2Z35A

Crystal structure of immune receptor
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
112
structure length
112
Chain Sequence
DSVTQTGGQVALSEEDFLTIHCNYSASGYPALFWYVQYPGEGPQFLFRASRDKEKGSSRGFEATYNKEATSFHLQKASVQESDSAVYYCALSENYGNEKITFGAGTKLTIKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T-cell receptor alpha-chain
publication title Structural evidence for a germline-encoded T cell receptor-major histocompatibility complex interaction 'codon'
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 21
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2007-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2z35A00
4F2MA 5BS0A 2EYSA 4PTTB 3I6GA 1I7ZB 3C08H 2X1XR 3K46A 3CH1B 3BESR 2ICEA 2FYYA 4X98A 5F7DB 4Y4KD 1U36A 2DQCL 4N5UA 2OTPA 2LV4A 4LSQL 2UWEF 4ONGH 3WFHB 1KIQA 1NCWH 4XT1C 3BD4A 1CFBA 3OKMB 5D7IA 5DS8A 5ACZA 2WP3O 2AJSH 3P30L 3G6DH 1B0RB 1WIUA 4HDIB 3BN9D 4XI5C 1MCLA 1NGQL 3HRZB 5GQBA 1UM5H 2FO1A 1AO7A 1JK8B 2HMID 2B4CH 2FJGB 4OD1H 2Z91B 4ERSH 1LK2A 2BNQB 2IC2A 4MAYB 4ZNEE 4NRXA 1ZT7B 4KKBC 4Z7WF 1IJ9A 2I5YL 5IBLD 2EIDA 4HZLA 1O7VA 5DT1L 1CD1B 3OXSB 4G43A 2IBBA 3CU7A 1G6RA 4IOIA 3HG1B 5HYFA 2HN7A 3S97C 5AZ2H 4OGAC 4ZTPL 3DV6A 3I9GH 5HSFA 1ITCA 3HAEB 4PRAA 1CL7H 4FTVE 4ONFH 4XP4H 1HINH 2YA1A 4CNIA 2H41A 3N9GH 1HI6B 4AH2A 2DQFA 3WNLA 4PB9L 3RUGF 1FE8H 2BZDA 3IGAA 1K8IA 4FXKA 3CXDL 3DVFA 4XNMB 1P7QA 4J1UA 3DI2B 1TXKA 2XN9E 5AWNH 1R24A 4MNGE 1E0OB 5GS1B 3MXWH 1RZFL 4M93C 1UWEL 5D72H 4HCRL 2SEBB 4JDZB 5I1GH 3A6OA 3KPLB 1HOCB 3ZT7A 1OT1A 4JQVA 1J12A 4KRPD 1NMBH 3TA3D 4H1LG 5FKAB 4OGXL 1DBKL 2OZ4L 4CL7A 2ZCKH 3WIIH 3GSXB 2ZNXA 1A3RL 4ZFFB 1BBDH 4LLWB 4L8SA 4NZTL 5C0RL 1OGAB 2ZUWA 1ONQB 4GRWB 2YEZA 1CGUA 1NANH 3JWOH 2Q6WB 2VYRE 1IM9A 1MJJB 4B50A 1K2DA 1ZSDB 2HTLC 1SY6H 2X70B 3SDYH 1TQCB 1B9ZA 1NC4D 2YSSB 3KS0J 3P0GB 4ETQA 1T2QL 1HYSD 4HPOL 1DBAL 3LQAC 1NL0L 3CCHB 3X3GL 1GHFH 3HFMH 1RURH 5TE6H 3DO3A 2AI0L 5J11C 2YKLL 5HGGS 1MLBB 1JNLH 3ILPB 1AD9A 3UBXB 4XPHL 2XIDA 1R5IB 2GFBB 4HWZB 5E2TL 4XWGH 2R2HA 1Q9LA 4HKXB 4Z9KB 3F65A 4LKCA 4HCRA 1NFDA 5E6IC 1HSBA 1LO0L 4K71C 2AXGA 4PY8J 4XNZC 4WO4D 5MENE 2CK0L 2E7MA 2J88H 4P2YA 3LEVH 3DSFH 2ZKHH 4HKXA 4PJDF 1OSZB 1R3LB 5IB2B 3PWNB 4OD2B 2KH2B 3WNPA 1AKJD 3PF2A 1WAAE 3GJFH 4J3WA 3T3PF 3DARA 1GC1H 4HX1A 3L3OA 5I2IA 5C2BH 4PRDA 4BFBD 4UV7L 3U7AA 4RFOL 3VA2C 3WIFA 2IANA 3PDOB 3L5XL 2NZ9D 1XF3B 1RJLB 3L5IA 2NXZD 4NC1E 2QADC 2H2SD 4OJFH 1FPTH 4P46D 4LSSH 4KJYA 3QIUB 2ZOLA 3GSNL 3MNWA 2NQCA 4YQXH 2DLFH 4LVHB 1Y6KR 3ECBB 3KPPB 4AL8H 5JORA 3LKPB 4GW1B 3GIZH 1QLFA 3O9WD 2YPKB 3WFCH 2F58L 3RWEA 4DTGL 4XVUD 3MBEB 2XNAA 4LCCA 1XIWB 2QQQA 5D2LE 2R69H 4NIKB 5BOPA 1P1ZB 2VDML 5JW4R 5GRYA 3OKKA 2YK1H 1CXKA 5GZND 4OQTH 5EN2B 1MCEA 4P4KD 2EXYC 4EDWL 5F7NC 4R3SA 3MJ8B 1PFCA 2RCSH 1N6UA 1RZ8B 3BPNB 5JXEC 2NXYB 4IRJD 1G7PA 1YEJL 3U0TA 4UTAL 2NCMA 3FQUA 2WWKO 4ZAKA 2UV3A 1DJSA 4K7PX 3PWPE 3VH8A 4Y89A 5TDOA 5FUZL 4BUGA 4ZYKA 3ZKXC 3S3SA 1MFNA 1TPXB 5H37G 4YK4B 1X5IA 5T5NF 5FYKE 4KK5C 4WWKA 1QPPA 4ZODA 1UB6B 3NFSL 1KN2L 1ZHBB 1UEMA 5I1CH 4Z95H 2CJUL 3S96A 1AHWB 3H9HB 4PJ9A 4E5XB 2CIKA 4J23A 4JG0H 5CGMA 4N1HB 2LAGB 2W0FA 1KT2B 4LF3A 4YHKL 4Y8DC 5DYOB 2MCPL 5I1AA 1F90L 3DRQB 4G5ZL 1CQYA 3ES6A 3BEVA 1MRCH 3SKNB 1MI5B 1UKSA 1T03L 1CVSC 1JMZA 4PREB 4BH7B 4CN6A 2VABB 1HH6A 4S1SL 5I9QC 1BLNB 5ALBL 5IW1A 3ZTNL 4DVRL 3RL2B 1GOGA 2X4QB 1ZWIA 3PHOB 4LAQH 5GJSL 2R56H 3Q5TA 1NH6A 5MEOB 1MIMH 1R3HA 1OCWL 2D03L 3MRLA 5CUSH 5EZOL 5JOEA 5F1SA 3TYGL 3BIAX 1KIPA 4FQ2L 3VD5A 3MV8B 3DHJA 2NR6D 1MCDA 3PWPD 4XAWL 3FOMA 4MYWB 5MEOA 2CKBH 4B7LA 3T0VA 4NUGH 4ZXBC 2B1HH 4XC3H 3ROOB 3BRFA 1FL3B 3FQWA 1A7NH 2JB5L 4OSUL 5I1IH 3HNSL 3IETB 5D2NB 5FA4B 2GAZA 1RU9L 2YD3A 3MNZA 5D7JB 5E94B 1N0XH 2KPNA 4U2YA 5JPMA 1MCWW 1T1YA 5B21A 1S7WB 3VXPA 1SJVA 1CFSA 4YHOL 1JHTA 3DGGB 2GSGB 5DI8B 3L3JB 5BV7B 1MQ8A 3G5XB 4I3SL 5D2LF 1BZ9A 2X4PB 1A3QA 1B4RA 1JZ3A 2ZOKB 4ZOAA 2NY1B 3CGTA 1WICA 5EO9B 1DQJB 1T1WB 4FFZH 4P2RA 3VXNB 1JHKH 4QHMA 4M5YL 3VFUA 2ADIA 2BNQE 2DRUA 4QGTA 4KQ4L 5F96L 1FYTD 4XBGA 2EDQA 3ZKNC 1U92B 1T2JA 5HHOB 3BFOA 3WKMH 1XGPB 1FG2B 5H35B 3HG1E 3D0LA 2YD2A 3ARPA 4PJFF 1CDYA 3F58H 3BQUA 5BS0D 4J4PC 2OTWB 3RDTD 2MTPA 1U58B 2ZSVB 1A6ZA 1TCRA 4UUJB 2YUVA 5F7KC 3WS6A 4IRSD 3QHFL 5J9PA 5KS9A 5T5FH 4JAMB 4LHUG 3SQOL 3L6FA 3DI3B 1BOGA 4LLUB 5K9QG 1Y6MR 3OX8A 4ELMF 4N8VA 1GRWA 4KKLD 1AO7D 3VFMA 1IGFL 1R3KA 3QO0B 2E3VA 3EIFA 1WCQA 4JM4H 3BKCL 4PGDB 3RJDA 15C8H 3IDUA 3VXUA 1N8ZB 4JKWA 2Q1EA 2WW8A 4MSWA 4WY7L 5DRXA 2Y36L 1MJ7H 3REVB 1F00I 3IFLL 3PGDA 3MLTA 2BNQD 3CIQA 2UZIL 3OKNA 3PGCA 2BY0A 1OGAE 3OSKA 3FFCA 4GRWE 1L0YA 2P8LA 1QLEH 3PV6B 2FX9L 3MRQA 2VXQH 4LIQL 3MMEA 3BJLA 3GM8A 2K9UA 1P7QD 1ZA3A 1ND0A 5FYJD 4C83B 4OZFH 5GS3A 4C59B 2IH3A 1OWRM 3M1BA 1RD6A 2QTEA 3OKYA 4UQ2B 2V5MA 4X99B 5EFIA 4GRLB 1P84J 3QNYA 5GRXG 1KJVA 1ZKAA 4OKVB 4QOKB 3MYJA 3HZMA 4U1KB 5GRUH 3HR5A 2HVJB 4ONHA 1U8MA 5DJCA 3WIHH 2RAMA 1J87A 3IVKA 3F7PC 1C08A 1IEBB 3MCLL 3W5MA 4MXQD 1A4KA 3BP4B 3RWDA 1IBGH 4PRNA 3P73B 4ZUVA 4JFOA 2VDQH 5JW4Q 1IM9D 1NDGB 4M3KB 1JGUL 2I24N 3MACH 5FXCH 2Z31A 3MUJA 5I19L 4DEPB 4NT6B 4GW5B 5DMKB 1MCBA 1WZ1L 3MRHA 4OQ1A 3STZB 1U8PB 4OLXL 2ED7A 4L4TA 1KPVA 3W82A 3OHXA 1TITA 4TYUA 3TZVB 2ITDB 4UDTB 3ULVE 2E27L 1YJDC 2OTUB 2C4XA 3CDGA 2W91A 4D8PA 4TVPE 4LQFH 3SO5A 5CEXB 3QZWA 1JGLH 3MJ9A 3GO1L 5HDQH 5I8KH 4KVNH 1RZJC 4RGMB 4X6EA 1ZLSL 2KZWA 2ZUQC 2P8MB 3BPCB 1EHNA 2FX8H 3QHZL 5AZEL 4TRPH 3C6LC 3KJ6L 4KK6D 1MHCB 1UXWA 5CEXA 2XQYG 4JB9H 5IJVB 4X5WA 3FTGA 4HQQL 2X7LA 1TZHB 3BRDA 1UJTA 3KPRB 3HMWH 3IU4H 1TIUA 2E6PA 1U9KA 3MCKA 1SJHB 1LEGA 5TDNB 3KPTA 1HHJB 3H6JA 3T4YA 3X12B 4I18A 1H3GA 4GSDH 2R23B 4U1HB 4P2CG 3LQAH 4TQEL 3GGWA 5LG1A 3U4EB 1CWVA 5B39A 1K4DB 4RWYL 2IAND 2BFVH 5J1SC 3KLDA 1P84K 4PP2B 2APVA 4HH9A 4DZ8A 1M71A 1RVFL 1MF2H 5IMKA 4F7EB 3J8F7 3QG7H 1QEWA 4J3OC 1R0AL 2DQDH 2AJZA 3NH7H 3KXFB 3KYKL 4GRWF 4OF5A 2EEDA 4Y16C 1RK1B 1R5VA 4P5KB 5F88A 4HG4K 3QIBC 3ROLB 2DWEB 3HE7B 4QRQA 5JQ6H 4FQQB 4HKZA 2DQEL 4H1LB 1JPTH 3TBTA 4YZFF 2C3VB 1F4HA 4YEFA 1ADQH 1FFNB 3BVNA 4QTIH 2CIIA 3JUZA 3GI8L 1X5ZA 4P48A 3TPUB 3W39B 5GGQL 5C0JB 1KBGL 3VA6A 1KJMB 2ICWA 1MI5E 5T1DL 4G7VL 3GSVB 3U36A 3BZ4B 1GPOL 4L29B 3KLAA 3WD5H 4YHYB 4QRSA 2W60A 2ORBL 3QXTA 1BFOA 4WTXA 1UVQB 4JCLA 4JFEB 5IB1B 1U8KA 5EB9A 2GK0A 5LJYH 4DFHA 2PW1B 5LGHL 4WWKD 1KC5L 1OAQL 5DD6B 3MV8E 4EUPA 5I8OL 2JF1A 4QO1A 1HN1A 2XTJB 1W0VA 3BE1L 1NCCL 4LVNC 3CK0L 4PJ9D 4WV1C 3OL2A 3VXOA 2AEPL 4JHAH 4PBXA 2GEEA 3QULB 4POZC 4WVRA 2EDHA 5DRZB 2I9LA 3IKCA 5EORL 1UCBL 5D2NE 3VFRB 4UV4H 4LSUL 1KB9J 3E8UH 3C60C 4JN1H 4LBEB 4XPAH 4RSVA 4E42A 1YC7A 2ICWI 5J57B 1I9JL 1R3JB 5DXWA 4HHAB 3GB7A 3TWCL 5T1MB 2FSEA 2B1AL 4XCYB 1PZUB 5GGRY 2BX5A 5D5MB 4FABL 3BP7B 5EWIH 1NCBL 3HA0A 4UB0H 1HCVA 5TGBB 2E5EA 4WJ5B 4EDXA 1A6PA 2DD8L 2OX5A 2XG5A 4JQIL 5IMOA 5J06A 1CK0L 3MV8D 3GHEH 2AJUL 3WDJA 5IIEB 5HHOE 2OS7A 3QEUA 4ODUB 2APBA 1IC1A 1RZ7H 2Y06L 3RU8L 3JWNC 3FAWA 5ICXA 1S7QA 2P24B 1EEYB 1ACYL 1T83A 3BGAA 2J4WL 1L0XA 4HUVA 1INDH 3HE6A 1QO3A 3MJGX 3F12A 3MV11 5D7JD 4IS6A 1C5CH 1MFEL 2IADA 4G6AC 3FOLA 3O4LB 3Q6FA 1CGSL 5F89B 4OFKA 5SWQB 4U6XA 4MQXD 2CUIA 1G7MB 1OTUC 3LQZA 2EE3A 2AK4B 2P7TA 4Z7WA 2RJMA 4MVBD 3FO1A 4UMGA 1JGVH 3FRPA 4RGNB 2NY1D 4Z7VF 1B0GB 2Q20A 3WFBL 5KG9B 4QT5A 3WO4C 2ED9A 3U0WH 3BQUD 3OG4B 2PYFB 2IALA 2A6DB 1H3PL 1DVFC 1KIUA 1KTLB 1WJ3A 1AGBA 3M07A 4QHUA 3MPCA 5JR1L 1RIHH 3WBDA 3V4UL 3GKWH 3L1OL 4N90E 5E6YA 1P4BH 3FQXA 4HUXA 5A16A 2ZPKL 2R2EB 3GSWA 2A6DA 4HKJA 1LQSR 5ITBH 1J0YA 4GBXC 2HLAA 3BZEB 2BCKA 2BOCA 4MA3B 3C5ZA 3QJHB 1U95A 1QD0A 4JFZL 4TN9A 3SKUD 4YX2H 1LE9A 1A14H 3T77A 4QOKE 4R7DB 4Y4HB 1LO2H 2B0SH 3ILQD 2DL2A 5B3NA 5IB3A 4LMQE 5JO5A 5DURB 2OK0L 1FZMB 4D0CA 3TVMB 2VWEE 3RZCC 1D6VL 3FRUA 2NY4D 3FFCD 4RIRB 1MCPL 5DEGA 3HCVA 3X11B 3UTZA 3O11B 5E4IA 3QQNA 3CPLB 2WBWB 4DN3H 1FNGA 1P9MC 3C08L 3SDAC 1J0HA 4K94L 2P8PB 5HXMA 1G9EA 2VQ1A 1X5JA 4JFXB 4TULL 1WT5A 1Z0MA 3Q48A 1OY3B 4R8WH 5C0FA 3JTTB 5ERWB 1KTDA 4JCMA 4DN4H 4BYHA 4LKXA 4TUOB 1L9MA 1NDMB 3TJHD 3VGGA 4YXLL 4XP5L 3BKJH 4OD1L 4MCZA 5IUSA 3KYMB 3WN5C 3ZE0F 5DUPH 4QHLA 4APQA 1S9VA 2G60L 4H5SA 2FO4A 5LKNA 2JIXA 3ZDYE 4YWGL 5AZ2L 3DV4B 4HC1H 4XCNA 3KR3H 3AFLA 2EDLA 4P5TB 3KPRE 3U48A 4HS3B 2Z31D 4ZDHA 4PJDA 3DMMB 5EUOF 4Y5XA 3HNVH 3VWJA 4CJ0A 5J89A 4L4TD 3UX9B 2AABL 1BAFL 1I1FB 5FCUH 1M7DB 1WCBA 3O6FC 1IGTA 1F6AB 3CC5B 4S2SB 5I1GL 1KJ2L 3GMQB 5DJ2A 4LOUC 5KSBF 4FFVC 3QDMB 1IFHH 3FJTA 4KROC 2EYTA 2YA2A 4GKZB 1K4CA 3VJ6B 4OM1H 3KXFE 1MPAH 3O81A 1OGTB 2R0ZH 1MWAH 2A6JA 3WIIL 2Q3AA 4F57L 1AXIB 5C0DB 1YQVL 4ZSOB 1D9KA 1E27B 2QL1A 3ZTJG 1F6FB 4OUUA 2KZ1B 1NEZG 3BSZH 5T33L 3PL6B 4F58L 3LB6D 2X4OB 2CKNA 3O2VL 4QWWD 3KJ4B 1HE7A 2VITA 1J1PH 4WU5A 4CADA 4XCEB 1PQZB 3QCUL 5IW6B 2YHGA 3VFSA 4LU5H 4KVCL 3ARSA 3C09C 3U2SA 1SY6L 3LHPL 1HWHB 4PJEF 1T7YA 3MLRL 3WNOA 2FECL 1V05A 2N4IA 4P49A 4XHJD 4PGEA 1I9EA 4JZJC 5JW3L 3G5YA 1KCVL 2XZZA 4KU1A 4Y5VA 1UZ6E 4I0PA 5D7KE 5F97E 3KYOB 1CD0A 3SDDA 1GHFL 4MD0A 1RURL 2HFFB 4OBSA 4X7TA 1CXEA 5TE6L 1RZJH 4XPBL 4DKEL 3PDGA 5DGRA 3EYFB 5E08H 1VKXA 2E7CA 3TBVB 4JFEE 1LO3H 2BHYA 4PV8A 4K3DH 3FL7A 2CXKA 3EBAA 3DUUA 5IVZB 1MIEL 4KK9C 1RPQA 4ZPVA 2NTFB 3NCEB 3MLWL 2XTJE 2C3GA 4H20H 5J6GA 3U4AA 4N0YL 1T04A 2XRAH 3SGKA 4Z7NF 4KWUA 5D1QA 3QXVA 5GGTH 1X44A 5F7MC 2VUOA 4OZGA 4UQ3B 5F7EH 3RPIA 4CMHB 1I8LC 5C2BL 4PRIB 2VXSH 4MDJB 3IDNB 1BX2B 2XZAL 1CL7I 1RHHA 1M6OA 2FD6L 4QXTB 1RFDL 1SY6A 4QY8A 4NN7C 5BZWA 3DURB 3GMNB 4M5ZH 3GSUA 2BVPA 2H1PH 5ESVA 4UBDD 4QHKJ 1MNUH 3QCVH 3KG5A 5D5ME 3WFCL 1U8JB 1HHHA 2IH1A 1UJ3C 4NO2B 5ETUB 3AUVA 2Y07L 2OMBA 3QO1B 1C7TA 4JFYA 3FFDB 4QTHB 5J4MA 5E2UL 3SBWA 4C4KT 5TE7H 5ESAB 3DBXB 1PD6A 5EU6B 4Y19B 5FYKL 3UYRL 1RV6X 1S7XA 2C5DC 4JRYB 5JIIA 3GSOA 1MCHA 4PJHB 3TO4B 1NANI 3GJFA 3N0PB 5FGBA 3AAZB 2Z92A 3L7EA 2HT2D 4FP8L 4BQ8A 2XPGA 3TPKA 3CAFA 5H37H 3MNVA 4O2EB 2FECI 3ET9F 4MMXC 4M7ZC 4PG9A 5BMFL 3MGOB 1AGCA 3O4LE 5IBUG 4H0GA 1MFAH 1BQLL 4P3DB 5I30H 4HJ0D 1MY7A 5HJ3A 2NY5L 3WS3A 3D3VA 2EIZA 3LZFH 4HIIA 3QPQC 3OZ9L 2AK4E 1I4FA 3VCLB 1A5FL 4JG0L 2EDWA 4OT1H 4R96B 1BJ1J 4RGNE 1CTNA 5CHNB 4GUPA 5GGSY 2BVYA 3OJDB 3B3IA 3FB8A 4YFEA 5KSUA 1ZVSB 3K4AA 3BZFA 2AV7A 1IGJA 4PJFA 3EHBD 1F13A 4OQTA 2Q86A 4Y5YB 3UAJC 3M17B 1J8HA 1OD9A 1ZS8B 3HE6D 2BSSB 3VXSA 4LAQL 2W9LA 4OI9A 1F58L 5IFJB 4GKOA 2R56L 3AREA 4U6HA 1QSZA 3E6HA 1V7ML 4NQEA 2LU4A 4ODBD 4P2OB 4N0FA 3OAYK 1ZLWK 4IEFB 3BXNB 4ELMA 5IKCB 3MO1B 5I8CB 4FQIL 3LN5A 1CLOH 1CD9B 2GHWB 3IFOA 4P4RB 2XZCL 1FH5H 1TQBB 1VFBA 4I2XA 1RUKL 3QP3A 1ZXQA 3VDBA 4KDWA 4XC3L 1LEIB 3O4LD 4NUJB 4X8JB 5FGCB 3RGVB 3CZFA 4Q9BA 3P2TA 2NW3A 1L6ZA 1CFNA 1IGYA 3MOBH 5D1XA 1HXYB 1X3DA 4YDLC 3WUWB 3D85B 1FGVL 4M61B 1S7TA 4MGXA 1XAUA 3BYYA 3M45A 4JREB 1T1XB 4QF1A 5J12C 2BNUA 4EI6B 2G9HA 4WI3A 4M1CD 4BM7A 3C8KB 4LLYA 3EGSA 2NZIA 5EIIB 3AMKA 1ZLUK 3MRBA 4NN6C 4IRZL 3QJFB 3CVHB 2XZQH 3UPAA 1BIIA 1SYSB 4G8EB 1D6EA 2CO7B 1AGDA 4RRPG 4RFEA 3LCYA 3N1QC 2PTTB 5DJDA 5DJ8A 4WGWB 3PWVA 5BVPH 3HUJB 2X05A 2NTSP 4BQ9A 4Y2DC 1FFRA 3V5HA 2VXUL 1KXVC 3G6AA 4OCSH 5DEFA 4G80A 2CKBA 3F58L 4YDVA 3GMMB 1IC7L 4HGWB 5JPNA 2XY2A 4EN3C 1DQML 3MJ7B 1YUHA 5DURD 3UO1H 2QR0A 4WFED 4IMKA 1QFWH 4PTUB 5T5FL 4ODVL 4OGYL 1JGEB 4JJ5B 5ID1B 1DSFL 1CGYA 5IT2H 3LRSB 3QFJA 4GMSL 1JZ4A 4LASL 3ARFB 1QBML 1IQWL 3QDME 3SE9H 4APQD 4X7EC 15C8L 3MLXH 1ZHNB 5CEZE 1P7KA 2JIXD 3DX9B 5GS0C 5F1KC 2FHBA 4RMSA 2DLEA 4D3CH 3VXTA 4I77L 1KPRB 3IDGB 4ZSOE 1OSPH 3CUPB 3WNMA 4KPHL 1A4JA 2VC2H 4QYOA 4W6WB 4HXAL 1DBML 4JM2B 4HIJB 2E7BA 4HFUL 3FHQA 3CFJA 4MD4A 5E9DB 1W72H 3VWJD 3GRWH 2VDRH 5CIPH 3QDJA 2DWDA 4WTZG 5BO1H 5BJTA 3BT2H 2BHUA 2D4DA 3FO0L 4EIGB 4XXDA 5HGAB 3RY4A 4PY7A 1FZJB 3L3DB 1RSFA 2YPVL 3DMMD 3KPQA 3MRMA 5MHSE 1SQ2N 4KZEH 5EPMB 4JY6B 3DYOA 1Y0LB 1L7IL 4R7NB 4XMLH 4JN2B 4Q58C 3S3JA 1YA5A 1C16A 4H8WC 4U2ZA 3ZKQD 2OL3B 1I8MA 4HWEH 1D9KD 2Q76A 3HC3H 4NKQB 5E8OB 1U3HA 3E3QE 3ULVL 4KI5F 1GAFL 4Q9RH 4TVPL 3EDDA 1TZGL 2EXWC 4FQJL 5DJZB 2EC9T 5HI4C 5CEZD 5T3XH 4DZBB 2HMIC 3OAZH 3QUYC 3VFNA 1CXLA 1IEAA 1TVHB 5IBLC 3MRRB 1A1OA 5GSRB 5IHUH 3MOAH 4HKBB 3CFDA 4PRIE 2HJFB 4I0PD 3ABZA 3SDDD 5IFHL 3OV6A 2D31B 1R5WB 2BJMH 5JUEL 4JHWH 1JGLL 1BZQK 4Z0XA 3K8LA 5HDQL 5I8KL 1D5XA 3P9MB 3NTCL 3TNNA 4JY5H 3N85L 2FX8L 4OZFA 2QHRH 1NKRA 4Y1AB 3A6BH 4MQTB 4JB9L 2FJHA 3BX7C 4NRYA 5C0BA 2BC4A 1CFQB 1KELH 3NCBB 2F8OA 1DQLL 1AQKH 3KHQA 4D9QE 4LGPB 43CAB 2MOVA 4NNPH 3AY4C 3QXAB 4TUKH 1FGNL 3WIHA 1EHXA 1D3CA 5E8PB 3GHBH 3V6OC 3TA3C 5D1QD 2XTLA 4DKAA 5E8DH 5GZOD 1XH3A 4L9DA 3LKSB 3UPRA 3V52L 3ZSSA 5EU6E 4Y19E 5C0EB 5KZCB 2IPTH 5GHWH 4LARL 4M93B 2CQVA 2YS4A 4MHHG 5HHQA 3JWDC 1XT5A 4JRYE 4G42A 4PJHE 1MF2L 1A9EB 4LNRB 2R1YA 4PRID 4YC2C 5ADOH 4LLQB 2X4NB 5HHXL 4MJ5B 1UEYA 3RWCA 1N3NA 5T1LB 1PAMA 3WSQL 3HI6L 3EOBB 5HI5C 3BW9B 4H25B 5FHAH 5D8JL 1VFUA 4ZUWA 1VCAA 3EO9H 2F5AH 2W07A 4WNQB 1KLUB 4G6JL 1S8DA 4NKIL 5FAAA 3TN0A 5D7SL 1GZQA 2Y1VA 4F8TA 3TYFB 3SDCA 1NGZB 1C1EL 5IVXB 2HA1A 2BVQA 4P23A 1WTLA 3BDYL 4HJGA 4AT6B 3UC0L 4DOHB 3L3KA 1IRAY 1NCUA 3QQ4B 2FIRT 2A9NH 3U1SH 5DJXA 1NEZB 2IEPA 2QQKL 5TH2B 1UQSA 4HJJL 3NACL 2VAAB 1E4WH 2DMCA 3KNBA 5IR1A 4BJLA 3VG0L 3O3BA 3GZKA 1WIPA 1QFOA 3ARQA 3V7AG 4LSVL 4MXWH 5D96C 5DRWA 4U1SB 1KIRB 3UTSA 1G7JA 5E6IB 3TO4D 4YDKL 4KFZC 3JXAA 2ATKB 1ZTXH 3LEXA 4Q9QH 3V6BR 5CD3B 2FNBA 3BH8B 2JB6B 4FFYL 2D7PA 3D3VD 3PABA 5IHZB 4HT1H 3FQTA 2MJWA 1HEZA 2P5WB 3BO8A 4KI1A 2H2SC 3S5LG 5BV7L 4YO0A 4ODTH 5L2KA 4X6BB 1RZKL 3CFIC 4PP1C 5FGCE 4Z7VA 4P46C 1A6UL 2P45B 4QXGL 5I6XC 5HHNB 5AEAA 2YD9A 4Y7MA 5LWYL 4UV4L 1OT2A 3O9WC 3E8UL 5BVJB 2JELH 4JN1L 1XGRA 5C09A 3OAYH 1ADQA 1ZLWH 4PJBF 4X5XB 5JA9A 3VXSD 5E5MB 1JYVA 2G2RA 3L5JA 1VACB 3ARED 1FIGL 5GZNC 1OW0C 1YZZA 4OZHB 4R0LC 4P4KC 1S9XA 1V8HA 4M02A 5EWIL 2E9IA 3MUHL 4RZCA 4ZUTB 3CLFH 3N1FC 2E8ZA 4JPWH 5GGVY 4KK8D 1EO7A 5HDOA 2WMPA 3RA7H 1MH5A 2HWZH 4P2OD 5E8NA 2NY0C 4X80H 4GG8A 1YMHB 3G04A 3QUMH 4XPGL 3GHEL 4U1LA 3HUJE 3BUYA 1RZ7L 2VDPL 1HNFA 5D1XD 2HKFL 5DUBB 5JOFB 2VL4A 3QUZA 5HPMA 4EI5A 2GT9A 4JPIB 1JVKA 1GOHA 1QQDA 1AD0B 4X4XA 1ZGLM 3D18B 1SJEB 4M7KH 1NJ9B 3ZKXB 2HH0L 4BFGA 1BJ1H 5GSVA 3T0EB 3MLSH 4LP4A 3WYRA 2LFGA 1YY8B 1FSKB 3V2AR 4Q6IC 3RY6A 4MA8L 1I3VA 4PY8I 5D9SA 4GRMB 4CU8A 1ZANH 1FN4A 5KSAC 1JGVL 5I73C 1Z0NA 1JF5A 3R0MA 1V3LA 2P4AB 1FC1A 4F9PA 2BVOA 4UNTA 4ONOA 5ID0B 3U0WL 4QRRA 4PR5A 1NGWA 3T1FA 3QNXA 1WLHA 3BEWA 5I9QB 5IFAH 3G08B 5IWLC 4PJGF 5EUOA 5FO9A 3VGBA 5SWSA 1CZ8L 4UILH 3RL1A 4KQ3L 5E9DE 5F3HB 4Y4FB 3B5HA 3W9EA 1FFQA 4KRMB 3ZKMC 1MJ8L 1FL5A 3W2DH 4NFCA 4BSVA 4OD3L 3WLWD 4JRXA 5JZ7D 3QFJD 4OLWL 4RQQA 1BZ7B 5DQJA 4MNHB 3WLBA 1FAIH 5KSBA 3MUZ1 2I27N 2W65B 1NBYB 1XR8B 2GI7A 2PR4H 3AS0A 4GLRH 3LKQA 4ZXBB 4F7PB 3VI3E 3I85A 3Q6GH 4E41A 1F11A 4HUUA 2B0SL 4MX7B 3CMGA 4RNRA 3ULUC 2A9MH 4KDVA 3DROB 3ARFD 5DJYB 3IFNH 1IMHC 1T0NA 3AGVA 5I71C 4JQXC 2QEJA 3B5GA 3GSRB 1IL1B 1K85A 2G5BB 3K80A 4J8RA 4JE4B 2IGFL 1EAJA 3QPXL 1E6JL 3QDJD 5TE4H 4NZRH 3BWAA 4PJEA 4JM2D 4FQLL 3RY5A 1TCMA 2WINA 1U42A 2E9BA 5C07A 3MRPB 4HS6B 5E9DD 4BK5A 4DN4L 5IOPA 1KUMA 4NC2B 4K8RC 2H26A 3O2WH 5K9OA 2JJTC 3SY0A 1JPGA 3ARDC 5DUPL 5HPOA 3GMOA 5LQBH 3QIWA 4Y1AE 3Q5YA 2WANA 3KPNA 3K8MA 1U3HD 4E9LA 5D1ZA 2PO6B 3SKMB 4RAUB 1KFAH 3KR3L 2D7OA 4DW2H 4KGJA 3AU1B 4C4KO 3EDKA 3HS0A 4L1DA 5GGVH 4LGSB 4DKFL 4HUWB 3P40A 1KJ3L 1ULVA 1E4XL 3B9AA 3S7GA 1DE4B 2R15A 5F9WC 1FLTX 1V3MA 3RAJH 1JGDB 2OLDA 1BVKA 2XXMB 3VFWA 4U1NB 1CIUA 4QXUH 5EBLB 4XP1L 3FAXA 5DHYA 1DBJL 5D6CB 1IFHL 3VXMB 2LABA 4MA1C 1ES0A 2AEQH 4H8WH 1EXUA 2R0ZL 3MV01 4XI5D 2R4RL 3IB4A 3CLEH 1DN0B 1OAYH 1FZOB 4ISVA 2KKQA 4XMPH 5C0BD 1OARH 4KKBD 3HZVA 1ODAA 1GVIA 1F3JA 2WBJC 5D7LB 1NAMB 1Q72L 1X9QA 2DI9A 3X13B 5A2LH 2Y5TA 4JQVC 3ARRA 3NCYS 1M05A 2C1PA 4J6RL 4UOW0 4LLMA 5EO1A 4OGAD 5C8JB 1A0QH 2OJEB 1IAKA 3DECA 1SBBA 2W9DH 1EFXB 3HI1B 4HC1A 5GGRA 5HHMB 4DOHE 1JNHB 1P5UA 3ZE1F 3HPLB 2FWOA 1RUPL 4N0CD 1EEZB 1PYWB 3H42L 5CJQH 3TCXA 5IVOA 3IJHB 4OV5B 3QNZA 4XCCH 4DGIH 5DRNB 5KZCD 4OCYH 1I3GL 4GKSB 1F4XL 2EEBA 1MEXH 4Q0XH 1BWMA 1P2CA 3EOYG 2DQUL 4FQHB 4JFHE 4G9FA 2B5IB 3TN0D 3VD7A 3SDCD 2LTQC 4L9LB 1MWAA 1FG9C 4TVSa 2P5WE 1IE5A 4NQCA 4QHNA 3UJTH 1D5MB 3SGEH 5F7EL 3S88L 1CICA 4LRNH 2X42A 2R0KL 1PZ5B 2P5EA 3D2UB 4FQCH 4YPGB 1UADC 2GSIA 2VLME 3QEHB 5IK3B 2HTLD 5CKGA 4Z7UF 3LPFA 3IAPA 4LSPH 1YEGL 2BY3A 4YBHA 3BGFC 2CDGA 1MCCA 4XNXL 4Z7QE 4NQSA 4XGZB 1OM3L 2ZUQB 3QXDB 3C6LB 3SQBA 3TBWB 2A6KB 4IIQB 1DEDA 5HGBA 3T8XA 5GJTH 3QEHA 4OZHE 4K07A 3UTSD 1A6WL 2PXYA 2O5XH 5AAMA 5L9DH 4DKDC 4YLQT 2JCCF 1ITBB 1LO4H 3GK8H 1DUZA 1IARB 4JO3L 2DQJH 5FUOH 1NBZB 2R2CA 2AAVA 3PP4L 4XNYL 2OI9C 1MLCA 3EOTH 3LN4A 2D9QB 4OIBA 4YXKH 3OAUL 3CFCL 5DVOA 3NIFE 5IMLA 5L2KD 5MI0C 4I3GA 5BRZA 2BMKB 1JPFB 4R2GD 5HVHC 3LY6A 4A6YB 4NYLB 5KANG 1RIVH 4OB5L 1G7IB 4FNLL 1YEHL 3GUTA 4LCCC 3RWHB 1IC4L 2MHAA 2VZTA 5GGTA 2R1WB 3OGCA 5J56B 3S4SB 1XR9A 2VLMD 3UTTB 3B83A 4Y16B 5JXAL 2V2XB 1O7SA 1VGEH 3MZGB 1U8NA 1N26A 3T0EE 2QADD 4N8CL 3B6SB 4YAQA 1A7OL 4Z5RB 1MFAL 3ZMRA 4XVSL 5IVXF 1QYGH 3OKDA 5B38B 4Y88A 5BXFA 4LCUA 4ZFOB 4DK6A 1OP5K 2AS5M 1KPUA 5EOQL 4OT1L 1GIGH 3QIBA 2IF7A 4ZAKC 3S37H 5BZDA 2OM5A 3JUYA 1U93A 1Y6NR 2CRZA 5F1NA 5I16B 1WGOA 4QRUB 4LFHG 2I07A 3RFZC 4CKVX 4EI5D 3EO1B 5KSVA 4WWKC 1KENL 2EXYD 1F4WL 5DQDH 4M7LL 5JNYA 2O61B 2CH8A 1CR9H 2J8OA 4KAQH 4PJ9C 3QG6B 4HBCH 5CINL 2V7NA 5JXED 2A1WL 5A2KH 4M7JL 1JUFB 3RNKA 3LEYH 1HHKA 4NNXA 1TJHH 2AK1H 3PJSB 4J2XA 1WBZB 4WV1B 1FH5L 4PGCA 3TT1H 4LNVA 1TZIB 3JVGA 2DAVA 4KK5D 3EYOB 1V3KA 2C3XA 1J1XL 3P9LA 4KHTL 4YDIH 5F1IA 3LKNB 3DIFA 2AJ3B 4EKXA 3PHQA 3BIKA 2Q8BH 4QRRD 2PYEB 3C60B 5I17A 1DBBL 4OM0H 4OZHF 4UI2A 4HS8L 3REWB 2R8SH 4JDVA 3U83A 3PGFH 1AFVH 3QHTC 1OTTC 1IKFH 1JNNH 1NC2A 4OFYD 3T08A 1FLRH 5KVGH 5JLZB 4Z78B 3Q1SL 2CLVB 2YWYA 2VZSA 4JRXD 1U2HA 3QEGH 3QWOA 2ADFH 2FCBA 1QFUL 3FKUS 4ZO8A 2A0LC 5LBSH 3FB5A 1QR1B 4OLUL 1S78D 3IDYC 1S7UB 2HJKA 3WFDH 1K8DB 4AQ1B 3V5DA 4E41D 2MFNA 1T3FA 4WFGE 32C2A 3V6FA 4M4RA 4OLEA 3V6ZA 3DX7A 1LEKB 4D0DB 4ZXBD 5E6ZA 3L9RA 4WW2F 5D71L 1LNUA 5TF1L 3VFGH 1L0QA 1H5BC 2V2TB 3P0VL 3WE6A 1TLKA 1E4JA 1ETZB 1YYLH 4MQXC 2EDKA 4G3YH 5L7XH 4JO2H 4ZQKB 3C2SA 3FT2B 4MVBC 4V1DA 2XKNA 4NQDB 1FVCB 1YN7A 4PJ8C 4NQXB 1K3ZA 3BH9B 4AENA 5C07D 3QRGH 4NP4H 4M48H 5JOPD 5CCKH 1WBYA 1DQDH 1MFDL 4TSCH 4YHZH 4HH8A 4IJ3C 3MLZL 2D4FA 2F19H 5EU4A 3VXME 3STLB 2QJDA 1Q9OB 3WS6C 2F54A 1HK6A 1LE5B 5DJAA 4R4NC 3I3BA 3RWFA 5I1DB 3O41A 2OP4H 5D1ZD 5IESH 1JIBA 2O26U 4O51B 2BNRB 4JZNB 5D7LE 5KTEH 4S11A 1VHPA 3PNWA 4G6MH 3V7MA 1IGCL 2C7UA 1KCRH 3BDXA 5J1AA 5BO1L 2DI8A 3BT2L 4J4PD 1JRHH 2XWTA 4MWFB 2FZ3A 5HHME 3ILQC 4OLZL 3MFFA 1KV3A 4GBXB 1DVFA 3DYMA 1DUYA 4K8RH 1N4XH 1JF6A 2NY4C 3JZ7A 4YFDB 4LHUA 4UT9H 3K7UA 2APXA 4HEPG 4XMLL 3F5WA 1Q1JH 3VE0B 1YMMA 2HJLA 3QEQA 3DRTB 2EZ0D 3HC3L 4PRHA 3RZCB 5C9JB 2VL5B 2FLRT 3KPSA 1YEEL 4HGMA 4L8DA 4OTXH 5C08B 1HILB 1XMWA 3CVIH 3FZUC 2EH8L 2NY3B 3FQNB 1H8NA 3RBSA 1Y18A 2X10A 4XTRD 1WWWX 5E56A 4D9LH 1Q9KA 4WCYL 2KL6A 5H2BA 5ICZA 2JJSA 4X4ZA 4OIIL 1P9MA 3SDAA 2ZCLL 5EBMB 5CKAA 3HMXH 2BJML 1W72A 4O58L 4NO5A 3GRWA 1NBVL 5CIPA 3DO7A 3S8WA 1CDJA 3WN5B 3F7VB 5C0IB 3ZE2E 2Z31C 5ENWA 3U0PA 5GGSA 1QFWI 5KN5A 3BWUC 25C8H 4MAUH 5C71A 4LHQB 3H0TA 3C87A 2EDNA 4I8DA 4PJIB 3THMH 3QFDB 5K9QI 2DICA 5C0IA 4G9FD 3IU3A 3OKEA 4M6ML 1AGEB 2IQAB 1OAXL 3VFOB 4NNPL 1YNTB 3QAZC 5AD0B 4NQCD 1CS6A 3D25B 5CBEA 1QP1A 4C56B 2NX5A 2YBRA 4JFDA 3O6FB 4FZEH 4WFHE 3LIZL 5LXGL 3TIEB 1INEL 1NFIB 5GXBB 5LCVH 1KGCE 3NCJL 2I5YH 5DT1H 4PJBA 4KROB 4S1QL 1C5DB 3D2UD 1EGJL 4MJ6B 3UTTE 3IDIA 4ZTPH 2PXYD 4LLDA 2FIKB 2R0LL 4MNQA 1U8IB 5FK9B 5DWUL 3EO9L 4FZ8H 4CRPA 4ESKA 3C6LD 4FQXC 4PB9H 3CXDH 1CGTA 1BD2B 3C09B 3V79C 2X1PA 5HI3C 3OB8A 4XH2A 5F6HI 5B3JF 2W9EL 2NLJA 5C0GB 2MQ0A 1RZFH 2RQ8A 4JZJB 1UWEH 2Z8RA 3U1SL 3IYLW 4H26A 1MCSA 1FFPB 1H8OA 3X14B 5I1HL 4GS7C 4P3CL 2V5SA 3PWUA 5T3ZH 1DBKH 1E6OL 2OZ4H 5HHPA 1SYVB 5FA3B 3QWQB 1A3RH 1C12A 4YIQA 2P47B 4NZTH 5C0RH 1OP5H 2FEEL 1Q9WB 3E6FB 4HD9A 1G0XA 5ACLA 4AYFA 1LP9F 4Z8FL 2Y23A 3ZL4L 4GG6F 2GTWB 4HT1L 1BBJA 3UP1A 4NPYB 1H0DA 1XFPA 4YHIB 3TO2A 3QIBD 2AXFB 4BKLB 2FX7L 1FL6A 2C1OB 1T2QH 4HPOH 1DBAH 5I15L 5IB5B 1NL0H 5FYJU 5IB4B 1V7NL 3X3GH 4UBDC 4U0RB 2AI0H 2YKLH 3CVHL 1LHZA 4TTGA 3IF1B 5A1AA 1A1MA 3G5VA 4LPXA 2PYEE 3RVXD 4XPHH 2APWA 4XC1H 2E8YA 1FFOA 2LVCA 4PJGA 1PLGL 3MREA 5E2TH 4ZUUA 4LCWA 3DXAA 4KRLB 3RX8A 1UZ8A 2QSCL 5HYJA 2YMXL 4X6CB 2BSRA 1LO0H 3JV5A 3RZWA 2RB8A 4IOFD 1UJ3B 3EJYD 3B43A 1NLDL 1ZE3C 4JPWL 1KXQE 5CJOL 2HWZL 4UAOC 5K59F 3HZKA 3QUML 3DYPA 3HTLX 2CDFA 5DEZA 1JZ5A 3FT3B 4U1MB 3SJVB 2EDTA 4RFOH 2HT2C 4DCQA 1LD9A 3L5XH 5FKPA 4HV8B 3FCTB 1KEGL 4POZD 2ARJB 4PRBB 1GXEA 3GSNH 5GS2H 2P49B 4O2FB 1MQKL 1NUDA 3IJYB 1NC2D 5I0DA 2WBKA 1RJZA 4NQDE 1BQUA 4PJXB 2BSTA 2F58H 3PXHA 1T5WB 4DTGH 4Z7OF 1U6AH 4JZOA 2GJ6B 5FUCC 3MRFB 3CFEB 3NZHL 3EHBC 4KJWC 4XXCA 1VGKA 3WJJA 4YR6B 4EDWH 3LKOB 5EO0B 3Q3GA 3T1WA 3HE6C 5F7WC 2FATL 4NNYA 4N0RA 1BQHB 4NRZB 1AXSA 4KI5D 2H8PB 1YEJH 3L3GB 2BNRE 2PUQT 1E4KA 2DQIH 3QUMA 3ARGA 4UILL 1U8OB 5FUZH 5E00A 1NCAL 5ICYA 3DWTA 1QSFB 1HHIA 2WSKA 2OL3L 4P9HL 4V1DD 1CT8A 4L4VA 4JANA 3MV9B 1XCTA 5EBGA 5CSZA 1N2RA 5IHLB 3NFSH 1KN2H 2I9TB 2CJUH 2X89A 2FDBP 1XGUB 4YHKH 5F9OL 5L6YL 3GMLA 2F54D 2MCPH 1F90H 3FT4B 2LU3A 3VXRB 2A9ML 4PS4L 1GZPB 3IDMB 1T03H 1I7RA 1OTUD 2YC1B 4M1CC 3M8OL 4KUCD 5I8EB 1FCGA 4S1SH 5ALBH 4M1DL 5C08E 3RI5K 3CSPA 3ZTNH 4DVRH 3AXLA 2L0DA 2KQNA 1S9WB 1UENA 3C5ZC 5GJSH 5FDWA 1T4KB 1OCWH 2D03H 4G9DA 5EZOH 2VZUA 3TYGH 3VU2A 2BNRD 1FV1B 2ZSWA 3O3EA 2K3TA 2EH7L 4FQ2H 3T65A 5HDBE 1KG0A 3QRFM 1DVFD 3H7BB 5DQ9B 1BVLA 4XAWH 1KCSH 3SDXA 3NPSB 4NN6B 1KTRL 4M8VA 3KYAA 2YN3A 1GYAA 2CR6A 3N1PC 4LHUD 4W4OC 3C9NB 1R3IL 1I8IA 1S7SA 5GRVK 5LQBL 4OSUH 1YMMD 4BFIB 2MKWA 4KMQA 3FB7A 3QEQD 2AV1A 5DR5L 5FYLE 1RUAL 3ARXA 4PRHD 4Y2DB 1MHEA 2DLHA 1X5KA 4PJIE 4D9RD 3KPSD 1CFVL 1XGQA 1I1AC 2BOBB 1BF8A 4AMKL 2OMNA 3QI9A 3V0VA 4YHOH 1MRDH 2VLKA 4EN3B 5I66B 3MRJB 2XQBL 2COQA 1A6VL 4U33A 3RZCD 3EO0A 4APQC 4I3SH 4XBPB 1WWAX 3UDWA 4C56E 2XA8L 3HAEG 2ICCA 2UVEA 1CE6A 3SDAD 3QCTL 4X7DC 3E0GA 4XNQB 5JIPA 1FNAA 4Z7UA 1AH1A 4KQ4H 5F96H 5CMAB 4GXUN 2H6PA 4L8CB 3IAQA 3GIVA 3VGAB 2UZXB 1G6VK 3VWJC 2JCCA 1Z9SA 4H0IA 4PJ5B 2Q7NA 1PY4A 4N0UB 3V0WH 2FL5A 3JV4A 1ORQA 1ZGLB 2X40A 3P77B 3ELAT 3BYTA 3QHFH 1UACL 3ARYA 4K94C 1X5GA 3AM8A 3SQOH 1BD2E 1I8KA 4GLRI 3W9DB 5DD5L 2V9RA 5FM5M 4ZFZB 3X17A 4W81A 2AKRA 4JFDD 4CVXA 3K8KA 5C0ND 3RWGB 1PKQB 2FGWL 1IGFH 5T3XD 1D9KC 3U46A 4NKOA 3HN3A 1YDPB 3BKCH 1XGTA 35C8L 2OQJA 5E5RB 4C56D 5FM4A 1Z5LA 4ZUSB 2Y36H 4PJAF 2EDYA 2A6IB 8FABA 3MLUL 3IFLH 1FZKA 4NFDA 2UZIH 4Y4KB 4NFBA 1JCKA 3TP4A 1EHAA 4MNQD 4JY4B 4YNYB 1N59A 2WQRA 4UU9B 2B2XL 1JWUB 3UBXG 2ADJA 2FX9H 4X6DB 1A6TB 4Y5VC 4V2BA 4LIQH 4I0PC 4PLJC 5FO8A 5IEKB 1VEPA 2K7PA 2VDKL 2VQUA 3BP6B 2N1KA 5EC2A 5AUMA 1G7QA 3NIGE 1OB1A 5I76B 5CJ8A 3I2CH 1RI8A 1QSVA 4YGVB 5TPWH 2F8XC 3E1F1 5DFVC 1FVDA 4N9GA 5F3BA 1IGIL 1A1NA 2NW2A 5EOTB 5E03A 4WFFE 3A6CL 4N5ED 4LRNL 4CMMB 4KMTL 3PUCA 3QUYA 3U7WL 2Z4QA 1RHFA 1DEEB 1I1CA 3SEPA 3BP5A 1QUNA 5HGHB 3W0WA 1EBAA 2VE6A 3O3AB 4FHBD 1FBIH 3NMEA 3SGKC 1FO0B 4X6CE 4JFQA 4GKNB 5AG9A 1T22B 1QVOA 2HP4A 3F7YA 1J86A 1HQRB 5F9AC 2VTFA 1LO4L 3LV3A 5I19H 3P9WB 4K9EH 2IPKA 2WWMC 1WZ1H 1ZT4B 4RISH 4OLXH 4NKDA 3P4NA 4KRPB 3CNKA 3TA3B 1NGYB 2VLJA 3TBYA 1U91A 3TCLB 3RNQA 3SJVE 3TBSA 3BRGC 2E27H 1CF8L 1CN4A 2CXGA 3AY4A 4FQ1L 3MBXL 3FO2B 3HPJB 5DZNA 3V6OA 1ZLSH 3PE9A 4K23L 3NZ8B 3QHZH 4EEEA 5L0QC 4X83A 4LCWD 3HI5L 1J7VR 3DXAD 4JVPA 4YC2B 1FNSL 4PLKD 4JR9L 2J6EL 1XZ0B 4ODXA 4O4YL 1RIUL 3MRGA 4HQQH 3TNMB 4TTDC 3BPOB 1X7QA 4JFFA 4GW4B 4PJXE 3SBWC 1RZIB 1IAOA 3PIQB 1NC4B 3U4BL 3UTQB 3KAAA 4WHYG 3S35L 4MD5A 1T21A 4RAVA 2GJ6E 4FXGB 1N6QL 4HSQA 5C3TA 4Z77A 5HTSA 4WI9A 4HIHA 3MV7A 3DVNA 1GC1C 2V2WA 2HRPL 5FGBC 1AE6L 3TESA 7FABL 1CU4L 1C5BL 4RWYH 4AG4L 1IAIL 4WW2A 1RVFH 3P3YA 4G6KL 2B8OT 3KGRA 1R0AH 4PYHA 5JDSA 1QSEA 3KYKH 1CG9B 3OKOA 2PW2B 1CR9L 3CX5J 4GXVH 4DVBA 1ACZA 1QSFE 4X4ME 2HFGL 5DUML 4ZS7L 4EZMA 4WUUA 1AKJB 5D96B 3MV9E 3SOBL 2HKHL 3SGEI 1U8QA 3G6JF 3U9UA 3T3ME 1DDHB 1TJHL 4I48B 3O8XA 5JW4N 4F7CB 3WHXA 4M8QB 5F9JA 2FJFB 5MERA 1C8PA 2NXZB 3GI8H 1F97A 5GGQH 4P46B 5EZLA 3VXRE 4U0QB 1JWSB 3AREC 1BHGA 4LSDA 2J8UB 2Q8BL 1GPOH 2DM7A 4W6YB 3O9WB 1Z3GL 2ORBH 3K1KC 4I4WA 4ODWB 3HC0B 4P9ML 3I75B 1U8HA 3PGFL 4LLVA 1JNNL 1X6NA 3GSQB 5LGHH 4PJCB 1KC5H 1OAQH 4P4KB 5I8OH 1E28B 2CLRB 3UAJD 1DANT 4CW1A 3BE1H 3QEGL 1NCCH 3NCMA 3BI9X 2EYRB 2NY5C 3CK0H 3MROA 5C92A 2X89D 5I1KL 1QSFD 1D5ZA 3WEXA 2AEPH 3SKJH 4IRJB 1HXMA 1JYWA 2NY0B 3FB6A 4R0LA 3UZEA 1ZHLB 2A83B 1G7LA 5EZJB 4F3FB 4LCIL 2P48B 4LPWA 5EORH 3ORJA 3MJ6A 4X6FB 3KPOB 3SCMA 3EYVA 4B53A 1S7RB 3WL9A 1HHGA 2DKSA 1I9JH 5KVMC 2WIMA 1LO5A 3CX5K 1QBBA 4RFNC 1CXHA 2B1AH 2DTSA 2HG5A 3H2WA 3W11D 2J2ZA 4FABH 2J5LC 3QQ3B 1NCBH 5INCA 3BGMA 3UJIL 2VLLB 3DUSB 5K9JH 2QQLL 1ORSA 4NP4L 4DUVA 3ARVA 1NAML 2DD8H 2HRLA 3OR6B 4Q6IB 3MGTA 1MOEA 3CSYA 2RIKA 4TSCL 1CK0H 2AJUH 2F19L 2J3SA 3T2PA 1HDMA 4KKAC 1MHHA 4I0KA 3R06B 5I73B 5EU3A 2Y06H 1KB5H 4IMKC 1NCTA 5IMMA 3T2QA 4PRPA 3DX6B 1I85A 1A47A 4PJ5E 2ERJC 4OZIB 1CFTA 2JJWA 4POUB 4N0UE 3QI9D 2J4WH 3P4OB 5KSAA 4RRPA 3QUXA 2VLKD 5I1LA 1LK3L 4G6FD 2XWJA 4MQ7A 4QRPA 4WW1B 4B41A 1KCRL 3NGBB 3T3MF 1P7HL 2VUYA 3BHBA 3LKRA 1MFEH 1KNOB 2H9GB 3L5WB 1HQ4B 1CGSH 3D69B 3MXVL 1F8TH 1PKQE 3QDGB 5IWLA 5CBAA 1MCFA 2GUOA 1S5HA 1MJUL 5CP7B 1T1ZA 3RBGA 3QUKA 5E5UB 5EBWB 2XYCA 4UT9L 2UYLB 3ULSA 3P4MB 2QSQA 1HYRC 4JLRA 3NIDF 5IEHB 4NO0A 3VFVA 5GS1C 1MCKA 4PJ7F 3IXTB 5INDA 7CGTA 1YJDL 4OZ4A 4A2LA 4EVNA 1H3PH 5E8EB 1UH4A 5I71B 2X4SA 4E0RB 4X6DE 2DYPA 4ODSL 2X4TB 5GS0D 5JR1H 4JPVH 3V4UH 3L1OH 1AIFB 3QYCA 4JKKA 4HFWA 4H88L 1UA6L 2ZPKH 3SPVB 2FR4B 1FYTB 1KLGA 2P44B 2GITB 4Q2ZA 1I7TA 2EDEA 3CXHJ 5EU7C 5DJ6B 1EMTL 1P4LB 2WM0A 4JFZH 3QZWG 4F2MB 5BS0B 3S3PA 2EYSB 4WTZA 2GCYA 3I6GB 1BM3L 5KW9L 5ILTL 5JW5A 2ICEB 2FYYB 4X98B 5TFSH 2OK0H 1D6VH 3D39A 1MCPH 2JJTA 1LP9A 1Q0YL 1KIQB 3D1MC 5DS8B 2B39A 3ARDA 3RTQA 5D7IB 5ACZB 4GG6A 2WV3A 4FFWC 1JI1A 3RI5F 4K94H 3MRDA 2X4UA 1AO7B 1I3RA 2CUMA 4P5MA 3VRLE 3SN6N 3C2AH 1LK2B 4HWBL 4TULH 4NRXB 4HZLB 2EXWD 3LRGA 5HI4D 1N0LA 1NSNL 1NLBL 4G43B 1W8OA 4FZEL 5L2JA 1G6RB 4IOIB 4YXLH 4XP5H 2HN7B 3I84A 4X0KA 5IF0A 3QUYD 1ED3A 4R90L 5LCVL 4ZFOL 3DV6B 3S34L 4JFFE 3PV7A 1FJ1A 3K81A 4PRAB 4S0TD 2G60H 4CNIB 2RFXA 3NN8A 4AH2B 1A7PH 3W0WD 5KVDL 1UM4H 2DQFB 4WI6A 4YWGH 4YFLF 2CDEA 3IGAB 3MLVL 1K8IB 4FXKB 1G7HA 1P7QB 2ATPA 3HMXA 4J1UB 3ULVC 1JRHI 1J5OH 1R24B 3ZYJA 3HLAA 4UT6L 3EYSL 4FZ8L 5L8LB 5SX5H 1ZA6A 4N0CC 2VLJD 2AABH 1BAFH 4XRCA 4PGBA 3T2NL 5B8CA 5DSCA 2WBJA 5EIVA 5EOCJ 3CX2A 3MBEC 2Z0BA 1KJ2H 1XIWC 2EDDA 4L8SB 2EDOA 1QACA 2ZUSA 4WU7A 2EC8A 2L7UA 1B4JL 3GJEA 2YEZB 2VO5A 3TN0C 5T3ZL 4YHPA 5CSBA 3SDCC 4K3JL 1IM9B 4F57H 2UY7A 1YQVH 1JYXA 1WQVT 1K2DB 1H3TA 2GQHA 5T33H 4JFFD 4P23C 4X6DF 2LVEA 4F58H 1DQQA 3BPNC 3O2VH 3ZDXE 2NXYC 3MRIA 5DZOA 4XZUA 5E7FA 4ETQB 3QCUH 1OP3K 2VERN 5IBTL 4KVCH 2LTQB 4HW6A 2YUZA 4X9FA 1WC7A 4GAJL 5HI5D 3LHPH 4QGYA 3MLRH 3MV7D 1AD9B 4GAYA 3TH4T 4OCLC 5C1MB 5JW3H 2N7BA 1KCVH 5KVFL 2R2HB 1Q9LB 2J8UE 4LKCB 4HLJA 1NFDB 5DDHA 3CDYA 1HSBB 4XPBH 2AXGB 4J7RA 4DKEH 1WF5A 2DQTL 4YBLB 3BGFB 3LH2H 4UOJA 4XC1L 1QSED 4OLVL 4LPYA 1I9RL 4KJQC 1T5XA 4P2QA 2HFEA 1JN6A 5ISZA 5JDJA 1JJUA 1MIEH 4PJCE 3GMPA 1T0PB 1AGFA 4HX1B 4GQ9H 3L3OB 3MLWH 4R2GC 3VRLF 5C0AA 5I2IB 2DLGA 4PRDB 4RWHA 4WI7A 3O45A 2OZ4A 2H3NA 1PY9A 3O8XD 3WIFB 2N56A 3FQRA 4MHHI 4N0YH 2OI9B 2IANB 4ZPTA 1KEML 3IXAA 4CAGA 2D2OA 4L3CA 4KJYB 4RDQG 5HVHB 3G9AB 2ZOLB 3MNWB 2O93L 2XZAH 1HIML 2FD6H 4K7FA 5JORB 5C7XH 3INUL 1QLFB 1RFDH 1OAKL 1YPZA 5DK2A 1Q38A 4PP1D 3RWEB 3S5LA 5IQ9A 1BFSA 2XNAB 4LCCB 1J05A 1FDLL 3EYQD 4TPRH 3QWRA 2Z35A 3OKKB 1PX3A 5HYQA 4MS8D 3ZT5A 1KULA 3QXUA 4R3SB 2Y07H 3QH3A 2OJZL 4YHNA 1U6AL 1IT9L 4NQVA 1T7VA 1JF1A 4YEEA 3QUZC 2VJXA 5C6PB 1G7PB 4EI5C 5E2UH 4I13B 3U0TB 2YWZA 4AM0A 1RZKC 4BK4A 3FQUB 4HGKC 3I02A 4ZAKB 5FYKH 5J3HD 2ZUXA 3WXWL 3UYRH 3VH8B 4ZYKB 5TDOB 4YJZL 2GTZA 4WEUD 2H32H 3UJJL 2NY0D 3LS4L 2VLRA 1ZOXA 4OZIE 1HSAA 2DQIL 4WWKB 3IDJA 1VDGA 3L7FA 4NDMA 5F7LB 3RY6C 4FP8H 3L95A 3S96B 4PJ9B 2CIKB 1HH9A 2CD0A 4M62L 5BMFH 2ZP0T 2W0FB 4LF3B 2Q7YA 2PETA 2J8HA 4OI7A 5FOBA 1BQLH 4P57A 5I1AB 3QDGE 3QDAA 2NY5H 3ES6B 5DHVH 2WUCH 3BEVB 4F9PC 3OZ9H 1JWMA 3GSNA 1J18A 1A5FH 3MCG1 4JJHA 5CZXC 1HH6B 1V5JA 4YBQC 1PSKH 1NGPH 5IW1B 2F53A 2DMBA 2YXMA 1ZWIB 3ULUE 1T0MA 3SKOA 1R3HB 4BELD 4I5BA 2HVKA 3MRLB 4U3CA 1KIPB 4AIZA 4ALAL 5DD1L 5KSAD 1L7TL 2NNAA 4KZDH 4UOW1 1F58H 3H3KA 4QRPD 3FOMB 4RMTA 2MCG1 3TT3L 1V7MH 1WUNT 1S78C 5FYLL 1FORL 1FYTE 2Y7QA 4IHOA 3C6SA 1X6LA 5T1KA 3L3IA 4FQIH 3FQWB 2DJSA 4OKDA 1TETL 1WAAF 1KCSL 1S9KC 3ZYZA 2XZCH 3ALPA 2GAZB 2ADGA 3MNZB 1RUKH 5EC1A 3ZKMD 4AK1A 2BVTA 5BS0E 5JPMB 2CO6B 2VH5H 3IDYB 4PJAA 3EFFA 1T1YB 3UYPA 3QDGD 5CLWA 3VXPB 2AW2A 1CFSB 1JHTB 3C8HA 4NO0D 5MP6H 3LSOA 4IBLT 1FGVH 1BZ9B 4NCC2 4GRLC 5D7IE 2DYPD 4EIZC 4R4FL 4GOSA 4QNPE 3GNML 3ULUD 1MRDL 1LDSA 1AO7E 4P2RB 4QHMB 1WSST 3VFUB 2ADIB 1FNEA 4XBGB 2VWEC 3QIWC 2XY1A 1H5BA 3HAEH 4NSKA 1MUJA 1YN6A 4IRZH 4DUWA 1HCFX 3F6IA 4CJ1A 5KBNC 3D0LB 4CVZA 5D1ZC 2DDQL 2AP2A 3BQUB 4U7KA 5JHLL 3KDMA 1J11A 1QA9A 4IJ3B 4PJ8A 1A6ZB 1FRGH 1TCRB 2Y6SD 2Z93A 5E2VH 3TZVC 4OZIF 5J9PB 5KS9B 3D39D 4OAWA 2VXUH 4K8RD 3WJLA 5FYJE 3L6FB 1IC7H 3FN3A 1BOGB 3ARDD 1UWXK 3V0WL 1DQMH 3OX8B 1RJYA 4N8VB 4RGMC 4XBEL 5A2JH 1UT9A 2DBLL 4WHCA 3VFMB 3ZSTA 4U6VL 1R3KB 2Z8WC 3X3FL 4ODVH 4OGYH 3VXUB 5M95B 4OIAA 1DSFH 4MSWB 5DRXB 4GRWH 4HIEA 1QNZL 2L7JA 3BMWA 1WFOA 2XV6B 1G9NL 2G75A 3MFGB 1V3JA 3PGDB 4GMSH 2EZ0C 4LASH 4S10A 3MLTB 3V5KA 1QBMH 1RULH 3GMRA 1TTUA 1T7XA 3OKNB 1IQWH 3PGCB 3RQ3A 2NY4B 3FFCB 2DTMH 3PWLA 1XGYH 2EKJA 3P0YH 2P8LB 4U1IA 5FF6A 4P59H 3MRQB 5SWZA 4I77H 3MMEB 4XTRC 1ZA3B 1ND0B 4KPHH 3VWKA 4XX1E 2BY2A 2ICWJ 1GSMA 3ESUF 4HXAH 1DBMH 3BKML 3FN0L 2IH3B 4HFUH 3M1BB 3WHE1 3B2VL 5HYSA 3LVEA 2XFXA 5EFIB 5HGDA 3I2CL 5TPWL 2ESVA 1UM6L 2JTDA 3FO0H 3QNYB 1KJVB 2XA3A 3MYJB 1MAKA 3HZMB 2WBJD 1T7ZA 2YPVH 3HR5B 1JV5A 4ONHB 3D0VA 1F3DH 1U8MB 5DJCB 2CK2A 3QA3A 2YPLA 1NFDE 1L7IH 1URLA 1AR1C 1C08B 1RUQL 5CLTA 5BQ7A 3IVKB 3KPMA 3CJJA 1A4KB 3RWDB 3TJEL 5MEQA 1IM3A 4PRNB 1B88A 4ZUVB 4JFOB 1YEFL 3MRNA 2Z31B 2QHLA 1OP3H 4K2UL 2GYSA 2C4FU 1DLFH 3MRHB 4TUJA 1FBIL 3ULVH 1GAFH 3O6ML 4TVPH 4L4TB 4M43L 1KPVB 1TZGH 2APFA 2CLZA 3OHXB 1K6QH 3G6JA 4FQJH 4UIMA 3S36L 1CICC 3U9PL 1QZ1A 1J0JA 4K9EL 3CDGB 5IJKA 4RISL 4D8PB 3CFBA 1JNJA 2IANE 3QZWB 1KCLA 1EAPA 3KHOA 3IJSA 4X6EB 3I6LE 3NA9L 5IFHH 3CFKA 1UXWB 5JUEH 4JKPL 4K3EL 3BD3A 2PXYC 2PCPA 3FTGB 4X5WB 2X7LB 3VMOA 3MZTA 4J3XA 3NTCH 5E4EB 4L3EA 1QHOA 3N85H 1OOAA 3MCKB 2VIRA 1LEGB 1UXSA 1GGBH 3EAKA 4MB4A 1UB5A 4WDIA 4M3JA 4QRTA 3T4YB 4I18B 4KY1L 1QRNA 4HK3J 5C0AD 1DQLH 3PQYA 3V9FA 4WHYH 3GGWB 1YEDA 5EOCH 5B39B 1FGNH 4R26L 3ZT6A 5JHDA 2R29L 4DZ8B 4HH9B 1M71B 5IMKB 3V52H 5HVFB 4MDIA 2CUHA 1QEWB 2AJZB 1BPVA 5FM8A 4X7FC 4LARH 3JV0A 4FQXA 1R5VB 1T20A 5F88B 3EJZC 2VMFA 1PW3A 4G7YL 1PG7W 2H2PD 4GS7B 3RHWK 4HIXL 5DVKA 1C7SA 5K9KA 3I6LD 3QWRD 4NCC1 5HHXH 3C5JA 3GI9H 4QRQB 2HLFC 2BERA 3WSQH 3HI6H 4GXVL 5EU5A 4HKZB 9CGTA 3TBTB 2GJZA 5D8JH 3WXVL 3BVNB 1BEYL 2CIIB 3HZYA 3KS0H 3ME0A 5C0CA 4G6JH 4KGLA 4NKIH 5D7SH 4LSRL 5CGTA 4NZUL 3VGEA 4NHUA 2ICWB 3H9SA 3WV0A 1NCDL 1IAIM 1C1EH 3PWJA 3U36B 5EDXA 4M6NH 1EPFA 3RVXC 5ESQA 3BDYH 5GISL 3K74B 3KLAB 3VRJA 4QRSB 2W60B 3UC0H 2W0PA 1NFDF 1BFOB 4NWUL 5DK0A 2QQKH 1KN4H 5DLML 4HJJH 2VDLH 1U8KB 1ZMYA 4J3TA 2VLRD 3DSNA 2GK0B 3JV6A 3NACH 4IOFC 4EUPB 4ZAKD 3VG0H 3EJYC 5CD5C 1W0VB 2AQ1A 4MJIA 4RGNC 3BD5A 4LSVH 4Z76A 3VXOB 43C9A 5ANMA 4F33A 3JVGC 4N8PA 2F74A 4YDKH 3TIDA 2NY7L 3WUWG 4X4YA 5FO7A 2I9LB 4FFYH 4QLRA 3IKCB 4DQOL 1DP0A 5KANI 4JO1L 1Z6JT 4O02L 1MY5A 5GS2D 2X44D 3SKJL 5CILL 5IM7A 3VRIA 5BV7H 3NFPA 1RZKH 3ULVF 1UGNA 4E42B 3MUGA 1BP3B 2F53D 1A6UH 1WV7T 4LEOA 1AY1L 2LE9A 3GB7B 4QXGH 1MFBH 1J0KA 2DKUA 1N5AA 1H3UA 3SGJA 1K5NA 3BIBX 4PJ7A 5IV2A 2FSEB 5LWYH 1FCCA 5CJXA 1SEBA 1S9YA 4L8BA 5GPRA 2ENSA 4Y2OA 4FRWA 4Y4HC 1JP5A 3MRCA 1CXIA 4P2RE 3R1GL 1FIGH 5CEYA 1DLHA 4EDXB 3C5SA 3SE4C 2E7LA 1RK0A 5EUKA 2JK5A 3TGXA 4R4BA 5IMOB 3TVMC 5J6HA 5T1KD 1QG3A 4MB5A 5TDPA 4M7LT 5GRVL 3QEUB 5K9JL 5MEPA 3FO9A 5FIEA 4KI5C 3UTPE 1OTTD 1CLZL 4KTEL 3TV3L 4UDUA 5ICXB 1S7QB 5GGUA 4XPGH 2IAMA 5D70L 3N1GC 5E2JA 4HUVB 1A21A 2VDPH 3HE6B 3NCYP 1KB5L 1QO3B 5KS9E 2A0LD 5DJ0A 3F12B 3MA7A 1PG7H 2HKFH 4IS6B 2AJYL 1AXTH 4OFVA 4JKLA 2IADB 1UYWH 3FOLB 4EXKA 2FHFA 3Q6FB 3JTSA 4LDEB 4D0BA 4U6XB 2F9BT 3LQZB 4ENED 3KWWA 2P7TB 2UWEA 2X4RA 2HH0H 4MB3A 1XCQA 4Z7WB 3VXUE 5E0QA 5FEBA 3FO1B 4NO3A 1VADA 1RQ5A 4YDJA 2R0WL 4P5TC 1F8TL 4P2RD 2GW5A 4QT5B 4MA8H 2YUWA 3ZHKA 2XWBA 3FFCE 2IALB 4PJ8D 4DK3A 1UWXH 3HHRB 4RMWA 1AGBB 4QHUB 1B3JA 2OCFD 3UTPD 3RX7A 5J0BA 1KB9K 3O4OC 5H94A 3FQXB 4HUXB 3A67H 5A16B 1QBLH 5FB8A 3GSWB 2V17L 4HKJB 1S3KL 1W0WA 2HLAB 3FONA 1CZ8H 2BCKB 1QLRA 4KQ3H 3RUGA 3WNKA 4F7MA 2BOCB 3OKLA 1TVDA 4JPVL 1G0DA 4R4ND 3C5ZB 3B8SA 4EXPX 1KB5A 1J10A 3I6KA 3O0RL 1M7IA 1U95B 4X9BA 1MJ8H 5LAXA 4X7SL 1LE9B 1A3LH 4OD3H 3T77B 1FO0L 4UNVA 2FB4H 2DQGL 3PL6C 5I74C 1X5YA 4OLWH 1ZVHA 2QLVB 5IB3B 4CGTA 5JO5B 4BSWA 4CBPA 1J1OH 5DTFA 4D0CB 4M6OL 3FRUB 3VXUD 1RZGA 1MSPA 4LGRB 1NEUA 5DEGB 3HCVB 2WK2A 3UTZB 5FECA 1OF2A 5E95B 1FNGB 5SWZD 4OZFG 4F15B 1A7RL 4LDOB 5TFSL 3VWKD 2VQ1B 4L4TE 1MVUA 2D0FA 2NMSA 4W4OA 5C0FB 2ZG3A 3JWDL 2JJSC 5GIRA 4G8GA 4Q74A 1KTDB 5BW7C 2IGFH 4LKXB 5LVEA 3QPXH 5D6DC 2A74A 1E6JH 3WFEL 1WVZA 5ITFA 4MCZB 3C2AL 2ESVD 4XP9L 4FQLH 4APQB 4QHLB 1S9VB 1B2WL 3BUTA 2FBJH 4JDTL 1I1AA 3EYUL 3FZUD 4H5SB 2FO4B 1NGXA 3RWIA 2E6JA 2ENYA 2JIXB 2YPLD 2PKDA 3MGAA 4NQTA 4XCNB 1RY7B 1D5BA 2BVEA 1I7UA 4ELKA 3B9KA 1A6AA 4ZDHB 3K1DA 1VSCA 4FS0A 4Y8AA 4PJDB 1A7PL 1MCQA 3IDXL 3AB0B 4PYGA 1UM4L 1OTSC 4Y5XB 1CIDA 3VWJB 1OAUL 2XKSA 4B0MM 2R1XA 3RIFK 4U7MA 4XPFL 1J5OL 1WCBB 2DM2A 1IGTB 5C0NC 1LILA 4AEIL 4DKFH 5IVNA 5DJ2B 1RUML 5LGJA 1KJ3H 2EYTB 2A73A 1E4XH 1K4CB 1AQDA 4J3UA 4DGVL 4ZNEA 2IWGA 2QSTA 1MRFL 2A6JB 3DVGA 2X9XA 1I1YA 1UH3A 2A38A 2ID5A 1D9KB 5IHBA 4U1JA 4OUUB 4XP1H 5HY9A 1H8SA 2R2BA 1DBJH 2QKIA 4H1LH 4L3ED 4EQ2A 4DGYL 2VITB 1SVCP 4WU5B 4CADB 2R4RH 4FTVA 3FN9A 3VFSB 5EA0L 4AEEA 3U2SB 2M8XA 4PGEB 1Q72H 1TVBA 3PQYD 3G5YB 3NAAL 3RWJA 2Q3ZA 2XN9A 4N5EC 4Y5VB 4HK3N 4I0PB 4BZ2H 4J6RH 4MNGA 3SDDB 5JHDD 1EIBA 4X7TB 4MD0B 4OFDA 1GGIH 3RVWD 2F8VA 5A3IC 1S7VA 4XPTL 4YUEH 1VKXB 3CSGA 3V4PH 4FQXD 3OAZK 1TFHA 4PV8B 5BOZG 2CRIA 4WO4A 1RUPH 1KOAA 2OXHA 3DUUB 4IMLA 3H42H 1EUUA 5HI3D 5K93A 4ZPVB 3LH2L 1I3GH 1AP2A 5SV4A 1A2YA 1F4XH 5J6GB 1T04B 1X5HA 4JFPA 1KJ2A 5F6IB 2DQUH 5D1QB 1DR9A 5C0CD 3QSKB 4GQ9L 1ZLVK 1OPGL 2WIIA 4OZGB 3RPIB 4F7TA 4Y5YC 4MCYA 2XQYK 4FG6C 2D7NA 5CWSA 1RHHB 1M6OB 4QCIA 4QY8B 3L3HA 3WDHA 5C9KA 1FQ9C 1XF5A 5BZWB 3S88H 3KYNA 4L5FH 3GSUB 2R0KH 1YECH 1LMKA 2BVPB 4PLKC 5ESVB 3VFTA 1NCNA 1YEGH 3DUHA 3NVQA 5C7XL 3ZDYF 1HHHB 4XNXH 2IH1B 1OM3H 2DOCA 3PDDA 4MJID 3IKKA 5L0QB 4TPRL 3RGVC 2EKSA 3NFNA 5MENA 1A6WH 2ZJSL 4JFYB 1ZAGA 4BH8A 1U8LA 2VISA 1IEHA 1ZT1A 5F71A 4JO3H 4FMFA 1WAAA 3PP4H 4XNYH 2ZUTA 5DC4B 1S7XB 5FUCE 4TSAL 3GBLA 3O2DL 3CFCH 3OAUH 1QKZL 3GSOB 1ZHKA 2ZUVA 3GJFB 4HK0A 5HDLA 3LS5L 4XP6L 1A9BA 4UNUA 2Z92B 3L7EB 3R4DA 1XF4A 4L4JA 4OB5H 2XPGB 5F72S 5GRJL 4FNLH 3MNVB 1YEHH 1YEIH 5FDYA 4PG9B 1A64A 3RKDC 1AGCB 1G9ML 1IC4H 5IROC 1CI5A 5HJ3B 4PUBL 3WS3B 3D3VB 2EIZB 1PEWA 3O6KL 4HIIB 5JXAH 4XXCC 4Z7WE 2QV2A 4NKMA 1I4FB 5D2LA 4N1EA 3WJJC 1F2QA 4N8CH 1QFWM 3ARBA 2NYYC 1A7OH 1INQA 4GUPB 4XVSH 3T4AA 3B3IB 3FB8B 2YZ1A 5KSUB 2WUCL 2OR9L 3D48R 3BZFB 3O3DA 2AV7B 1IGJB 4PJFB 5EOQH 1QBAA 4XAKE 4U6YA 1E4KC 4IDLA 4GMTL 2Q86B 1UZ6F 3ARGC 3OR7A 1PSKL 1NGPL 3DTXA 1J8HB 1H15A 4WHTA 3VXSB 5E1AA 3AREB 2JE8A 2UUDK 4U6HB 2YD4A 3WUZA 3E6HB 4NQEB 4KJWD 3PWPA 1ERNA 1KENH 4N0FB 3G5ZA 4WI2A 1F4WH 4M7LH 4ELMB 1HNGA 1Q94A 3LN5B 4KZDL 4NGHL 3RHWF 3IFOB 4UZGA 4ORGA 5CINH 2A1WH 4M7JH 1VFBB 1N5YL 4I2XB 2H32A 3EOAA 4KUZL 4O2CA 2KBGA 5IQ7L 3CZFB 3IFPA 1OVZA 1WBXA 1U0QA 5FHBL 3U6RA 2NW3B 4G8IA 1CFNB 1IGYB 5D1XB 1A22B 5TQ2L 4R97C 3B5TA 1S7TB 2VH5L 3I50L 1LDPL 1J1XH 4KHTH 3MRKA 4QF1B 1XF2A 2VDNL 2BNUB 6FABL 5FM5O 5DHVA 2G9HB 4WFEE 2V7HA 5MP6L 4XAKD 3W11C 1G6RL 3MR9A 4LLYB 3EGSB 2YD8A 4LCYA 4C58B 4BZ1L 4PV9A 1DBBH 4NHCL 2OSLA 3MRBB 4HS8H 1OAZL 1PEZA 5D5MF 1OD7A 4TSBL 1BIIB 3DX8A 4RDQF 1FVEA 1D6EB 1AGDB 4NJ9L 2ITCA 4RFEB 3Q1SH 2J5LB 1IQDA 5DJ8B 5DJDB 5FYJL 5IG7A 3J7HA 3PWVB 3VGDA 2Q87A 1QFUH 2IBZX 4MLIA 4EOWL 3C5ZD 1O5DT 5HD8D 1OLZA 4HXBL 3RDTA 1CBVL 3V5HB 2KUTA 4OLUH 3G6AB 5DEFB 4G80B 2CKBB 4YDVB 1PKOA 4IRSA 2VN7A 3QI9C 4Y0GA 5JPNB 3VFPA 1FRGL 4PJDE 2IG2L 1YUHB 3T0DA 2QR0B 1U3ZA 4WUKH 1SMOA 5E2VL 4PTTA 5EIQA 1I7ZA 3T3PE 3CH1A 3UDWC 5D71H 2ZCHL 5F7DA 3LAFA 5TF1H 1WFUA 4GFTB 1FYHB 4K7PL 3PXJA 3P0VH 2ERJB 1EEUA 4G8GD 4F80A 4KTDL 3OPZL 1M7XA 3QFJB 3WFHA 5CEZH 1MAML 3OKMA 1B0RA 5I1EL 4HDIA 2WZPD 1EERB 1Z9OA 3NABL 3HRZA 4LHJB 1JK8A 2IMNA 1I1AD 2FJGA 2Z91A 2BNQA 4MAYA 2IFFL 5ADPL 1P7KB 1ZT7A 1GGCL 3VXTB 3H7LA 1CD1A 4ZTOL 4UT7L 4WI8A 1RULL 2BRRL 3OXSA 1A4JB 1MFDH 4QYOB 3UCRA 3MLZH 5FGSA 4I9WE 3HG1A 1CDUA 1ROWA 2DTML 1XGYL 3B9KD 3P0YL 3ETBF 3HAEA 4P59L 3CFJB 1AR2A 3AM8C 4MD4B 3QDJB 1HI6A 2DWDB 5BJTB 2P43B 4NBXB 4XXDB 4XNMA 4PY7B 3KPQB 1IGCH 3R8QA 3MRMB 3EZ8A 2FH8A 1WWBX 5GS1A 3VD9A 4FN0A 3HC4L 4JGMA 4KJPD 1N64L 2SEBA 4JDZA 3KPLA 1HOCA 4XB8A 4OLZH 5C6TL 1C16B 3ALXA 2X09A 1H3WM 5FKAA 1I8MB 1MCNA 2Q76B 4WEBL 4QKXB 1U3HB 5CFHA 1M4KA 3GSXA 2DF3A 4ZFFA 4LLWA 4C55A 4KV5E 1OGAA 1ONQA 4FTVD 3ARZA 4GXUM 2VB5A 2YR3A 1DLFL 2Q6WA 3VFNB 1IEAB 4I9WD 1YEEH 1MJJA 1EJOH 1A1OB 1K6QL 1ZSDA 2EH8H 1KCKA 4OZGE 2X70A 2XN9D 3CFDB 4M1GL 2VAJA 2YSSA 3STBA 4LEXH 1NAKH 4Z0XB 1D5XB 2P1YA 3CCHA 1UWGL 4WCYH 1JZ6A 2BK8A 3TNNB 4OZFB 4OIIH 1MLBA 3ILPA 4PLJD 3UBXA 2ZCLH 4X7CC 1R5IA 2FJHB 2GFBA 4HWZA 1I9IL 4O58H 1FIEA 4C57C 4NRYB 1NBVH 2F5BL 2I60L 5DFTA 5C0BB 5DFVD 2BC4B 1VPOL 4KKCD 4AIXA 1VESA 1ZLVH 5I18L 1WEJL 1GGBL 1F4YH 3MC0A 1FHGA 4UIKL 5ALCL 4Z0BH 1PX4A 1XH3B 3N1MC 3D5OF 1OSZA 1R3LA 4LPVA 5IB2A 3PWNA 4OD2A 3UPRB 4M6MH 2EECA 4I3RL 1NUFA 5DMIL 3QDHA 1IKNA 1OAXH 5EOCL 3S4SG 4KXZH 5HHQB 1JPSL 4G42B 4JPKL 3PDOA 2R1YB 1XF3A 1RJLA 3QISA 3LIZH 5LXGH 1SEQL 2WWMD 3RWCB 1INEH 1N3NB 5B38G 3AS2A 2QQNL 3TFKC 3NCJH 3QIUA 4URTB 1VFAB 1N7MH 3UBXI 4ZUWB 4S1QH 3ECBA 1S8DB 3KPPA 3TN0B 3LKPA 1GZQB 3OJVC 4GW1A 1GOFA 2YPKA 3SDCB 3D3VE 1EGJH 2MKLC 3GI9L 3UMTA 5MEND 1KTKE 4YH6A 5TQ0L 3MBEA 3ZDZE 1XIWA 4JEGB 1IZKA 2R0LH 4UINL 1P1ZA 1VFAA 2BVQB 3OWEA 4P23B 5DWUH 4HJGB 3MUY1 3B2UC 1MFCL 3RIFF 5EN2A 3L3KB 2P42B 1KYOJ 5DJXB 4XVJL 1UQSB 4WW2C 1Z9MA 3MJ8A 4PJFE 4M6NL 4RX4A 4TTDD 1RZ8A 4BFEA 2W9EH 5E70A 3KNBB 5IR1B 1TNNA 2AEIT 1J8HE 3T0EC 2DM4A 3O3BB 3VXSE 4MQSB 5I1HH 1KN4L 5DRWB 2VDLL 4NQEE 4YXHL 1FSKC 3UTSB 1G7JB 5J11B 4KV5F 4P3CH 1G0YR 1E6OH 3LEXB 4ELME 2NY2C 2OR8A 3PABB 3O8XC 2GJJA 3FQTB 5JMRA 1UB6A 3HNTL 4I2XE 4OZGF 4N1CA 1HEZB 1ZHBA 3BO8B 3ARBD 4K71B 4CUCA 4YO0B 1AHWA 3H9HA 4BSJA 5L2KB 4Z7VB 4E5XA 2VR4A 4Z8FH 3ZL4H 4XNZB 4R2GB 3S98A 1KT2A 2VOTA 2YXFA 5DYOA 4K55A 2UUDH 3DRQA 4Y4FC 2FX7H 5JTWA 3SKNA 1MI5A 1XGRB 2Q8AH 5C09B 2FH6A 5I15H 5HHVH 4PREA 4BH7A 3EYQC 2D7TL 5HYIA 2VABA 2G2RB 1V7NH 1BLNA 2IQ9L 1MFBL 3LD8C 2O5YL 3CVHH 2ARJQ 4MS8C 3RL2A 2X4QA 3PHOA 2AJXH 1S9XB 2QADB 1PLGH 2YD5A 1J8HD 4RZCB 4NJAL 2NY6C 1HZHH 5FYKD 2QSCH 2YMXH 3MV8A 4YE4L 4NQED 1MH5B 2GKIA 5E8NB 4GG8B 3G04B 1RJCA 1JYNA 4D2NA 5FV1L 4U1LB 5J3HC 1KYOK 3BUYB 1NLDH 3EKCA 3ROOA 2ZG1A 5L88L 1EZVX 2EIEA 3HKFA 1FL3A 5CJOH 3SCMC 1N6VA 3IETA 3QUZB 5HPMB 4EI5B 2GT9B 5D2NA 5FA4A 4DAGL 3DVIA 5JW4M 5D7JA 5E94A 1A7QL 1QQDB 4X4XB 4PJHF 1S7WA 3H9ZA 1PG7L 3DETD 3OF6A 1KEGH 1AXTL 3DGGA 2GSGA 5DI8A 3T0BA 1CDGA 5GSVB 3L3JA 1AJ7H 1P5VA 1UYWL 3ZDZF 3G5XA 3QFJE 2X4PA 4HPYH 1MQKH 2ZOKA 1AI1L 5EO9A 5D9SB 1DQJA 1T1WA 3VXNA 1TTFA 3O6LL 1ZK9A 1FN4B 4HF5L 1FNFA 1YNLL 2PO6C 4B5EA 1MREL 5E1HB 2BHZA 1REIA 1U92A 2FHCA 3IT8D 5HHOA 5KAQG 1I85C 2EE6A 2BVOB 3NZHH 1XGPA 5B4MC 3WMSA 1FG2A 5H35A 4QRRB 4PR5B 1NGWB 2E7HA 3T1FB 3QNXB 3QUXC 3BEWB 1PDKA 3UZQA 2FATH 5EUOB 5FO9B 5SWSB 3RL1B 2YD1A 1UC6A 2OTWA 5E99L 5AYUL 1U58A 1X5XA 2ZSVA 3W9EB 3QDJE 5TF0A 4UUJA 1BIHA 4XMKL 4S1DD 1FL5B 3A67L 4BSVB 1QBLL 4JAMA 2R9HC 4KKAD 4JRXB 4RQQB 3ZHLA 1WZMA 4LLUA 5DQJB 1NCAH 4AEHL 3WLBB 2OL3H 4P9HH 5KSBB 3LKQB 4CVWA 1A3LL 3QO0A 4MAYD 2FB4L 12E8L 4E41B 1F11B 4HUUB 4PGDA 4RNRB 1N8ZA 4ZD3H 1J1OL 2HT3D 5EU7E 4ACPA 2XOTA 3REVA 1T0NB 4TNWF 5F70A 3HG1D 5F9OH 5L6YH 3MJ9L 1EO8L 4J8RB 4PS4H 4GJTB 1NPUA 3H8NA 3M8OH 4YZFE 2WQ8A 3PV6A 1FNHA 1JTTA 3BWAB 4PJEB 4AEFA 4M1DH 4GAGL 3VI4E 2WINB 5C07B 1WZLA 4C83A 5IOPB 4DJMA 3EW3B 2H26B 5K9OB 3SY0B 4NZDA 1JPGB 2EH7H 3NCCB 2OXGA 3GMOB 2FBJL 4UQ2A 2Y72A 2Y6SC 4X99A 2WLYA 4GRLA 3QIWB 4M6AA 4OKVA 4HG4J 2B5IC 4QOKA 3KPNB 4U1KA 4OF0A 2HVJA 4L9LC 1GH7A 5D1ZB 3HUJF 5C0BE 4WTWA 4NM8L 3RTQC 1R3IH 2ZNWA 2EDRA 1LWRA 1IVLA 1IEBA 4LAJH 1OGAD 2VRAA 3BP4A 5DR5H 3HS0B 1T89A 1RUAH 3P73A 2VXVL 1NDGA 2D0HA 1CFVH