2Z35A

Crystal structure of immune receptor
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
112
structure length
112
Chain Sequence
DSVTQTGGQVALSEEDFLTIHCNYSASGYPALFWYVQYPGEGPQFLFRASRDKEKGSSRGFEATYNKEATSFHLQKASVQESDSAVYYCALSENYGNEKITFGAGTKLTIKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural evidence for a germline-encoded T cell receptor-major histocompatibility complex interaction 'codon'
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords T-cell receptor alpha-chain
total genus 21
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2007-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2z35A00
3RX7A 4Y16C 1ZLUH 3MGTA 2FHBA 3JV6A 2FLRT 5DD0H 3GI9H 3BWAB 2YPKA 2V2WA 3V79C 2DRUA 4M1GL 4OZHB 2XZQL 1MCFA 4AIXA 3KJ4B 5KVEH 1KENH 3HPJB 1RPQA 3ZE0F 5EBMB 5C08E 3MOQA 1JK8B 3OPZL 4FG6D 4GAGL 2CDFB 4YXLH 3TN0A 5L7XL 5DVKA 5D7LD 4IDJH 4M1CD 1OOAA 4X9IA 2R0WL 5JMOC 3G6DH 1PW3A 3UC0H 3LN5A 3WIIL 2EDOA 2UWEA 2BCKB 5KS9A 5HDBF 4FQXA 4FN0A 1S7RB 4LDEB 1FYHB 1RUKH 4I9WE 1RJLA 5SX5H 1GGIH 4G80A 2NQCA 5I1DB 1CLYL 5D93B 3FTGB 5EO9A 5TFSH 2EDRA 2NY3C 4R4FH 2SEBA 1GZPA 1X6NA 4WI4A 3RUGA 4CNIA 1FPTL 4NQSB 4JHBA 1ZHKB 3VE0B 4PRBB 3QCVL 3PGDA 5BMFH 4OV5A 3HC0B 3OKMB 4P3CH 4OD3L 4E0RA 2X7LA 4HUMB 2I60L 2EE9A 4ZDHB 4HQQL 5FB8B 5HYEA 4J12A 2OCFD 3QXVA 5LGJA 4NO2B 1RZIB 5DFTA 5FOBB 3JWOH 4YHKH 4F7EB 4U2YA 5D71L 2EIZB 4HIJB 3O3EA 2R4RH 3H42L 3TEUA 3IJYA 3VGHA 2HKHH 4GRWF 2J6EH 3T04D 1LO0H 3PWPA 5IP4A 3MMEA 2HLAA 1KPUB 2ZSWA 4K8RH 4EI5A 4Z6AT 5KSVA 4HWBH 5L8JB 3MBEC 1NBQA 1X5ZA 1FPTH 4RWYL 3VA6A 2LU4A 4PJAB 5SWZD 2IANB 2R2HB 4I18A 4F37K 1PLGH 4I3RL 4WGVB 5DJAA 4QNPF 3OG6B 3WUWB 1FO0H 2OSLA 1ZHBB 4OZIE 3FB7A 2J8UB 4HH9A 3CIQA 3SOBH 1KYOK 2Y36H 3DOSA 4WHDA 1U93B 32C2B 1ZSDA 4KRMB 3T0VA 1HHIA 5GRJL 2E9WA 4L4VB 4XZUA 2L7UA 2VXUH 4WO4A 3RWHB 2YC1A 1DEEA 2YEZA 4PRPA 4R3SB 4OZFB 1DE4B 4JFQB 1XF2A 3ULVF 5E1AA 1HQRA 4NCC2 5IHUH 3ZHLA 1K6QH 1I9RH 3KYKH 2QHRH 5JZ7D 4U1SA 2F54D 1WF5A 1BQLH 3Q2CA 2Q3AA 2X4PB 3DUHA 3BPOB 3UDWA 4ZYKA 5IESH 1MVUB 5D5ME 3V0VA 5HPOA 2QADB 5IT2L 1TZHB 1F6AA 4I3RH 5E4EB 3FZUD 1DBKH 5HHXH 4J1UB 1I3GL 3BUYA 1HEZA 3TCLB 5IW6A 1YEKL 2V17H 2BVTA 5LGHL 1RZGB 5IJVA 2WK2A 1AGFB 4HUUA 1NGWB 3ARFD 5A2IH 2FECI 3W11D 3K2UH 1MRDL 4YPGB 3TA3B 5HXMA 1XGTB 2WP3O 2XKSA 5DD1H 4LSUL 5L0QC 3KLDA 4NKDA 2BY2A 3WD5H 3RWDB 2AV7A 4AG4H 5AAMA 1V7NL 2YHGA 4P2QA 2JJVA 1NEUA 2IALB 1WZ1H 2VLJA 5E2JA 4CMHB 4XPTH 1CK0L 3ULSB 1BOGA 1Q1JL 3DVGA 1S9VB 1FFOA 4RGND 3HI5L 1S7WB 3BPNC 3QUZD 3RNKA 4DN3H 2RR3A 2AJSH 4M9PA 3ARSA 2NX5B 4OCWH 4I2XB 1CXFA 5DGQA 4MNHA 1FVCA 3MODH 3MFGB 1TFHA 4PJEB 1MCQA 3U7WH 1WISA 3BI9X 1DVFD 4KKNA 4ZOAA 3KWWB 1HQ4B 3L3DB 4P49A 2IPKB 1AHWB 1HKLH 4UU9B 4G8FA 4S1QH 3MSPA 5IF0A 1U91A 2Q8AH 1MFAL 4QEGA 3LKPB 3D69B 3UJIL 2LABA 4X7EC 2ZCLL 3P4MB 3QA3B 1N5AA 3I9GH 2UZYB 2MPAH 1C5BH 1CK0H 3QWOA 1CG9A 2W38A 5IIEA 3QXAA 4C55A 5E2WL 4G42A 4K3HA 4DKFL 1KJ3H 4UV7H 5T3XE 2V5MA 4MZ2A 2GAZA 5EUOE 3AXLB 4LLQB 3FQNB 4PP1D 2HJKA 4OCXL 1RZJC 3DX6A 1S9YA 3BJLA 3JVGC 4IOFD 1KJVA 1QRNE 3TA3C 3M8OL 1F58H 4ODXA 4R90L 5B3JF 3O3AA 1T7WA 3SGDH 1K8IA 2XG5A 3AY4A 4J3OC 5FKPB 4X7SL 3SE3C 5H35B 3TBSB 1NAKL 5C2BL 5DSCA 4EDXB 5IMMA 5F8QC 2EDQA 3RUGF 2ZOLA 2MPAL 4EQ2A 3RQ3A 3SGEH 1XGPA 2LAGB 3HZVB 3LV3A 1GYAA 4LCWB 5T3XD 3MREA 4L1HA 4Y4KD 3KPQA 1TNMA 4JE4B 4NT6A 1INQA 4U0QB 1AXTH 4Y5YA 2D7PA 1T5WB 2EKSB 1T0MB 2V5YA 4I4WA 4S1DC 4TPRL 2BDNH 5F9OL 3WE6A 2G75B 5DJDB 1K8DB 5I1KL 1MAKA 5BZWA 3UTZA 4HMCA 2GCYB 3IF1B 1FYTD 5GGSY 2VITB 2E9IA 4KV5E 2Y6SD 3WFCH 1A7PH 2ARJB 2BVEA 3MYJA 2Z8SA 2Q7NA 4MNQE 2BVUA 2BOBB 2QEJA 4HIHA 2GJ6E 3FN9A 4ETQA 2AI0L 1BLNB 1P1ZA 2DD8H 4Y5VB 5FO7B 5CEYB 3SY0B 3LKRA 4JFFE 5FYKU 4ZXBD 3QDJE 2VZ3A 1PGRB 1DVFC 1U8NA 4H1LH 1VHPA 5I8KH 4X7TA 1OWRM 1VDGA 2UZXB 4HEPG 4RGNB 1MJJA 4H0HB 2HFGL 1C08A 2CK0H 3BH9A 3L3IA 2AV1B 1LO4H 25C8L 3C60A 3I50L 4RNRB 3E6FB 4JCMA 2Q87A 5EH1A 1CLYH 4ODWA 4JPIA 4OBSA 1E6OL 1RK1B 3S3PA 4KXZI 4KUZH 4WUUA 4JAMB 5D5MF 4JDVB 4PFEA 3ILQD 5IQ7H 1A5FH 4LEOB 2CLZB 3F7VB 3ZYOA 4F9PC 1MH5A 2GJ6B 2VC2L 3CFJB 4OD1H 2OZ4A 1T1YB 4NPYA 4NCC1 2FATL 2LU7A 4GJTB 1NEZA 1MVFA 3ZYJA 2D7TL 1DCLA 4KQ3L 3DHJA 1J87A 1Q0XH 4PJBB 1WBYB 4U1HB 4XCCH 3TBWA 5JHDD 2DWDA 4QRTA 4X4XB 1H5BC 1NFDF 1LO4L 4UQ2B 1BF2A 1J0YA 2I07A 4QTHA 5GZNC 1A1OB 5EZLB 4YO0A 3V5HB 4AL8H 3GMRB 1II4E 4U1IA 1DN0A 2OK0H 4M02A 4NNYA 4BFEA 4HLJA 3QQ4A 5GJSH 4P2QD 1A1MB 1EEZA 4QKXB 4TNWF 3S6CA 4ELKB 1QACA 3LD8B 1IL1A 2FNBA 4WEMB 1DQQA 4E9LA 2DQGL 5D1QB 3S5LA 1MCPL 2AXFB 2IAMA 5FYLD 1IM9A 1DLHB 4Z76B 5EO0B 4S1DD 1KJMA 2YD8A 35C8H 4LSPL 4Z78A 3UAJC 4QRQB 3SOBL 2PXYA 1RIHH 3LAFA 1RVFL 4XC1L 3N50A 5HYSB 3ET9F 3IDGB 4IMKA 2PETA 4HC1A 2BHZA 1Z9SA 1IQWL 2Y07L 1X5IA 4JM4H 1W0WA 3ZSTA 3W9DB 3TBYA 1MEXH 4JM2D 4P9HH 5ICYA 1LD9B 4D0DB 4ZXBC 3WIHL 2VISB 3VRJA 1EZVY 4RAVB 2NY2D 4Q6YA 4PJ5D 3KXFB 5DVMA 5E03A 1R3JB 1R5WB 3HUJA 1UH2A 3HTLX 5ANMA 3K1KC 5IG7A 4BJLA 4YHOH 4RFEA 1I3GH 3HNTL 1OPGL 3FQUA 1ZGLA 1LK3L 4K7PH 4N0RA 2DM3A 3F12B 4DAGH 2BP3A 4AENB 1NANI 5JW4R 2XNAA 1NCWL 2AJZA 2VLME 4JM4L 4FQIH 1NFDE 4L3ED 2BNUA 4ODTL 2DM4A 1GC1L 4NC1C 4G8IB 2RGSA 5L8KB 1P5VA 5DHXB 1QRKA 2PTTA 3RA7H 4E42A 1YEFL 3TYGH 1RZJL 1RMFH 1S3KL 3V4UL 1LP9B 4OUUB 3ULUF 1YUHB 2O5ZH 5HI3C 2UY7A 5D7LE 3J8F7 1CE6A 3NFPA 3ARBD 1SJHB 1F4HA 1YA5A 5T3ZL 4GBXD 3FZUC 1YQ2A 1QR1B 3RIFK 2YN3A 3ULUL 2VDRH 4JFEE 4LIQH 4MSWB 1IGIH 3BP6B 5T33H 4KRPD 1MIEH 3N1QC 1R5WA 4UB0L 4CN1A 4JPVL 1I9JH 1EEQA 4KAQH 3FT2A 2VIRA 3PL6C 1AGCA 2ZPKL 3O8XB 2EE6A 2X9YA 4M1GH 1IRAY 4M7LH 1HDMA 2VH5H 3P4NB 4PV9B 5TE7L 5I17A 4QRRB 5K93A 3QZWB 3G5XB 4IOIA 5ICYB 3IFOB 4FQLL 3LVEA 2B20A 3SDXE 4NO3A 1RMFL 2D0GA 3GSOB 4WU7B 3VXSB 4F15C 4I0PD 3MRJB 1WUNT 1LO2L 1U6AL 4RQQB 3KHQA 4RGNC 4YQXL 3HMXA 3FOMA 3QUZC 2O26U 2Z8WC 3O0RH 4K2UH 2O93L 4XNZC 2A6KB 4ORGB 1XZ0B 3P4LA 3X13A 1GVIA 2G60L 2NY2C 5CFHA 5LBSH 3GSUA 2WIIB 1DQML 1GGIL 4XNYH 1OW0C 3D39B 4OZHE 5L9DL 1UA6H 2A83B 2LU3A 3ZDZF 1AE6H 1GGUA 2X4RA 1IARB 1D6VL 2VDQH 1MY7A 4I48B 4KTDH 1FC1A 2EDNA 2R2BB 3QG6B 4YEEA 5KSBB 1A2YA 2OL3B 1VENA 2IBBA 1FSKB 1VGEH 4BKLA 1RAMA 5BJTA 3BE1L 2NW3A 3L95A 4U1IB 3VGGA 5AUMB 4PGDA 1DLFH 1CLOH 1A6AA 2ZZUT 4QTHB 5IB2A 3MV7A 3BP4B 5I1CH 3QEUB 3WS6C 5E8EA 1MFNA 2PCPB 4XNQA 1WWBX 2ATPA 2O5YL 2P8LA 3ARQA 4WWKD 4DFIA 1U8PA 5GSRA 5BCAA 2G60H 2W0KA 3BRDA 4P2QE 3ARDB 4GW1B 2VXQH 1VGKA 1P53A 2NY5C 2EE3A 2YD9A 1BBJB 5DMKB 2I24N 5JHDB 4HZLA 2OJEA 3KPMB 5F21B 3O4OB 3RKDC 2E8ZA 2WSKA 4JAMA 4H1LA 5ESAA 2FX7L 5IK3A 4LSSL 1MPAL 4XP4L 4EXKA 2VLRD 4NQDB 1DVFB 3VFTA 2G2RA 4ODWB 2PXYD 3LS4L 2VLKB 1Q38A 5FV2A 2XKNB 5B8CA 1MJUH 5IVXA 1WAAE 4S1RH 3S88H 3QO1A 1OY3B 4CW1B 2CKBA 4E41E 3VA2C 5EBGA 4G7YL 4F2MA 5EU7E 1U8NB 1LDPL 1Z3GH 3EO0B 4M3KB 5HYQB 5EWIH 3O6LH 5IUSA 4I5BA 1FL6A 4PIRF 1YMMD 4NDMB 3FL7A 1U36A 1F8TH 4Z7VE 5CEZH 1G7LB 2KQNA 3G5YA 4ONGH 1CFSB 5DUML 2X4TA 3F7PC 3MJ6A 1F6LL 1BWMA 2XG4A 5T1KD 3PQYD 4CVXA 4K3GA 1FN4A 3ZKSD 3HI6L 4X6DE 2B7DT 1LWRA 3CNKA 3FRUB 4M8QA 3U1SH 4FZ8L 4LSRL 2ID5A 4XP4H 4KK8C 3LQMA 1ORQB 3CMOH 1JI2A 4LVEA 4Z95L 5L8LB 2JIXB 1A22B 3IRPX 1DZBA 3U2SB 1HNGA 3QDMD 2QLVB 3RIAK 2EIEA 4OLXL 5ICXA 4FOMA 4R96B 4MXVF 2V17L 2EKSA 1MFBH 3MUJA 4QWWC 1XF3A 1QA9B 4BQ6A 4J3SA 4G8GE 4MWFA 3ARPA 3HN3A 1FYTB 2VXTL 3Q1SH 4Y2OA 3HHRB 3PV6A 3PWUB 4TSCL 4U1NA 4Q9QL 3MZTA 4S0TD 4YIQB 1LDPH 1Z3GL 4L3EA 4WW2A 1DBMH 2DDQH 2WUCL 2K3TA 3ULUE 1AI1L 3GRWL 4OF0A 4G6AC 3MYZA 4WHYH 3SKJH 4DKDC 4N8CH 4OFIA 4OLZH 3V95A 4YR6A 4PRNA 3C08L 4EKXA 1N2RA 1SMAA 1J11A 5BO1H 1FAIL 3C9NB 4HIIA 3QFJD 3VXUB 3SDDB 3ZT5A 5E7FA 1XFPA 4RISL 4PGBB 2VXVH 4UV4H 1EFQA 2HFFB 1CGSH 2IQAB 2Z9TA 2AJVH 3BD5A 5EOCJ 3T77B 3WXVL 1UZ8B 3JV0A 1JRHI 3K46A 3SJVB 3S96B 2CMRH 5IEHB 4LMQE 3QI9A 4G8GD 1CGYA 1C16B 5E4IA 5CJQL 3V0WH 3ULVE 1F4YH 5K9JH 3WDHA 1FHGA 4NQXA 3ELAT 1MRCL 1P7QD 4PJ8B 2ZCLH 3K1DA 1OM3H 4JFPA 3P9MA 4JFPB 4DKEL 3WO4B 1RUKL 2H2PD 5F7WC 5IR1B 5IVXF 4BFBD 2FRGP 3BFOA 3G04B 4PY7B 4HEME 3PV6B 3PWUA 4PRDA 3P77B 4OCLC 3NIDF 3QH3A 3B9DA 1ZANH 2YUXA 1DBBL 3D6GA 5JLZA 5ALBL 1XF3B 1U3HC 1QSVA 4DAGL 2AEIT 5FUOL 3WXVH 2X9XA 3H9SD 5J6GB 1AH1A 1RUQH 5F89B 1CDGA 4PJ9D 1UZ8A 5L0QB 4ZSOA 3G9VA 3JBG7 4M9OA 1S7WA 4PJAE 2GT9A 2HFFA 4XMLH 3SDCA 4HWZB 1AKJA 3FB8B 4XGZB 4QGTA 2ADGA 1BFVH 1JF5A 3RWGB 1K9TA 4LKXB 2IH1A 4Z5RA 4KDWA 4OZIB 1T7XA 2LV4A 3LSOA 4C56A 2I25N 1LGVA 4P23B 5ACLA 1RZJH 2EDEA 3G08A 1V05A 1MLCB 1HCVA 3LRSB 4L4VE 3FO9A 4NQVA 4JN1H 3K74B 2FEDD 4NKOA 5IB1A 5J13C 3GM8A 4P2OC 3PNWB 4JKWA 5IMLB 3WLBB 3UPRB 5IW6B 3S34H 4YXHH 2P46B 3RWFA 4EJ1C 4NN5B 3BUYB 1LO5B 4U7SA 4HKZB 1EJOL 5HHVH 3SGJC 5DZLA 5DQJB 4WI7A 3PP3K 1AIFB 4JO2L 4KC3B 1KJ2L 1L0QA 3AREB 3QEGH 3UTPE 3UZVB 3BKMH 1SMOA 3E8UH 5IJKC 5I1EL 5JHDA 1YJDL 5D93C 4GKSA 4M7LL 3VFGL 4TVPD 1G0XA 1GCFA 4JFZL 5T1MA 5IBLC 5F88B 5C6TH 3FN0L 1YEIH 1HHHB 5HGAA 5E94B 4YBLB 4BQ8A 5DRNB 3A6BH 4UT7H 1IT9H 1XGQB 1JFQL 5GS1B 1T66D 3OB0K 3OTTA 3O9WB 1QFUL 4GAJL 3MV01 4ISVB 5IB5A 5GGTA 3RJQB 4M6OL 3S34L 3SO3B 4DUVA 3QUXD 1A6AB 2WV3A 4JPWH 2J8UA 4HH9B 4PGDB 1JZ2A 2QL1A 4PRIB 3MPCA 3SQBA 4CU8A 3U0TB 3UZEA 4RX4D 2VNCA 2W65A 5E00B 4HWBL 5JW4N 4I3GA 1EPFA 4Y16B 4DK3A 43C9B 4PJAA 3BIKA 1YPZF 2B1HL 5LGHH 3NZHL 2DI7A 2HA1A 3LZFL 5CCKH 5J4MA 1JV5B 5KSVB 2IBGA 1U3HD 3CSPA 5CJOH 4JG1H 2LQRA 1RJZB 3HAEB 4J23A 3BJ91 1BBJA 3V6OA 2IGFH 4UTBL 3BRGC 3GNMH 5JIKA 1D5ZA 5DI8B 1VGKB 3VD9A 1BP3B 4NQED 5DRZA 4UT7L 4L8CA 2D0FA 2DYPB 3OAYK 5D2NA 1J1XH 2R1YA 4I9WD 5GSRB 1QSFD 2EO1A 4ZNEE 4HPYH 3MRJA 3O4LE 3IAGC 3QUMH 5HBBA 3HI5H 4WU7A 4XNQB 3B9KA 4NBZB 2WBJD 3LH2H 1NCUA 5MEPA 2LFGA 4HIXH 5EOTB 2GTWB 4JCLA 4PRHE 4OV5B 1RZFL 1NFIA 1FLRL 4Y2DC 3SGJA 3RPIA 3TP4A 4WW2F 4UT6H 2J7LA 4UNUA 1KTKE 3REWB 1UC6A 1FNLA 2XTJE 5DJCB 2IG2H 1UJTA 4PS4H 4G80B 1S7RA 1L9MA 4JFED 1QR1A 2BCKA 5INCB 3TF7C 1I1FA 1SJHA 4TRPH 4NRYA 1HINL 1NSNH 1NFKA 3IFNH 3LEYH 4KDTA 3WNMA 1WBZB 4XCFL 1MUJB 4X8XA 2YRLA 3RL2B 1W72L 1RIVH 2R2CA 3MOBL 4CN6A 3DNKA 2Y72A 4ONGL 2HP4A 4WWKC 3BEVA 2ITDA 4OFYD 2IH3B 4APQB 4AIZB 2N1KA 4OLEA 3BVNA 3EYOB 5IW1A 3IT8D 3AAZB 5GRUL 4PJ8D 3HMXL 4JO1L 3CFDA 1CWVA 2VQ1B 4XP6H 1OGTA 3ARGC 4GT7A 5C8JB 5CINH 2VIRB 2IAMC 4OCWL 3QUXC 3Q5YA 3PE9A 2E7CA 4XHJD 4AENA 2MWCA 2V5TA 5C2BH 2VDML 2QR0B 3IDJA 5EU6B 4EIZC 4KK6C 4TYUA 3QQ9C 1XIWD 1DN2A 3TNMA 2PXYC 5HY9B 1KIQB 4HBCL 2VAAB 1HHGB 5D7JA 3BZFA 4LPCA 4WTZG 3MUHL 5KBNC 4O02H 4OCSH 4QRRE 1QSEA 3IETB 1IGFH 5C07B 4JDTL 4ZOEA 1C12A 3SDCD 1WBXA 1TLKA 3K7UA 3CC5A 2JJSC 2AJUL 1OGTB 2JJUA 4G3YH 2XN9B 3CFDB 3C5ZA 1B0GA 5ESQB 3LRGA 2GJZA 4CMMA 4D0DA 5C08A 5JOPD 1FIEA 4XNUH 5F9OH 3IU3B 4BSVA 5I1LB 3HMXH 2WWMD 5F1SA 4GUPB 2Q6WB 4UV4L 1Q9OA 1PBYA 3RAJH 3TT1H 4EN3B 3RNQA 2GJZB 1DQLL 3RL2A 2P8PB 2CGRL 1NCDL 4OCYH 5BVJA 1EDQA 2WBJC 1BQHA 2HAZA 3WIHA 1C12B 3MRDB 2JE8A 2AI0H 4Z78B 3P0VL 4ZAKD 5I1IH 2A9NH 3OJDB 2HH0L 2AEPH 1FNHA 2F53B 3I2CL 4QY8B 4K9EL 2AXFA 4RFEB 4X7SH 4HGMA 4OB5H 4DGYL 4JFXA 2FJFA 5AD0A 4P46D 2J12B 3KR3H 3MCLL 3ISWA 3REVA 1ZVSB 2K7PA 1TQBC 5C0GA 4ZODA 1HWHB 4RAVA 4Q0XH 4MA3B 2GTWA 1RSFA 5MEPB 3BVNB 4YH6A 3S35X 5JQ6L 3MZGB 4NFDA 2P5EB 3VI4E 2B39A 3TO2B 4JRXA 1WBYA 1R24B 4TPRH 3VG9C 3QUXA 5F6HI 1QLEL 5F44A 2R1YB 5J1SC 3T4AA 4NUGH 1XMWA 2ZOKB 1A7OH 3GO1H 1IEHA 1IAOA 1MHCA 1MH5B 5D7IE 4MXWH 4Y4FD 3HAEA 3L7FB 4OM1H 1HCFX 1IM9B 4LVOB 5ID0B 2V2TA 5EZOL 3QCUH 4LLVB 3O11A 5IROC 1PG7W 1XIWC 2PYEB 3QNZA 2PKDA 43C9A 5I8KL 3BXNA 3OBAA 2ZSVA 2FR4A 1D5IL 3MRFA 1MNUL 5DRWA 4R7NA 5F1NA 3VJ6A 4HUKB 3BHBB 4DZ8B 1OGAA 4ZUWB 5T1KA 3GHBL 3JWDH 1FZOA 4NSKB 3VWJB 1UCBH 1F4XL 4DW2L 1H8OA 3KJ6L 4ISVA 4B7IA 4E41D 2DOCA 2DQFA 3RWIA 4J8RA 1JMZA 2QSCH 5JDSA 4Z77B 4HS6A 2DBLH 2C4FT 4PUBL 4GS7C 4P48A 5T3XL 2ATKB 1I3VA 5HGAB 4O2CB 2DYPA 3E3QE 3FT4A 5F7EL 4LSQL 5DQDL 1XF5A 4GQ9H 4KZDL 2YSSA 4NCDA 3MLWH 5C9KA 2C5DC 2OM5A 5C6TL 1BECA 4JDVA 5DYOB 4WUUB 3AREA 1AC6A 4ZAKC 3BDXA 4M62H 3IB4A 1MJUL 1E0OB 4Y5YB 3P11H 4NKQB 3MNZB 4M7ZC 3DROB 2J8UF 4AL8L 3NIFE 3D48R 1VEOA 1B6DA 3LKSB 2Y5TA 4LPXA 4NKOB 5IB1B 2EEBA 1RZ7H 3VFVB 3GIVB 2FGWH 3VXSD 4I3SH 4RMRA 5D7SL 3KPPA 5EC1B 1M71B 3G08B 3RPKA 3MNWB 1DR9A 3BUTA 1KB9K 3WN5C 3LKRB 3DUUB 5DRNA 5C0CD 5DJ6A 3GMOA 4TVPH 3LZFH 4PB9L 5JUEL 5CCKL 5I1GH 2PTVA 2DMBA 2LAAA 2BOBA 2FDBP 4ODVH 2ADGB 3QUYC 1MJ8H 5GGSA 1BJ1J 4NHCH 4GLRH 4XBGB 3RBGA 4G9DB 3P9LB 1QLRA 3UTZB 4L8SA 4UTAH 1JGVL 1FIGL 3IDNA 3QZWG 3CDCA 1HWGB 5HPMA 2X70B 1U8KB 3DX7A 3FQNA 2OXHA 4APQD 5EU6D 1J0KA 2EEDA 3TBVB 1SJEB 1AXSB 1XCQA 4GAGH 5A40E 5JLZB 4XVJL 3QXAB 1G7QB 5TE4L 4XWOD 3ZHKA 5DK0B 1CFVH 1JIBA 4HF5H 3BKJL 1MWAA 1P69B 1U91B 4J3VA 2ERJB 4JJ5B 1ZA3A 2VDRL 2ZKHL 3LSOB 1T80A 2OR7A 4P5KB 4PS4L 3MA9H 1NC2B 1JN6A 2IH1B 4Z5RB 1GIGH 5C0DA 4IBLT 2MMXA 2VSCA 3MROB 1JGVH 2GT9B 4LCWE 1QPPA 2CMRL 4GAYA 3NCCB 3U9PH 4ENED 4OD3H 2NLJA 4FXLA 3VFNB 3GMNA 3SJVA 1ZV5A 2EYTA 3GMNB 5CZXD 3RX8A 4RMVA 1MELA 1YYMH 4MLSA 4KDVA 4PGBA 4ODTH 1MRCH 5D71H 5E2UH 3SEPA 2IALA 4WW2C 3CLEL 3C9NA 4RBPK 1CBVH 4P5KA 2DYPD 4WY7H 3UTTB 3V4VL 4PY7A 2R4RL 4M4RA 3U48A 4X9BA 3T3ME 1ZA3B 4XP6L 4PRNB 3FFCD 2X4OB 4HV8A 1DUYA 2X1PA 4XP9L 2YPLA 3H7LA 3QUYA 1FORH 4N90E 2Z4QB 2IPKA 5FAAA 4MWFB 2CLVA 3B9VA 3WFBL 1KENL 2VZ1A 4KI5D 4Y19D 4XBEL 2J4WL 4IOSD 5KS9F 4G8EB 5EBLA 5I8EB 3IDXH 4I2XA 5K59E 2KKQA 1OTUC 4GXUM 5HPMB 1AP2B 2VXSL 3FN3A 3V5KA 2IQAA 5CUSL 5L2JB 2CRMA 3KPLB 5FDWB 1AY1H 3WKNA 5C0CE 2X4TB 1UM5L 4KMTL 1KCUL 1UXSB 3DURB 3QXUA 1K6QL 4NDMA 3SPVA 3RFZC 1DQTA 4L3AA 1FG2B 2AP2A 1NUNB 4L4VA 2OX5A 1ZSDB 3DHMA 4N5UA 5H94B 1DBJH 5DS8B 5C0RL 4HUUB 1MHEB 2F5BH 3M17B 3ME0A 3VWKC 5DEZA 4XHJC 1U3HA 3DROA 4X6CE 4YEFA 2VSDA 3I2CH 2XKNA 3CDYA 5FUZL 3LPWA 4JO2H 4S2SA 1M7IA 3DO7B 1AR1D 4NQDA 4HXBH 4NQEA 4WUKL 3STZA 1U41A 1BQSA 1TZHA 3VMOA 5C0IB 3QBTB 2W9EL 1KXQE 3SDCC 1ORQA 3ARFA 1EHLH 2B5IC 4OLVL 3X12B 2EECA 3S36H 1A4KA 1QHPA 3O3EB 1HQRB 3CZFA 3GK8L 2H8PB 4KPHL 3PXJA 4K8RC 4RWYH 1N8ZB 4P2OA 3VD5A 4NO2A 3NA9L 4MQSB 1PLGL 5SWQB 4PB0H 1U92A 1RHHB 3I6GB 4KTYA 2EDKA 2L7JA 1OGAB 1A3LH 2ZUQB 1IFHL 4WUUD 5FM5M 1MCHA 1L4IA 1X7QB 3TIEB 2F8XC 4M6ML 1A2YB 3RUGB 1JHLL 4Y4KA 3NH7H 1T4KA 3W5NA 3VFWA 3MV8E 3ZDYF 4P46C 1G7PB 5F3BA 4Z0XA 2FEEI 5FUCE 2UYLA 2R1WA 2F5AH 5MENA 3G6JE 4PJ9B 2UVEA 3V6OE 4A6YB 1MHCB 4WI6A 3MUGA 5A2LH 4MLIA 2A6KA 4MDIB 4UINH 3T4AB 4EEEA 4M7LT 1R3KA 1T5XB 1J0HA 3O3BA 1KELH 1NLBH 3VFMA 1U8PB 2RHEA 5D2LA 1NCAH 1CDUA 1VFAB 2ATPB 5GRVK 1RZIA 5ADOL 3H7BA 3TO2A 4LSVL 4BYHA 1KXTB 1NDGA 4MX7B 4TUJA 5FB8A 2OBGA 4PGCB 4Z7UE 2ZUVA 5IB2B 3GB7B 4UMGA 4PV9A 5FF6B 5LKNA 1IAMA 2VR9A 2WW8A 3H3BC 5AUMA 3PGDB 5EULV 3ARRA 4OIIL 1FNEA 2HJLA 4ETYA 1ZLSL 1P7QB 3NAAL 2IF7A 3MV7E 5F72S 2AERT 1HIML 3AB0C 4XB8A 1GZPB 2DMCA 1YEGL 2DM7A 2X4UB 3MRIB 4P2YA 1U8QA 1UQSA 1BQUA 2K7QA 1RK0B 3EFFB 4O2FA 5DF0A 3KYNB 5EU3B 4TRPL 3X3FH 4TSCH 3QDGE 5TF1H 3QUZA 3T2OA 2EZ0D 3DWTA 4HWBA 3MRDA 3FT3A 3PHQB 5E9DD 1X4ZA 2KDGA 3LQZB 1YZZA 1P84J 3WCYA 1CGUA 4WO4D 1OP5K 3VD7A 1OAUL 3K4AA 5CBEB 2PTTB 4E42B 2N56A 5HD8C 2ED9A 3IFOA 4ZD3H 4OF3A 5I17B 1YEHL 3P4NA 3CX2A 2MCPH 2PO6B 4LLMB 4BQBA 1UYWH 2BSTA 4RA3A 5D6CA 1X4YA 3DGCR 3VMPA 4P46A 2ZUQC 3SKMB 5FECB 4H5SA 5BZDB 2NZ9D 1JPST 3QQ3A 3FHAA 4HBCH 5CJQH 4KHTH 3WLWD 3QNYA 1U3YA 1WWCA 5EU7C 3D0VA 5DRXB 5TDOB 2JIXD 2MCG1 2FBOJ 3HNVL 4Y1AA 5KSAD 2GTZB 1LEGB 2WBKA 3L3OB 4WI5A 1C5CL 3U46B 2V9QA 1YYLL 4XAWH 2PN5A 4P2RE 5J6HB 1TZGH 4KGLA 3OKLB 3IS1X 4CVZB 2FBJH 4JEGB 1UQSB 2BMKA 4KVNH 1YECH 3RVXC 3KNBA 4KKCC 1EO8H 5D1XA 1RFDL 4V2BA 1DBBH 2IH3A 4Q58C 3MRGA 4JZOA 4LPUA 5DO2D 1A1NB 1NL0H 1S7VA 2DJSA 4NN7B 1CLCA 1WBZA 3S5LG 4P59L 4MD4A 2FATH 1RULL 3MTRA 2AK4A 2PYEE 3H7BB 5BOZG 4XMLL 4APQC 1CR9H 3CU1A 2R0WH 5JPMB 5F8RC 3VFOA 1QFUH 4I77H 1DLHA 4MDIA 3S5LB 4ELMF 4N1EA 2A6IA 1GH7A 4WFHD 1UWGL 1UEMA 1N0LA 2X44D 2BHYA 5HHMD 1BIIB 1WCBA 5DEGB 2UYLB 5FYLE 5C2UB 5F3HB 1JPTL 4Q97A 2DM2A 1FORL 4HUVB 4GSDL 5ACZA 5EZLA 2JCCF 2DTSA 4KJPD 3UJTH 2FO1A 2AJXH 3LHPH 3CD4A 3S3JA 1A7QH 4QXUH 3VDBA 4JQIL 3AS3A 3QXDA 1W0WB 5CD5C 1JHTA 4KVCH 5CJOL 4PJBA 4U1HA 2D7NA 3L3KA 4EI5D 4XXDA 5HD8D 3F5WB 5GGUA 4Z7QE 1RU9L 4JFYB 1E6JH 2GK0A 1JYWA 4X4YA 3SQOH 5E9DA 2ADJA 4MA1C 2VKXA 1BJ8A 2YWZA 4RMSA 4JFZH 2PW1A 2Y07H 1RJZA 1NGQL 1HI6B 2E8YA 1AY1L 3BGAA 3CVHA 4YFDB 4FTVD 5DT1L 3SKOB 1KB5H 2VDKL 4QCIB 5MP6L 1KFAL 1IGJB 1DQQB 2WM0A 4JREB 2FEEL 3PDGA 4UOJA 3VRLE 3FMGH 4HUNB 4F9LA 4DZBA 2N7BA 5E6ID 4TTDD 3CK0H 3AMKA 1DN0B 2Z0BA 3FO1B 5DHYA 4NRZB 3AU1A 4PR5B 4U1JA 3VXRE 1OHQA 2D7MA 2UWEE 4LGRB 5I16A 1Y6NR 1EBAA 3NIGE 4ONFL 3QI9C 3GSXB 2D31A 2B1AH 1RD6A 3QFDB 1AO7E 5CSBA 4AQOA 4PG2C 4ZNCD 1CIDA 4OJFL 5CEYA 3SQOL 1CE1H 5CWSA 2XRAL 3AY4C 3MNVA 1OTUD 1W0VA 4NPYB 3ZT7A 4HKBA 5IM7A 1GSMA 3X3GH 3SO3C 4X8JB 2IGFL 1NFDB 4UTBH 1LEKA 3IF1A 1BPVA 1EEYB 5GS1C 2AXJA 1QHOA 1ZMYA 3GSNL 5DJDA 5FKAB 1BD2A 5IVXE 2F58L 1FNAA 1R5VB 3VGAC 1AIFA 4AEFA 3WEXA 4JPIB 2NTFA 1QKZL 1T0MA 4LF3B 4M7KL 2Y1VA 4P23D 3TYGL 1FL5B 5DC9B 4FA8A 1MJ7H 1T89A 4JG0H 4ZPTB 1QFWL 2J5LC 3VG0L 1XGRB 3VI4F 1FFNB 4WFGD 5FHBL 3WFZA 4PJDE 4W4NA 1MJJB 5F1OB 1W0YT 2PYFA 4UT6L 1KN4H 4OZIF 3P0YH 1MLCA 3NFSL 2VUYA 3NH7L 2YR3A 1U95B 3CAFA 5A2JH 4NN5C 1EVTC 4KJPC 3QUYB 3I6LE 4DOHB 5HHPA 4YPJA 1K8IB 1UXWB 4HV8B 3QDMA 4KAQL 3WJLA 3MYJB 2NCMA 3BW9A 4RGOL 5TE7H 4LPTA 4PLOB 5CZKA 3K8KA 2VR5A 4ERSH 4DN3L 1S8DB 3TIDA 3AXLA 4LLQA 3B4NA 4KMLB 3L1OL 5TQ2H 1BZ7B 3VG0H 1UCTA 4H20H 1BVKB 2EYTB 2DTML 4HWUA 1Y6KR 3N85L 5A2FA 3VGAB 4BZ1H 3HB3D 3QA3A 1P4IL 4X9HA 5I8OH 4OIIH 3MRHA 2Q7YA 5EORL 5F7KC 4KTEL 4NWUH 4JHWL 5F1IA 2V2XB 5E5UB 5IF0B 1I8MA 1AE6L 3SCMD 5DSCB 4UDTB 2XICA 4YDLB 1JGLL 3IXAA 1I8IA 3QI9D 4U4BA 2R4SL 3KWWA 4ZG1A 1I8MB 2H6PA 5E8PA 1M7XA 3WO4C 3P2TA 3O3AB 4PRHD 1CL7H 3JWNC 4PRID 2AABH 1L9NA 1I7ZA 2ICWI 2NX5A 2MKLC 1RJCA 1QFOA 4OKVA 1F11A 2CRZA 4KUCD 3RNKB 1SJEA 1XCQB 3BD3A 5IV2B 3NACL 5TDPB 1INEH 2DICA 3ORJA 4XNUL 1MRFL 1WZLA 1JHKH 5J13B 4P2QB 5F6HJ 2R0ZH 1EEYA 1YEEL 4LVNB 4PJCF 1I3UA 2MCPL 3JVGA 3V6BR 3BW9B 3MGAA 4YR6B 3RU8L 2M8XA 1V7ML 1G84A 5TGBB 4LEXL 1F3RB 5CWSB 4MJ6A 2P7TA 3QIWB 4HSQA 1T6WA 1KC5L 1UH3A 2Y9RT 1FYTA 3UTQA 3TCLA 3ZDXF 4IMKC 4XBEH 3KPPB 5ELIA 5T5FL 4OF7A 4I13B 1CICB 3GSXA 1P6FA 4ZAKB 5C86A 3B2VH 4H25B 1KEGH 1CL7I 3PABA 3VXUD 4E5XA 1F6AB 4A6YH 1DDHA 3ULVH 3KR3L 4NM8L 1JGUL 1F5WA 4WUUE 2CUMA 3UYPA 2Q86B 3LPGA 4DW2H 1U8MA 3TCXA 4WNQA 2FO4A 2FBJL 3MXVL 5EWIL 3O3UN 3TV3H 1YECL 3H42H 2D9CA 2HKHL 3PWJB 3VWJD 4CVXB 5K9QI 5L9DH 1UM4L 5F7NC 5DUMH 2Q76B 3BN9C 1XF2B 3GHEH 1KB9J 2GJJA 3MLUL 4OZFA 2DQJH 1NFDA 1NL0L 1UWEH 2D4FA 2EKJA 3L5XL 4MJIA 3U4EA 2GK0B 4PJFB 3AROA 2Y7QB 3KYOB 4B41A 2V5SA 5FUZH 5GGUB 4XXDB 1HZHH 3DARA 1DLFL 3CVIH 4J3XA 3WLWC 2I9LB 4X6EB 1XIWB 4OM0L 2G2RB 4TUKH 1Q0YL 3FHQA 2H2SC 5KSAC 4PR5A 2AJ3A 1WFOA 2XACC 1RZ7L 1I7UB 2OJEB 3C60C 1MNUH 3IJYB 4UQ3B 3QNZB 2ADFH 4G5ZH 5C92A 3JWDL 3RVXD 1SBSL 1EXUB 1UCBL 1YNLL 2V9TA 1IKNC 4HIJA 1CDJA 5ECJE 3SDAB 3GKZA 1HI6A 3SO5A 1DEEB 2C1PA 3EHBC 2P4AB 4DQOH 5CEZE 1ZLWK 3Q6FB 1RU9H 4XRCB 1DBKL 4KROB 3HG1E 1IAOB 1N59A 5E8EB 2WIMA 3IDUA 2AJVL 3K2MC 3ROLB 3MRRA 4KQ3H 3LKOA 4NN6C 4PJHB 2R15A 3MLRL 1CD8A 1FAKT 1OAXH 1Q0XL 4JFYA 4XCCL 4PJBF 3UROR 3O6MH 1J12A 3WUZA 2QV2A 3L95B 3L7EA 1R24A 3HNSL 4JZOB 2JJSA 3FQXA 1H8NA 1MRDH 2A74A 4UOW0 1OAZL 5KSBA 3C5ZC 4HUXA 5ITBL 1MCIA 2IANA 2HLFD 2HTLD 2IPUK 2OK0L 1MOEA 3MV8A 1CFVL 3ES6A 5I0DA 5DLMH 3WYRA 3F65A 4F7TA 3PWPB 3DXAB 5KS9B 1H3PH 3T0EC 2ARJQ 4CJ0A 1MHHA 5T1LA 1KELL 4MJIE 3AGVA 1ZLVH 1FNGB 4PJ5A 4LSPH 5C0BB 4O58H 4LSVH 5JPMA 1NBZA 2OYPA 4RDQG 4XC1H 5FOBA 1MI5B 4KZEL 2AK4B 3WS3A 3NN8B 3V6OC 2H32H 1IQWH 3T2QA 4O5LH 3LKNA 3HRZA 2W59A 5ABDE 1LMKA 3R8BB 4PRBA 1VACB 1GGCH 1W8NA 5JXEA 1NAMB 3B9KC 5IGXH 5D96B 3HE7A 1DEDA 3BP6A 2PR4L 1B0GB 5ESQA 1I7RB 5GRWA 4XX1E 3B3IB 1WBXB 2VR4A 5ALCL 2VLLA 4F3FA 3D85D 1UKQA 1QO3A 4JB9L 4L4TE 1VKXA 2NR6D 3E6HA 4MHHG 2GTZA 1YN6B 3UTOA 1OF2B 4GKZA 4YZFE 1K85A 3D0VB 1F3JA 4PRHB 5CAYB 2QR0A 1INDL 3IDJB 2J4WH 3CGTA 3MRIA 1AD9B 3SHSA 4S0SD 5F96H 1GIGL 1P7QA 1KGCE 1KNOA 2HKFH 3BWAA 2FECL 3MV7D 4CAGA 1ORSA 5JOPE 3C87A 3HRZB 5IGXL 3EYOA 3WFHB 4OTXH 4F58H 3FFCB 2A2QT 5C9JA 3WS3B 4WWKA 2VERN 5E9DE 1S7UA 5IMOA 5GRZA 3F12A 3WSQL 1JNLH 4R26H 5KAQG 1F13A 2NY2B 3C5ZD 3O41B 3UJJH 4XAWL 1OF2A 5HGHA 2AQ2A 3CXDL 1MHHB 4F3FB 1S9WB 2X4QA 3MRKB 15C8H 2ORBL 3FJTA 4ZFFA 3DECA 3V52L 2YUWA 5LWYH 3MV9D 3T0ED 1NLDL 2HT3D 4GAFB 1SJXA 2IAND 3JWOC 1JGLH 3UO1H 4HJGB 2QHLA 1PG7L 2C4FU 4EDWH 1FG9C 1NFIB 1EHLL 5JXEC 1UZ6F 4U6XA 3TO4D 3BH8A 4M3JA 3HE7C 1RHHA 3I6GA 4LAJH 5SWQA 3WSQH 4F8QA 5HGGS 3VXQA 4XRCA 1RIUL 2HFGH 3C09B 1YNKL 3CJJA 2CK0L 4CVWA 3BDYL 5EPMB 1ZGLP 3SGEI 4JFDD 1F2XK 1HYRC 2YMXH 2E7HA 2APTA 2VMFA 3VGFA 3CFBB 5DRZB 15C8L 3P40A 5DI8A 1IL1B 5T1LB 1OP3H 3RDTA 1E6OH 3D5OF 4A6YA 3D3VB 1ZHNB 3BPCA 1ODAA 4ZTOL 4R2GB 4PJIE 4LSDA 4QGYA 1NGXB 1QEWA 4DVBA 3ES6B 2YD2A 1JZ8A 2XQBL 4NQEB 5HYFA 4LASH 4PJDA 1PX3A 4KRPB 4UQ2A 3EBAA 1D3CA 4RIRA 3RWEA 4FZEH 1G7MA 3BKCL 5I66B 1U3HB 3GJFA 5C09E 1JGUH 2IPTL 3S9DB 4NIKB 4PTTA 2I26N 3ECBA 5D1QD 4HKXA 4X5WA 2I9TA 3PGCB 4HWEH 1IC1A 2W0PA 1VFUA 3U4EB 2ZJSH 1OD9A 1QVOB 1JF6A 3QT2A 1OTTC 4H0GA 3MJ9A 1NCAL 5SV3A 3N1FC 3N1GC 4L8BA 4OFDA 2CUIA 1HHHA 1SBBA 5BS0D 1J8HE 1EUTA 4ZTOH 1RK1A 2DQEL 4O4YH 5GGTL 3N9GH 2HTKC 4QLRA 1UWEL 1AC0A 3WL9B 1WFNA 2DQGH 3DIFA 5E56A 3S36X 2Z92A 3W0WD 1X5AA 2FH8A 4M6AA 1MCRA 3E6FA 2VE6B 3PP3H 1EBPA 2HVKB 3Q0HA 5AAWA 5HHXL 3RVTC 4G8EA 1HNFA 4ZPVA 3EJZD 1YJDC 4FRWA 1FL3A 1HSAA 2XPGA 5EN2B 3STLB 3JXAA 4KWUA 2VRAA 1CICA 3HPLB 3LDBC 5JA8B 1AO7A 2NPLX 2BHUA 2Y06H 4GW4B 2Z4QA 2BY0A 4PGEB 4C54A 3U6RA 4QOKE 2H1PL 4X0KA 4Y5VA 5FO7A 1T21A 2VB5A 1ZVHA 3SY0A 3QRFM 3QUML 2ZJSL 4F7CB 5T5NG 1DANT 4JANB 2CPCA 5C3TA 4YE4L 3HE7D 4FTVE 1RZFH 2MQ0A 1DUZA 2WUBL 3RDTC 2FX8L 2F15A 5BOPA 2AW2A 3P30H 4F9LC 3ILPB 3DRTA 2NY1C 3NPZB 4HAGA 3C6LD 1T22B 1K4DA 1E28B 1QFPA 3NMEA 3RVVC 4M7JL 3PWLA 4WNQB 5IMKB 4ODHL 3MLRH 1AD0A 4PJXA 1AKJD 1YNTA 3HZKA 3SKUD 3EOBB 4H25A 1MI5D 4XPFH 2AEPL 4C56D 3DX8B 2COQA 2EYSB 2JCCB 2ZG1A 3K3QA 4J3WA 3FO0L 3QIWA 2NY7H 2YPLB 3MLZH 5GGQH 2A6JB 3K4ZA 3BN3B 2X42A 1A02N 3U0PA 4ZFGH 3EFDH 5F1IB 5TGBA 3X3FL 5ESVB 2BOCB 3GI8H 5BO1L 2RJMA 1PAMA 4J6RL 6CGTA 12E8L 4HPOL 4NBXB 2P43B 1S9YB 1H8SA 5TQ2L 4OCXH 4YHLH 1OTTD 3PHOB 1A7BA 3A67L 2ESVD 5C7XH 2EO9A 1U8KA 5JIHA 1F02I 1YEKH 1V5JA 4Y5XB 2X70A 4KGJA 5I73B 4JY4A 3HZMA 3VXTA 1F11B 4MS8C 1IAII 5E8OB 1QFHA 1T0NA 2HTKD 4Y4HA 4QRSA 5J06A 5FCSH 4XBGA 3RWJB 4JPVH 3ZYIA 4YJZL 2EH8L 5J1AB 3VGEA 2NY7L 1X5KA 4G8FB 4Q74A 4HIIB 5HHPB 4AEHL 4G8GB 4LKCA 1J5OL 2O5XL 4EN3D 3EJZC 1WWAX 4XPHH 3SJVD 2JCCA 3NABH 5SWSE 4DKEH 1NMBH 5TE6H 1ZGLM 2XWBA 4IRJA 3OZ9H 2DQDL 4BK4A 4GS7B 1YY8A 1OAYL 5ALCH 5EIVA 4PJEA 3MRHB 1JPTH 4R4NC 5DVLA 5IB3A 2NX5E 5DK0A 5IFJA 1NCDH 1YMMB 2WLYA 4XTRD 5JHDE 4ZO7A 1QYGL 2HRPH 2HT4C 5K9OB 4H8WC 3WMSA 1B2WL 1E28A 5EOQL 4OFYA 2YUZA 3RDTD 4PBXA 1OQXA 3RU8H 4LHUA 2GKIA 1V7MH 3DRQA 3T08A 3P9LA 1XF1A 5DQDH 1KPVB 3VXRB 5IM7B 2XY2A 4KKBD 3CFCH 1DBAL 4JKKA 1DSFL 4Q0XL 1FL6B 2IWGA 3MNWA 3EYSH 4LHUG 5DJ2A 2FX9L 4J8RB 1JRHH 4Z77A 5JDSB 2PYFB 1UKTA 4C83A 1DQDL 4U1JB 4WEBL 5EU5B 5T1KB 1LO3L 5DURB 3FO1A 5DRWB 1T04A 3VJ6B 4X6DB 5IVXB 1MVUA 1CN4A 2ZSVB 4BZ2H 3MC0A 2FSEB 4OIAA 3O6KL 1A7OL 3GO1L 4FQCH 3VFTB 3QEGL 1QSZA 5D8JH 3ARGA 4LLVA 3L3HA 1MCCA 3NIGF 4OM1L 4H1LB 5IK3B 1KBGL 5FKAA 4YXKH 2R69H 3EDFA 4RFNB 4WWID 5ENWB 3V7AG 2XQYG 4OD1L 4PRPB 4R3SA 5GJTL 3BPOC 1YEJL 5J56B 4QXGH 1QR4A 1XF5B 2JB6B 4P2RA 5EO1A 1WK0A 4FP8H 4LHQB 4UTAL 3ARDA 3ECBB 4G9FA 1CD1B 1M05A 3F5WA 1AO7D 2MFNA 1G7MB 3L3KB 1PSKL 5AYUH 4K3EL 4M6OH 2EXYC 4JRXB 3QCTH 3QXDB 2YPLD 5T1LD 4OLYH 4PLKD 3ARXA 1V8HA 3FQTB 2DLEA 4J4PD 1F90L 1TETL 3EOTL 4C4KT 1U8OB 4NRZA 3O6KH 5I74B 2CJUH 4GRWB 3VWKA 5BJTB 3MMEB 3KXFD 2FR4B 1QQDA 4FQ2L 1J10A 4C4KO 1WCBB 3IS0X 2AK4E 2PYEA 1KBGH 4N0CD 1CQKA 4B50A 4I48A 2RCSH 2P5WE 2HT4D 1S5HA 2BNRB 5JHLL 3B5TA 4XI5D 5FUCC 1CFBA 2WIIA 5I19L 1ACYH 4Y16D 1ZA6A 4HPYL 4LLYA 5BVJB 3GMPA 2VDPL 4WFFE 5LCVH 4JRXE 3O8XC 4UBDD 4OZ4A 5KJRH 1NCCL 3QUXB 4Q6IC 4XPGH 2IQ9H 3RNQB 2FJGA 5M94B 3L1OH 4FG6C 4NO3B 2F58H 5I1LA 3C5JA 4HJGA 3RTQC 5FA4A 1FLRH 1MAML 2LE9A 3DMMB 5F71A 1KIUA 5MEQA 4WRLA 5K33A 5LJYH 4UAOB 4BM7A 4NOBA 1FGNL 5C1MB 4FFYL 4URTB 3NCYP 4ONHA 2RCSL 4FNLH 4L9LC 4KRLB 2CRIA 2VZUA 3IETA 3L3OA 1LK3H 2CUHA 3JTSB 4K7PL 5EFIA 4PJ7B 4RFOH 4Y1AB 3IXTB 1HHGA 2YPVH 2R4SH 4FQHA 4ZS7H 4RDQF 1CF8H 4K3DL 5FM8A 3K81A 2XXMB 4XCFH 1P9MA 4K7PX 5KG9B 2R0LL 1GOFA 1YPZA 3O2DA 5JR1H 1RIVL 3MOBH 2UZIH 3LD8C 2BNQE 5IROA 4NFBA 4MNQD 1KTLA 3JV6B 4KDTC 2P8PA 3MV9E 3T0EE 5AG9A 4RMQA 3KPNB 3EYUL 2DB8A 1UB6B 3MRGB 1INEL 1KG0B 1QSED 3GSVB 4LSTH 4W81A 4DEPB 4OFKA 4WFHE 4R4BB 3KNBB 2R0ZL 5CBEA 1B0WA 1TVDA 4QRUA 3BOVA 2DN7A 2P5WA 5HYJB 1KLGA 3F6LA 1KOAA 3E0GA 5DR5H 4AK1A 4QHLA 3N85H 4HCRA 2XWJA 4HUWB 4J4PC 4J2XA 2YPVL 5D72H 3V5DB 1GL4B 2EH7H 4FFVD 4X6CB 1G7JB 3LEVL 4KTEH 4NWUL 2NY6C 1CF8L 4K3DH 4GRMA 3VRIA 3SE8H 3DMMC 1FVEA 4PJGA 3JTTA 3MXWL 4D8PA 4JKPH 1O7VA 3FO0H 3JZ7A 2KPNA 1N6QL 2DQIL 2WBWB 1A6ZB 2XQYK 3TPUB 3GI8L 5C8JA 5DJYB 2VZSA 2VQ1A 3KXFA 2PO6A 2PUQT 1SYSA 1FZJA 1P2CB 3D3VD 2NY3B 3WBDA 1IAKB 3QHZH 3TT3H 3GBLA 1MFEH 4AIZA 5L2KD 5AZEL 1WICA 3GK8H 5D7IA 1KB5B 3GHEL 2NY1D 1AQKH 1VFAA 3NACH 3Q48A 2FYYA 4JFDB 2FIRT 1MCNA 3O3BB 4OLUH 5I15L 1QSFE 4PJ5B 5ADPL 3LQZA 4L8CB 1DQMH 1NC4B 5MEOA 5H37G 2V5RA 4V1DB 1G9MH 1MQKH 2R29H 1DANU 1S7SB 3QEQD 1P7KB 3EYVA 4Y89A 5MERB 1CXHA 3L3JA 2APFA 3CPLA 2ICWA 4DGYH 3H9ZA 1JV5A 2BNQA 3OKYA 5F3BB 5C0ND 1Y18A 1M4KA 3MV8B 4R0LC 1UACH 1H15A 5IKCA 2WAHA 1OD7A 3REWA 5HGBA 5E00A 3OPZH 3FQXB 5INDB 3BP7B 1WT5C 4YXLL 4EOWL 1FZMB 3CU7A 2A1WH 1JPSH 1QOKA 4QOKA 3EO1A 3G5ZB 3MOAL 1U92B 1DBJL 3TH2T 5FDYA 2H9GA 3A6CH 3O9WA 1VFBA 3Q6FA 4P2OB 3VU2A 2MJWA 2H26B 4U3HA 3DUSB 3IDMB 5ADOH 2XTJB 3SDAA 5DURD 4S10A 5D2NB 3VXRD 4UB0H 1EXUA 2HJFB 1D5ZB 1RUPL 2B1HH 4MYWB 3NZHH 2FX7H 1HSBA 2R1WB 3V0AC 5MENB 1ZLSH 2W9EH 1URLA 2QQLL 3ZE0E 3U0WL 3KXFE 3ALXA 4IRSC 2DWEA 5DQJA 5I75C 2FWOB 3ZTNH 5FIEA 3VXSE 4HKZA 1BOYA 3LN4B 3M45A 5F7FA 4OM0H 1IC5H 3Q5OA 2NW2A 4QXTB 3ZO0A 3VD4A 3DMMD 1OB1B 4R6UA 3RHWF 4N5EC 3V2AR 3O0RL 4K2UL 4KFZC 3QDGB 1C08B 1HOCA 3PNWA 1OSZA 4R4ND 3A6CL 4PJIB 3RIFF 1R3IH 5IB5B 1ULVA 1LO0L 5DHVB 3QRGL 1BD2E 2EYRA 3T4YA 1IZJA 4PP1C 1BLNA 1VPOH 3V7AE 2OJZL 2H8PA 1X4XA 3OR7B 3TZVA 5HDQL 3HI6H 7FABH 4U1MA 4AZ8A 3FB8A 4HWZA 4AEEA 4ZUSA 2Q20A 4IOFC 5JOFA 3BE1H 5EU4A 4GKSB 4Y88A 2E7LA 2EDBA 4MA8L 3BDBA 4OSUH 3HCVA 4KKAD 4FP8L 2HVJB 5E2TH 2EDFA 3SDYH 4PGZA 3U9UA 3WD5L 3T0DA 5J6GA 1P4LA 3PABB 4OZFH 3CFIC 3MV11 2XZCL 1LO5A 3ZHDA 5DMJB 1G6RL 3CH1A 5C0NC 4R9HA 5F1KC 4LLWA 2DDQL 4X9FA 5IMLA 1T7ZA 4YHIA 3U36A 1DUYB 1VEPA 1BFOB 4D0BA 4HLZH 3X11B 4DTGH 1WIUA 1G9NC 4PG9A 3TBSA 1Z2KA 5I73C 5HDBE 5IT2H 2ICCA 1LE9B 4L4JA 3KPLA 3OB8A 1BWWA 1YEGH 3U4AA 3MFFB 5ETUA 2Z35A 3MR9B 5DMIL 4S1RL 4C56E 1T6VN 5IEKB 2P47B 4OTXL 1VADB 3UYOD 2G9HB 1FNSL 2F54A 3VFNA 3T77A 4DN4L 1I7ZB 4N8VB 3GMLB 1TQCB 2HJKB 4QRPE 2VZVA 4GMSL 3D1MC 3FO2B 3WJJA 1TVBA 4L3CA 1O0VA 1MIMH 3M1BB 2CLVB 4UV7L 1TVHA 1W2KT 4U33A 5C0JB 3I3DA 4D3CL 4PRDB 3R06A 3OKEB 4ZFGL 4OV6F 1FZKA 2XA8L 4NZJA 5I8CB 4ODUB 5IR1A 1NANH 1QTYT 4IIQC 3QULB 2YD4A 2EDDA 1KSRA 2IFFH 4JB9H 5I8CA 5M7QA 5DZOA 4Z95H 4XBPB 3UTTA 4HZAA 2AKRB 1G7QA 3L3DA 3O2VL 1J05A 5KANI 1TVHB 1NGZA 2MHAA 4NQXB 5SWZA 1AXSA 4JKLA 3ESUF 3ILQC 2RAMA 3P0VH 1FDLH 3BEWB 2A9NL 3C8DA 4H26A 4QHUB 4N8VA 1IEBA 1I8LA 5JR1L 1YYML 3IDNB 3UEZA 2XOTA 1DBML 3QEHB 3VFUA 1S9XB 1A6UL 5E2UL 3FRUA 3O8XD 4M8QB 4UBDC 1C5CH 4DWHA 3GUTB 2NY4C 3PP4H 1HK6A 4AEHH 3DVGB 5GGSB 3QIWC 2HMIC 3UYRH 2QADD 5A3IC 2F74B 1NC2A 3DUUA 1QRNA 5CBAB 4MCZA 3U7YL 3ZKXB 1XGTA 3FCTA 5DUPL 3EO0A 1Z9MA 3TA3A 1BFOA 4PJFE 3B2UC 4NQDE 4TSAL 4OGXL 4P57A 3QDHA 4X6FA 1QYGH 1GHFH 3WFBH 3K0WA 3U83A 4ZPTA 3MNZA 1F58L 1LK2B 1A8JH 3MRMB 5K9JL 1S7TA 4R96A 1NCNA 4GBXA 3WEXB 1P4LB 5LG1A 5DJ0B 4JFEB 3NCJH 4ZYKB 2XZZA 4X7FC 1A7RH 4HWEL 2ZNWA 4V1DD 5DD6A 3GIZL 2J8UE 4G9DA 5DMKA 3X3GL 1LEKB 5JOFB 3UYRL 4X8JA 4NGHL 1QBAA 4R8WL 5BV7B 4JRYD 3JWDC 5E1AB 1G7HA 2P8MA 4M5YH 3GMOB 2FX9H 3VXMA 3TGXA 3OQ3B 5DVOA 3EZJB 3MLXH 3UTTE 2A0LD 1VA9A 4ALAL 4GH7B 4ONOA 3SCMA 2BSSB 4LPWA 4UNVA 5KAQF 3VGDA 5FYLH 4JQIH 3QEUA 4N8VG 3T2NH 2KZWA 4CW1A 3AS1A 3KJ4C 5DJAB 2VQUA 3MRFB 5FGRA 2YS4A 4Q9CA 5B8CB 4DVRH 4NNPH 1RUAH 3HC3L 4LSQH 5T1DL 2OL3A 4Y8AA 4I18B 5E7BA 1KPRB 1AFVL 1DVFA 2VXUL 4JR9H 4NQUA 3HA0A 4JFFD 4EI5B 1P4BH 2OP4H 5BS0E 1B4JL 4KK9D 2DIBA 1SJVA 1KUMA 3UTPD 4RAUA 3KYKL 4M5YL 3UTSE 4X4YB 1TDQA 3FT4B 2PNDA 5CS7A 1QUNA 5I9QB 4TULL 3EUUA 4OIBA 2NY4D 1D5MB 5CLTA 1JHTB 4WV1C 3RWIB 1D5XB 5B38B 5GGRB 3CVHH 1I9IL 1A6WL 3BKML 3BHBA 1HDMB 3ARBC 3TFKC 4GMTL 1B9ZA 4FABL 1AFVH 4JR9L 2XWTB 3BP7A 3B2UD 4XPFL 2D4DA 1NGPH 5MHSD 3Q3GA 4X6CF 3QG6A 4MCYB 4LVHC 4JFXB 2X4SA 2JF1A 4RCAA 4KRPC 4Y1AD 1NC2D 1ACZA 3ZL4L 3E3QC 2NXYC 2BNQB 5A43C 4JO3L 4GW5B 2A83A 3IFPB 2VLRA 4L4TB 3GSUB 3LN5B 2HG5A 4IS6A 5GZOC 4KY1H 1T2XA 5KJRL 1G0DA 4MD4B 3JV4A 2GJ6D 3OAZH 2F19H 1DFBH 3FOMB 3TN0B 1JWMB 4YHLL 1IKNA 4OUOA 4I0PC 3V6FA 5EBMA 1I9IH 4GG6F 3K4DA 1U58B 2P5EA 4BSVB 4NZDA 3VCLB 4K7FB 4GMTH 4FABH 4TVSa 4QRRA 4ZXBB 1CZ8H 1FVDB 4JG1L 1WJ3A 3AM8C 5HJ3A 5DJYA 2BVPA 3MRLA 5J9PA 3FFCE 5DC4B 1MFDL 2UUDK 2VDLL 3DVFA 5I30H 3UPCA 4AMKL 1X5YA 1B3JA 4IRSD 2XZQH 4D8PB 1C5BL 1FVEB 4HMEA 1CFNB 1Q72L 5TH2B 4N90D 1CFNA 1BEYL 2VABB 5DRXA 3VW3H 2A9MH 1G7JA 1KJ3L 4N5ED 1KEGL 3V4UH 1Y0LB 3PWPD 4P9HL 4P4KD 2VKWA 3BKYL 1ITCA 1SY6L 5B21A 2AAVA 2X1QA 3QR2A 3KPSD 2BSTB 3MRLB 4LCWD 5J9PB 3RHWK 4PJ7E 1N26A 1WC7A 3QUMA 2BC4A 5I8OL 1OQOA 3O4LA 1QRND 3O2DL 4GUPA 2Q6WA 3AFLA 1S78C 1NMCB 2X10A 2VLMD 4CMMB 4HHAB 4N1CA 2CLRB 4EZMA 1H5BB 2VDLH 1OAKL 5I1AB 5C0BE 5HYSA 3JV4B 5I1IL 3T1FA 3OB0H 3MV9B 3T0EB 4HCRL 4MAUL 1G0YR 4XNXH 1PVHA 1Q72H 2I60H 1DBAH 3TFKD 1MI5E 1A47A 3EDDA 5INCA 4FTVA 3S4SG 1U3JA 4G6JL 5KN5A 3V4PL 5IVZB 2VAAA 5B3NA 4DUWA 4W70A 1RK0A 5CEZD 5KSUA 1TZGL 4YDIL 5B4MD 3JTSA 4NN7C 3C8KB 1H9VA 4M43L 1ZKAA 1TXKA 1UH4A 3W11C 4U05A 4PJXE 2ITCB 3TVMC 4IRZL 4RRPA 1Q9WA 1XT5A 1FVDA 4B7LA 4ODSH 5GZOD 3TH4T 3CDGA 3GB7A 4KROC 1I4FA 5HI5C 3VCLA 2E7MA 4UUJA 5EU6E 5FYJL 4Z7QF 3B9KB 4OLWH 4FFZH 1CU4L 4LMQI 3QWRA 5ADPH 1NEZB 1T5XA 4LDOB 1ADQA 3RZCB 5F7LB 5C07E 1A6UH 2ZCHL 2XI9A 1WAAF 4LEOA 4OAWB 3QFJE 3D85A 2NY5L 3Q5TA 5I18H 3HE6B 1PX4A 1QZ1A 1BFSA 5CIPB 4DGVH 2R0KH 4JRYE 2X4SB 5CJBA 3U7YH 1F90H 1TETH 4EOWH 2BVOA 3TT1L 1U8JA 4K55A 4XC3L 1PZUB 4P99A 2EDJA 4TSAH 3S8WA 3LS5H 6FABH 1HXMB 4LQFH 1EZVX 2C9AA 1N5YH 1GHFL 4YO0B 3V5HA 4OLWL 3NA9H 2I07B 3QDAA 4DCQB 3EKCA 1ZHLB 5H2BA 2HRLA 4XXCC 3U4BL 5GIRA 4AY0A 5F9WB 5F7EH 4HK3N 2X1OA 1S78D 3VXMB 4CUCA 5LXGL 5BVPH 3CDFA 4KZDH 2R69L 3CZFB 3GMQA 1MREL 3WNKA 4BFIA 1KEMH 1B88A 2Z91B 3X12A 4RRPG 2WZPD 3ARFB 4CADB 1EV2E 4R0LA 1CLOL 2VDNH 1T3FA 3L3HB 1S7XA 3MLXL 3BT2L 3TVMA 2VZTA 3HR6A 1RZ8B 4BA8A 4K3JL 1B6UA 3MLTB 2W65B 5FYLL 2XN9D 3RWFB 3T2NL 1E4JA 4OI7A 1T04B 3C60B 3EOTH 4ONFH 3BGMA 5EU5A 1MHEA 3M17A 3QRGH 3T0WA 4ZUUB 2DF3A 4RFOL 3IVKB 1HKFA 4PREB 2YBRB 4M61B 3UTSD 2Q8BL 2AS5M 1CI5A 3CH8A 4MCZB 1BVLA 1LILA 1V3JA 4OCRL 3SPVB 4C56B 3C2AH 4KROD 1MPAH 3Q1SL 1EEUA 1NKRA 3I84A 4PJ9C 5HHOB 1CLZH 4PJBE 3MLYH 4N0FB 5E2TL 3IKCB 5IW3A 4YNYB 5L88L 2P42B 4ZUTB 2Y6SC 3QAZC 5BZWB 2PW2A 1TMCB 5DLML 5IHLB 3MLSH 2P48B 3D39D 1TZIA 2VDPH 1AQDA 1EMTL 1UKSA 2P24A 5DJ0A 4TQEH 3LIZH 5E2WH 3QWRD 2MKWA 5SWZB 3CVHL 1OPGH 3ZE1E 3UTTD 2QSQA 1HN1A 5IBTL 1UGNA 3B43A 4LCWA 1YQVH 5FGCE 3UX9B 2W07A 3NFSH 3GJEA 3QPQC 5FOJA 1Y6MR 2DLHA 1N0XL 5GS2D 3LEVH 1YY8B 4DTGL 3P9MB 5KSBF 3LRSA 1MCBA 4D2NA 1CICC 1SYVA 4L3EE 1IE5A 1P5UA 4LCCB 1OAQH 4LGPB 4KK9C 5J3HC 4MNHB 4ODXB 2X4NA 4ELMB 4WU5B 4QRSB 1YEFH 1QD0A 3VFUB 4EI6A 5IEHA 4ZSOB 1VADA 4NC0B 3VXTB 4LVNC 3UBXB 4KJQC 3S3SA 1S9VA 1IGMH 4XCEA 4D94A 4Q9RL 4LCCA 2XFXA 1J05B 2GI7A 1T7YA 3P77A 4XPBL 5AWNH 5I1GL 3QWOB 4PG9B 1V3MA 5GZND 1INDH 2CKBH 4M4PA 3P4MA 4RISH 4MJ5A 4UNTA 1FBIH 3FRPA 3DGGB 5ESVA 2DMKA 1MFDH 4NJ9H 4L3EB 1OT1A 2WP3T 4MQTB 4NFCA 1T2QH 4U1NB 4UILH 2O61A 4NJAH 4Y4HD 1HHKB 3GKWH 1HQ4A 1FDLL 2NXYD 1K5NA 4XP5L 3TC9A 2R2EA 4L3CB 2ERJC 5KVFH 1FVCB 3QHFL 1SEQL 1CR9L 3UAJD 1ZLWH 2KQMA 3F58H 3S96A 2IFGA 3G5VA 4L8SB 3BP5B 4Q9RH 2W1NA 2XA3A 4U1SB 1K4DB 5CGYD 1FFOB 3BPLC 4U1MB 3SE9H 4LU5H 3SDDA 3ILPA 3TT3L 1X3DA 2ORBH 4WTZA 3NCBB 5FO8A 4JM2C 4NWTH 3RWDA 2QJDA 5EG6C 4PRAB 5E6IB 3BO8A 4Z7VF 4NM4L 4YWGL 1L7IL 1YPZE 2A38A 1L6XA 4Y2DD 4WFFD 5GS3A 4F2MB 3GBMH 4HX1B 3VFVA 1HE7A 4KHXL 3T65A 2Y5TB 3BGMB 3G6JA 4OGAD 3QPQD 4PGEA 1TIUA 4WUKH 4IDJL 3HPLA 1NJ9A 3WN5B 5FXCH 1C1EL 4FS0A 1JFQH 1BFVL 1JTTA 1RZ8A 4X5LA 4FQJL 1JNNL 5D70L 4ZPVB 2AGJL 5ESAB 2GEEA 4HJ0D 2XTLA 4IJ3B 2HVJA 1SY6A 1UJ3C 4R8WH 1SHMA 1KB5L 2VDKH 4M7ZB 4NP4L 5MP6H 5J3HD 5J11C 1W72A 3OF6A 5I76B 4BFIB 1XCTA 3TYFB 1BAFH 5D5MB 1IGYA 4PJXF 2ATKA 3T4YB 4Z7VB 2YEZB 5JXAL 3TNNB 4HS6B 5HHMB 5DHVA 4MAYC 1ZHLA 3H9HB 4MA8H 3S4SB 4U1GB 4DCQA 3BP4A 5HI3D 1C7SA 1KJ2B 2XKUA 4DZ8A 1NGYB 2KZ1B 5T1DH 3W39A 3QDGA 1YJDH 1HXMA 3H9SB 4GBXC 1ZHKA 3VE0A 1T1XB 4NQSA 4QHMB 3BXNB 4XMPL 4BZYA 2R2HA 1U8JB 2SEBB 4DGVL 4Y4FA 2DWEB 4HFUH 4AT6B 3P0GB 3WIFA 3MLZL 5I1DA 1F8TL 1QEWB 4DVBB 1CXLA 2X4RB 2R9HD 1FYTE 5EIQA 5J89A 1KPUA 2ZSWB 4P3DB 4XVUC 5BS0A 1MLBB 4G9FE 3RVUC 5MERA 3D39A 5CJXC 4YHZH 1YNLH 3N9GL 4I0KA 4X6BA 4GW1A 4PJ7F 4YHYB 1R3HB 5JXAH 3IDMA 4YHOL 5JMRA 4KH2A 4RQQA 1FH5H 5BV7H 4KJYB 3QHTC 4FMFA 5JQHC 5DXWA 5KVDL 3VXUE 1JJUA 3OJVC 3OG4B 4OZHA 3FONA 2IEPA 2GHWB 3B83A 1KEML 3HAEH 3NAAH 1ITBB 1Q9WB 1AGEB 2DQTH 2NW3B 2ITCA 5FHAH 2CKNA 4CNIB 1N64L 1JF1A 4OGAC 3BZEB 1FC2D 3WFDL 2C7UB 4YHZL 1IEAA 1ND0B 4HJJH 3BESR 5HVFB 2F53A 3L3GB 3GZKA 5C0EA 1OAYH 3MRPB 2VZOA 3LH2L 1JCKA 1ED3A 1XZ0A 1VCAA 3MV9A 3T0EA 4OQ1A 2ESVE 4ORGA 4YGVA 3CSGA 4QHLB 3W9EA 4OUUA 2V7HB 5T3ZH 1KLGB 4Z18A 1MCDA 2X05A 3IAPA 2IBZX 4M6MH 2ZG2A 4F7MB 4NKIL 3UCRA 2YA2A 2VWEE 4PJIF 3GSOA 4P4RB 4U31A 3VXSA 4QYOA 4LIQL 4HC1H 3H3KA 3HFML 2JB5L 2BNUB 3H3PL 1JNHA 3O4LB 1AGDA 3R8QA 3STBA 1H3UA 2AJUH 1OLZA 2A6DA 4R97C 4YHNA 2DLTA 1WT5A 3GSRA 5JO5B 5C0AB 4GG8A 3JUZA 2D2OA 1PKQB 5C07A 3CFCL 4I1NB 3BMWA 1CL7L 3RTQA 3VW3L 3VXOA 3BZFB 2PYED 2XY1A 12E8H 1HH6A 1AXTL 2OI9C 3ZKNC 3ULVD 4P3WA 1GAFL 5CSZB 5IG7B 4IMLA 3SDAC 2DKMA 1CE6B 2NMSA 3WV0A 3MUY1 4XVUD 4PP2B 2BVPB 1AGBB 3EAKA 1RUMH 4K07A 4RX4A 1RFDH 4ZUVB 5I6XB 2BXZA 2P5WD 3HFMH 5MEQB 5D7JC 1F6FB 3WKMH 3W82A 4Z7WA 3T0BA 3G6AA 3BEVB 2J8OA 5DJXA 3BSZL 2OZ4H 5HVHB 4BH8B 2R39A 3GIZH 3QDJB 4JY6A 1KTLB 1YEJH 3EDJA 2V7NA 5T5FH 4LLYB 4C59B 1L0XA 4JN1L 3UP1A 3ARDD 4FQXC 3GSWB 1KIPA 4EXPX 1TTFA 5EBWB 4QWWD 4U6VH 4FQHB 3TJEH 3BZDA 1ZLVK 4XX1G 3IXTA 3QXWA 2B8OT 1LEIA 2I5YL 4YDVB 5FO9B 1TTUA 5EFIB 5EOQH 1XGYH 5ANMB 5EZIH 2JK5B 3F8UB 3NGBC 2OQJB 5DQ9A 2GIYA 4J4PA 4LCUA 1EEZB 2IADA 1TJHH 2ENYA 5IFAH 4XWGL 4OT1L 3HG1B 4G6AD 1FRGL 5J12C 5IQ7L 3NOIA 3PDOB 1UG9A 5MI0C 2VISA 3RVWD 1CICD 3FQTA 5D7IF 4GKOA 2QTEA 4MAYB 1NUFA 3VFPB 1GGYA 3QCUL 1YEIL 1JZ5A 4LCYA 2DWDB 3QUYD 1D6EB 1TENA 2AEQH 4QHKJ 2F53D 4Y2DB 2YUVA 4OD2B 3F58L 3QDGD 1IC7H 2DQHH 3FB5B 1JGEB 1ZA6B 4L8DA 1ES0A 3BDYH 2JB6A 4P2RB 4PBVC 5BRZE 2JJTA 2DQUH 3FFDA 3QFJA 5I18L 4KK5C 1KJMB 1PQZB 4KJWC 3HE6D 2FL5A 2BNRA 3W0WB 1UM6H 4R4FL 5GJSL 2IAMB 4POUB 4JFHE 5JQ6H 3T3MF 5HHNB 3ARGB 4OT1H 3ZE1F 5IVOA 4ZS6C 2E6PA 3QQ4B 3IJSA 4YXKL 3ZKND 3ULVC 4NNYB 2CK2A 3VWKB 4FZ8H 3HAEG 1RI8A 1J18A 2H2PC 3L3IB 1A64A 4N0YL 1SVZA 5C07D 4G6FD 3LPFA 1BBDH 3ZL4H 1CXIA 4FXGB 4W4OA 4Y4HC 3NVQA 4YFLF 1XIWA 5DJ2B 3O6FC 3QIBA 2VOTA 1XGQA 4L1DA 4DFHA 4NZUL 3V6ZB 1NMAH 3WNOA 1OWWA 5E94A 3KYOA 2G5BA 3MLVH 4PJFA 3VFRA 3CFJA 3TN0D 1D9KD 5T1MB 2WUCH 3ALWA 1UB5B 3VXPB 1I1CA 1MCEA 1KCLA 4LHUB 2DIJA 4O4YL 5ENWA 5GGTH 5CJ5A 4U6YA 4Z7WF 3GM0A 3S37X 3LHPL 4TVPL 5ISZB 2EXWD 4CL7A 4YGAB 3MRMA 4ACPA 4F33B 4O58L 1R3LB 2CXGA 2A73A 4UZGA 2Y36L 2FEDC 2AV1A 2D7OA 1A7NL 4YK4C 5IB3B 1IAIM 1WVZA 3HZVA 3LV3B 4XXCA 1GRWA 2QSTA 4HKJA 1NCWH 4ZAKA 3FO9B 4OZFG 1OGAD 1PYWA 1EERB 3UTQB 3I02A 2APWA 4HGWB 2NY3D 4XPGL 4HW6A 4M93B 1BMGA 2JJTC 1VERA 4MJ6B 1GC1H 3NTCH 3PUCA 1FJ1B 3KPSB 3ARTA 3NIFF 1A0QH 2ARJA 4PBWD 2JKXA 3PHSA 5EC2A 2EDLA 5C09A 1T0NB 5CD3B 4QTIL 4HBQA 1K8DA 3WE6B 5AZEH 4FNLL 5DK2B 1AJ7H 4P5MB 4LHUD 1CGTA 1MCJA 4JQXC 4PV8A 1BM3L 1J1PL 5B3JE 3KPQB 5DWUH 3RBSA 3ULUH 4L5FL 3MREB 4L8SC 5F7MC 1T1ZA 1H0DB 1CZ8L 5HYJD 3VWKD 4ZS6D 3T3PE 3QIBC 5L2KE 4XP1H 4MD0B 5F96L 3LKPA 1MEXL 2H6PB 5E8PB 1N64H 4UU9A 3IXAB 4NYLB 3KDMA 1V7NH 1AR1C 3BX7C 1MFCH 5IHBA 5EIIB 3CLEH 4S1SL 1Z9OA 1M7DA 5SV4A 4JGJA 1QPXA 3O6FD 2W9LA 4HT1H 4WTXA 2AXGA 1C16A 4JG0L 4JO4H 1UVQA 1U6AH 1I8KB 4FHBD 3BKYH 1BJ1H 1H0DA 4LRIC 3W5MA 4QOKD 3KG5A 3HC4H 3HZMB 1BVKA 5IEKA 5IMKA 3L5WA 4PJFF 4NKIH 3HR5B 3QUKA 1NUGA 1YEEH 4MQXC 1WFUA 3SE3A 2DJ4A 1T2JA 5IIEB 4YZFF 3AMLA 5DZNA 5E1HB 43CAB 4S1QL 1A6VL 4TSBL 3ZZ1A 1N5AB 1IQDB 3V8OA 3X11A 3D69A 3KPOB 5JTWA 4D0BB 4Y8DC 2PF6A 4XPHL 1OL0A 1NGWA 3NABL 4MA1B 2PO6D 4LAQL 1ZXQA 4GKNA 4X0KB 3SGKA 1JYNA 1UM5H 4KMTH 1U95A 2NY4B 5GSVB 1MHPH 1CDYA 5GGVL 2O5ZL 1NAML 1T83A 1EA9C 5IWLC 3QDME 5EN2A 3STLA 3G6DL 5E8NB 4M43H 1B2WH 4K23L 1QBBA 4OLUL 1AD0B 1A14L 1WQVT 1QBLL 4K7PY 3LQAC 2BNRD 2Z92B 1OSPH 5TFSL 5J1TC 4NWTL 4JZNA 3I3BA 1A3RL 3VFSB 1A6VH 2NXZB 4TSBH 4HXBL 4ODBD 3OR7A 3C6SB 4L8BB 2HN7A 3L5XH 2IBZY 1ZT7A 3BYYA 2H3NB 1UB5A 1XAUA 2YOCA 3VXPA 5IJKA 4PJ8C 2E27H 2ADIB 2FJHB 2FB4H 4UT9H 5CEXA 1HHIB 4M00A 3ZKMC 3D0LA 1W0VB 1T03L 1ONQA 4PTTB 4M5ZL 1P9MC 1OSZB 2ZCHH 3S88L 3QO1B 4W6XB 3WUWA 2Z8RA 4RMUA 3B9AA 2HYMA 3QFDA 1OB1A 1JNNH 1WZKA 5D70H 3OAUL 2NY5H 4CBPA 4FXGA 4LARL 4PJDB 2QSCL 2Z31D 1RY7B 1YDPB 2GUOA 3DVNB 3CLFH 1FCGA 5I1KH 4D9LH 2KH2B 3RY6C 3SDAD 5DHYB 1OSPL 2EZ0C 4P9MH 3V0VB 1X5GA 2C3HA 2DLFH 1DQJB 4DUXA 3LS5L 3WFCL 3ZDYE 1D7FA 3MJ7B 3D3VA 4FQ1L 4U7MA 1VESA 4UIMA 3ARWA 2CDEB 3C2AL 3DI2B 2NNAB 5KSBE 3SKOA 2QQLH 2XIDA 3CVHB 2F8VA 3MRCB 3U4BH 1PQZA 2BY1A 3DUSA 4QXWA 1RZKL 5JW3L 4MMZC 1KYOJ 2ADJB 5C0CB 5LXGH 5BW7C 5I1CL 3DV6B 3PGCA 5MI0B 4HKXB 4X5WB 1JGEA 3VD3A 2I9TB 3HS0B 1BF8A 5DD3L 4OD2A 4E0RB 4BSWB 3ARDC 3IFNL 4WJ5A 4QRPB 5I66A 5IWLA 4UINL 4FQXD 4CDHA 4TOYH 4O51A 3NGBB 3HKFA 5F9WC 4AM0B 1T1WA 5IHZA 5CHNA 1E4KA 2PO6C 3HLAB 1I9RL 2YXFA 5JIPA 2HT2D 2HWZL 3MRQB 5E99H 2GITA 3NPSB 3P73B 5F3HA 2YD1A 2HLAB 3CPLB 4ZFFB 2GK2A 4FQXB 1I1AB 2FLBT 1MJ8L 4LCUB 1FSKC 4NHCL 4H88L 1BZ9A 4GRWH 2XV6B 4M7JH 2OLDA 4EUPH 5HYSG 1IFHH 5I1HL 1FIGH 3IYLW 3PQYB 1GJIA 1KCVH 4WI8A 1SQ2N 4WCYL 1F4YL 5LGJB 5FV1L 5CZVH 1Q0YH 2DL2A 3VGBA 3ZE2F 3MLYL 3HC0A 3OKMA 2QBWA 3O8XA 4Y4FC 3ZKMD 1ZS8A 4Q6IA 4KJWD 3QEQE 1OAUH 3BZ4B 2CR6A 3OX8B 1Q1JH 3DBXA 3F7YA 2OR9H 5GRYA 3LIZL 2G5RA 4MSWA 1Q94B 2FH6A 4CVZA 1OCWH 2AQ3A 1IZKA 1PDKA 3RI5F 3R0NA 2VLJD 1ZANL 5ALBH 2Z31C 3OWEA 5DFVD 5IBTH 1YN6A 4JFFA 1WIPA 5J57B 2YA1A 5I1HH 4GFTB 3U46A 3BGFB 3P4OB 5MEND 2BNQD 5CSZA 4BQ9A 1CDIA 1QFWI 4K9EC 4KI5E 3EO9H 4LBEA 1JL8A 3O41A 3D2UA 2P5WB 4JN2A 4L29B 2VLJE 5A16B 4Q9QH 1EFXB 3QNYB 1HIMH 2B4CH 4ZTPH 4K9EH 1MF2H 3TWCL 4NQCA 2HKFL 4WWKB 3WO3B 5BXFB 5FECA 3AS0A 4G8IA 4HLZG 3FFCA 1ZK9A 1RQ5A 3G9AB 3WFHA 5EUOF 3QJHB 4O2EB 3TN0C 1ZOXA 5DMGD 2XA8H 4I2XE 1KIRB 1XR8A 3VH8B 1OCWL 4OZHF 4DKFH 2QKIA 4NQCB 3B6SB 1CGSL 2ILLA 2W0LA 1KTRL 1EFXA 2EXWC 1EAPA 2BXYA 3TH3T 1UT9A 1J1PH 1FV1B 3FQUB 4KZEH 3O4LD 4JPKH 4PJ7A 5CILH 4K94L 4R90H 3ZDZE 1XGUB 4LP5A 3PL6A 4O5LL 5IQ9A 4JFFB 1RUML 1FBIL 3ARUA 4JKPL 1AXIB 3L3GA 4F15B 4Y1AE 1UADC 3EFFA 4O2FB 3DLQR 1I7RA 5GS0C 1U8HA 3P73A 3DMMA 3CFEB 3DBXB 3F7YB 1NDMA 4WV1B 4JZJC 4GRLA 2OP4L 3W9DA 4Z7OF 1VACA 3QIUA 5I9QC 1P7HL 1XR9A 5FK9A 3T8XA 2C1OB 4YHYC 4LLDA 3QSKB 3OXRA 2C3VB 3CUPB 3LMJL 2UY6A 1TCRB 1N59B 4YX2H 4QRQA 3KJ6H 3D25A 2C1PB 2VL5A 3ROOB 4JPKL 1NBZB 3MRCA 2DBLL 1JZ4A 4BZ2L 4Z0BL 4JGUA 3MUGB 4I18C 1A6WH 5CJ8A 1QLFA 3MJ7A 3QIBD 1A1MA 3RRQA 1BIHA 2RFXA 5BMFL 1JMXA 1ZTXH 5GHWL 3ZDXE 3MLWL 5LAXB 1EHAA 1U8OA 2IMNA 4W68A 1YMHA 5HVGB 2GUOB 4HFUL 2EC8A 2AEQL 3DSFL 4KXZH 4YHKL 1X7QA 2QHRL 2VDOH 3TIEA 3MOAH 5ANME 1EGJA 3UJJL 4CDGC 4S11A 4IDLA 2BSRA 1NGYA 4N9GA 4YBQD 4YX2L 1YC8A 3MRNA 5LBSL 3LKOB 2OS7A 1RHFA 4PB0L 5J11B 4MNQB 1ETZB 4Z7UF 2GJ6A 1E4XL 4XVTL 1UJ3B 3UDWC 2FGWL 4MJ4A 4Z7VA 2XT1B 1A3RH 1EUUA 3O3DB 4MQXD 5AZ2L 5KVDH 5D5MA 3UO1L 2NNAA 5I1EH 1A4KB 3IDYB 4DKAA 4JZNB 4Z8FL 1A5FL 2CDEA 4F7PB 1NEZG 1FO0B 3HB3C 3MCKB 1U8MB 1NC4D 4OQTL 1JGDB 3QPXL 5DEFB 3A6BL 5C0IA 1LNUA 1I9EA 2AJ3B 3STZB 3CZJA 3QIUC 2A77H 3RL1A 5B38G 1RIUH 3WFDH 3CCHA 1NSNL 4GAJH 4BUGA 3A0OA 2FIKA 4PJCB 2AVGA 3NZ8A 5C09D 3PGFH 5E24E 5T3ZD 5H8DA 5EZJA 3G6JF 4WVRA 5FGCB 2V6HA 4QO1A 2MOVA 4JDZB 4GG6E 4Y19E 3PL6D 3KPOA 1F3DH 5FHBH 1VPOL 3RP1A 1KPVA 4HFWA 5AG8A 3P30L 4CKVX 3P0YL 3KPRB 1XF4A 4PRAA 5EUOB 2JELL 2HN7B 2G75A 2R23B 2HFEB 2QQNL 5D1XD 3QG7L 4OSUL 1CXKA 1RZKH 5JW3H 3RIAF 2OTWB 4I4WB 3Q6GH 2CSPA 4HD9A 2JTDA 5K9OA 4NT6B 3MO1B 2Q86A 2P1YA 4HULB 1CE1L 1MY5A 4OKVB 3NCMA 4YHML 4MXVE 4B5EA 4G7YH 4JFOB 5EBLB 5I8EA 2OTUA 5TF1L 3GSQB 3O6FA 1IAIL 1IGFL 4IIQB 3O6LL 3HZYA 2GFBB 4NQCD 4M6NH 2GSIB 4W6YB 3MBED 1M7DB 3C5SA 5IB4A 4M48H 4WI9A 4O9HH 1G6RB 4UDTA 4YDIH 5H35A 4UDUB 4XPTL 2DTMH 3KDMB 2B2XL 1U42A 2EIDA 4U6HA 4JM2A 4QT5B 1HHJB 4WDIB