3L5XH 2QFPA 5HD8D 3VD4A 1TJIL 3NCMA 1QATA 1HH6A 1KBGL 3ARWA 3PWPD 4TNWK 3WAJA 4P48A 3WTSA 3NIFF 3FN9A 2I32A 2CAKA 1A21A 2BOCA 5DFVD 3CSFA 1UB5A 1CFQB 3KPNA 1U91B 1OCOB 3HJEA 5LAXB 1ZXQA 4JFXA 4MCYB 4Y1AD 3BP4A 3EH1A 4X8XA 3SHSA 4J3BA 4PEEA 5E5RB 3HN8A 1E4XH 3QCUL 4LOFA 1CLZL 3CVCA 2VDQB 3O3BA 5H2BB 3BHBA 4KRPB 4DZBB 2LHAA 1UADC 4WU5B 2NUTB 3QCVH 2VC2L 4L4TB 3EZJB 3L2NA 3KCPA 1ZEAL 4FQJL 1KJ2L 2NXZC 1V55B 2JKNA 1JK9B 3VXQA 2X1PA 2LR4A 2UZYA 3DYMA 4YS4A 4EAEA 5E7BA 3HUJB 4GQ9H 4L37B 3H2WA 4AQ1A 1FNLA 4XCEB 3LIUA 4UM9B 4PRNB 1MHCA 3VFPA 3EJPA 4KJWD 4MNGB 5KBDA 4LSTL 4HJUA 5DZNA 5C70A 3HZKA 5EZJA 1J05A 4BRVA 1R24A 2R0KL 4P4KC 1QUNB 5FK9B 2XXFA 4HIQA 4M8QA 3ZTCC 4HK0A 3NQIA 4NQXB 3DVNA 5E51A 3HI5L 4FJZA 1G7QA 3QNFA 1NANH 1DDTA 4KGJA 1RHHB 4F20A 3DV6A 4ETQB 3CIAA 3WMSA 3PHSA 3MPCA 3IDIB 3L1FA 4BE6A 5J1TC 1U8CA 5EC1A 1OWRM 5FUOH 3QUZC 3OJDA 3IKKA 1CLCA 2RA1A 4LHUA 4M5YL 1IQDA 3FOMB 2XN9D 3QS3A 3UP1A 5KVGL 2Q8BH 2EH7H 4QPEA 3F01A 1EMTH 3SDCC 1TR7A 4MZRA 3QA3B 2IBZX 2X12A 5AL8A 1AHWC 5I1EH 4X98B 1JUFB 4HGWB 4NQTA 4OJDH 2HVJA 1WFIA 3IAQA 3FPYA 1YEIH 3WUZA 5J6HB 3U6XA 3AUVA 5GGUA 1ZJAA 3AQYA 3BUQA 2VDOL 4ANXA 4E9WA 2WWKO 2FJSA 2HKHL 2JCWA 5A16A 3T3PE 4EN3A 1RJCA 4PJFE 5ESVB 4WGKA 4IMLA 1LDPL 4WTXA 4IIQC 3GTVA 4S2SA 3VFTA 4R8WH 1KBWA 3M45A 4ZUVA 1E9OB 1WDAA 1NBQA 1HS6A 2Y36L 5B39A 5KTEH 3L5HA 3H8NA 1BGXL 1OWWA 4BQBA 2WXRA 3H7BA 3EGDA 4L4VB 3MUGA 1HKFA 1ETA1 2Y7SA 1H3XA 1RXLA 4PAZA 3D39D 3D4CA 1TZAA 3BLPX 3UDWA 4XP9H 2VR7A 2CCLA 3ETSA 4P2OB 3WN5C 4CA4A 3L3GA 3HE6C 2E27L 5DK0B 1A25A 4ODSL 3NSXA 3ARYA 4R2GD 5ANHA 4AT6B 3CZFA 3NRQA 5GZOD 1YN6B 4F2FA 3KWUA 1FNEA 1NPNA 1MWAA 2ICWB 3BH8A 3IB4A 1PU0A 1X5ZA 2NY1C 4WEUD 3UZQA 3ZL4L 1KGYE 1NIFA 1QD0A 2H0JA 3AABA 5D7SL 2VXSL 1MJJA 3CU1A 3P54A 2XWZA 1KIUA 2CLVA 4C47A 2E75C 3X12A 4OCLC 2Y1YA 5IKCA 4O4YL 5CIPA 3OPUA 3AT9A 4PJCE 4OM1H 4TVPD 2D7QA 2QJDA 4YX2H 1BQLL 1PVHA 2WLMA 3HG1B 3QWOB 5FM4A 4GW1A 2WLNA 2BP8A 4KKRA 4NIYE 5JHMA 4I77H 3CC1A 4HSAC 1DL7L 2FQGA 3QJQB 4NO3A 1Z3GL 1Z5YD 4XAKD 2KH2B 1G7JA 1CIDA 4AMKH 5IBUB 2N7SA 2DIJA 3GDBA 4AIZA 1UM5L 2XWJA 3DSFL 3FT0A 5J6HA 3R06A 4YIQA 5C8JA 4K2UH 2JJUA 3S96A 5DQJB 3NCYS 2YEQA 2ORBH 1U8HB 2OL3B 2WGXA 4I7ZC 1K8DB 3FB7A 3FBKA 2XIDA 5TJWK 2X42A 1P1ZB 4WTWA 1Q1JH 2DIAA 2MMXA 2N4IA 1MCDA 4PB9L 5JW4R 1Q9OA 4NERA 3RP1A 4GRLD 1MHHA 1DUZB 5DJ8B 1ACXA 4IRSA 4O9HL 3VRIB 4HULB 4ICWA 4Z7QE 3GRWA 2E9WA 1BZ7A 1L0YA 4PD4J 1OCWH 2IG2H 5IMKA 1Y6MR 5CEYA 5K9OA 5MEOA 3UYRH 4N87A 3BN9D 3EJQA 4BSJA 4HISA 1IBFA 2NNRA 2R1WA 1KXTB 3G5ZA 1KJMB 2NY4B 3SKNA 4E5XG 4UOZA 5DDHA 1E28A 3FSZA 1TQCC 3OGCB 5FFOA 3DX1A 1F1GA 1U3HB 2HLEB 2WIMA 3LHAA 4Y1SA 3ZGHA 3LZQA 5J1AA 2PCPB 1CR9L 4C57C 1KEMH 4TSCH 1HU8A 2AJZB 1M05A 2UXVA 3BD5A 5SWSA 3X17A 3CIQA 5KSBB 4JJHA 3QSKB 1K3IA 5D7LD 1BHGA 1TTGA 3CZSA 3MJ7B 3RX9A 2W07A 1KB5A 1NC4B 3NAAH 4RMRA 3O0LA 3V0HA 2NY5L 4X8CA 3UC0L 5MENB 1DO6A 1ZSHA 5DEGA 5JPNC 1DR9A 4KK6C 1VADA 5E9DA 4P49A 1G9MC 2YMTA 2YXFA 3DX6B 3MCKA 2V4LA 4KMLB 1MRCL 3O45B 1YPZE 4BELD 2HG0A 3Q05A 4JFFA 2FJHB 5D7IE 2W65A 4MMXA 5GS0D 4PW4A 2A83B 5TDPB 5EO0B 2N3JA 5CINL 2J25A 2ZOOA 2AANA 5IHZA 4FFVD 1LEKB 4U1SB 4WHYH 3OJMB 3WTUA 4HJJL 2VR5A 3QQ3B 5ESQB 4DERA 1RUKH 4XVSL 3PWVB 4ODWB 2D7MA 2VMEA 1QKZL 1C1EH 4PJ7A 2NX5B 3TP4A 4ENEC 2YXWA 4GFTB 3D09A 3QUMH 1R0AH 3ARUA 1DJWA 1XGUB 1A2YB 3K74B 5HDOA 4QXGL 2QSTA 1T6VN 4TLTA 1QSVA 3MO1A 2IAAC 1WWCA 3QJXA 2CKBH 3T71A 4A6YB 2IANB 5E99L 4AJ0A 3LKOB 5I71B 4WI0A 1DCEA 3KE0A 2R9HD 2ZX5A 4AGLA 4D9RE 2GJ6A 3KEHA 3QQ4B 1EZSA 3FMGL 5BS0A 2YAHA 3S37L 5LBSA 1NCBL 4CMMA 5AVQB 1JXGA 1AO7B 4OZGA 1LD9A 4JFDB 4IU3B 2DWTA 2MKLC 3DXAB 5BS0B 4UOW1 1QNZL 4YDJB 4MXWL 1HEZB 5DTFB 5E5MA 4M7LH 4NNPH 3EYQC 5TQ0L 2GY7B 3OAZK 4QRQB 3ASWA 4MZ3A 1WAAF 2G2NA 1GTNA 2EIZA 4JRWA 1NCBH 1I7RA 5FGCE 1CLOH 6FABL 3APFA 1MLBB 4FG6D 3WS3B 4NZJA 5INCB 1DJHA 1X5IA 1MOEA 2A4CA 2EECA 3QK0A 1F6LL 3NFNA 3MXWH 1W0VB 1XFPA 2FH8A 3BAIA 3NZHH 4FFZA 5K69A 3E38A 1F3DH 1ZLWK 3ARED 2EILB 1TIUA 1BMWA 1M7XA 2G2RB 4XVUC 2EH8H 1AKJD 2B15A 2WWOA 4FXTA 5JW5A 1KY6A 5HYSA 2JJVA 1NFAA 4FLSA 1L9RA 4LIQH 3TO2A 3VGDA 2FUTA 4YUEL 4DN3H 1ICTA 3DOSA 3KPQA 4M3JA 2Y7QB 5CUSH 2XFXA 2KDYA 4PJAB 5F6HJ 1M1SA 1I3RA 1NOAA 2IH1A 4OI8A 1U3ZA 1MFUA 2YQ3A 4JFFE 2APFA 2K3HA 4L2YA 2QKIA 1PTZA 2QKIC 5IREA 1UGKA 1IEAB 3ZKXB 1KZQA 5HI5C 5MENA 5AB1A 5EUOA 5TD4A 1WC7A 2NZ9C 3MRKB 4DEWA 1MRDL 4OM1L 4PBDA 1NANI 3TYGL 4Q9RH 4N0YH 3PAZA 2XPYA 2XV0A 3O2VH 4XMVA 1BD2E 3O6FB 5KSBA 4OQTH 4U0RB 3PWNB 3MJ8A 4AK1A 3QHZH 3WLBB 2VUKA 4HHAA 5J1AB 2AXWA 3HZMA 2EQDA 3Q6GL 4QRUB 4S0HA 2P5EB 4JQIA 3MJ6A 4XOEA 4AE1A 3GZPA 4I0KA 4NAQA 4C4KT 1E3ZA 2HA1A 3CVIH 4I5BB 4H88L 1OB0A 1KJ3L 1PD0A 3H6AA 3FQWB 4U1KA 1YEDA 3BJ91 3CZUB 1N6QL 3Q0HA 4W68A 2C3VA 2QADB 1CF1A 4DN3L 1D7FA 4QLWA 1PAZA 3QHFH 3BVXA 1A4KA 1CU4H 2EO7A 3QNYB 5KUKA 2ED8A 3LS5L 1GL4B 4JFUA 1A7OH 2A9AA 2UZXB 4PGJA 5IMKB 3FHEA 5F97E 3OWEA 1OO2A 4BH7A 1MAMH 4PJIA 1DBJH 3CFQA 4JQXC 4C56B 1BGXH 1HNFA 1NPUA 4TVPL 3C08L 1FORL 2E6PA 2P8PB 4M6NH 4XP1L 1NCGA 1NEZA 2UX7A 3FUNA 3OKKA 5BRZB 4P5MB 4IS6A 1CGXA 4X9IA 4NENA 3WIIH 4A37A 2H4EA 1UOLA 1XGQA 9PCYA 4PUBL 4P59L 2VR9A 3I3BA 3RE0A 3S36H 4B95C 2HVKA 1ZXKA 1AR1D 5IVXE 4AG4H 3D0LA 1MFDL 1ZHLB 3NJVA 2VLLB 2D4DA 4XB7A 3UXFA 4EMZA 1BVKA 4GAYA 1JRHI 4N2HA 3SPCA 5IK3B 1G7LB 2DQDH 1YY9C 2I25N 5E9AA 4ZMAT 4A1RA 5B8CA 1QWHA 3PABB 4NJ9L 1YN7B 3KLAB 4Z7VF 4ZMXA 3C09B 3DVGB 43C9A 4OIIH 3FFCE 5SWSE 4JFEE 4N8CH 2CIKA 1FNHA 5I1HL 4NZUL 2ZKYA 1XVSA 5KYYA 3EYFA 3LKRA 4OU3A 5F9JB 1WTGT 2X7LA 1BQUA 1ZK5A 3PAYA 5DMKB 2WIIB 2DQEL 4HUVB 5D1QC 2GAZB 3ULVH 1XH3A 3MLTB 3VWJD 2X4OB 4O4YH 4GLRH 1U42A 2VZTA 2EYSA 5IHBA 1CICD 3CZFB 3F6JA 5D9SA 2VDMH 4ABVA 5J89A 1IKNC 2IALB 2VXSH 3CXFA 1RZKL 5DD5L 1SXAA 2NY2C 3HFFA 3EOYG 2J6EA 3KYKL 3EO0A 3B8YA 2XKUA 1KIQA 4PJEF 5IJVA 4J2QA 3S3CB 5IQMA 1COBA 5CJQH 1Y1UA 1EH9A 3ZE0F 2C7UA 3FTSA 2JKRM 3AWGA 4KQ0A 3IFNH 3DRQB 3EGSA 3TZVA 3TN0D 1QRNE 4MQ7A 3ECUA 3SCMB 3U7AA 2VXTL 5KOVC 3WELA 1KN4H 3EBGA 4E9XA 2WXHA 3A4FA 3G9AB 5E6IA 5CBAA 1I3GL 1INQA 2J43A 1IGTA 3D8MA 4KO7A 1CYXA 3QHTC 1ZKAA 3IDJA 2XETA 3DUUB 1FZKB 4LBEA 3PNWA 1D5IL 1HNYA 4QO1B 5DD1L 4XVOA 2A9BA 2NSXA 1RUQL 1II4E 2ZCKH 1VESA 1OAZL 4A67A 2K6WA 5TE7H 43CAB 1X9QA 3IDUA 3SGJC 4FI7A 4Y2DA 5DUBA 3EYUH 3O3AB 2VDOH 3EFOB 4M4PA 1LILA 1SYVB 4X5WB 5CKAA 3QI9C 2XKSA 1I1YA 2HFEB 5DJXA 3N9GH 1PZBA 1SEBA 3FQUB 5I30H 4Y9EA 1CK0L 2H6PB 4Q4IA 3MLUL 1SUHA 1QR4A 1FFQA 4Q9CA 5AD0A 3BWAA 2A6DA 1QI4A 4B3EA 2IG2L 2IXQB 1FBIH 5IVXA 2VERN 4FQLH 1YNTF 1BX2B 2QV4A 4PYGA 4WK2B 4OD2B 1P1VA 2AJVL 2VYRE 4KO6A 3GSNH 1JP5A 4V1DB 5I6PA 4X7SL 2OYPA 3U36B 3GI9L 4NQDB 4LAQH 5T1KA 3DDGA 1N19A 2VABA 4LSQL 5AB9A 5IF0A 4HWZB 2AFNA 2V7HA 2YBRB 4UU9B 3I75B 2EDQA 1M2VA 4GQQA 3CXDH 4WNSA 3ZXAC 5IMLB 1LK3L 1G9MH 2FECL 2NZIA 4WWKB 1KYDA 3BRDA 2AEIT 2VAAB 1QWUA 3PIQB 2UZYB 3DWTA 1AGFB 1OTTC 3CMOH 2VDLB 2EE2A 3NFPA 1KULA 1DSFL 3HG3A 1OP9A 3UC2A 4DPRA 2AGJH 4PRBB 3DYOA 2O30A 4S10A 4L2LA 1RUML 3FU9A 1GGTA 4PJ9B 4HOXA 3DHUA 4JFDD 5E8PA 4K3JH 5FLUA 3VFUB 2FLRT 1Z9SB 3GO1L 3WEMA 4B9CA 1KTKE 4BRJA 5FEBA 2QGEA 5DD6A 2VO5A 1TJHH 1PIFA 1UD5A 1FG9C 1SF5A 3SE9H 5GS0L 3CSYB 4NKDA 3V5DA 3R4RA 1EIBA 3PAUA 4YSQA 1P7HL 4G1MA 3U4BH 2GFBB 3S7GA 2E6JA 1U2YA 2E46A 4YX2L 1CMOA 1J0ZA 2YRBA 3GBMH 4JY5L 3NIGE 1TQCB 2A74B 4Z3JA 1NSNH 2CCWA 3FQRB 2R2HA 1FO0B 1UT9A 1D2PA 2KERA 2YIHA 2ED7A 2QMJA 1E8WA 3B7UX 3MROA 3V6ZA 5C0JA 3WN5A 5D1QB 3MOAL 1N59A 2JCCE 3BZEB 2AVGA 2EEAA 2DB8A 4ZYKB 3MYZA 5I1KH 5I8OL 3ULUC 1JCVA 1HOCB 4S1SL 4YHNB 2R2HB 1PMYA 1U3NA 5J11C 1FG2B 1UUSA 2HLFC 3F7YB 3S8GB 1NA8A 1PY0A 4H25B 1HH9A 1H15B 3E6HB 4N5EC 4M93B 3CCHA 3QIWA 4E68A 2X4TB 4P2QE 4YHYB 3SDDD 3BZ4B 4ZNCD 4L8BA 1L7IL 4CC4C 1F2QA 3PXHA 1Z6JT 4O2EA 4DIXA 3GMRB 5JORB 3NABL 3FQ4A 3MFFB 4KZ0A 2DBLL 1MCJA 2DKMA 4AEHL 1EJFA 2V2XA 3FU6A 3U7YH 3QFGA 4NFDA 3B8SA 3DHMA 5J12C 1BVLA 3HBGA 3DTXB 3I9AA 5EZIL 4OGXL 4X9YA 4OLYH 3WJMB 3TURA 5G4MA 3U9PL 2QELA 2CLZB 3G9VA 2O5XL 2C1OB 1INEH 4LHUD 3STLB 3SYAA 3DUHA 2N1KA 2JF1A 2IJ0C 3ZPDA 1LE9A 1LL1A 3AU1A 4XXDB 5D71L 3Q5YA 1WCBA 5KG9B 3MGOA 2CJUH 4XCFL 2OTUA 4LP4A 2BVQB 1TQBC 3PXJA 4WV1A 4UIMB 1A6ZA 3KJ6H 2H26A 1I85A 3TU6A 5CLZA 1N67A 1U3HD 2AVFA 4K5PA 4G6JH 1A6WH 4NSKA 3GC3A 4KQ4L 4C83A 1JZFA 3VFWA 3QJHA 1RZQA 1KBPA 1B6DA 2Z31C 4PS7A 3HLAA 2BSTA 1P6AB 2H6UA 3EJRA 4C56A 3VXMB 5FF6A 3EO9H 3Q2WA 1MUJB 3DV4B 1CLYL 2EEBA 2FNWA 4Z0BH 4TPRL 4PJGA 25C8L 1D5BA 5KVDL 4ZMVA 4WHTB 3QAZC 2P5WE 3FQUA 4PGZA 1HAWA 4IRZL 4JM0A 2MOVA 3ARSA 1FFRA 2MPAH 1XZ0B 4Y88A 4F7CB 3OC8A 1I1FA 3ES6B 3VXSA 3TM6A 3PHQB 1I8UA 1HTYA 4N5UA 5I0YA 3WIHH 1FNGB 2AXHA 4MDJB 2LFEA 3VFVB 5IUSA 3SQRA 4L3EB 5D1ZC 3BKCH 1FZJA 4IOSD 4F2MB 4HCFA 4WWKA 4FQ2L 2FEEI 4BEIA 5F9WC 4Y2LA 2BIOA 4OB5H 4DESA 4I3SH 5E6IB 4JM4H 5LQBL 2B59B 3LB6C 4RWYL 4Z7WE 4E9SA 5B39G 3KLDA 2X87A 3O3EB 4EDXB 3RGVC 1YG9A 5J13C 2WB1A 1EJ8A 2J73A 4G2AA 1EAPA 1FVCA 5GGTL 3PQYB 2WSDA 5DFTA 5D1XD 1AHWB 3ILPA 4WI7A 3P4MA 3TPKA 4MJ6B 2DQDL 1PL3A 1CPUA 4IYKA 4HU8A 3RPIA 5E5UB 5F89B 3LXAA 3LNGA 3O8XD 1GTFA 2Z91B 1OGPA 3MLSL 4PYHA 2OMNA 1UWEH 2DI9A 3ESNA 3MKKA 4U6YB 4ZO8A 1Y6KR 3TEZA 2YMOA 4FCHA 3QGVA 1I1YB 2PW2A 4OBRA 3QZWG 4P9HH 5L4MA 2BO0A 2G3NA 4JFWA 5K9QI 3QQDA 4KHXL 3TWCL 2OR7A 1A4JB 5CLYA 4F2ME 5FO2A 5EOTB 3L2MA 4IRJD 1DQML 3DRTB 5T3ZL 2NYZA 4GG6E 4KKZA 5KYXB 2VQ1A 3HG5A 5LBSH 4U6XB 3VXNA 1K2DB 2QQQA 1BF8A 1CGUA 3KNBB 4UDUB 3AXLB 3M07A 5IVZA 1OP3K 2DJ4A 1BCIA 1O6SB 4PG9B 5C0GB 2IVFC 1WWBX 4HKXB 4HPOH 4QTFA 2Y4SA 3QWRD 2ZG2A 2W59A 3F7QA 4H8WL 1YEHL 4N6RB 4FFYH 2CCVA 1QEWA 3M8OH 3V0VA 3SEPA 5I8KL 1M71B 2FCBA 2BCMA 2YPVH 1TMQA 1YJDL 3DURA 3EYUL 1FSKB 1F1DA 2PKDA 4AEIL 1R47A 2XV6B 1GZHA 2QSVA 1JNHA 3N42F 3GHEH 3LHPL 3C2AH 4QGYA 1ZSDB 2ENSA 2VR4A 4JAMB 5B21A 5EU6E 2ZCKL 1SNRA 2H5UA 1Z9OA 4HF5H 2ICWI 4JDEA 4OAWA 4GKZB 5LO7A 2DLHA 2EDMA 2NW3A 2YD6A 3WSQL 4APQB 1ADQL 2E9IA 1HEJC 4M8UA 3GIZH 4JFOB 4EN3C 4X5QA 1C12B 3LPFA 3QFJD 1OGAA 4CKVX 3B9KB 3TEXA 3IFOA 3TYGH 3VI4F 5J56B 5AVUB 2BCKB 3DJ9A 3NDYE 4Z78B 1HDMA 5D5MF 5C0IA 2C4FT 3HE6A 4JG0L 4XN2A 4NN5C 4UINH 4PJIB 3KMDA 1T03L 5FO7A 3THML 4KKNA 1BV8A 2VZVA 1BEYH 4HBQA 2WW8A 1JPFB 1T20B 5IJKC 3CSPA