2Z34A

Crystal structure of spcia1/asf1 complex with hip1
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
159
structure length
155
Chain Sequence
b'SIVNILSVNVLNNPAKFSDPYKFEITFECLEPLKSDLEWKLTYVGSATSQSYDQILDTLLVGPIPIGINKFVFEADPPNIDLLPQLSDVLGVTVILLSCAYEDNEFVRVGYYVNNEMEGLNLQEMIKKVKVDISKVWRSILAEKPRVTRFNIQWD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone chaperone cia1
publication title Crystal structures of fission yeast histone chaperone Asf1 complexed with the Hip1 B-domain or the Cac2 C terminus
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Chaperone
total genus 27
structure length 155
sequence length 159
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04729 ASF1_hist_chap ASF1 like histone chaperone
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1490 Mainly Beta Sandwich Immunoglobulin-like Histone chaperone ASF1-like 2z34A00
5EIIG 2I32A 4RRPM 1TEYA 2IIJA 1WG3A 5BNXD 2HUEA 3AADB 1ROCA 2Z3FA 2Z34A 4ZBJA 2IDCA 2IO5A 2CU9A 5BO0D 4EO5A 2YGVA 5C3IA 2DZEA
chains in the Genus database with same CATH superfamily
3RNKB 3RVVD 5AWNH 4NNXA 3GRWL 3SCMC 1YNLL 2BFVH 4PMFA 1VEPA 3V4VH 5C0DB 4NP4L 1BIHA 1E5YA 1OL0A 2XZQH 3MV7E 4K4KA 4PGBB 5EEXA 3EDEA 3IM1A 1RJYA 1OTUC 2HT4D 1UXLA 1VDGA 1JHLH 2QQNH 2X4UB 3QC6X 2PO6A 3QCVL 4JFOA 1KWKA 4P57B 2FUTA 1M57B 3QW9A 1HQ4A 3NJVA 1HK6A 3CVCA 3HAEB 2BOLA 5E00B 2VUYA 3QCUH 4OKVB 1YQ2A 2WNGA 2ICES 1K4CB 3P77A 2QGEA 3QNXB 4R4NC 4FQHA 1VZHA 2IH3A 2E9WA 4UWQB 2OQJB 3GS4A 4DGYL 3PF2A 2AEOA 1X4YA 1UKSA 4ZFOB 3QZWA 2Y23A 3EDKA 4NUMA 3EYUL 3F7QA 5CSGA 3J07A 2A6KB 1ROCA 5DCCA 5GGUA 2XTSA 4KRNA 2LU7A 2NTFB 4DK5A 5BRZB 4HT1L 2NUTB 5DD6A 3MV7D 3SE9H 4PVLA 4CMHB 4LL4A 3QUMH 3S97C 4QXTB 2VZ3A 2ZCLL 1QABA 3CXDH 1E9OB 1FN4A 4F2MB 5IMMA 4UB0H 4DKEH 5TF1H 2CUIA 3D2UB 4QRRB 1CD1A 2IDQA 3EOTH 1BQRA 4LCWA 4OLVH 4HD5A 2XCMC 4JRXB 2KI6A 4JVPA 4WI7A 5AOIA 3IFPB 1ZHKA 1C12B 3UYRH 2EVGA 3PDGA 4MMXA 3HE6D 5J4MA 5IR1A 2D9CA 2AQSA 1OP5H 1CCZA 1ILUA 1G7MA 2NCEA 2AJYH 3MNVB 5E5MA 4AOFA 1U8CB 1IBDA 1P6FA 1KLUB 2A6IA 2BSBA 3T0EA 5LAXB 32C2B 3DOHA 3P30H 4YHLH 1NOFA 1AXSB 1HHHB 1IKFH 1OGTB 5I15H 1KDJA 5DMIL 4NUGL 2R4SH 3M17A 5LGHH 4JS7A 1X6NA 4PJDF 1F6FB 3HE7D 2XIIA 3TL5A 3OJDA 4HHWA 4YN3A 3D9AH 2XDHA 4Y19E 1SVZA 4HZLA 5DMGC 3ISYA 2ZOLB 3ZE0B 3SDCA 5FUOH 3Q8BA 1W72A 5JOPE 3JWNG 5FF6A 3OZ9L 3CPUA 4UAOB 1ZTXL 5C0IB 3F01A 1KJ2A 3OAUL 4JDEB 2JKWA 1NCCL 1D6VL 4NQXA 1A14H 3BSZA 4ZQKA 3FQYA 3DETC 3LN4B 1QSZA 4YHOL 1N59B 1SXCA 1NCDL 3DMMA 3C5XA 2CO7B 2HRHA 3APFA 3BXNB 3TYGL 4WHTA 4HCRH 4PHXA 3X3FL 3CIAA 4JFHE 5KSUA 1NCUA 3APMA 4PV9A 1L9NA 4GKZA 3FTWA 4Z7AA 1N9PA 5E2TL 1NAKL 4J8RA 3WDJA 1QSEE 5ESVA 1XH3A 4FQQB 2JTDA 5IT2H 1NPJA 2O6CA 4Y19D 3EKCA 1NUFA 4LSPH 1HZHL 3WE6A 2JCCE 2V2WA 1JZJA 1A6ZB 1OAQL 2V9TA 1KGCD 2X44D 4KXAA 3GSNL 4GG8A 4NLHA 4PGEB 3QJFA 3CVHA 3LZNA 5DJ6A 5K9KB 4PBVC 2X4RA 1GPOH 5LQBL 1R3IL 4HMDA 4YDKH 3AG4B 3NJKA 3NEEA 4GO6B 4QTHB 2BVTA 2KDYA 3QXDA 1G1YA 4R96B 1K8DA 1P6AB 3MLWL 2Y5TA 3ARGD 3OMAB 5ANHA 3UAJD 2VMFA 3G04A 1ZXQA 4HEME 4JFHD 3GNML 3HJEA 1MXGA 3ILPB 1XDTT 4TSBL 5HD8D 4PD4J 4XVUD 3CK0L 3FQXB 12E8H 3B9DA 4XPAH 5EOCJ 4KGLA 4N8UA 4CVZA 1CDUA 3KWUA 1Z9SB 5T5NF 3X3GH 5A7EA 3HLAB 4TM9A 4LLDB 1A5FL 5DWUL 3B7SA 5DJZA 5B38G 3ASNB 1TTCA 4MYPA 3WCYA 4CN1A 1TFHA 3SDAD 3TEZA 1A7OH 2EEFA 1AG0A 2YBRB 3GYRA 3KBPA 1F4YH 5IWLA 1QAWA 5TDOA 1JUFB 1CDYA 2R2EA 4Z8FH 3MFFB 1FIEA 3PIQA 4M1DH 3E2HC 5C09A 1KEMH 3DVGB 4XHQA 3RY6A 1LEIA 2ARWA 5CIPH 2RCSL 1FL5A 4B7LA 5CKGA 2UY6B 5EUOE 1N5YL 3O6ML 1Y6KR 1DZBA 4ABQA 3LQAH 3HC4H 5HPMA 1R3LB 2DM3A 5EUKB 5F9OL 5C0JB 1C08B 3AW5A 2FRGP 2J4WH 4XVOA 5AKRA 1REIA 2DLHA 4ETQB 4O4YH 2V7HB 2IDTA 1XCQB 4D94A 2DPKA 1JIBA 4ORGA 5L7XH 1EFXB 1I75A 5A6MA 4F33A 4NZRH 1TVDA 3UTTE 1OGAB 3RUGA 5FB8A 5JNYA 4BD4A 1NC2A 2VW4A 3QK0A 3ZDYB 2FBJH 1RV6X 2YK1L 1NGWA 3VGBA 2UVFA 4OUOA 5KJ7E 1JD9A 1RFDH 3A22A 3DJSA 4GXUM 4HS3A 4XVJH 3MNDA 3FB5A 5J1AA 4BZ1A 2BP8A 2XXGA 1KJMA 3R7QA 1HEJC 2Y25A 3JV4A 4X80L 3IJ9A 4RIRA 4NFDA 2NXYB 1A3LH 5E6UB 1KGJA 3WJMB 3KG5A 4BDVB 5I0DA 3WELA 5JQHC 2HRLA 1NCWH 3TWCL 4OLXL 4V1DD 4O02B 3U9WA 2D03L 2VL5A 3BH8A 2GHWB 3MV01 3II1A 4XT1C 5AW4B 1U36A 1NFKA 5B4MD 1S7WA 2V3FA 3B43A 4DP1X 4KO7A 1YJDC 1MQ8A 3HVNA 1E5BA 4QMEA 4GG6B 5BVJA 4XCNA 3EBIA 1UENA 3FQRA 3WSQH 4FE9A 1I53A 2WXLA 2O5YH 5DT1L 2D2CC 3TBWA 1DJYA 1S9VA 3QEQB 1YEIH 4RRPG 3U36B 43CAB 5E08L 2YD3A 1TEGA 5GRXG 1OW0A 5FV1L 4U3XA 4P2OD 5FO7A 4D3CH 4AC2A 1NIBA 4ZX5A 5CJ5A 1S7QB 3A6CH 3F84A 3SPVA 1C8QA 1DBAH 3S0PA 5B8CA 4HS6B 2DI9A 3QUGA 4ODBD 1FFTB 3VXQA 2J72A 5MEQB 3NCYS 3N1MC 4JG5A 1IQDA 2C1PA 3X13B 4MSWA 4Y2NA 2QT6A 4X9GA 4M7LH 2YQ2A 4DZBA 1A4BA 4LDLB 1RSYA 1X5HA 2FNBA 5D7LE 3K46A 2J1KA 4BZYA 5I1IH 5D72L 3RZCA 4XMKH 3T2NL 4AYDC 1AHMA 3HB3D 2DWYA 3WMSA 1PJ9A 4UT6H 3BUYB 3T2OA 2K6WA 2XFGB 4Y4KC 1J5DA 2HFEA 4GH7B 1ORQB 2X1WL 3NH7L 4NWTH 4QD2E 4Y5YA 5AKTA 4JL2A 4P2RB 1JNLL 3ZDWA 4A2EA 2AXWA 3LH2L 3R19A 4OLYL 3RWJB 1CGVA 2GK0A 2GG1A 4JVWA 3FUEA 1EQWA 2IDSA 2DMKA 3QHZH 4LAJH 5F9JA 1OTSD 2FE0A 1KCVL 1UWXK 1T83A 1IGJB 2IAMA 1MNUH 5EIQA 1JGVL 3H9SB 3QZNA 3HFMH 2ICWI 2DQHH 4H8QA 2X2JA 1J7VR 3UEZA 5C07E 1TF4A 3VACA 1JYVA 1I1AD 1AGBB 3NGBB 2NOYA 2WVSA 4NRXA 1G9HA 4BK5C 4GKSB 4D0BA 3TO4D 2HB0A 2W0PA 3D34A 1R5IB 3KXFB 1GW6A 4KHXL 5CZKA 4JFQA 3GS7A 3OJMB 5LG6A 2NW2B 1QFUH 3P0YH 1QW8A 4HAGA 3DSNB 4OGQC 3OVUB 3N0AA 1X5ZA 3D3VA 1G7PA 3E6FB 4G8FB 4GEJA 1GGCH 3KPSD 1X5LA 4MXWH 5DZVA 5EHFA 5B1JA 5SWSE 3K2KA 1HVXA 2F58H 4G8GE 3Q3GA 5AOZA 2OL3L 3P4NB 3VYOA 4G6JH 5DQ9B 2F1AA 5BS0A 5EEUA 2IALA 3VTTA 1M3JA 3DBXA 4HEPG 2FJHB 4X7TA 4GIOA 3NIGF 2EDWA 3VXUD 5D7IE 2R4RL 1J05A 3NIGB 5DD3L 1ILSA 4PHZA 2P8LA 4PS3A 3EO9H 2YJLA 3K91A 2ZXBA 3NSJA 4F9PA 2XRAL 1B0GA 2R2HA 3N44B 5IKCB 4PP2B 2EIEA 4R7VA 2FB4L 2WXOA 4KBPA 5F0JB 4NQCA 3O2DA 1FO0H 3WYRA 4D9RE 1P7KA 1UC6A 4LLUA 1X5KA 4E0RA 4IMLB 4S1SH 3SDXB 4UQIM 1IZKA 2QV2A 3ML9A 3Q6FB 3OLIA 1F58H 3ECWA 2K45A 2Y6TE 1S7TB 2XG5A 2J71A 3NVQA 4KKLD 1CE1H 2AMUA 4Y89A 1IC5L 2CHXA 4EI5B 5TK4A 2WNKA 1PYWA 3V52L 4JFFE 1MOEA 3SGJC 1BEYL 2G3ZA 3BPNB 5KJ4A 2CIIB 2PXYA 2YGPA 2E6QA 3V4VB 2Y36H 3VXMA 1MFAL 2NY3B 2GTZB 3CN3A 5ID0B 4G7VL 5JO5B 3M8OH 2IXQB 3ULAB 3IETB 3VTMA 2QMJA 1JPTL 2XIDA 4WWKA 2MOQA 2VMEA 1KUMA 3MUGB 3MKGA 3MYJA 1YC7A 3VE0B 2BCKA 3V0FA 2ADFH 4A37A 4UNTA 5A3IC 1OE2A 1N64H 1W80A 1TO4A 2AVGA 2K1MA 4WU5A 3UAFA 5IEKA 3BI9X 3T04D 4MJ6A 1II4E 1MHHB 3MNZB 5CJ8A 1TSRA 4F3FA 4FAAB 1BZ9A 2K6YA 3QCTL 1F3JB 4HXAH 2I85A 4RWHA 4NJAL 1CF1A 1V7ML 2CLVB 2ENQA 4KAQH 1XZ0B 2VOTA 4R4BA 3ILQD 3Q01A 3EJQA 1URLA 2VDRB 2P5WB 2W07B 1QR1A 1G4MA 1EZVX 2J8UB 4KTDH 1S7RB 1PLGL 1NC4A 1RIVL 5E6SB 5A2CA 4FQLL 5JHAA 2B0SL 3HZMB 3WNPA 1Z0NA 4HIXH 2X6VA 4AUYA 1YZZA 5AVTB 3HPJA 1AS8A 4YL9A 4OLEA 4OJDH 4M8VA 4DP6X 1TVHA 3OPZL 1JWUA 3QEUB 3RTLA 4W4OA 1M7UA 5AZEH 3QDJD 2VZTA 2FD6L 1QLEH 5D6DC 3NBNA 2DQFA 4IRJD 2FEEL 4PY8I 2FGWH 1D9KB 2WTPA 4XMVA 4NNYB 1P4LB 2FLBT 2BHZA 1R34A 2GITA 3NESA 1DEEA 1BVNP 3QPQD 4PJHB 5IJKA 2NW3B 2WMPB 1F18A 1X5IA 5KEZA 4QRPE 1S7UA 1YEJL 3VU2A 1RIUL 2ICWJ 2Q2EB 3LY6A 5GS1C 4I2XB 4A04A 2EDJA 1URZA 3QI9A 3L3HA 1SDAB 1E90A 4G6AD 1KIQB 2ENJA 4PSPA 1IAIH 2ZWLT 3PWPE 1JZ5A 2MQGA 4W81A 5GISL 1AIFA 1IARB 1CTOA 2I5YL 2IWGA 2R0KL 3BH9B 3OC5A 4DGVH 1HH6A 3CQQA 2DM7A 4AYBA 4AG4H 1J8HA 5DHVB 3UJTL 4HMCA 4XO3A 3VI3B 1ZHNA 3RVTD 4WNQB 4DO4A 5ANMA 2W8CA 5F3FA 1IBBA 2FQFA 2G3NA 3PWUB 1GZPB 3JV6B 1KC5H 3IJHB 3DIFB 1TKWB 5ITFB 5ABDE 1J0ZA 4PCKA 2V7NA 3UJJH 2F5AH 1W15A 5GGTA 2ADGB 4KI1A 1D5ZB 3MGOB 4QRPD 2OL3A 5HYQA 2B4CH 2WIIB 4MDIA 1WZ1L 3KPOA 2XN9E 1QI4A 4Z3GA 3QBTB 4IIQB 4XN4A 3QIBC 4S0HA 5JIDA 1X7SA 4AYGA 1J1XL 1FNEA 1URIA 3S5LB 4ZG1A 3O81A 4UDUB 3HMWL 4L23A 4X8GA 4MXQD 1U42A 2GY7B 4JPVL 2I32A 4H5SB 3IRCA 4LVHB 2IIJA 1BAFL 2FBOJ 5E1QA 4M9OA 5KBMA 1IT9L 3TF4A 2B77A 1WZLA 3DOSB 1R1CA 4WO4C 3FSVA 4OZFB 4HOWA 1S9WB 5B39B 2VITA 1KXQE 2BWDA 5DMJB 3LHPL 1KYAA 2APXA 4F5CA 5HJ3B 3TTSA 4NCC1 5T3XD 4HETA 3FT1A 3S3BB 1Q0YL 3G5ZB 3TVMC 1M6OB 1UACH 2ZJSL 3HAEG 3L2MA 2OP4H 3Q2NA 3FU5A 2GCYA 2JKLA 3VG9C 2G3XA 3VFVB 5AG8A 4DN3L 4NB7A 3IDGB 5ICYB 1KTBA 1KLFB 2FX7H 4O2FA 5TTRA 1CDJA 3MLVH 3D2TA 5DHMC 2F7OA 3TNNA 4PJFE 3P2TA 3CVIL 5E4EB 1PG7X 5FUZH 4QYOB 4ZNEE 3ULVL 3TEWA 1WFIA 3EHBC 4YIQB 4GYBA 4P9HH 5L9DL 4Z7WE 1I9JH 3KPQA 3GTVA 1MW2A 2H8PA 5G55A 1WT5A 3GM0A 4P2YA 4F27A 2MKWA 3PL6A 2QGDA 3VRIB 4MAYA 1I7TB 4IEFA 1JTTA 1MW0A 4M43H 2VLRB 2ENSA 2P52A 3SGKC 4XNDA 4XN5A 4IQHA 4KRPC 5GRVK 5IESH 3KLHD 2XKNB 3V79C 1UD8A 3TXAA 3A4EA 3DUUB 2UZXB 3P3TA 4J3VA 3OKYA 3IDNA 2AK1L 2H1PH 4Q2ZA 4H26B 2MCG1 2WNWA 1RZIB 3SN6N 3SYPA 2Q0ZX 4I77L 2CALA 2Y2TA 4HAKA 1ZLWH 3U2SB 5A2JH 1EHNA 3H8NA 2X5PA 2VN4A 4GKOA 1HSBB 4C83B 2IV9A 2Z31C 1MAJA 4Q9RH 2RAMA 1FNFA 2ORBH 1Z9NA 1G7LB 2QBWA 2IDUA 3MRQB 2H3NB 4PRHE 1IGTB 1BYNA 4G9FA 4XOCA 5D6CA 1NMBH 4GEIA 4X4ME 3CJJA 1CFBA 3C6LD 4UOW1 4A2FA 3MBWA 5I73B 5JHLL 1IJNA 5D4HA 3HC2A 1ODUA 4LHUA 2YWZA 3SCMD 2WW8A 4HX1A 1TU2A 1N6VA 4BH8B 1CDIA 3L9RB 4XPTL 2BP3A 3SDDB 5DF0A 5HY9B 4TRPH 5TQ0L 5FR3A 1I1FA 1UD2A 3ECUA 5I8KH 4PRAB 2F19L 1OTUD 3IT8D 1CURA 4Q6YA 4QY8B 3VXSA 3CXFA 4OLZH 2OTWB 4ODUB 4DGUA 1YCSA 3AREB 4ZMAT 1SMDA 3LXUX 4OCXH 1BGXL 1NBYB 3V6OE 1Q9LA 3MUHL 1Q9WA 2J1YA 4R4ND 3O4OB 3Q6GH 3IJSB 1DJGA 4P23B 4AENA 3VFTB 1HILB 5E2JA 3K4AA 1SY6H 3I2CL 4JRYB 4N2HA 4LIQH 5F88A 3UBGA 4IRSB 1P0SE 5BO1H 4TL4A 4MJ4A 4L8DA 2PO6C 1VEMA 1AGDB 1FRGH 4K7FB 3F85A 1WBZB 2PP8A 5DU7A 5E9DA 1PZUB 3W2DH 4Y2OB 5A40E 1OT1A 4N8VB 3SE4A 1UKTA 1XAUA 3KPTA 2P5EB 5MP6L 3QDGD 3KGUA 1CT8B 3ETSA 2DQJH 2XWTA 1Q1PA 3EO1A 3PGDB 4E42A 1OAZH 2ARJA 3L2LA 4P46A 4X7SH 1DANT 3LZPA 2FK9A 5DSCB 1JOIA 1OSYA 3KNBB 4ZUWB 5K9OA 1UA6L 3MZTA 4EUPH 3GXIA 3T71A 2AXFA 3F58H 3ARUA 4U05A 2VNCA 4AT6B 4OCLC 3LS4L 4X8CA 5F3BB 2DKMA 4QEGA 2VLKE 1FH5H 1HI6B 3MJ9A 3OKDA 2E7LA 3FONA 3CZFA 3CFJB 5F7LB 1F3DJ 3DYOA 4FCAA 1QRNB 1Q9KB 4OV5A 4JFEA 1NCIA 3L3KB 3QJTB 1FYTA 1BIIB 3ABZA 1E27B 3IAPA 5C08D 4LOUC 2VE6A 2BY0A 4MMXC 1Y18A 1JZDC 2NLJB 2X4TA 1DQTA 4WUUE 1ZEAH 1W0VB 4IRZL 4LSTH 4KY1L 5HHXL 1DVFB 4RGNE 2QR0A 2P42B 4PBDA 4Z7VE 5DS1A 4JX0A 1YN7B 5C0BB 5F7BA 3Q8CA 5DMGD 1X5GA 1YEHH 4X99B 1L9QA 2A1WL 2OJEB 2GC4C 3I02B 5INDB 2J88L 1KGUA 2C5DC 3BWAB 1FA4A 1XTMA 3ME0B 4LCIH 1EXUB 3U46B 3BD5A 3FTYA 2HRPH 5EU7C 2R2BB 1PSKH 4OFQA 2VLKD 5DGRA 4NI3A 4CADB 1W0YT 5HGAA 5FO8B 4L4TB 2I26N 3ZSSA 1RURL 4WKZB 3EO0A 3AXLA 4RX4A 3HG1A 3EJYC 1QA9A 2EYTA 4CC0A 3V4PH 4JFDD 4PTUB 2O1AA 3PXLA 1XCWA 5F1NA 3SDCC 1KY7A 2WKLA 1T2QH 2R1XA 4RNRB 3VRJB 4B9KC 4ZK8A 5ESAA 1J5CA 1QATA 4GAGH 4PG9B 3LQMA 1KGYE 3O0LA 1VACB 3QUZB 3FSAA 3U6RA 4ALAC 1MFMA 3QWOB 1A8JH 4IW4C 4ADGA 3A6BL 1UH4A 4YK4C 3DMMC 1MDAA 5BUGA 3QRLA 4HWZB 1SGKA 5DDHB 1G0YR 4MRBA 1KFAL 1LNUB 1EIBA 2DI7A 1AMXA 3UTSB 4MKTA 3LN9A 4AZ8B 4UTCA 1KB9J 3WN5B 2X7LB 4UT7H 1R0AL 2CUMA 4OIIH 2AJVH 3U4BH 3GGWA 1LQSR 2E6JA 1QASA 3NZHL 3RNKA 3SGDI 2XVGA 2CGRL 2WVTA 7CGTA 2FX8H 5JPMA 1GC1L 5E9NA 3TN0B 2JJWA 4XP9L 1MFUA 5ICUA 2V2TB 4PGBA 3K0WA 2QQKL 1OSPH 3AB0B 2X4UA 3MXWL 3VD7A 2HSIA 3DA0A 2P4AB 2SEBB 4P57A 2X88A 2CLRA 4OQTL 5C2UB 4ZMOA 4XAWL 3GLAA 3HAEA 4MNGA 5IB5B 3WL9B 4AW7A 4EMZA 5E00A 5L8JB 4OKVA 3QWNA 1K4CA 4HPYH 5AD0A 3QNXA 5EOTA 4NPYB 5J1TC 1TQVA 3QO0B 2QGBA 1PY9A 2OQJA 3BIAX 1S3RA 3FSZA 4QXVA 3S37X 4PJCE 1SHWA 1MCWM 1RUQL 4PJBE 3RYMA 4DZ8B 3BPOC 4ZFOA 1AVAA 4JGJA 1YVLA 2E9IA 1X5XA 2A6KA 3DPBA 3BUTA 2VISB 2NTFA 5L88L 2ZXEB 1TCRA 2OBGA 3NCJH 2OYPA 3MUZ1 2Z6FA 1W2KT 2JSFA 4LRNL 4LARH 1OAYL 1OAXH 3OAWA 4QXTA 4LEOA 5AZ2H 1E9OA 4F2MA 5I2IA 2IFFL 3TO2A 4QRRA 5IWLC 2I25N 5DVPA 1WISA 5I1CL 2X05A 3RY6C 2L8AA 1WGVA 2JJUA 4DOHB 4C54A 2EO9A 3IFPA 1IEHA 3BGFB 1C12A 2AERT 4ZXBB 2R59A 4R97B 1PMYA 1PZDA 1BBDL 1MH5B 5E24E 1ECYA 3ATAA 2ZXDA 2XOTA 4WTZG 35C8H 3MNVA 4IDJL 5D70L 4ELDA 2VMDA 4RDBA 1RULL 1KLUA 2A7BA 3H9ZA 2GSGB 3HRPA 2J56A 3KHQA 4HWNA 5F1IB 5LAXA 3IPFA 1O7VA 3RVWC 4RWYL 32C2A 4O02L 2DQTL 5IOPB 3V5DA 1F02I 4IGBA 4ZUVA 2FEEI 4ELME 4FXKB 3P2BA 1AXSA 1HHHA 1OGTA 2CMRL 1NGZB 3W11D 1G9MC 1WFTA 4HXBL 1CVRA 4PJDA 4E9RA 2JLPA 4HU2A 3WKML 1NANH 3ZKSD 2EVFA 4U1JB 1A6UH 1T0NB 2J5LB 3EFFA 2K8QA 4YWGH 1TUPA 4BRVA 2ZOLA 5KS9F 1GYUA 3IXAA 5KS9B 2VMCA 1I1CA 1INEH 2A4ZA 2WXJA 4HUNB 5DHXB 5ALBH 5C0IA 3AC0A 5DUPH 5HGHA 3UYOD 1Y1UA 5IFJA 2P44B 1ASQA 5C6PB 1FG9C 4GT0A 5A43C 2XUWA 3IMTA 3WY4A 4PWGA 2MRYA 3HHMA 2OKMA 3LIZH 2CO7A 1OQXA 1Q90A 3MV8B 2C4XA 4P3CL 4ZFGL 4B60A 2W95A 1QD0A 3A67H 1P5VB 2HT2C 2OTPA 1OXYA 5KWYC 2BZ7A 3CDCA 2R29L 3CD4A 1F90L 1YY9C 2BSEA 1VGKB 3MN8A 5T1LB 4AL8L 1G7IB 4B95C 3OSKA 1OW0C 3ZDXE 2X70A 3Q9QA 3UG4A 2ZG1A 4O58H 3MV7B 4JM0A 4Y4KD 4X8XA 3ARBB 2HX8A 1DBMH 3V4UH 2M83A 1MWOA 5B8CC 4HQQL 1JCVA 2VXQL 2AK4D 3H55A 4YHNA 1IGMH 1MIEH 3FF8A 1FNSH 2BIIA 3CZSA 3S34L 5EB9A 1OLZA 4P5RA 5I1JH 5K9KA 4JRFA 3IKCB 2A6DB 3REVB 1MY5A 3KBEA 3R0MA 3GLDA 4LGPB 1AGEB 1A8ZA 3O3UN 5SV4A 2YPLE 4YSAA 5CEYB 5AYUH 4R96A 4OR1A 2X6CA 4JRLA 4X98B 4MXVF 1EA9C 1BG9A 5E70A 4TULH 4XODA 1YYML 3MRHB 1CI3M 4Y1TA 2EYSB 5B7FA 5BZWB 3FQXA 4AEEA 3WKYA 1MW1A 3BVVA 2LFGA 1Z9SA 3QXAB 4J3XA 3MGAA 3INUL 3GBNH 1QYGL 5IVZB 3D0LB 4LLDA 1CFMA 3PP3K 1T83C 4YDZA 4UNVA 1MZZA 4L9LA 3NJJA 2IAMC 3H3BC 1SJMA 5KBLA 1CGSL 1MJUH 3QEGH 2CO6B 2VXUL 4Q9QL 2YFNA 3S8WA 3P0VL 1MRCH 3B3IB 5F9WB 4YSCA 1C5CL 1JUFA 3MFFA 4Z7NE 2CDGB 3O6LH 2XWRA 3FBQA 5IMKB 2YPLD 5LNDA 2XACC 4TVPL 2OR8A 1P7QA 4HKXB 1YEEH 2BHYA 2YXMA 3B56A 3DVGA 5E99L 5EZLB 5AL8A 3WU1A 4NJ9H 1N6UA 1UCBL 3C60B 1P84J 1F11B 5DVOA 5K1JA 1YMHA 3NA9L 5B1JC 4AKOA 2XYCA 1R3LA 5EUKA 5C0JA 2WBXA 3QQ3B 1GOHA 3ELQA 5I8EB 4MQTB 1V7NL 4DAGH 1RUMH 5EPMA 5LGJA 4ETQA 2W94A 1HU8A 2V7HA 1MAML 4AYEC 4WEBH 5HHNB 4CJ0A 1EFXA 1XMEB 5IM7B 4L3EE 1KCBA 2RIKA 4AE1A 2H9GB 2P8PB 4JKMA 4PB0H 1CS6A 4QXGL 1OGAA 2OM5A 5LG1A 1BVLB 1T03L 4FQCH 1R47A 4F9PC 3JWNC 4E9WA 2WBJA 2ZKHL 4WW1B 3DXAE 2MH4A 3C6SB 5ALCL 2XTJC 4GRWE 1RU9H 4L29B 5D96C 5A1AA 1BYPA 5AWNL 2IMMA 4OFIA 4Y19B 2YGOA 2BFVL 3V4VL 3RB5A 2FHCA 2XZQL 3TV3H 3DDGA 4A7QA 2WO4A 4JDTL 1U8NA 2IG2H 5DFTA 3WJMA 2BNUB 4IJ3B 2OJ1A 4C4KO 4M00A 3NYKA 1UOKA 3KMDA 4O02A 2W0FB 5T3XH 2Q8AL 5TJWK 4AV5A 4OD1L 4AYSA 3S5YA 2XN1A 5IQOA 1BWMA 2O6FA 3ZQWA 5A3ID 4J4PA 3S8GB 4OKDA 3NSDA 3UPRB 4ZZKA 4K55A 4GQ9H 1OCWL 1OPGH 2A83B 2PXYC 4EKXA 3T8XA 1FUNA 3DXAD 3QEQA 3S5LG 1N0XH 3U9UB 43CAA 3PGCB 4U0RB 5FK9A 1KXVA 5KVGL 1AQKL 1TETH 1TVBB 1MCQA 4A2LA 2OI9B 4F91B 1B2YA 2QVKA 2AEQH 3C8HA 4WWKC 3SE9L 2JCCB 2EDTA 3QUML 1WBYB 1R19A 1S7QA 1XGRB 1JGEA 1RP8A 5JPNB 3CXDL 3SDAB 3CFMA 3AMKA 4HS6A 2AVFA 3NPZB 4WJKB 4DKEL 4OZFG 4JQVA 3T5WA 1AZBA 2EDBA 3QFJE 4GW1B 2B9BA 4MX7B 4XC3H 4OLVL 3I9AA 4X5LA 4H88H 2X6BA 1RZFH 4ZNCD 2WXMA 4PJ5E 2FO8A 3R8QA 3UYRL 2F08A 4G42A 4I0CC 2WXRA 1I8KA 3MJ7B 1M6UA 1R4XA 3KBFA 2O61B 3O0RH 5CCKH 1FC1A 4QXUH 5I6MA 3BUYA 3E8VA 2P49B 3CDGA 1V3JA 4JPIB 4P2RA 4KH9A 4LPTA 4L2LA 4NQED 2VXQA 3RWJA 1S7VA 4JK0D 4H44C 2ITDB 3ULVF 1EO7A 1I7ZA 4W4OC 4YHLL 1XO8A 5BZZA 3NAAH 3WS6A 5F7EH 2MWCA 1IGJA 4N6QA 4YXKH 1IKFL 5I15L 2W88A 3DVFA 3QFJD 2R4SL 5LGHL 1CTNA 4PSRA 5AENA 4MQ7B 4UTBL 1AGBA 2VN3A 2KL6A 3D9AL 4WTZA 4GKSA 4Z7OE 1IEAB 1EDHA 1UB6B 3UAAA 1R5IA 3KXFA 5IJKC 3C2SA 2NW2A 5FUOL 5EUOB 5C3TA 5LDSA 3DSNA 1RZJH 3Q5OA 2HFFB 3E6FA 2JKRM 3II2A 4G8FA 4K8RC 3ZT5A 1KULA 5DHYB 3QI9C 3GI8H 3M45A 1W0WB 5I74B 3D0VA 3P4NA 1A14L 3GC3A 1NEPA 2OXGA 4ZOBA 5IROA 3QEHB 5CNHA 1NTDA 3G5VA 1P69B 2YOAA 1JZEA 3QIBD 1PX8A 4N6RA 3H42H 4XBEH 3D25B 4HCRL 1Y1DA 5D9SA 1AOZA 5TE4H 2Y9RT 5FOBB 3L54A 4AJVA 3DVIA 3IK2A 3V9EA 1EPFA 1VCBC 4DUVA 5IT2L 1DYZA 3RHWF 5IKCA 4PP2A 4PWIA 4XNYL 5C9JA 5HPOA 1N70A 3EF7A 4P2OB 3CFNA 4B9JA 4HJSA 1NIAA 4WO4D 5D2LB 1T5XB 2OSWA 4C59B 3DC0A 1B4JH 4LSUH 3E7JA 3Q13A 2DY2A 3OGCA 1ZD6A 4IMLA 4IOIA 1OTTC 3HKFA 3V5KB 1Q4NX 1MCIA 4IK6A 3Q6FA 3TVMD 1E67A 4WFFD 1S7TA 4DN4H 2X53A 4PLJC 3FKUS 4BHUA 1AAJA 3A21A 5IG7B 1XMWA 4Y4FA 1NJ9B 1Y0LA 1KGIA 1SJEA 2Y7NA 3LXAA 4XOEA 4EI5A 1BD2E 2IBZY 1KFGA 1X9UA 3VFGL 2CIIA 2DI8A 1UXMA 5T3ZE 4LCUB 3GSUA 12E8L 2J3SA 4XPAL 3IB4A 5ID0A 4F8OA 3DUSB 4PGDB 3X3GL 5KVEE 3EHBD 4KI5E 4ERSH 3IETA 3UPAA 2Z8WC 4LESA 5KAQF 4R7NB 1TTBA 1PJWA 4QHMB 5CU9A 1IFGA 1EHXA 1V27A 2H0EA 4QUOA 1A7OL 4FFTA 2FECL 3AWGA 3H6AA 2D9QB 3IFLH 2Y7MA 4YHZH 4N8VG 1KJ3H 4JFPA 1MHHA 4MCMA 2WC7A 5D7LB 4M1DL 2ZUWA 3TO4B 4KRPD 1F3JA 1KEML 4K7PH 2CLVA 7TAAA 2C8NA 4MBOA 1XZ0A 1KPRB 1BD2D 3M7FB 1YA5A 5DHDA 4MHHG 1Y6MR 2XV2A 4C56D 1JWMB 1KYOJ 2ZOKB 3FFCE 3LQAL 3HC4L 3MFGB 5I76A 5T3ZD 2W07A 1FFNA 1CYGA 1E30A 3IN0A 2J8UA 3KPSB 1WT5C 2J4WL 3MLTA 4G1MB 4XO8A 3OMZA 3ES6B 3PL6C 4O4YL 3HZMA 5BV7B 2CWRA 1AQ8A 3WLWC 1EK3A 3VXRD 2IADB 2WZPD 3W57A 4BCXA 4MAYC 2EUZA 3RBGA 2XXFA 5L7XL 2Z31D 4BFBD 4HJJH 3NABH 3QEUA 3VXUB 2X9WA 4P59H 4DEUA 2CPUA 4BWTA 2FBJL 4ENZA 4B3VA 3KVQA 1BDYA 3IMSA 1XXFC 5D1ZA 1NDMB 2F53D 1D9KA 2CBOA 3BN9C 4NNYA 4OJAA 4UU9A 1WO2A 4M7ZC 1P4LA 4PJ8B 1DQQB 1F4XH 1O7DE 3ILDA 4DPRA 1XGTA 2F1BA 1W8NA 4PJHA 1JDDA 2WMPA 2NW3A 2V2XB 2DQGH 2X2UA 3FFCD 4HK3N 1BJMA 2B59A 1XF3B 3M7OA 1U92B 3R06B 3E9UA 4I2XA 4QRBA 4UILH 4Y5XC 4AZUA 2Y1AA 4PS4H 1E4XH 3ZU8A 5DJYB 3MLSL 1M56B 4I0PA 2JKSA 1A7PH 1KIQA 4LO9A 3F65A 5D7IF 2Q8BL 3FPXA 5CCJA 3ROOB 5D7IB 3BH9A 3PWJB 1DN2A 4UAHA 5DC4B 4UOQA 1YEIL 4YGVB 4A6YB 1R9FA 2VLJA 4WW2C 3O9WA 5DHVA 5MEPA 3VI3A 4EAEA 3UMTA 4N5EC 3PWUA 1GZPA 2EP6A 2PO6D 3IJHA 2D4DA 4GSRA 4O5LH 5ITFA 3S2AA 1JTOA 1GW0A 5EA0H 3A6CL 2ADGA 1DBAL 1D5ZA 2Y24A 4UM9D 3MRRB 1ITCA 1IL1B 2N1TE 4IIQA 3STLB 1WCBB 2G2RB 4R8WH 2VDNB 7FABH 1PNCA 1S8DB 2JB5H 4PAZA 2ZNXA 5KSAB 5KSBE 4UDUA 3CC1A 4EBQH 4XMKL 4YSQA 1T7XA 5JIMA 1QX1A 4JFFB 1AO7A 4FQ1H 5AQ0A 4YPJA 3N1PC 1LDPH 1MKFA 5BUPA 3PDDA 1VF5C 4NWTL 5IHUH 3DOSA 5CMAB 2C3WA 3NJFA 1CBVH 1S9WA 5LBSA 2WTRB 2P48B 1NFDE 5HJ3A 1NAMH 1S7SA 2VDKH 3QHZL 4H8PA 3QJRB 5DK0B 4LCYA 3HIZA 3WLBB 2WYHA 5DS2A 3G5ZA 4JZNB 2D0GA 4BUGA 3CFUA 3LZRA 1M6OA 1GGBH 4LOUD 1AZZC 1MNUL 4FKHA 1N68A 1OGPA 3HFML 4TLUA 4C58B 3QAZC 3OLDA 5I30H 3MLPA 3EUDA 1HL9A 3B8SA 3AUVA 1R3KA 3OTTA 2M1KA 5FCSH 3HR6A 5ICYA 5CAYB 1DTUA 1KB5H 2V9QA 3ZR5A 2E7LC 2ESVA 3KPMB 3P0YL 4N2CA 2W65B 3H9YA 4YIQA 1BMZA 4MXWL 5I16B 4Q14A 3SQRA 1OGSA 1X7TA 2COQA 2F58L 4G6JL 4MMZC 2W0LA 1SLVA 1JZHA 1YJDH 3D05A 4OZHE 3IBOA 4FFWC 5ESQB 5IHLB 5FUCC 4PREB 3EJYD 1PD1A 2VLRA 3WFDH 1ICTA 1KB3A 5J6GB 1R75A 3ATEA 4NGHH 2W60A 5EDXA 1CU4H 1W6WA 2OULB 1LWHA 3EO9L 4NM4H 4R5TA 4WI4A 2DW5A 1XR9A 3DUUA 4L8BB 5FYLH 4LT7A 4H26A 2NY5H 1H0DB 3S3PA 1RZIA 5D7JA 4QRSB 5I23A 4QRPB 3MYZA 3DMMD 5IUCA 1MHCB 4X7DC 3U4EA 5ES4B 5B3SB 5IMLB 4L1HA 5DJDB 1HSBA 1TQSA 4QRUB 3GRGA 4S1SL 3US9A 2H5UA 5FYKD 1T6WA 2GEEA 3QQ9C 3VFNB 1DBKH 1OWWA 5C70A 4UT9H 1F58L 2YGVA 3CU7A 4Y2LA 1OD9A 1DSYA 1FCCA 1CE1L 4LP4A 3TASA 1IGTA 1AYOA 1VFAB 1EAPA 4NAMA 3R8BB 1N0LA 4XOBA 4JZOA 2VMJA 1ZKAA 3DWTA 4Y1SA 1PG7H 3EGDB 4FABH 3DX9B 4C57C 1KN4H 1H5BB 2J1ZA 4CDGC 1IMHC 1RK0B 2OSLB 2ED6A 1LYQA 3BP7B 3F00A 1YSOA 4BH8A 3L9RA 5HY9A 2I07A 4PRAA 1XB6A 2TAAA 2PYEE 2WM0A 3M8OL 3C08H 3WKQA 3J7HA 4H0LC 2AF2A 2Y4SA 1THAA 4YLQT 2OTWA 4ODUA 5GJSH 1YNKL 3K8MA 2Z92B 3CWGA 4G8EB 2ADFL 3OKKB 3US1A 1NBYA 1BV8A 4K94C 4Z95H 1H6TA 2B16A 3CZLA 2XX0A 3T65B 3EXJA 3HZKB 2GSIA 2J57A 1HILA 4R4FH 2KDGA 5JPMC 1HH9B 5DUMH 4HXAL 3H0TB 3BFWA 3T3MF 2Y7QB 3PWLB 3HMXA 3GRBA 1KCRH 4IRSA 3WXVH 4RZKA 1DJXA 1Z5YD 1ET7A 1JYNA 1AGDA 3PPSA 4RDQF 2X3AA 4K7FA 3FTSA 4KTDL 1WBZA 3BMVA 4XMPH 4DVRL 5I17B 4HIXL 4FNRA 3MO1B 1DO6A 4N8VA 4BYHA 1K3ZA 1LO2H 2P5EA 2CJ3A 1BG1A 1CT8A 3QXWA 4IDLA 1JHKL 5C09D 3PGDA 1QLEL 4BXSV 5JYMA 3TC9A 2EH8H 4YVNA 1FJ1A 5DSCA 1QOKA 2W9DH 3O6FB 3ZTCC 1XT5A 4ZUWA 2EEBA 2R51A 4PJFF 4MB3A 4CMHC 5EO1B 4KK6C 2WWKO 4PJFB 4PV8B 2BERA 1U3JA 1IAOB 2HG0A 3CG8A 3DURB 4YVUA 5F3BA 5FKPB 2C9XA 1ZPLA 3RFRA 4Z7WF 6PAZA 4NQDE 5DRZB 2FL5B 5DC0A 4Z7WB 5IW6B 3RVWD 4FD0A 3TBVA 4I3RH 5AW3B 2LAGB 3CFJA 3GT6A 3LEVH 1K3IA 1QKZH 2H26A 1TZAA 1QRNA 2CLZA 1NCHA 5C0CE 3NIFF 4QT5B 3L3KA 4DNLA 2QQQA 2KPWA 2HVBA 2V0AA 1W0VA 3QG7H 1IAIL 3BWZA 3EYOA 5D1QE 1DVFA 2H32B 1ET8A 4DPAX 4KXZH 2G75B 1MCOH 5FM5O 4AEHH 1QSFE 2L3BA 4LSRH 3CZKA 3GBLA 4JM4H 5GPRA 5C0BA 2E59A 3V6BR 2JCWA 4X99A 1EBAA 4H1LH 2OJEA 2MSPA 5INDA 4LVOC 5SWZE 3BWAA 1LP9F 5L2KA 1UGNA 3N04A 2CAKA 4GXUN 1KC5L 1CWVA 3CSGA 3ME0A 1EXUA 4IGBC 4HUUB 3U46A 1HT6A 1NBQA 3DV6A 2R2BA 1P1VA 3UJJL 4XCCH 2GTQA 3CH1B 4J2QA 2B4CL 4L4TA 3BKCH 4PRPE 4WKZA 2VTFA 2HLEB 4JBSA 2H0JA 3V0JA 3FQNB 2D0HA 4PTUA 1TJGH 2HJLB 4NO0B 3ETBF 2HT2D 3SPJA 4M5YH 4HIEA 1HHKA 1YY9D 4RNRA 1LK3H 2VABB 3VRJA 1A02N 2F18A 4RRPM 5ERWB 4L0PB 4PG9A 3B9KB 1B4LA 5H4YA 5B21A 3D69B 1VACA 3QUZA 1OAJA 2FJSA 2AEWA 2HLAB 5FDYA 1RI8A 3L4XA 3QWOA 4X5PA 3UXFA 4B9YA 5GJTH 3GXUB 5HYJA 1MCEA 3WO3B 2JQAA 5MERA 3Q48A 5BZXA 4DHLA 2IJ0C 3BVXA 4EXPX 5JHDE 2CK0H 2LVCA 3JV0A 3UTSA 4AQ8A 3EJJX 4AZ8A 2NYYD 3FQTA 4P99A 2OP4L 2R7EB 1T7VA 5EG6C 3FOLB 2FX7L 3MV9A 2ALWA 3ETBJ 1KB9K 1OF2B 4G5AA 3MLVL 4MJIA 4XVSH 3TN0A 1I31A 4HWEH 3IPEA 3FQUB 4OFPA 5FUZL 4OLWH 3PV7A 4OFYA 3T2PA 1I9JL 2Y1VA 2SEBA 5BRQA 3RA7H 2IANE 3I6GB 1HZKA 2IAMD 5F7YC 3H4FA 5C08B 3QISA 3WL9A 1F4WH 3MODH 1NMCB 1RH8A 4NPYA 2WO2B 1ADQH 2JIXB 3QO0A 5IJDC 3K4DA 3RIKA 4JGUA 4OIBA 2X0UA 4KJQC 5HI3C 4DZ8A 1TITA 4JY6B 3SE3A 5IESL 2XWEA 2PR9A 3MHZA 1WA2X 1XIWA 3D3VD 4PYHA 4NRZB 2I69A 2H1PL 2VISA 2QDWA 1JZ8A 4L9LC 3B1UA 4FJZA 5AW6B 4U3CA 4NN5C 4Q6IC 1JN6B 3QNZB 3K72A 2VLKB 2FECI 2BVPB 4LASL 1KDIA 2JELH 3CXHJ 4K3JH 2AAAA 4RMTA 1PBYA 2MCAA 1H8LA 4Q9RL 2ORBL 4JFDB 4M8UA 4GUCA 3UPCA 1AXIB 1JPST 2ZXGA 2NPLX 7PCYA 2EE9A 4RGNB 1NMBL 4X9YA 3Q1SL 4Z7VF 4ZXBA 2HJFB 1OAKH 2XTJD 4NZTH 4Z7VB 1B9KA 1MH5A 1C1EH 4NQCD 2CU9A 2ZUXA 3BKYH 3MNMA 5I8KL 4TRPL 4YBQC 5F1IA 4OZIE 3ZZQA 3C5ZC 4PJ7F 5KZCD 2YOCA 5FGBA 4A7SA 5IOPA 4OLZL 4M48H 3TF7C 2BP0B 3O3AB 4ODTH 2P45B 1A1MB 4OCXL 2WBJC 4IBUA 4H8WC 4IOFC 3DGCR 3B3BA 4ZMPA 2ATPB 2GBUA 1MI5E 4Q89A 3GJFH 3NMEA 3ZQ9A 5EF1A 1FNLA 1SJVA 3Q6GL 1KENH 1SLXA 4Z0XA 4UV7L 2PXYD 4XC1L 5EC1B 4YFDB 4MTMA 4A63A 4U1JA 1SY6L 1T0NA 1DBJH 4UI2A 4NN6B 3SYOA 5FO2A 4LIQL 4FQJL 4NZFA 3G6DL 5I66B 4MLIA 1TG8A 5BO1L 5KS9A 1HOEA 1EBPA 1TEFA 1A7RH 2OSXA 1FRGL 4JUTA 4WWKD 1JE6A 3GIZH 1AQDB 2R69A 1RJCA 2D3NA 4XPGH 3VJ6B 5G4OA 4IOSA 3W2DL 5FPIA 3O45A 4J4PC 4OCRH 4YNYB 1H3PH 2BM3A 3MV8A 1HEZB 4LPUA 5DEGB 4HIIB 2DQJL 4M8RA 2RGSA 4WHYH 1P5VA 2OMWB 1KXVC 1MI5D 3HHSB 3E2HB 5DK3A 1OAZL 3DHMA 2OMYB 5T1LA 1VGKA 1G7IA 4DP5X 2VL4A 5KVFE 1GYWA 4PTTB 4DERA 4GQQA 3VD4A 5GRWA 3KWXA 3VGFA 1CDBA 1A6TB 2WLLB 3F58L 3KDPB 1JFHA 2ZD0A 3MV7A 3IAQA 1HXYB 4EPSA 3ARBA 3QJZA 4MS8C 1F0LA 2MOGA 3BHBB 5CUSL 4JQVC 4Z7QE 2VWEC 1JNHB 3TH2T 5IQMA 2GUYA 2XVBA 3S3JA 1NBCA 2OCCB 4BM7A 4LMQI 1WAAF 4TNVF 3VXNA 2NY0C 2A6DA 3IKCA 4XCYB 3REVA 2QZ5A 3GB7B 1CXKA 1AGEA 4W9IC 1ZEAL 5ECGA 4LSTL 3MRCB 5F7KC 5CEYA 4MDRA 5IFAL 4PJCF 2LQRA 4PJBF 4YDJB 3ALWA 1WWAX 4PJCB 5ILTH 1ETZB 3CZJA 1B0RB 3T8MA 3MRHA 1FL3B 1QRKA 4JR9H 1J9SA 1YEHL 2IH8A 5BZWA 1A2YB 4LOEA 3U4AA 4ZT1A 4UUJB 2OMZB 4HLJA 1NSNH 2VR4A 3QXAA 3WHXB 4K8RD 4NBYB 5IVZA 1KZQA 3D0LA 2HRPL 3WS6C 4YHIB 1PSKL 3QI9D 4OI9A 4A2MA 4QOKE 1X9RA 2ENPA 3FW6A 2DD8H 4Q9QH 3ESMA 5I1EL 2CO6A 2IC2A 2WO3B 5JDJA 1ZTMA 3NGBC 5GIRA 1SUHA 5LVEA 1JNJA 3V4PL 1P4BL 1R17A 4JCMA 3UYPA 1YUKB 4M3JA 4LL1A 4XNMA 5IMKA 1J8HD 1FFOB 4HKXA 4OCWH 1FORH 5AW9B 3C60A 4GAGL 1F11A 1TZHB 2HKHH 2R1YB 3CFKA 2R0ZH 3MLUH 1B2WH 1P84K 3D39E 3T8VA 2FZ3B 5I8EA 2JI2A 5E8NB 5T1MB 1NFIA 5FDWB 4PS8A 5IROC 3FB7A 1VIWA 4Q7DA 4HLEA 3MU3A 2ODIA 2V9UA 3TLRA 3S48A 5C3IA 5HHNA 2WWNA 4ODSL 1U2CA 2Y2YA 3DPDA 2WUBH 5DYOB 5IM7A 1OTTD 4ELMB 4RMSA 3FFDB 5I19H 2H9GA 1OARH 2P8PA 5FYJE 2FJGB 3D4CA 1SMOA 2I60H 5CCGE 5I75C 1HNYA 2FQDA 1FVDB 4Y8DC 4LEXH 1UOLA 4ELKB 1AD9B 4PLJD 1Z66A 2AHIA 1VFBA 5J8OA 3FU0A 3C6SA 2GQHA 3LJ3A 4EKJA 5I0ZA 4U7SA 3U4BL 4L29A 3WBDA 5L8LB 5IB2A 4Y19A 5DMKB 4QHUB 4YSEA 2FX8L 3VFOB 4OUUB 4Y4KB 2AJXL 1K5WA 5H37G 2BNUA 3PHQB 1OSPL 3AG1B 4ETYA 2W0FA 3WY2A 1WV7T 1L9MA 1GGIH 1IAKB 5HBBA 5I1AB 4G83A 4G6FD 4QGYA 2AMGA 1DCEA 2GYSA 4FULA 4Y4FC 1QP1A 5LNEA 4EI5C 2BIMA 4HPYL 4L9DA 1PVHA 4PJIE 4X0KB 5FYJD 3BKMH 1JXGA 2WSKA 1NM4A 5BQ7B 3FRUB 1AI1H 2HP4A 2A2QT 3L4CA 2HVKB 4HKJB 3ZDXF 2NDGA 2NY3C 2XWBB 3U9UA 1QSEA 1BMGA 1TVBA 4YAQB 2JJSA 2HFTA 1N7MH 4ZYKB 1T3FB 2I9LB 3RU8H 4FFYA 4A55A 1Q0EA 3P3SA 4B9GA 1JWSB 1UFGA 3NCJL 3FQ1A 3RWIA 1WBYA 4LARL 3PL6D 3WLWD 1VB9A 3SGEH 4MAYD 2E27H 1KLGB 5T5FL 3L48A 1XQ4A 4GW1A 4J3OD 4MX7A 3N42F 1NBZB 2VO8A 5FFOA 3IXTB 3N42B 2JKXA 2YPLB 4L3AA 3ARWA 3C5JA 1W72H 1IVLA 3NT0A 2CCWA 1DFBL 3MJ7A 4HEMA 3BN9D 5IB1A 4GO9A 3UIYA 2O61A 3OJVC 2P24B 4ONOA 3OQRA 2UVEA 5CU5A 4E41E 3CSYB 1KJ2H 2DB8A 2EEXA 5E8PB 5EZJA 4ALAH 4TLSA 5CD5C 1B0WA 2DDQH 35C8L 3BSZH 4JPIA 1BM3H 2XV0A 4XAKE 2QVFB 5FYKH 1Z1WA 4Z78B 2VUOA 1DQKA 2JXMB 3TWYA 1FH2A 1ZV5A 5I24A 5D1ZC 4G9FD 1D9KC 3EDDA 3GZKA 1IJ9A 1OE3A 2VC2B 2CKBA 3JZ7A 4XVTH 5FW6A 4MQ7A 4LHUD 4L48A 4Z7NB 4UYPA 2AITA 3W0WE 3T0XA 2UX6A 1IEAA 1A6UL 3MROB 1C5BH 4U7KA 4E9QA 4A6YL 5CGMA 2ZUTA 3U79A 4LCCB 2JKNA 2VLMD 1LO5B 4EN2A 1DQMH 5EUOA 1QG3A 3UJIH 4N5ED 5ALBL 1INEL 4N1CA 2C34A 2EE2A 2HFFA 3CVHH 5DUPL 1IC7H 5DHYA 2VERN 4XAKD 1W0WA 3EH4B 3MRFB 3W82A 3NFSL 4ZMXA 3ATBA 1IAII 4I0PC 4AVKA 1AGCB 2A5UA 3LN5B 1BJ1H 3OX8B 1MELA 3LIZL 4CBZA 4L3EB 4YBHA 3UTTA 3BP4B 4X9IA 1G87A 3D25A 2ZKXA 1JDAA 4N9OB 3GRWH 4F7MB 4L1DA 4U3SA 3OZKA 3WXWH 3A67L 5LN8A 2WINB 1GYCA 1D6EB 3O9WC 1N18A 4PRIE 2FIKB 3DXAB 4QWWC 5GGSB 4ZTOL 2PABA 3UABA 2LOEA 4G9DA 2XSKA 4GRWB 3QWRA 2KC0A 3W0WD 1T0MB 3B2UD 5EEWA 3QCVH 1ZHBB 1NUGA 2O5XH 5E9DD 3V4UL 1DBML 2AJZA 3FZUC 4RZCB 1G84A 1T5XA 1IGML 1MIEL 3MRPA 1OHZA 4IIQC 1FNSL 4BK4A 1J5IA 2C3HA 4L5FH 1ZS8B 3V5KA 5I1JL 3HFFA 4LK4A 1KCUH 1E7VA 4F20A 3AACA 3HUJE 4GUOA 2CRIA 5KN5B 1E40A 2EDNA 1DVSA 5C7XH 3L7EA 4F58L 5CJXA 3FMGH 2YQ3A 2WKOF 5FGCB 4U1MB 3K2MC 5JIQA 1NJ9A 3X14B 2XN2A 3T1FB 4YUEL 1CLYL 1I8IA 3BUBA 3NZ8B 4TULL 1A4JA 4HMEA 3NCFB 5JW3H 3PGFH 4RH4A 5FA3A 4N2LA 2P28B 2XV3A 3RPIA 4LCUA 3GIVB 3POHA 4NQEB 3STZB 4NPKA 5HYSG 4PJAB 1KBPA 1QZ1A 3GBNL 2O72A 3HCVB 4LQ1A 4JFED 2WLNA 4ZMLA 2OMNA 2R9HC 4R7NA 3RHWK 4AXWA 5KVDE 4I13B 1M71B 2Q76B 4RDQG 4QHMA 1CDCA 3QEGL 1USZA 4FNSA 3QFJB 4FFWD 1MRCL 1G9MH 2N56A 4BZ1H 1NBVH 4UCFA 4PJ5B 5CLXA 5D7LA 3O6LL 4N2FA 1BYOA 4R0LC 5E4EC 1CDHA 3TO4A 4PH8A 3U83A 1AR2A 1YEEL 3NSXA 4MAUH 1KPRA 3KM2A 3L08A 5EEZA 1ZCRA 3JT2A 1MVUB 4X4XB 1JWMA 2ZOKA 3LCYA 3LZQA 4CSTA 8FABB 4Y9EA 3ZBMA 2EIBA 3QUXB 4G1MA 1NOAA 1KYOK 1IGIL 1RUML 3ES6A 1IGFH 1NKGA 2G2PA 3LNGA 2Y69B 1PIFA 3OKOB 1K8IB 4NUGH 4BA0A 4RX4D 3HG1D 5F6IB 2PWFA 4FQXA 4JGMA 5T5FA 5I0YA 4PJ9C 2XC8A 4PVNA 4PB0L 4ANWA 2XWJB 2CZNA 2OAAA 3MJ6A 4FQCL 1C7SA 2G4EA 4HC1A 4DPCX 1NDMA 3CH8A 5C07A 3V6FB 4Z7OF 1RU9L 3OZ9H 4ZOEA 3OPUA 4YSPA 1ZTXH 4OU3A 4PJ8A 1DQQA 5D7JC 5K59F 4H8HA 2KKQA 4Z6AT 3OAUH 2BY3A 2YXFA 3TV3L 1D6VH 1PDKB 4J39A 1MCHA 2IG2L 1BQSA 2PTUA 4WO4B 2V2XA 4XI5C 3HZ3A 5SWSA 1VJSA 5T3XL 1U92A 1PKQE 4G8GA 3HRZA 4XMUA 4B0MM 3NRPA 5I6KA 3LRGA 5DK2A 3UTQA 2PKDA 2P47B 5DJYA 2J1WA 3LD8B 3LB6C 3TIDA 1SVBA 1KG0B 1OM9A 1Y07A 4QYAA 4OIFA 4GQ9L 5D7IA 3ROOA 3TYFB 3T6QC 2C9QA 4LLVB 1X9LA 1FE8H 1VAHA 4WWID 1NKOA 4ORZC 4BSVB 1F1DA 3IF1B 3PWJA 3MKKA 1IGYB 1N0XL 1XVSA 1A3ZA 2VAAA 3G5WA 3I75B 3OKMA 4J3TA 4N2BA 4WDIB 5H37A 2YA0A 5FFLA 1TETL 3U0WH 3US0A 3RPKA 4KZEH 3TM6A 2QTVA 4Z76B 1MHEA 3O41B 2AEQL 2C4FT 4PCSA 1T80A 1XF4A 3DI2B 1KPUB 5LQBH 1T4WA 3MOQA 3SKJH 1OOWA 1UZ8B 2FSEB 1AS7A 1BQLL 3MRRA 3O4OC 3STLA 1ED3B 1WCBA 2NQCA 4XPHH 4XC3L 5G5DB 3MGTB 3MJ8A 3GNMH 3OXSB 4H88L 1SOQA 3BVNB 1BJ8A 2BVEA 3HR5B 4KRPB 5ID1B 5KSAA 1AP2B 1BMWA 1ULVA 4IRSC 5HHME 1CICA 1DSFH 3TESA 2IGLA 1BD2B 4JFFA 1S6NA 4M29A 4TQIA 2DIEA 4FA8A 2O93L 3D18A 3O0RL 5AEAA 4CVXA 5CCKL 4QXUL 5DWUH 3SBPA 4KK6D 1PX3A 4FZ8L 43C9A 1WFMA 4N2OA 4NO2B 2E86A 3AS3A 4KI5F 4N0UE 2ED9A 3VM5A 4CC4A 3OKEA 3VXRB 2WTRA 5HVFB 1ZGLB 5D7KD 2ZCHH 5DK0A 2Z31B 3GMMB 2DQMA 4U6XA 3NAAL 2XYBA 4JZNA 4YXKL 1BPVA 4HULB 1RY7B 3JWNH 4OCYH 2F53B 4MD0B 3ZOAA 1JZ2A 4AEIH 4N2DA 4OGAC 2Z7YA 2ZP0T 3O2DH 5HHMD 5AAMA 3F6JA 2J6EL 3IN2A 5A2LH 3KPMA 2CR0A 4AV0A 2W65A 2HKAA 3FFCB 5L0QB 5BVPH 2X4QB 3FHQA 4IGBD 3FO2B 4TUOB 3JUZA 3GI8L 1XWVA 1E9PB 2HZHA 1S5IH 3N2JA 2YK1H 1MWAB 2E5EA 3QP3A 2CRMA 3FUKA 1DVFC 2OMXB 3H42L 2XICA 4NCC2 4PREA 4XBEL 3WTUA 1JNNH 4NNXB 4APQD 3WY3A 4GW4B 4WFHD 2YMTA 1DDTA 4N2GA 5J6GA 3KL3A 4NRYA 4X80H 4L1BA 2YPVA 4FN0A 4R2GC 1I7RB 1M2VA 4L8BA 1DJSA 2WQSA 2PO6B 2BOCB 1H0DA 5F97E 1HQ4B 3FT3B 4QRSA 3RB7A 1JTPA 2BS9A 2ZF9A 4UMSA 4QRPA 4TPRL 4UM9B 2H47C 4RFOL 5B7EA 5AOJA 5IMLA 1HOCB 4LSUL 1B4JL 5DJDA 4F8LA 4QRTA 1YECH 5LGYA 1JXJA 3A3YB 5IMOB 2BY1A 3N85H 1MCDA 4DN4L 2PCYA 2BSED 2Q3ZA 2V5RA 5DJ8B 1VFAA 3PWPA 1KCWA 1HCZA 1FGVH 3QUZC 3B1TA 2A9ML 3DX9A 5DD6B 3TPUB 3SY0B 1H5BA 4LQFL 3V0WH 1L4IA 4J8QA 3BP7A 3KPLB 4NIYE 5EIIG 4A2HA 1P6WA 5C0NC 3HS0C 1CLZL 3C9NB 4ERSL 5DEJA 5J6SA 5CLWA 4Z7UF 1E0OB 1XH0A 3ZE2E 4UNIA 1K2DB 2NZ9C 4AQ8C 5AW1B 4GB9A 2XN9A 1I8AA 1N12A 3MMEB 4G8EA 1R46A 3OKKA 2XV6B 2GJJA 1XH2A 3T2NH 2NY7L 3GSXB 1KTCA 3IFLL 3GHEH 5IR1B 2FSDA 3LPOA 4YHZL 4KKAC 5EF2A 1KJ3L 1QBAA 3T65A 3RL1B 5KSBF 4KMTH 3HZKA 5C6TL 5I71C 3TN0C 3SOBH 1XBRA 4KJQD 5HI3D 3H0TA 2Y7QA 1YEKH 4K7PL 2D73A 3PWLA 4PJGF 5CD3B 1FFRA 5HYSA 4KO9A 1GIGH 3OAZK 4B9CA 3VAEA 4DP2X 4N5UA 2XX1A 5K33A 4AGPA 1BM7A 2X12A 3QYNA 4K8RH 3BWSA 2VSCA 4ZS6C 4ZRGA 1QO3B 3GXTA 3L45A 1NFDF 2APWA 1EGJA 1KXQA 5I17A 4LEEA 4P5TB 2B9AA 1D7BA 5AKVA 3RP1A 1M9SA 4LU5H 2TSBA 4HJJL 3NABL 1SXAA 3B6SA 4PU2A 3SE3C 3NRFA 3H3PL 1P7QD 5IEHB 3MRNB 1E65A 5GRUH 1XIWC 3C75A 1Z9PA 3I3EA 2VDLB 3AM8A 2ZF8A 5FF6B 3TA3B 3O6FA 1SHSA 2EXSA 5A6LA 1E4KA 4AC4A 1F4XL 4PJFA 1KJ2B 4AKPA 1IAOA 2E7BA 4ZQKB 2OL3H 3DURA 4CILA 3T2LA 4NUPA 4ZNEA 1S9KC 4NOFA 4YBQD 1GH7A 5DA4A 3DMMB 5DRZA 3C5ZD 1EFXD 3QUHA 4Z7WA 3TCTA 5K9JH 2VSKB 2F61A 3OB0H 4LL9A 5EWIL 4OGZA 1OGAD 4QT5A 2Y3NA 2FWLB 4UILL 2WXIA 2R4RH 2XBTA 3WG7B 4OFKA 5DHEA 1FNHA 3BGFC 5KSUB 4QPEA 4PS4L 4OZHB 2D3VA 2WBJD 2V8LA 4ZXBC 1E4XL 4IOFD 2YSSB 4R97C 4XP4H 1A7PL 2DLIA 5ESVB 1XH3B 5JORB 5JQ6L 5J89A 2H32A 1JL8A 1JS4A 1ID2A 1L6XA 2G75A 3PNWB 3L4ZA 4HK3J 3K6NA 4O2CA 1IC4L 2V2WB 4Q0XH 5E95B 4E9XA 5FGBC 5TE6H 1HWWA 5F89B 3ZR6A 4GG8B 1PF3A 1LP9A 4O5LL 3GZOA 4G71B 5DJ6B 4HUUA 4UZGA 1QI5A 1NGQL 4B9ZA 5EA0L 1BAGA 4W9DC 1BQHB 4J4PD 3M1CA 4P04A 5HDOA 1TLMA 3QUKA 1NANI 4R8WL 1U95A 7FABL 2ZXWB 1V54B 1E5ZA 1BEYH 1U8PA 2J5LC 1DQLH 2JB5L 1FV1A 2KMWA 1QEWB 2ZG2A 4KROC 4NO0A 1K5NB 4PRHA 3B7UX 5F8RC 3BPOB 3QJHB 5FYKU 4EBQL 1PZBA 3DSFH 4X4MA 4ANXA 3K1KC 1VCAA 2HT4C 2VABA 4FQ1L 5ERWA 1XF1A 1LDPL 3B9KA 2VSDA 3D69A 4HHGA 2HLAA 3T3PF 5DJZB 4OH2A 5IHUL 4NBZB 4JHVA 3IMUA 5I6OA 4M1GH 2PYEB 4MS8D 1MY7A 5AW7B 3LPPA 2VN6A 1NAML 4BZ2L 4P06A 4NKMB 4YE4L 4CRPA 5IBLC 3ZKNC 1MLBA 3PIQB 2NY0D 3OG4B 4OZ4A 3ARDB 1A1OA 3V6OA 1V7MH 3DX0A 2IPUG 5EF0A 2R7EA 5I30L 3PJSB 3FOLA 4L3CB 3WGUB 1RK7A 2K78A 5HPMB 4BK8A 2OJZH 1OF2A 2YRBA 5JDSB 3GMPB 3L4TA 3QQNA 1KB5L 2ZPKH 3ARBC 3KEDA 4KKPA 4X42A 1N2RA 5FEBA 4R3SB 5H35B 3MUY1 3O11B 1HL4A 3LX9A 3NZSA 4NN7C 4O51B 1U93B 2UUDK 3C87A 2G9HB 1QZNA 5GRZA 3MV11 4JN1L 5MENE 3N40F 3OPZH 1WTLA 4X6CE 3I6GA 4X6EB 1EJOH 1SXNA 5FLUA 1YJDL 2BK8A 3B8YA 2EEAA 4OM0H 4UINH 2AAVA 1RXLA 4XHJC 5KSVB 2JIXA 2Y6SC 1BFVH 2DN7A 2OMVB 3QH3A 1HIMH 1OY3B 4QTIL 3WFDL 3OHXA 1KJMB 5FGRA 4W6WB 3KXFD 1LEKB 3DX6A 1H3GA 2V9RA 4BQ9A 5JQIB 1L7TL 2WXFA 4JY6A 4NGHL 4Q6KA 1CU4L 3QQ4B 2J21A 2FGZA 4NM4L 4P2CG 2EXTA 5FM5M 2K7PA 5FYLL 3ZZSA 2HAZA 3MA9H 4RFNB 1B4TA 1UUNA 3KAAA 2VL5B 3BH8B 4HV8B 2GABA 1GR7A 1KELH 2EE0A 3S8FB 1JN6A 1JHTA 4PIRF 3QNZA 4EE2A 4S10A 2VLKA 4NQDB 5IROD 2BVPA 1FVEA 4FLRA 3VD0A 2PWDA 3IPBA 4WJG3 4DK6A 5BVJB 4XCNB 4OTXL 5SV3A 3VSTA 2GPZA 2PPEA 3I84A 5C0CB 2UX7A 5A16B 1VPOL 2W59A 1DBKL 2AJ3B 5KYXA 3CXHK 3CC5B 1S9VB 1P4IH 4WUUA 3LEXB 1UT2A 3UJTH 2FCBA 3C60C 5D1QB 4AYFB 1JJUA 2HJFA 2QTEA 1PG7L 1QSFB 2CIKA 2H6PB 3KLSA 4Z7VA 1KN4L 1H6EA 2BP5M 4X5WB 1ETB1 3MUJA 4DWHA 2YUWA 3VXQB 3LHAA 3IS0X 2VUKA 3GKZA 3C08L 4JQIA 4CUCA 1IQDB 2EUWA 4CGUB 4WEMB 1XL6A 2BP0A 4DZBB 1JV2A 1K6QH 2NSMA 3IJYB 2AQ3A 3HMWH 3ALXA 4PRPB 4EI0A 5CFAA 2ADIB 2QVIA 2WK2A 3PUCA 4Y4FD 4Z95L 2WXNA 4JPVH 4L4VE 4LPWA 4P2QE 1RZPA 4JM2F 4EI5D 1JXKA 1IILE 1BAFH 2AW2A 4WSGA 2XU9A 2PCPB 3GBEA 4F1ZA 5DURD 1OM3L 4FFVC 5EC1A 1UZ6F 4DSYA 2HFEB 1L3WA 5EIIA 3E3QE 4DH2A 1ZGLP 2NY3D 3ARFA 3MJ9H 1YYLH 3CV5A 5I66A 1KCRL 3BUIA 3WXVL 2OCJA 1KCKA 3TFBA 2AQ2A 3JWDC 5F9JB 2WV3A 3ARRA 1N8ZA 1EDYA 4XMPL 1A1NA 1PX4A 3N9GH 4X4YB 3VJ6A 3ZYOA 2E74C 3SD5A 3WTXA 5HVHB 2XETA 1FNGA 1LO2L 1MJ8H 1HEZA 4NRXB 5DEGA 2VKWA 1Z6JT 1WIPA 3HHSA 2EH8L 5GS0C 2OMYA 4FTVE 3ZYIA 4WGWB 2OI9C 2W9DL 1X5YA 5JOFB 2BRQA 3WKNA 5L9DH 4HHAA 1B9ZA 2I24N 1A6TA 1QHOA 1SFHA 1U8LB 3GFUA 3KZ8A 5CD5D 3RTQA 1BECA 4UIKH 1EJFA 1KCLA 1KJVB 3LKQB 1O9ZA 1VA9A 1JNHA 5IZ7A 2NNAB 3P9WB 4I3RL 1T66C 4I1RA 5DD1H 5DRWA 4FYTA 3LEVL 2YKKA 4NAJA 4BE5A 4BKLA 2IANB 3L5XH 2NUPA 4LLYB 5DZOA 2WN2A 1J05B 2P8LB 1J1OH 5LXGL 4BUQA 5D1ZD 2CHDA 1D9KD 3L5JA 3QG7L 2C1OA 1IIIA 1MG2C 2R2HB 5CXPA 4YDJA 1E2ZA 2AK1H 4XN9A 4PJCA 3ECQA 3IMBA 1MCOL 4PJBA 4AEHL 1B0RA 2WP3T 4LSRL 4NQCB 2WIMA 4JM4L 5CR8A 1QPXA 5HDLA 1FL3A 2CUHA 3PJLA 5E6ZA 1UGKA 5IUSA 1WIOA 3WTSA 1UQSB 1A2YA 4E36A 1UYWH 1PAMA 2C9PA 4FNLL 4AEFA 2BOBB 2Z91B 5HHQA 5JHBA 3DYPA 3VQMA 1NIFA 3ULVC 4ODVH 1HTYA 3BKJH 4XCCL 3TFKC 2ZXAA 4V2BA 4YSDA 2ETWA 4FLSA 3G6JF 1J87A 4I0PD 5AVSB 4JGNA 1QPPA 4K94H 4XBPA 4ZAKD 1PYWB 2A0LC 1UVQB 2E56A 1AO7E 1T4KB 5HYEA 4GRMA 4IKKA 3WHE1 2PXYB 4F92B 5CWSA 4V2CB 2VLJD 1A3RL 1FFOA 3O9WD 4JY5H 2W92A 4QWWD 4TNVK 3P2DA 4CAGA 3WFBH 1BFTA 5K69A 2F19H 4KC3B 2GJZB 2R1YA 2KZBA 1EJ8A 5I74C 2FZ3A 5T1MA 3HAEH 5E8NA 5GS2D 1FDLH 4PB9H 5FDWA 2BCKB 4OZIB 4ACPA 3FZUD 3APCA 5EU4B 5GJTL 2ZX5A 4YXHH 2R23B 3WUWB 1NGPH 5DYOA 4MJ6B 3OMNB 2Z4QB 4N26A 3GBDA 4ELMA 4F3FB 3AQZA 5J3HC 2CK0L 1JVOA 1MLCA 2QPEB 3I2CH 1FVDA 3CU1A 5IW1B 1J88A 3DKHA 1MI5B 1AD9A 4R4BB 1AO7D 1VHPA 4LOVA 2OZ4A 4KHTH 3VGEA 2PETA 1H8NA 4UTAA 4MA8H 3FPYA 3RJOA 4BFNA 1F1GA 5IQNA 1MFEH 2Y5EA 5DMKA 3DRTB 4HGMA 4XVSL 2GT9B 3VFOA 4OUUA 4HWEL 1YPZF 3L5IA 4OLWL 1LMIA 3O4LE 3PFUA 3L1EA 3WIAA 1INDH 3HOGA 3PHQA 5MP6H 4W9HC 1RHFA 1JWUB 3RA7L 2BIHA 4JFXB 1U2YA 1IGCH 3WTVA 1CXHA 2X42A 2G4GA 2M8XA 3EFDH 4JMXA 2DQFB 5D1XC 3UG5A 1F4WL 1DANU 4OJYA 1I9IH 3ERXA 2WOYA 1BX2A 3FN9A 2ZUUA 3FU6A 4JMNA 5DO2C 1ADQL 4XOAA 4F37K 3APDA 4JDZB 5BQ7A 5DI8A 2WUCH 2JJTA 3FRUA 1DEEB 4HKJA 4M1CC 2ESVD 2HVKA 3CCHA 3L8QA 2DH3A 4B9FA 5BNXD 2XWBA 4FI8A 4LSSL 1G1CA 5EV7A 4ZYKA 4P5KB 1T3FA 1JGIA 2I9LA 3CHQA 1JWSA 1LLAA 3B7TA 1SVCP 4Z7QF 3IGAB 4G8IB 2VQ1A 2NDFA 4UT6A 1YDPB 4OAWB 3VMOA 3B2DC 1HJCA 5HHXH 3Q5TA 4K3JL 2G30A 2VLRD 1EFQA 3ULSA 1AIFB 4PJ9D 1NBZA 5K9QG 3TO4C 3AU1A 1HH6B 3IXTA 5IBTL 1VFUA 2YPLA 4OW6A 3CGTA 2J88H 5ANMB 3PYCA 5JLZB 4FX5A 5A2AA 4NZTL 3TGXA 4JVUA 1G5GA 3B5GA 5DFVC 2NNXA 2P24A 1C1EL 2H6UA 3ATDA 3PDOB 2R2CA 5D7JD 5BQDA 1JK8A 4JKKA 3BRGC 3BKYL 5BV7C 5HYQB 4MDIB 3EJPA 2CUAA 1RZ8A 1WA0X 1ZTXE 4FQXC 4FZEH 4TNWF 2HH0L 4WEEA 1G7QA 1T0OA 3WNNA 2D2OA 2HG5A 3D1MC 4QOKB 4WWPA 4Z78A 4E9VA 1MRDL 4ODTL 2JXMA 2QQLH 2Z64C 1BZ8A 2WLZA 3F7KA 5EOCH 2UZYB 3QYCA 3VXTA 3LB6D 1UWEH 1A9EB 2EACA 5HHPB 1KENL 3PP3H 4PJ8C 25C8H 5LBVA 2GBTA 4W9CC 1W8OA 1SZNA 1J9CT 1OP3K 3MROA 1DBJL 2WQWA 2DQCH 4FP8H 4LCCA 1AQMA 1T20A 1UWYA 3A47A 1WHPA 4N9GB 2AV7B 2VITB 3NIDF 1ZANH 3BISA 3W9EB 2CRYA 3E1ZA 3HNTL 1CL7L 1A7RL 1SM3H 4XN7A 3HRZC 1KFAH 3D39B 2F8VA 5D5MF 1GZQB 3GIZL 4PWJA 4DCQA 3KYOA 1E4XI 4JKNA 3MRFA 4XPGL 1ZA3A 3QJVB 4FJ6A 1AGFA 1AGCA 4YDVB 3LN5A 4OCRL 1H3PL 3OX8A 3UTZB 1FGNH 1MVFA 4L3EA 3EF4A 1FZJB 3BP4A 1L7IH 1FO0A 3IMVA 5B1AB 3NZHH 5TGBB 4ZO9A 3E6HB 4F7MA 4LSQH 2WINA 2DKUA 1D6EA 3DXAA 5GGSA 1A66A 1JMXA 4IRSD 2HTKC 4KY2A 3KPRE 5T33L 2QQKH 1IBGL 3HBZA 4P9MH 3TBTA 3VH8B 3OKLA 1ZHBA 5T3ZL 3IKKA 2H8PB 3B83A 5C0EB 5JW4M 1BF8A 3NCMA 3PL6B 5DZ9A 3UGXA 5KVEL 4RZCA 3VB9A 5F1OB 2NTSP 5DZNA 2P5ED 4K15A 4MAYB 5L4MA 1SNRA 3RWHB 3NTCH 4L37B 3F7RA 3GHPA 3LRLA 1RUQH 5KSAC 3S3DB 1CICC 4PJIF 3CBKB 1DQIA 3EFOA 3WEAA 4PJIB 1IC1A 3F64A 2D31B 1HKFA 3A6OA 4OT1H 3X14A 4LP8A 5C0AE 3IDNB 4Q2ZB 3WDIA 2EQDA 3BAYA 3NZ8A 4QHKI 2PF6A 3THMH 1OALA 4OGAD 4AVIA 2E7MA 5D2NE 3ZGIA 4JR9L 3SPIA 4CC4C 2IWKA 2BFGA 1G5AA 3K2UH 5M94B 1X5AA 1GC1C 4RAVB 4XCFH 3STZA 3RAJH 2Y7OA 1RPQA 4S1DC 3RX7A 3MA7A 3MBEB 1QRND 3IFNL 4UQ2B 5CN3A 4AIEA 1Z9LA 5I1CH 4Y5XB 3V0DA 1M71A 5AAWA 2Q76A 2DD8L 2ZNWA 1MWAL 1V5JA 4JG0H 5D6CB 2PN5A 1EERB 2NSQA 3QFJA 4XMXA 4BQBA 1DVFD 3HW7A 1DJHA 3QZMA 1BOYA 4A39A 4RA3A 4LHUB 3L3IB 1NIDA 5AAMC 4PJ5A 4UOJA 1GKEA 2V8MA 1DCLA 2BVQB 1PZ5B 4OCWL 3TJEH 2G9KA 3MXVH 4JG9A 4R2GD 4WW2B 5L2KD 2OS7A 2ZWSA 3MRIB 3BZFB 4XGZA 4O02H 2TRYA 1MVUA 2DQTH 4X4XA 5HYJE 3FQ4A 2HKHL 3CMOH 2R0ZL 2PCXA 8FABA 3QUXA 5BOPA 3TZVA 1EEYA 2RB8A 4IBQA 4BELD 3FT2B 4OVUA 2CMRH 2WXQA 2Q1EA 1F41A 2XVKA 4KMLB 2AGJL 3OKOA 4C47A 4YDNA 4DKAA 1HAUA 3QJQB 1KTLB 1M2OA 4GO8A 3NJXA 5I19L 1OARL 3OR6B 2XWJA 3SHSA 2I60L 5KG9B 1NKRA 1CFVL 2PWHA 5F88B 2EABA 1O6TA 2NQ3A 4GUPB 3V6FA 2HUHA 3HPLB 3QUZD 3W0WB 3CLWA 2EXWC 3EYVB 5SWQB 4G7QB 2EVIA 3T09A 2DM4A 1MCKA 2BH0A 1QW9A 2BO0A 2AKRA 2X2YA 3D4ZA 4XMLL 2IDCA 3UO1H 5E9DB 4WO4A 1FF5A 2VZUA 5HYJD 4YE0A 5AB9A 5C0ND 5I5RA 2VN7A 3QB7C 5PAZA 3BYYA 2EINB 2YHGA 3NUKA 4ZFGH 1GGIL 4ZODA 2I9TB 3PREA 3EO1B 4OV6F 3UTSD 4CN4A 2NZ9D 4KITB 4TVSa 4E42B 4J6IA 1TQWA 1WS7A 5JA9A 4PJXE 4AL8H 3M88A 1BQHG 4Z7IA 3MV9D 5K9OB 3BKML 4KKAD 2Q20A 2J8OA 3TYFA 4EDXA 1FHGA 4MJID 4LLVA 1AI1L 3C2AH 5GGSY 3ORJA 3ZPDA 1IGYA 1VLXA 4WDIA 2VXQH 3BVUA 2VDQB 3NJNA 1M1SA 1EEZA 1N7ML 2QADB 4OFYD 1CXEA 2RMNA 4Z76A 3EJRA 3QC5X 3WOVA 4OV5B 4JFEB 4XWOC 4ZS6D 3VNZA 5GSRB 2RQEA 3P9LB 1HHGB 4Z3HA 5KBDA 2VE6B 1UZ8A 4MMZB 2BHUA 1ZJBA 2FSEA 3NG5A 1JBJA 4CBPA 1UD3A 1I7UA 2Z93B 1ED3A 5CEZD 2QR0B 1GVIA 3HUJB 5G5DA 1EEQA 3OXSA 1A7NL 3BVNA 1CJYA 3B5TA 1MN4A 4NT6A 3HR5A 4JKLA 5ID1A 1AP2A 1XIWD 5J7CC 1E2WA 3L3DB 3KHOA 1BD2A 3TV8A 3E0GA 3RNQB 3FB6A 2F2HA 3INUH 4NC1C 1S9YA 4ALAL 1KJ2L 1I8LA 3CN0A 5C71A 2DDQL 2EYRB 4NO2A 3BSZL 1NWOA 3B7RL 1HWHB 1BM3L 1CGSH 4JANB 1SF3A 4M7JL 2ZAHA 2WZPA 1ZGLA 4KTGA 1OCZB 1D5IH 2EYTB 1C5CH 4BSWB 4LDEB 5FYKL 3GMMA 4M7LT 2B1AH 3AQDA 1N26A 1MW3A 3GDCA 1RJLB 1J1PH 1H8SA 4QHKJ 4TVPH 1X3DA 1MPAH 4LLMA 5E99H 1NICA 3F04A 4ZXBD 3AM8C 4RMBA 4MBRA 1Q1JH 5ESAB 3O6FC 3RL2B 1NUDA 4FYQA 1E4KC 4XVTL 3Q0HA 5EZOH 3NA9H 3FUNA 3U6RB 4HFWB 1CR9L 2A6JA 5E9AA 2P5PA 1B6UA 1HWGB 3L1FA 1S5HA 3RWEA 1V7NH 2YAOA 5JIPA 4Q58C 1E4WH 2NNRA 2YJQA 1KTDB 2F7QA 4KOBA 4XNZB 3D08A 3K6DA 1DQML 1MAMH 4NQQA 3UJIL 3FFCA 2ZAIA 5KUKA 5EU3B 3SYAA 3CVHL 2X4QA 2RR3A 5C2BL 3FO2A 3GKWH 4IBYA 1LE9B 4TUOA 5LBGA 1E9PA 2IPTL 3AS1A 3RIAF 4UQEA 3HNVH 2ZKHH 2Y1ZA 3O3DA 3VW3H 4KXZI 2KPNA 5ALCH 2OMXA 4J3BA 2ZP8A 3V7AE 4B97A 2YAHA 3WXWL 4GW4A 3BP5B 4IKIA 3VDAA 5JPMB 2EDRA 4KROD 4LLAA 1QTYT 3DI3B 3HI5H 4JO4H 3PHOA 4JDTH 4NZJA 4PGCA 1I7RA 3JQOB 1OP4A 4UMGA 4UZUA 1ITBB 5EH1A 2BOCA 4GXFA 1HYSC 2IMNA 5ETUB 2Q8AH 2WQAA 2CLRB 4OD1H 2O5XL 2YZ1A 4X6DF 3FT3A 4IOSD 4MNGB 5T1KB 3S6CA 5DJCA 4EQ3A 1OT4A 4UM9A 1B4RA 3MV8D 4AM0Q 5AD0B 5EOTB 1NZRA 1HOCA 1PKQB 2V6HA 2XQYK 3FHAA 1MJJB 4L5FL 1OCWH 1KCUL 1WHOA 3FH8A 5IBLD 3ZKND 1TPXC 2OXHB 4MXVE 5C7XL 4GFXA 4NBXB 1CIDA 2JV6A 3FMGL 2ADJB 3FH7A 5DJ8A 5T1LD 3WI9A 5KVGH 1AQKH 1LQBC 2VDPB 3UZQB 3B9KC 3DPBB 3F7VA 4S2SB 5F93C 4I1PA 2KLTA 2VDRH 1TCRB 1ZLWK 3TPUA 2WN3A 5JW3L 3X2QB 3PGFL 3SY0A 4FCHA 3D48R 3ARBD 3KDMB 4LEOB 4G59C 3KPLA 3FTUA 1ND0B 5I2IB 1DFXA 3FRPB 2HWZL 3B9AA 3KWWB 1XEDA 5AYTA 3TO2B 3C9NA 3HN3A 1GGTA 3L9EA 4XPFL 5I5JA 3CFDB 1AYRA 1F1AA 1TQBB 3GO1H 1K2DA 3V6OC 3HLKA 2HLFC 3MMEA 2H1XA 2XG4A 3S7GA 2VJXA 1ET5A 4HGWB 4WJ5B 3GSXA 1G9ML 4BZ1L 1NBVL 4XHJD 3GXDA 2Y6SD 3RL1A 3RDTA 5KSBA 3ZHNA 4HG4K 1KZYA 5EULV 5HHMB 5CD3A 3PJNA 4MAUL 5GXBB 4AQ1A 1E6JH 4LVOB 1BHGA 3FSOA 5IY5B 3V5DB 1NQBA 1DLHB 2GTWA 5KBPA 2VXTH 4IGBB 4YLBA 4ZUVB 1B6DA 2YXWA 1M7DB 1QO3A 1IGFL 4HJ1A 4N0UB 1NMCC 1JK9B 2DBLH 4EZLA 4RMRA 3ZO9A 5L8KB 4P5TA 1NFDA 5D4QA 5J57B 4HGKC 4EVNA 5LGKA 4PJDB 3OHXC 4UTBH 1IFHL 4AMXA 2BXZA 1O6VA 2CBMA 4FI6A 4APQB 1JRHH 4QRQB 3EFFB 5DXWA 5IEHA 5DHVH 3MRNA 4NC2B 2DWDB 3C60D 3IXAB 4LF3B 2HN7B 3TA3A 4KK5C 2YZ8A 5F0MB 5HGHB 5IFJB 2PTTA 5F9AC 1WFNA 4HZ1A 2VXVH 2CSPA 3FT0A 3RJQB 2OK0H 4FF9A 4FEMA 3KW7A 3ILEA 2EO7A 2F7RA 1RZKH 1YRKA 2YC1B 4N8PA 5E6YA 1WWBX 1UXSB 5I9QB 1QUPA 5C7ZA 3ZE1E 4S0SD 3LKSB 3QIWC 3DX1A 4HDIB 3RX9A 1SN5A 4OZHA 5CN2A 4RGNC 4X9HA 2YSSA 4XX5A 2X70B 5JORA 2YWYA 1ZE3H 4E9YA 2NR6A 3IJEA 4XNYH 2A9AA 4KV5F 1FE8L 3PNWA 4FFVD 3UTPE 4GQZA 2YD1A 4MCYA 3AAZB 2OR9L 4OZFH 3U0WL 1L9TA 4YHNB 5JOPD 5LN4A 1Q0XL 4NENB 4KZEL 4ZFFB 5F89A 2WYIA 1R3HB 3Q5YA 3KGSA 4KRMB 1RKRA 3OBAA 5FXCH 2QELA 3VO0A 1T2XA 5KYWB 1S2EA 3SKJL 1GKOA 2DLFH 3FU3A 4XB8A 1BQHA 1UM5H 3ARZA 2OMBA 4L1SA 4WKXA 5A2FA 4XPHL 5IHZB 3WUWG 3HC3H 3LV3B 3VFGH 4IBZA 4NN6C 1QEWA 3LSOA 1K5NA 3ARFC 4JN2B 4U1GC 1QSED 3D85B 3QJHA 4XMTA 5GS0D 1DSFL 1TTFA 1CL7I 1T0PB 1YEWA 1EAQA 1JPSH 1LJMA 2NNCA 1BA9A 4L9LB 5HDBE 4NN5B 4Q6IB 4H0HB 1LWJA 1KT2A 3ULVE 5LUMA 3FCTB 5DEZA 2PYEA 1E8ZA 4JHBA 3ZE2F 5MEOB 1SN2A 1T66D 1BXXA 4B27A 4GINA 2ZCHL 3X12B 1M1XB 1NEZB 4NKMA 1DQJB 3LRKA 2WLYA 3P4OA 4TQHA 3L4YA 2F7PA 3ARDA 4OF0A 1P7QB 5EBWB 4OCYL 4TVUA 3PJSA 4L3CA 15C8H 1YMHB 4XNAA 5GGVY 4AEIL 4N87A 2QSCH 5I1GH 5JDSA 3GMPA 3O2DL 3RTQC 5B1CA 4OM1H 4F15B 5EPMB 5LGJB 4D0DB 2QZQA 4R3SA 5H35A 3O11A 2BX5A 4O51A 4ZSOE 1U93A 4ZTPH 2G9HA 2Y07L 5BVPL 3C5ZB