2Z35A

Crystal structure of immune receptor
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
112
structure length
112
Chain Sequence
b'DSVTQTGGQVALSEEDFLTIHCNYSASGYPALFWYVQYPGEGPQFLFRASRDKEKGSSRGFEATYNKEATSFHLQKASVQESDSAVYYCALSENYGNEKITFGAGTKLTIKP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T-cell receptor alpha-chain
publication title Structural evidence for a germline-encoded T cell receptor-major histocompatibility complex interaction 'codon'
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 21
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2007-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2z35A00
3S88H 3ROLA 3MCKB 4RIRA 3PWPD 4KUZL 1MI5E 4G8EB 5HGAA 4OTXH 2M1KA 3MO1B 5GS3A 2Y7QA 3MUZ1 4Y16A 2E9IA 3VG9B 4RX4A 2W9LA 4PLKD 5F8RC 5DRZA 1TJIH 3EOYG 3OXSB 5DD6B 1PYWA 2H45A 1SM3L 3EDFA 4JO1H 3SDCB 5D5MA 1Z3GL 4M1DH 3LY6A 2YXFA 3PWPE 3LKOB 3DO7B 1I3UA 5HYFA 2NY6D 5JHDD 1H3XA 1IRAY 3QH3B 2WIMA 2X4OB 2Q7YB 1GXEA 4HG4J 2IQ9L 1WFOA 1ZT7B 4PJ5D 1HHHB 4YHZH 3VI3E 3QNXB 5EZOL 4IRSD 4PJHF 2DM7A 1G9MH 4KMTL 2NY1B 1NLBH 3RVUD 1RULL 4XWGH 3KPOA 1JMXA 4M7ZB 4TSAL 4RMSA 4OZIA 4U1IB 2ILLA 1JGEB 3E1F1 5BJTB 3F7YB 1I9JL 1FIGH 5FA4B 2XZAL 3U9UA 5CLWA 3X12A 3T4YA 1FFRA 2VDNL 2AV7A 2F19L 1QR1A 1I4FB 1PKOA 1UACH 5J11C 5GRWA 5SWZD 3SDAD 4YK4B 1N0XH 3ULUE 3DI3B 5DJ8B 3T4AA 1ONQA 1L0QA 5T1LD 4LLQB 3R8BB 4HIXL 3RRQA 1CFSA 4R26L 2GI7A 5I1HL 3ULUL 5DJ0B 4I0PA 1BGXH 3BX7C 1G6RA 1BFSA 3ET9F 4PIRF 3WE6A 1XF4A 3QWRD 4BUGA 5SWZE 1FL3B 2HKFL 3M45A 1UYWH 5D7IE 1LP9B 3KPPB 3WKNA 1MFEL 3BEVA 3OAYH 1GPOH 4HWEH 4JFED 1EAJA 1RHFA 4TNWK 2W60B 3BW9B 2XKSA 35C8L 4YX2L 1T4KB 1TJHL 1ZVHA 4G7YH 2AJZB 2DS4A 2XNAA 1OY3B 1QFOA 4YWGL 2BSSA 4XRCB 2CLVA 4LCCC 4NHUB 3ZT6A 2H32A 5IFAL 2EYTB 3FHQA 3HZKB 4D0CA 2WWMC 3QIWA 4DGVH 5C0FB 3L1OL 5IM7B 4NO2A 1S78D 5HDQH 3C9NB 3LKRA 1A7OH 1AD0A 1KEGH 2Q86A 5IW1B 3F8UB 4JO3H 5ADPL 5F7HA 1MF2H 3ZSSA 4HWBH 3P4NB 4ETYA 2R8SH 3B5GA 4F7PB 2MNUA 1UM6H 3MRHA 1F3JB 4Z77B 4OLEA 5E8EA 4BQ6A 4YIQB 3PHOB 4LSVL 4DZ8A 4JO2H 4ZUTA 1OP5H 3C09C 3GO1H 1LMKA 3WO4C 3PNWB 4WRLA 4BSWA 3WLWC 5TGBB 3HG1A 4X4MA 1PG7W 5JLZB 3C60B 3QUYA 1U3ZA 1CGTA 1HZHH 3CFBA 2PF6A 1AY1H 1A47A 4MXQC 1K4CB 1KOAA 4MB5A 4DN3H 4YGVA 3NIDE 3DX6A 2H2PC 1G7MA 2V6HA 1Y6NR 4BZ2H 4ZS6C 3CDYA 3ROLB 3IS1X 4XZUB 2D9CA 3KR3H 4HJ0D 5IB4A 2VUOA 1OAYL 3OAYK 4FQ2H 4H5SA 2VDOH 3QDMB 4KDVA 2UWEB 5INDA 1SBBA 2EC8A 1G9NL 3NIFE 3W2DH 4D3CL 3KHOA 4YHNA 4J3WA 1FGNL 3TO4A 3BH9A 4Q0XH 2IPUG 1LP9F 4OLUL 5D5MB 3RVXC 2C7UB 3NCJL 4P5KA 1XGQB 3QHFH 4P3CH 4GRWB 5BQ7A 4HBCL 4KJPC 4GBXA 5E4IA 1QVOB 3RNKA 3BRDA 1F3DH 1ZK9A 4K3GA 1AHWB 1INDL 3SBWC 4I48A 5DLML 2X4NA 4N0RA 5K93A 4NZRH 4IMKA 4OZIB 4F3FB 5BVJB 5JW5A 3TT1H 4N0UA 1RIUH 1RUML 2JJTA 2VLJE 1OP5K 4JVPA 4XAKE 2COQA 2EXYC 2YD9A 5TF0A 3VA2C 1LNUA 2Q76B 1A7QH 1A1MA 3UC0H 5L2KA 4HUUB 2OTWB 1TZIB 2AXHA 5B39B 2GFBA 2MCPH 3BMWA 4F80A 2VZSA 4K55A 3O11A 1AQDB 3AREC 2VXUL 4U6HA 4C57C 4QRQB 3U36A 4RSVA 1MJJA 3SGKA 3I75A 1SEBB 1HQ4A 4KJYA 3T4AB 4J4PD 5ALBL 3VFSA 5IMMA 4UBDC 5E2JA 1T5WA 4WFEE 4F2MA 3LEXA 3DHMA 2FEEI 1G6RB 4G9FA 3S5LB 5GJTH 1RQ5A 2UZIH 1TQBC 2BNRB 4F37K 4WEBL 3D85A 4QHMB 5HI5D 3E8UH 3IAGC 5FXCH 5TPWH 1LEKA 4CADB 1UXWA 1GGCH 4G6AC 4MSWB 4WFHD 3KPSA 5HGDB 3BIAX 1FNHA 5FUOL 5ADOH 5KAQG 1ZANL 1JPFA 2CDEB 2YEZB 4GUPA 4N8PA 2AEQH 1JPST 4LCYB 3RY6C 4M8VA 2XNAB 1CU4L 4MNQA 1I9IH 3QHZH 5F9WC 4Y4FA 1RFDL 3UTQA 3G5XB 3GMMA 3QXUA 5D5MF 3SGJA 5D1QC 4Z95H 4WFHE 1Y6KR 3VWJC 5IOPA 2NY4C 3IRZA 2J8UB 3RU8L 4I18B 1AD0B 3PDDA 3T2OA 3ZTNH 4MQ7A 1IKNA 1E28B 5MP6H 4ZNCD 1KIRB 4PJ8C 1MWAH 4Z76B 2E7HA 1XF2A 5D2NC 3MRHB 3T8XB 3QXDA 4LRIC 2CRIA 2HTKC 1KJ3L 5GS0D 5E8EB 1WTGT 1SBSL 3DMMC 3VXSA 4OKVA 2OL3L 2I9LB 2BERA 1TTGA 4PUBH 4OZIF 4X4ZA 2HFFA 2XG5A 3LHPH 4G6KH 1IBGH 3S36H 1DBJH 3ARDC 4HPYH 2D31B 1I3RB 4MD4A 2JJUA 3X3FL 4J2XA 2ZUUA 1V3MA 4Q7DA 5FYJU 2J7LA 4QXUL 5C0BE 1TVBB 3QDJA 5IKCA 3GBNH 2VC2H 1UZ8B 3K74B 5GGSA 1KXQE 1S5HB 1F4YL 4HW6A 4W6WB 2WAHA 3CFJB 4KK6D 2FEDD 4K7PH 4S10A 1P7QB 3IU4L 3U46B 4PRBB 1VGKB 3WNLA 1JHTA 4Z5RA 3U7AA 3QULB 3ARUA 4RFOH 4M03A 3KWWA 3VW3L 3P3YA 3RA7H 3STZB 4ZSOB 4NPYB 5EU6A 5DDHB 1T7ZA 1GGYA 3TA3C 4KVCH 5D7LA 5F96H 5C0AA 1GC1L 2XZCH 2BNUA 4NZTH 5D7JD 1J9CT 2F5BH 5C09D 3RAJL 4DVRH 4OUUB 4WTZA 5J12C 4F7EA 3RZCD 3BZEB 5CJ8A 2GK0B 2VLKA 4RNRA 4MQSB 4KTDL 2CR6A 5H94A 2A9MH 1BZ7A 5GJSL 3WL9B 3LKPA 1BX2A 3QEGH 1IILE 4Y5VA 4Z18A 2Z8WC 1MLBA 4OCRH 3K81A 4ESKA 2XI9A 4NJ9H 2OLDA 2H6PA 5E08H 4QY8A 5AAMA 1Q9OA 4FABL 3B2UD 2AJYL 2W9DH 1R3KA 4FXKA 1G7PA 4KI5D 4N0UB 3HRZB 2APBA 5C09E 1NCBH 5D72L 1FE8H 2Y07H 1BQLL 4OUOA 1A1MB 1T3FB 4PREB 4LP5A 5DMKB 1RUAL 3SGEH 3VXMD 1S7XA 4U0RB 3TP4A 1JYWA 5DMIL 2VDPH 3MGOB 5C0NC 4P4KA 3CDCA 5K9JH 4KI5E 3AAZB 4PJ9B 3QIUA 4N5UA 3V4UL 4YO0B 3PXHA 1Y6MR 4NQCD 5LQBH 3TBWB 4Y1AB 4JY4A 5I1GH 5IMLB 5HSFA 4KHTL 4XCFH 3SN6N 5GISH 3VH8B 1DBAL 1VPOL 5EU3B 5L6YH 3VXME 1XZ0A 4G9FB 4RGMB 5HYSB 1D5IH 3W0WA 5EU4B 1OGTA 1OGAD 1FHGA 4N0FA 2PO6C 4YHIB 5E2VL 2L0DA 4MLIA 1LEKB 2VXTL 3SKMA 1ZT4B 1J0KA 2FEEL 2XN9D 5GGTH 4OZGA 1BF2A 1KTDB 2G5RA 3EAKA 2BY3A 2R29L 4ZFFB 2GCYA 4LEXH 1TNMA 3GNMH 4NT6B 2XA3A 5C0GA 5LWYL 4NWTH 43CAB 1YNTB 2VDML 4YDJA 2B8OT 1OGAE 1HHGA 2AK4B 3KPRD 2CXKA 5IVOA 3SE9L 2B1HL 3D25B 4L9LB 3DETD 3GMMB 3CFDA 5FKAB 2HLAA 2YA1A 5IG7A 4JCLA 1DUZA 4UOJA 1JP5A 2BXZA 1YPZE 3CX2A 1KIQB 1MCFA 2G2RA 4HIJB 3MYJA 3RNQB 1CLYH 4R4FH 1IAIM 3DBXA 1QHOA 5CBAA 2PN5A 1FV1B 4U1MA 1AGCB 4FQQB 2N7AA 4DW2H 4TQEL 2BRRL 3QQ9D 2BJMH 2CGRL 1W0WB 4GRLA 4XPBL 3WJLA 2GEEA 1LE9B 1EO5A 2A38A 1L4IA 1LK3L 3O3DA 2VZ3A 2FIRT 2EIBA 3JSSA 3WHXA 4OBSA 3SCMA 4XC3L 5DUBA 3QDJB 2HWZH 5LCVH 1IZJA 3TIEB 4APQB 4DAGH 3P11H 4P23C 3S36X 5I66A 3KG5A 5I0DA 4G3YH 2NLJB 1WITA 5EOTB 5EZIL 4LSTL 4XP6H 5C0JB 2XPGA 1KCUH 4RDQF 2Q8BH 3KLHC 1YEEL 3DUUA 5DTFA 5MEND 1X5KA 1QR4A 3L3DA 4JG0H 4L4VB 1JHTB 5JDSA 4DQOL 1DL7L 1IE5A 4X98B 1UJTA 1EEZA 1E4JA 5EU5B 4BZ1H 3IFNL 1R3JB 4F7CA 2DDQH 5CJQH 2IBZX 3UBXA 1UM5H 2WQRA 1R3HB 5T3ZD 5D7LB 2DQEL 5J13C 4OCYL 1TPXC 1WTLA 3QXWA 5MENE 1XF5B 4QRPA 4F7TA 4YGAB 4TVSa 4RNRB 4O2FA 3IXAA 3CU1A 4PJDA 3RUGE 1MPAH 3I84A 2DWDB 2X4QB 3FONB 2NXYC 3S3SA 1DE4A 5HYIA 1JRHH 1MLBB 5IROC 3JV0A 3DURA 4ACPA 1BEYL 3MCLL 1U8HB 2E5EA 3AM8A 2KBGA 1I9RL 5FKPB 5BZDA 5E5MA 1ZVSA 3FTGB 3ZTJH 4OFYA 1IGFL 4XNMB 3SHSA 2ATKA 4JM2C 5FYKL 5ISZD 1BF8A 1REIA 1YY8A 3GRWL 4JFDB 2JJVA 3QQ4B 4OV5A 3FO2A 3BIBX 4ZTOL 3ALXA 4X7TB 4JDZB 3KXFD 4LPTA 1C1EH 3O6FB 5DJAA 3D69A 3JVGA 2ICES 4NUGL 3GSNL 5ISZE 4Q74A 1MVUB 4P5TC 4H8WC 4X99A 1JF5A 1NMCC 4MX7A 5GIRB 4NZDA 4ENED 3HA0A 5HDBE 1XZ0B 4OGZA 2OXHA 2HLFC 4RMTA 2NY3B 4JQXA 4A6YL 1CLOH 3TZVD 1MREH 1A6AB 3QIBB 4S1DD 4N0FB 5T1MB 5CGYD 3KXFE 5GHWH 1NFDE 3GB7B 1WF5A 2C5DC 2ZOKA 1FL6B 3P4MA 4E0RB 4O4YH 5MHSD 3O8XB 3IJHB 4OZGB 3BESR 3WN5C 4WO4D 4JFFA 1T0PB 3ME0A 1N64L 1BMGA 3T2NL 5IFJB 3FMGH 4ZOEA 1TENA 4YDJB 1AXIB 2FSEA 5E2UH 4XB7A 1V7NH 1FNGA 3TT3L 2AABL 1C08B 1WBXA 5E2TH 4OZFB 3ZKXC 2VN4A 4ZD3H 5JUEH 3WLWD 5IG7B 3RDTB 5MHSE 4C58B 2PYEE 1A6UL 4LHJB 4QNPF 3DO3A 2G2RB 2A6KB 4JM4L 4PJIE 5DF0A 3HKFA 4MXQD 5KOMC 1B88A 3S97C 1H3TA 1NCWH 2K9UA 2VQ1B 3M17A 4F33B 3CPLA 1FJ1B 2HA1A 4ZS6D 5T3XE 1X5JA 4KZDH 4PBXA 2Z93A 1SVZA 4JGMA 1OAKH 1E6OL 2EH7L 4PYHA 4JGJA 4PGBB 3FCTB 1QBAA 4YHKL 4Y5XC 5EO0B 1UKTA 5B39G 2ED9A 3H3BC 5T3XL 1NAMA 4ZDHA 3V7AG 1YYLH 3L5XH 4TULH 4YLQT 1P1ZA 2CIIA 4OLYL 4ONFL 3LZFL 5IT2L 1MCRA 1NSNL 2HT4C 5HYJA 3O4LB 1P4IH 3RVXD 5DUBB 1KT2A 1FGVH 1F02I 4HX1A 4P59L 5T1KB 2Z31A 1IGTA 1EVTC 1JL8A 4KJPD 1OLZA 3JWOC 2NNAA 3S5LG 5DFTA 4JPVH 3DUUB 4BH8B 2LE9A 3ARBC 1EUUA 5TQ2H 3OKMB 3OX8A 2P47B 4NQDD 4KI1A 4HIEA 1TVHA 4QHKI 3JTTA 2Y25A 4I0KA 1FAIH 3B9EA 5DQDL 3VFRB 1QYGL 3EOBB 1AGFB 1ADQA 4FQXB 1Q8MA 1HSAA 2H41A 4OZGF 4M5YL 3L3OA 4XVJL 2YPVH 2EC9U 3CVHB 4TVPD 1KB5L 3BKYH 1T0NB 4F9PA 1S7TA 3TO2A 2H26A 2N56A 4HXAL 3KYKL 5HI4C 4NQDE 4E41A 3SE8H 2A1WH 4XBPA 2G9HA 2BSTB 3OF6D 4BUHA 1MAMH 5JIPA 4MJ6A 1D9KC 2CQVA 5SX5K 1CDHA 1NCAL 5BZDB 3C8KA 2J8OA 5E5MB 1ZVSB 2E9WA 3QRGL 2ZUXA 3C5ZA 2W38A 3MBEC 4KQ4L 2ZG3A 4XCYA 5ANMA 3RKDC 5LXGL 3S35X 1C16B 1UWEL 3HUJA 5CSBA 1KPVB 1F90H 5L2JA 2IANB 15C8H 1MNUH 3MOAH 3BD4A 1CGVA 5KSAD 4F7MB 1WCQA 3W82A 1A3RH 5TE4H 4Z7UA 1GL4B 5HGGS 3N1PC 5KBNC 4OTXL 4G6AD 3P73B 2IPTL 3TCLA 1W0YT 3AU1A 3ZDXE 4WU5B 5IF0B 4HBQA 1A1NA 5E24E 1TJIL 4GKNA 5DJAB 1FL5B 4NN5C 1OL0A 2YR3A 4JO1L 4KKLC 5JA8B 1Q9WB 1QFWH 4M1DL 5IMOB 2VXVH 4MX7B 3C2SA 2WBJC 1XGTA 3DV4A 1Q0YH 3P0VH 2P5EB 4H0GA 1YEIH 4KXZH 1N5AA 2NY4D 4X5WA 3VRIA 3X13A 4YHZL 3Q6FA 1HHJB 2X4UA 4XHJC 3B9VA 2FJHA 4J3TA 3LEVH 2X5PA 1G9ML 4PJ8D 1NLBL 3FQRA 4Y88A 5H2BA 4XWGL 2CO6B 5DD5H 2ZUQC 2P7TA 3GI9H 3DMMD 5C0CB 1JTOA 5GRVK 4HC1H 2HVKB 1UENA 1EUTA 2FSEB 4CU8A 1FIGL 2FYYA 3IDYC 4PJAA 5J0BA 1H8NA 1FNGB 2Y06H 4NC2B 4HLJA 2AJVH 3DGGA 5JNYA 1MFDH 3CK0H 1MAJA 3CXHK 3QB7C 4RAVB 3LKNB 5DK0B 1U95B 1UACL 5KG9B 5F1NA 4ZYKA 2OM5A 1OQXA 4PJDF 4ZODA 1N0XL 1ZS8B 1CBVH 4EUPH 1ZA3A 4TSBH 3EUUA 3WEXB 2DN7A 3M17B 4LIQH 2PW1B 1YY9D 5DFWH 5FOJA 1FYTE 4WHTA 5IV2B 2R2BB 3JZ7A 4ETQB 5FFLA 3UDWA 2Z93B 3DYPA 4RGOL 1BGXL 3NGBB 5HI3C 5LGHH 5FYKU 1OD9A 1I9EA 3BHBA 2EZ0D 4HK3N 2E7LC 4YZFE 2BX5A 5M95B 1UYWL 2VXSH 2DJSA 4QYOA 1ZWIB 3V4VH 4YC2B 4DFHA 2APXA 2ENYA 4HMEA 1GPOL 1U3YA 4HWEL 4MCZA 4C4KT 5HYJB 4NFDA 5DSCA 5H35A 4P99A 4HX1B 3V6OE 4MAYC 5BV7C 2OYPA 4G7YL 4RDQG 2XWTB 3EOTH 1MI5A 5E6IB 2X2YA 3V5DA 3VH8G 3IDNA 2NNAB 3WFHB 4AH2B 5HYSG 2PXYA 1FFOB 1A4KB 4RQQB 4DGVL 3V5HA 4JHBA 5K9KA 1H5BC 5HDQL 1A7OL 1KEGL 4G8IB 2DJUA 3BGMA 4JO3L 1MF2L 4YBQC 4HWBL 1K85A 1XF3A 2DQJL 1TVHB 3GMQB 2YD3A 3I6LE 4LLMA 5E8OA 5FCSH 2R8SL 2QHRH 3OPZH 1UM6L 1FG2A 3LSOA 1LO2H 2JCCE 4MDJA 3O3AA 4KY1L 1KV3A 1HSAB 5TDNA 3UPRB 5D93C 5SX4H 3TO2B 3ZT7A 3AXLA 1ZKAA 3GO1L 1HEZB 3TC9A 1MUJB 4CNIA 3D0LA 3D3VD 1UJ3C 1EBAA 1HHKB 2DKSA 2UVFA 5D96B 1AD9B 1CFNB 1T03L 3QUMH 3HE7C 2OR9H 3MODH 4PB0H 5IW3A 3F7QA 3BZ4A 1KPRA 1HZHL 1NQBA 1AY1L 5GPRA 3C8KB 3NFSH 3JXAA 4OQTH 5GS1A 4DN3L 2DTSA 5BXFB 1ZE3C 1HI6B 2X4SA 4BZ2L 1T21A 3IGAB 4X8XA 1YA5A 3H7BB 5F7EH 1M7DA 3D3VE 4PY7A 1YEDB 2F74A 3KR3L 2PO6D 2BVQB 1S7UB 4FQ2L 2VDOL 1SJVA 3OB8A 3HNVH 2Z8VC 1WBYA 1YMMB 5CGMA 4AENB 4F15B 4KV5E 4Q0XL 4AT6A 1ZHLB 1QSFB 4Y2DA 3O6LH 1D5ZA 3QHFL 1LO4H 3H9YA 4A2LA 1KN4H 1XGTB 1RJZA 2YRZA 5FM8A 1EGJH 4XMKH 5DHVH 1N5AB 3ARGB 3VRJA 4X5WB 2A6IB 3VU2A 4GLRH 4MXWH 3ZYOA 3OZ9H 3VXUB 4D9RD 3GMNB 5CD3B 5I6XC 1X7QB 1OD7A 2AI0H 5H2BB 4HS8H 4QOKA 4NZRL 3TJEH 1XFPA 3SGEI 2YD7A 5DZNA 3TT1L 1RIUL 5ILTL 5EIIA 3T1FB 3FQXA 2EDHA 1A7QL 1EXUB 1YDPA 3OG4B 1XMWA 5JNYB 4J6RH 1YEGH 4WW1B 4KKCC 1B0GA 1CGWA 5DJCB 2B4CC 4JRYD 4WW2A 2MCPL 1AQKH 4K71C 3FRUB 3BE1H 4YXHH 3T0DA 5IB2A 1BPVA 4XC1H 5F1NB 3MV01 2OJZH 2X10A 1NC2B 1H15A 1UWXK 1CICA 1BFOB 2VQUA 1Z2KA 4Y4HA 2E8YA 3HR5B 4K7PY 4S2SA 4P2RE 4JRYE 3ILPB 1HN1A 3O3EA 5GJTL 2UZIL 4TVPH 3RL1A 5IWLA 1AIFB 1ZGLA 2DQCH 5EUKB 4E5XA 3HUJF 4ZQKA 2Y5TA 4Z7WB 2X1WL 4XVUC 3E8UL 4NRYB 5TPWL 1BQUA 1GGCL 4MCZB 4MJ2A 4S1QH 4NO5B 3PWNA 5JW4Q 1FDLH 1MY5A 5H35B 2DAVA 2AEQL 3M1BA 3IKCB 4WI7A 4X9GA 1MI5B 4BQBA 1I9IL 1VCAA 3QHZL 3G5VA 1FC2D 4LGSB 4KROC 4NCC1 4NSKB 3GJFA 4EI6A 5CEZD 2DD8H 1U0QA 4GQ9H 4Z95L 4N1HB 3V5HB 3LQAC 3SDCC 3TF7C 1RPQA 3GSWA 3L7EB 1PQZB 5KSVB 5I75C 1PGRB 3RWFA 5FGCE 3ZTNL 1WQVT 5MP6L 1R5WA 3EYOA 2ICEA 3PWPB 4LLMB 1MWAL 4ZFOL 4IJ3B 1I1AD 5TH2A 1FG2B 43C9B 4LSSH 2SEBA 1OPGH 3QUKA 3O9WC 1LGVA 5CEZE 3G6AB 3LRSB 3QEHA 3ZYJA 4M62H 1G1YA 2NY1C 4PUBL 5I8KH 2F8VA 1Q9KA 1JZ2A 3LHPL 4G6KL 4PRHA 4NN6B 1NBQA 3EW3B 4M7ZC 4OZFG 1SEQH 3HC0A 1IBGL 3GZKA 3S36L 1HXYB 1DBJL 3UX9B 4WUKL 5D6CA 4HPYL 5C08D 4D9LH 4FQIH 4HUWB 2GUOA 2R4RH 5CP7A 4Y2OA 3ARPA 4UDUA 2VLJA 3KHQA 3QJHB 2NY6B 3ES6B 4WNQB 1JHLH 3BP6A 4ELKA 4DOHB 4P5TD 4PJ5B 1F5WA 1MOEA 3DWTA 4R0LA 5DVOA 4IRSB 5AYUH 5J9PB 3GBNL 5IEKB 2VC2L 2XXMB 5D8JH 4JFZH 1KPUA 1P6FA 3G6JA 1Z9MA 2HLFD 4TSCH 2ICCA 4YK4C 4PY7B 4HUVA 1NFKA 4PG9A 4K7PL 3QZWB 5FYLD 1MH5A 3FFCE 2IAMA 4UINH 4PRID 3AGVA 2C26A 4H0IA 4RFOL 5HD8D 5IIEB 3ARFC 1FBIH 2IH1A 1NL0L 5IK3A 3SE3A 5HHOE 4Z7WF 3LEYH 1XIWA 3TH4T 2GJ6D 4MVBC 4KVCL 1AR2A 1D5ZB 5F96L 2VKWA 2XZCL 4NZTL 5SWZB 2QQQA 3SDAB 1G7HA 5KVDH 1JRHI 1XT5A 2Z92A 4N8CH 5D7IB 1ERNA 3K4DA 1RZJC 4M8QB 4DVRL 4FQJH 3Q0HA 5FYLE 2V2WA 3RWCA 4X7SL 2A9ML 5T1LB 2YRLA 3BAEH 3QEGL 4HK3J 3CH1B 5JIHA 4OCRL 1EDQA 2AXFA 3IFPB 2GJ6E 4NJ9L 3MRGA 3UTTD 3D9AH 4JHAH 3LB6C 4OF0A 1BBDH 4OM0H 1A3LL 2W9DL 2YD2A 3MLXH 4F58L 3WIFA 1WT5C 1T7VA 1NCBL 1AR1C 3VFVA 4E42A 4AZ8A 5HGBB 3CZFB 4MB3A 3BDYH 4HH8A 4KZEH 2LAAA 1YDPB 4JFEB 4CDHA 3DIFB 1NEZA 3RWDB 1DUYA 3A6BH 4U3HA 4L29A 2OL3A 4MJID 1CN4A 1JV5A 3SDYL 2PW2B 4UV4H 2VSCA 3G5YA 4IDLA 3VI3F 5IB2B 4HUKB 1DDHB 2VDPL 3OXRA 1JNHB 2X6MA 1SJHB 1H15B 2HT4D 2YHGA 2VL5A 5E5UB 4I0CC 3LS5H 3S34H 2BDNH 5LQBL 5I1GL 3UXFA 4NQXB 1S7VB 3V4PH 5GISL 3C60C 5L6YL 4MJIE 1UC6A 3CDGA 3U1SH 4OGXH 4N0CD 1D5IL 3Q5YA 4FFZH 1VB9A 4OFIA 4PJGA 4ZAKD 1C12A 1S7RB 4PRPE 5F6HI 2A83A 3REVA 5C0BA 3CFKA 3BZFA 5LAXA 5GGTL 2YZ1A 3D39E 5I1LA 3ULUF 4MS8D 1EK3A 4OV6F 4LEXL 5A16B 1I8MA 3GNML 1LWRA 2FATH 1RSFA 1W72H 1WEJH 4HK0B 4NWTL 2DMCA 3LKQB 4PR5A 4OD3H 4Y16C 5IW6B 1DBKH 3TN0A 1LO5A 3K2UH 1Y18B 4JG1H 2EC9T 4L4TE 3BSZH 4FQCH 4Y19A 1B3JA 4LPWA 1XGUA 1S9WB 5D7IF 4N5EC 4IRZH 2YPKA 2R1WB 1PKQE 32C2A 3FB6A 4LDOB 5MEPB 1AFVH 1CLYL 4R4FL 2ZSWA 3S96A 5C6WH 4NUJA 3O6KH 4NBZB 1AHWC 4HIHB 4C4KO 4DW2L 3FZUC 1Q9KB 1DANU 2BJML 1MQKH 5K59E 3QXVA 4KHXH 1O0VA 3SJVD 1JPGB 3B8SA 2RGSA 1FO0H 1V3KA 2GUOB 5F7DA 1U93B 4HUMB 1JZ8A 1CDJA 5SWSD 5EO1A 3ZMRA 4MNHA 4QF1A 4EI5A 1KJVB 1RZGB 3WUWA 4DGIH 2R1XA 4GW4A 5LCVL 4PJXE 1RJCA 1NKRA 4DAGL 3P11L 1B9ZA 1KPUB 4R4BA 4XBGA 3BEWB 4XB8A 4G3YL 3SJVE 5EC1A 5JO5B 4XP6L 1HILA 2Q8BL 1S7WB 1LEGB 2J2ZA 1GGIH 3FHAA 4M1GH 1BLNA 1CFBA 4JG0L 4JFPA 5JHLH 3QSKB 2VDQL 2KPNA 4S0SD 1QEWA 4BZ1L 2DDQL 5CJQL 5IK3B 2RHEA 1UM5L 1XIWB 4FMKA 5FUCE 1OM3H 4RISH 3NIDF 1IKFH 3VFPA 3MR9A 3MRBB 3BKCH 1NMBH 4OD2A 1BD2D 1F6AA 4NYLB 4D9QD 5E4EB 3VMOA 3LV3A 1MPAL 1KIPA 2N1KA 2EIDA 2VLRA 4BQ8A 4JVWA 1JRHL 5C07D 2ADIB 2DTMH 3NIFF 3H9HA 1EV2E 2R0KH 1H8OA 3J8F7 1MJ8L 1K5NA 2EE9A 5FM5M 1S9KC 2D03H 3MRIB 2R0LH 5F9AC 5TDOA 1LD9B 4O5LH 3WIHH 4E42B 2X4PB 4I18C 5F88A 4JRXD 1IMHC 3TBTB 3I6GA 1YPZA 1NEZB 2OTUA 3MX0A 3P9WB 4L8BB 1I1FA 1JPSH 4JHWL 4DK3A 1JV5B 1DN2A 2LU3A 5IEHB 1GIGH 5BZWB 1EEQA 1QFWI 2VDLH 1N2RB 3VFOB 3MCG1 2F53A 1A6TB 1C1EL 4P2YA 4U1SB 3P0YH 4MAYD 3C08L 3FB5A 1MAKA 4JRXE 4P2OD 1FCCA 5EUOE 5EORH 2R69H 3QEUA 1XGYH 4XVSH 3NABL 2F58H 3CDGB 4QRRA 2MPAH 5EBLB 1CLOL 4M02A 2DQTL 1ES0B 1E27A 4I77H 4Q6IB 3HAEH 3REVB 2IJ0C 5GHWL 5C0BB 4Z0XA 3L5WB 3P4OA 4YBQD 2IALA 1DLHA 4O4YL 4JLRB 3PDOB 4D8PA 4FZEL 4KAQH 2FH8A 2GT9A 2VITA 4U6VH 1NCNA 4BFIA 2HJFA 5FGRA 5DRWA 1UB5A 4G6MH 2OZ4L 4H8WH 1WZKA 5E2UL 3B9KA 1V7NL 4C59B 3BPOB 1OT1A 5E2TL 4ZD3L 5JUEL 2OJEB 3HE7D 2DBLH 1W8OA 1XGUB 1YC7A 1A6VH 1MCCA 1F3DJ 3WNMA 2CRYA 2W0FA 1IEHA 5JW3H 5IJVB 1E4KA 1IEBA 4K3DL 3S96B 4LCUB 4X4XA 4XTRC 3L3GB 1NCWL 1NGYB 4ISVB 1QFUH 4Y7MA 5EFIA 1CFTA 4PJFE 2PR4H 4BSJA 3PWJA 3RUGA 5HJ3B 5FGBA 4KZDL 1OAKL 3K80A 4IMKC 4I2XB 3UJIH 3ZYIA 5DQ9B 3HE6D 1VFUA 5D7JB 5C6TH 4TUJA 1QRKA 5C09B 1YYLL 3L5XL 5I74C 3RZCB 3GSUB 2VN7A 4Z78B 2W07A 4ODWB 3D2UD 1JGVH 1MHHA 4BH7A 3X14A 4XAWL 1QA9B 1P4IL 2XICA 1RUKH 4U0RC 1JGDB 3PUCA 4QT5B 2IADB 5EB9A 3MUGA 5D1ZD 1U58A 4DUXA 5DRNB 3NCYS 3GSNA 3SGKC 5T1DH 1T1XB 3VWKD 1VADA 3PABB 4PJ9C 4HKZA 5ICZA 3H3KA 2R23A 1BLNB 2FR4A 4JFPB 5H37G 5CGTA 3INUH 4A6YA 4HT1H 3RGVA 4QCIB 4XXCA 3RX8A 5KSBA 1FVEA 3CGTA 4RGMC 1FAIL 3VXMB 4JAMA 2FHFA 1TCRA 4PP2B 4DGYL 3HI6H 3PHSA 2YPVL 3PG2A 5CP3A 4OD2B 3BKYL 1F6AB 1PSKH 3JWOH 2FECI 3DHJA 1J0ZA 1T1ZB 3LV3B 4NQCB 5FO9B 4NO0D 4OT1H 3AMKA 1WZLA 3SE8L 1QSED 2A1WL 5AWNH 1DN0A 1KJ2H 4WWKD 3H9HB 5DMJB 1MAML 2DIAA 3UTZB 1OGAB 4X5LA 4BFGA 3R0NA 5FUZH 1BJMA 3ZSTA 3TNMA 4HGKC 1J12A 1L9NA 4WDIA 5DD0H 5L0QC 1F90L 2PYEA 1MNUL 15C8L 3MOAL 3EOAB 4FHBD 1MCOH 1S7SB 3CZJA 4PJ7E 4XVUD 1A3RL 3RX7A 3G08A 4ODSH 3TVMA 1ZLVH 1LVEA 2ADJB 1SJXA 2HG5B 5C6PB 2G5BA 2Q1EA 4U1LB 4RFNB 2QHLA 3E3QC 5EA0H 3R4DA 1QFWL 4XVTH 5K33A 4GLRI 1FCGA 5K9OB 2VXVL 2I5YH 4V1DD 5F3HB 4KROD 4O51A 4LMQE 3IFOA 4P3DA 3VFGL 1Q0YL 3P0VL 4DK6A 3VXPA 1YEIL 3PF2A 1HYSC 3QZWG 4PD4K 4APQC 2HN7B 1A6ZA 4OCXH 3P4OB 3LEVL 4HWNA 1OB1A 2BVOA 2H8PA 4KI5F 1HHIA 3O4OC 5DD5L 3QWQB 3PGCA 4BFIB 4V1DE 5DRWB 3RBGA 3ZKMC 5I1EH 3O9WD 1IGJB 2NYYC 4IOFC 3VXRA 4HC1L 2MTPA 4ELMA 2NY1D 3D0VB 3QPQD 3B83A 2RR3A 2Y06L 1M4KA 2AJVL 1MFDL 1B90A 3CK0L 3ESUF 2OP4H 2C3VA 1KB5A 3EO0A 1J8HD 5IB1B 4R96A 4LNRA 3MNZB 1G6VK 1FLRL 5MI0B 5A3IC 2E9BA 3OJMB 1CBVL 3QO1A 4POZD 5F71A 1OAXH 5MENB 4TSBL 2ADGA 2XG4A 5EFIB 3HMXH 4PLOB 3PWJB 3RUGB 4U6XA 2I60H 3W9EA 2EXWD 4NQDA 1OAQH 3IDJB 1NCCL 4ZFZA 3T77A 4LHUD 2ERJC 5LGHL 4ZUVA 1ZLVK 3MA7B 4K7FA 2NX5D 3X3GH 3FRPG 2VXSL 1YPZF 4TUJB 3V4VL 3BN9D 4UMGA 3ARFD 3BVNA 3N0PB 1QQDA 2OS7A 3KPLA 1MHHB 4N9GB 4LSPH 4UUJA 4PRAB 1KXTB 2XFXB 4Z8FH 2CIKB 4JFOB 1KCSH 5ID0A 2NX5E 3PGFH 1N3NA 3O6FC 4JJHA 4NDMA 4HKZB 3QIUC 4M6NH 2H1PH 1ORQB 1XR8A 1WWWX 4LLAA 4M7JH 1ITBB 3NAAH 4HMDA 5ISZB 3RGVB 1ND0B 3O41B 2JK5B 4IOSD 4RGNC 2G75A 2NY3C 2QHRL 3OPZL 4MB4A 1HIMH 3EFDH 4OIBA 1AR1D 1LO2L 5BV7H 1CFQB 4CN6A 4X9HA 3F7VB 3KXFB 1NFDB 2CK2A 2ZUSA 2IPUK 5CHNA 4ZUUB 3GMOB 4U3XA 4AM0A 4MYWB 1MCJA 2XZZA 4GAYA 1OTTC 3RTQD 4LCCB 4PGCB 1EEUA 3QUML 4RZCA 4Q9BA 2OR9L 5F1IA 3MTRA 3MODL 3DX9A 2QJDA 4PB0L 5IHBA 5KANI 4POUB 2WUCH 4CU7A 2FECL 2X70A 3VJ6B 3TZVB 1X5AA 3NFSL 2X42A 4OQTL 3BO8A 3OV6A 3V8OA 5CCKL 5E1AA 4UI2A 5ESQB 2DI8A 1R5IA 1C5DB 3T65A 3HPJB 3NZ8B 5F7EL 4WO4B 3B2VH 4PJIB 3K2MC 3RUGF 2VO5A 3STBA 2R2CA 1BP3B 5D4QA 3TBYB 1CK0H 1FZMA 3HNVL 3CIQA 1FYTA 5ACMA 1ZHBA 4GRLC 3WJLC 5I2IA 2XQBL 4LKCA 3IAPA 3LDBC 4KKBC 3O6LL 3FQUA 4Y16D 5TE7H 4JN1H 1LO4L 1JNNH 1KN4L 1ZHKB 1ZOXA 3QRFM 1EGJL 5JPNA 4GW1B 1ZT1A 4XMKL 1VFBB 3SCMC 1UCBH 1PLGL 3FQNB 4N5ED 4AQ1B 4YNYB 4MXWL 4X6DE 1DVFA 3OZ9L 3V6OA 3U4EB 5KTEL 2E7MA 2V9TA 1OB1B 1NBZA 2BVOB 2AI0L 5FK9B 1IAOB 4AK1A 3TJEL 5HPMA 2DLGA 1EA9C 1RK1A 3DVGA 4MD0A 3IFLH 1WC7A 4NFBA 4HWBA 3TPUA 5KSBF 1X5HA 3C8HA 2I07A 3FZUD 3J7HA 1VA9A 1JZ4A 5HDBF 3MRNA 1U8MB 1B0WA 1YEGL 4J6RL 4YDIH 4M00A 4OGAC 3U7YH 4HSQA 1MRDH 1DANT 1OLLA 1AQKL 3MRFA 4JZJB 1OP9A 1NFDF 1NUNB 1VSCA 1RHHA 3BE1L 3KPMB 4FQHA 4JRWA 4JPIB 4R96B 4RAHA 4YXHL 4XC1L 4EBQH 4U6TA 2JCCA 3WYRA 1BIIA 3IU3B 3GSOB 2Y23A 3UAJD 5DC9B 1UG9A 4M3JA 1ZXQA 1X9QA 4U7KA 3VGGA 4U6XB 4NNYA 4HS3A 4TOYH 2AVGA 3F12B 4NQDB 2DLEA 1A9BB 2ZOLA 4HGWB 1RD6A 3ZTJG 5D71H 3EJZC 5DC4B 4J3XA 5DRXB 2DQCL 2B4CH 1UVQB 1I8IB 2AP2A 2EDOA 3FT4B 4LK4A 4CVZB 2P49B 4I0PD 4PJIF 5D7KD 3VFWA 2NY5C 1FDLL 1YQ2A 5GS2H 5JW4N 4KQ3H 3QCVH 2J8HA 4WIQA 1ZHNB 2ATPB 4ZPVB 1KXVC 1N3NB 4OZHA 4X6EA 2DD8L 3V2AR 4NDMB 4GQ9L 4PTTB 1H0DB 2C3GA 4OAWB 4P46A 3JVGC 4MCYA 4UDTB 4M6OH 4EEEA 4HIIA 1NC4A 2VR9A 4XXDA 4AIXA 4IS6B 1S8DA 5C70A 3H7LA 1KTRL 2G75B 5KSAB 3QIWD 3ZDZE 2YN5A 5T5FL 3WKMH 4PRDB 4LSSL 5F6HJ 4G8FB 2D7PA 4M1CD 4O2EB 1OPGL 5EWIH 1OCWH 4HULB 1JF1B 5LBSL 4ZPTB 4M62L 3VGDA 1OSPH 1MRCH 5I8KL 4TRPH 2A0LC 3K3QA 1SEQL 4LDEB 4MNGB 1K8IA 5F9WB 3RL2B 3LQAH 3P77A 5DI8B 4D9LL 4FQIL 2R4RL 4GXUN 2BVPA 1QSZA 1H3UA 1UADC 4DCQB 2X70B 3HN3A 1IAIH 4X6CA 4ODUB 2NY4B 2XWBB 2F5AH 1JHLL 4WI5A 3QXTA 3BO8B 5B8CA 3HG1D 3QUYD 2M2DA 4XCEA 5D8JL 4PJ8B 1R5IB 4JFZL 5HGHA 4WU7B 2OQJB 3P9MA 3ULSB 1BVZA 4TSCL 4OGYH 1DCLA 4RAUA 3VDCA 1A9EA 3DMMB 1JHKH 3EZJB 1TTFA 2W91A 1I1YA 3QEQE 4MAUH 4UINL 1FBIL 3NACH 4P2RA 3UYPA 4JHZA 1ZHBB 3HG1E 3NGBC 4X4ME 5I2IB 3B6SA 3LEYL 5ACZA 3CX5K 4ODHH 2OTPA 2D4DA 5KVDL 4N8CL 3TO4D 5CMAA 4FQJL 1N6VA 1ZT1B 3PXJA 1DEEA 1C7TA 2O5XH 4PFEA 2L4OA 5KSUA 1S9VB 5FYJH 4ALAH 4NRXA 3VXQA 1ZSDB 3BAEL 2Z31C 3HMWH 4NJAH 5KZCD 1PG7X 1KBGL 2Y5EA 4TNWF 3ZDXF 1NBZB 5IB5A 3FB8B 3QO0A 1NUDA 2EDJA 1GCFA 3WJJC 3BDXA 4GBXD 4L8CA 4JHAL 4XTRD 3ZO0A 1BBDL 4MD0B 2BY1A 2CRMA 3MLXL 4L1DA 4OF5A 3VG0L 4WTXA 1S7QA 3LD8B 1I3GH 2FX9H 1TETH 2DM4A 1MWAA 2FCBA 4ZFOA 3BDYL 4KZEL 1RZJH 4UU9A 4HXBH 3A6BL 5BMFH 4FTVA 4W4OA 1ZGLP 1CLZH 4EJ1C 4UV4L 1JCKA 2CKBA 3VFMA 1A64A 3VA6A 5J12B 1RIVH 5FOBA 1D5BB 1OW0C 3CXHJ 4NZUH 4EIGB 2DKMA 1BIIB 1X4XA 5L2KD 3LS5L 3U82B 3EYFA 2DIJA 3S34L 4GKSB 2QSCH 2BDNL 5DT1H 5D96C 1LEIA 4OFPA 3V4PL 3GSQA 4UOW1 2IWGA 4YJZL 3U1SL 1RZIB 5DFVD 4OGXL 3TV3H 4FFZL 2Y36H 7FABH 2HJKA 3DX8A 3OKNB 5MERA 1HNFA 3SPVA 4CVUA 5DJDB 2ZUTA 4G43B 4G9FD 2JB6B 3BQUA 4KMQA 3V7MA 2OX5A 5IQ7H 4M7LH 2X40A 1HCFX 3D85D 1NAKH 4LLYB 3D3VB 1WK0A 2FATL 2AAVA 5EU7C 2VRAA 1W72L 1WEJL 4JVUA 5DXWA 1U8QB 3KPSD 4OD3L 1DBKL 4P4RA 2MQ3A 4F15C 3K2UL 3FFCA 4X9IA 3D1MC 3AB0B 1MCWM 1RZ7H 4JG1L 1JF6A 3BSZL 1NBYA 2E9JA 3ETBF 2E27H 4FQCL 4LCIH 4MNQD 5HHOA 4YZFF 4LPYA 1JYVA 4I1NB 4IRZL 4Y4FD 3K8LA 5I8CB 4GOSA 4LAQH 4QRUA 5D7SH 1J0IA 1MCEA 4MWFB 5JDJA 2GJZB 2MWCA 2PO6B 2QADD 5ELIA 2XQYK 3ARGC 1P7KA 4LHQB 1XGRA 1OP3H 3L3KA 5INCB 3O6KL 2IFFH 1C5BH 4ERSH 4X7FC 1D6EA 4MNQE 1AXSB 1UM4H 4YFLI 1P4LA 1MQKL 5CJ5A 3OJ2C 1J1OH 2HFEB 1K8IB 4KHXL 4YR6B 3VXSD 5B38G 4WV1B 3VXTB 3EYVB 1FZKA 3P77B 1FO0L 1T1WA 1OTUC 1JK8B 1IC5H 2DI7A 1ZA6A 1U92A 3S4SB 4GRWH 5F9OL 3ECBA 3BP5A 5DMYA 1IEAB 4G7VH 3RWJB 4DGIL 3BRGC 1OAUH 4B7IA 5LKNA 3SDXA 1IAKA 4QHLA 2JCCF 4ODXB 2P8MA 3LCYA 5FHBL 1YJDC 2HJLB 4XCEB 1A5FL 1T83C 4N8VG 4HKXB 5B3JE 1BVLA 8FABA 5HHPB 1A9EB 2FO1A 1L0XA 5E8NB 1GGIL 4M1GL 5FHAH 1I1YB 2HVJA 2V9QA 1KLGB 2C1OB 5CJOL 5E99H 4ZG1A 1MLCB 3MRRB 3UDWC 2IH3B 4P2RB 2R39A 2APVA 2HFGH 4JRYB 1Z5LB 2NYYD 3L5HA 5ACZB 3EIFA 4IBLT 1U8LB 5GGTA 4NGHH 2W9EH 1OM3L 4RISL 1IKFL 3NTCH 4PRPA 2IMMA 3CSPA 2X1QA 4Y8AA 3ZE1E 5CMAB 3BKCL 1NMBL 3G5ZA 4HUXA 5EU6D 3EFFB 5KSUB 1AO7A 5D7LD 2DYPA 3D39A 5C0AD 5I1CL 3MJ6A 1RVFH 2P43B 4DKAA 4YHLH 5A3ID 2DTML 3DVIA 2R0KL 1N6QH 2VLKD 1YEJH 4KV5F 1OP3K 4PJEE 5F89B 1G6RH 4ZAKA 3F7PC 3T0EA 2PXYC 2X1PA 2LQRA 2D03L 3DRTB 1QLFB 1NH6A 5DC0A 2R0LL 3MRDB 4WHYH 4L4TA 3BOVA 4O5LL 3WIHL 2YOCA 3EYUH 1ZTXH 5FM4A 5EU6E 5L9DH 1CXHA 4KTYA 5EC2B 1SYVB 3BP7B 3HZMB 3AY4A 5FGCB 5J13B 4IJ3C 4TUKH 5F7NC 3QFDA 1JPSL 1TPXB 3QNZB 3X11B 1SVCP 1K9TA 1GIGL 2VLKE 1AH1A 2CKBB 2VDLL 3UP1A 5FOBB 2ZSVA 4Z7VA 4YHYC 2H32H 5CJBA 5ICXA 3P0YL 1FZJB 3MRKB 4GAJH 1XCTA 3A67H 4M4RA 4NN6C 3EYFB 3R0MA 3FFDA 4L4JA 2X05A 4P4KD 5C0IA 5EORL 2R69L 1XGYL 2N7BA 4XVSL 2NY6C 2YD5A 2F58L 3MUJA 3QIUD 2XZQH 2MPAL 1I1AB 3WBDA 3BWAA 4I77L 4IRSC 1XF1A 3SPVB 4ZUWA 1CQYA 4RGND 3LIZL 3Q5TA 5HHMD 4J1UA 3W0WD 4KAQL 5J7CC 1OF2A 4U6VL 3SJVA 5C8JB 3WNKA 3ULUC 5C08B 1JUFB 3KDMA 2BC4A 2EYSB 2YPLE 5T5NF 4H8WL 3RWIB 3DSFH 1N59A 1R5VB 1A2YB 1NDGB 4R7NA 5MEOB 5EBMB 2UY7A 5BW7A 4NKDB 4O9HH 5EBWB 4P5TB 1YMHA 1NMCB 1X5ZA 2DBLL 2BXYA 2D7OA 1A6VL 5HHME 5D1XA 3OAZH 5AZ2H 3W0WE 1T89A 3SDAC 4ODBD 3C87A 2A6DA 3BKJH 4QRUB 3JV4A 4FA8A 3HS0B 1S9XB 3S7GA 5IQ9B 3O2VH 1P7KB 2XKNA 2BOCA 3MZGB 1QFUL 1S9YA 4PRIB 2PR4L 3BUYA 3OR7A 2ICWI 1ZLUH 4BSVA 2AERT 2GJ6B 1AKJA 1KG0B 2JIXA 4B0MM 3UJIL 3L9RA 4L1HA 4P0DA 5C6TL 1U92B 4UT6H 5IBLD 3ZKXB 1WICA 4GRLD 4NZJA 1JGVL 1YEKH 1RK0A 2Z35B 4KDTA 2FB4L 2VQTA 5C3LD 2DWEB 4KKBD 1RUKL 2EIEA 4NKQB 2FO4A 4LSUH 5MEQA 1BQHA 3MLYH 2NTFA 1FFQA 3UTTB 4U1GC 3SCMD 5T1DL 1DBML 3P0GB 4FOMA 4Y4HC 4L3AA 1K2DA 3RWGB 4PLNC 1S78C 4OFVA 1AP2A 1Q94A 2ITCA 3INUL 3L3JB 3Q2CA 4OCNC 2C1PB 4HT1L 2V7HA 2RAMA 3PWVB 1VKXA 4MJIB 1Z6JT 4QO1A 5A2LH 1ROWA 5EN2A 1MJ7H 1K8DB 2C3HA 2R2HA 1I7TB 2VR5A 5CILH 1M6OA 5I0ZA 3HI6L 4OLWH 2VB5A 1QRNE 3ZT5A 1QPPA 4TNVK 3EYSH 4U1NB 5JORA 1U8IA 1PSKL 3JWOL 2OZ4A 4HKBA 2EKSA 3UTOA 5AWNL 1KJ2L 4QRPD 5C2BH 2W65A 3EO1A 4Y8DC 1F45A 4ZAKB 4M61B 3MQIA 3KPTA 2B1AH 4G80A 5IHZA 5FUZL 4L4TB 3UCRA 2JB5H 5DD0L 2NW3A 1FFNA 4HJ0C 1MCOL 1PKQB 2GW5A 3VMPA 4OFYD 3QFDB 4QRPE 3HNTH 3MREB 4JPWH 4ODSL 4PJDE 2FIKA 5J6HA 5FEBA 5ID1A 4PJFA 5GGRB 3QXAA 3QDGA 5ICXB 4HS6A 1TQCB 3TBSA 1Y0LA 1ZAGA 1TJGH 4K3HA 2PETA 2J6EH 2KQNA 4XVTL 5I17A 5D9SB 5C0IB 2AS5M 2I5YL 4GRMA 1JN6A 3TBVA 5DWUH 5ETUB 1FN4A 2FL5A 5C0EA 4FS0A 4S1RH 3A0OA 5J6GB 4OCXL 1AE6H 4PJXB 3BH8B 4N0YH 4OZ4A 4OCSH 3MRQA 4UT9H 3SJVB 1TZHA 3MNVA 2W1NA 5I1EL 2VOTA 1QUNA 4PGZA 3C6SB 3ROOB 1YECH 2LU7A 1N59B 5SWSB 3HZVA 1F13A 3OKYA 3D2UA 2Y1VA 3RVWD 3SE3C 4JFFD 2YS4A 1XIWC 2OP4L 4M5ZH 4IOIA 1G7JA 4XNQA 3JUYA 3WS3A 1YEHH 4UB0L 4GKZA 4P2QD 1I8LA 5HY9B 1IVLA 1YN7A 1DQJA 4J4PC 5F7UA 1OAXL 5C0RH 4G9DA 1TXKA 2YSSA 2BOCB 2VH5H 4MQXD 2VAAA 3HMXL 2XY2A 3D6GA 4HFWB 3BUYB 4XPAH 5DURD 2GAZB 2I60L 5EO9B 1OAQL 3K0WA 4XH2A 4D0DA 4BSVB 3QQNA 2VR4A 3VXNA 5KVEH 2DLIA 3L9RB 4P2QE 1TZGH 3X3GL 5HI5C 2RFXA 3DVNA 5JOPE 5TFSH 4CL7A 5HPOA 3IJSA 2ZG2A 1BD2B 1B0RA 1RK0B 4LSPL 2OXGA 1CTNA 1K3IA 3T0WA 5CJXA 4G42B 2ICWB 4Z8FL 3MRMB 2FO4B 5I18H 1PZUB 3QPXH 4WWKA 4PJ7A 1KCSL 1BQHB 2IPKB 3G9AB 5JIKA 3QI9A 3PHQA 5IVXE 3I3EA 3MMEB 1QO3B 3CUPA 4OCMC 4M6NL 2H1PL 4EN3D 5K59F 4R7DB 1K2DB 2Z31D 4M7JL 1VACA 4GW5B 2GIYA 3RBSA 1JMZA 3WSQL 2DLTA 4JRXB 2DLFH 3NAAL 3QWOB 5EUOB 1JWUA 2VLMD 2Q6WA 1DEDA 2NR6C 1T20A 1JWMA 4WI8A 1HIML 3GJEB 3EFDL 3W11C 5GS0C 1Z9OA 1IT9H 4HEPG 4PJXF 3IF1A 5BV7L 4CJ0A 4XMLH 1CE6B 3LS4H 5DEGB 25C8H 1I85C 3OKLB 4JCMA 4MAYB 2G60H 2QQKH 4HKBB 4HC1A 1IAII 4P2OB 2EKSB 3P9LA 4L8DA 4V1DA 2VLME 2D2OA 3U83A 4LCWA 3HCVB 4B41A 4NO3A 3ARYA 3BMVA 5CBEA 3BPOC 4I3GA 1H5BB 3ESVF 3OMZA 4E41D 4GG8B 3PIQB 1D5XA 4EUPA 1YN6B 1D3CA 4UZGA 3OKOA 4MJ5A 3K4AA 2FEDC 3B2VL 4U1HA 3C5ZD 3E6HA 2ZNWA 3WHE1 1CK0L 1BQSA 3C5SB 2IQAA 3SKNB 3QXAB 3W39A 4JR9L 4QXTB 5C1MB 1BZQK 3C6LA 1H9VA 4OZFH 3HE7B 4JZNB 2WINB 5TE7L 4JN1L 2RCSH 5D7JC 3ZHKA 1HQRA 1SYSB 4GRMB 3RZCC 4LLDA 5ANME 2V7NA 5CWSB 4P3WA 1UCBL 4P5MA 3RJDA 1LE5A 1CT8A 3B4NA 4YDVB 1GZPA 2HMIC 2R0WL 3QT2A 4X4YA 4Z7UE 4JY6A 1J0YA 3MJ7A 4U1KA 4Q9QL 4QXGH 1A22B 3B2UC 3T0XA 3GUTB 4KI5C 1CDGA 3IFLL 1N26A 3HE6B 1HSBA 4YFDB 3RIFF 5EUOF 5HTSA 5AEAA 3KYNB 3D2UB 2IGFH 4E9LA 2VIRB 2GSGA 3NCMA 3VFNA 2MHAA 3L7FA 1DSFH 4YDIL 1CGUA 1M71A 1MHCA 3U7YL 1K4DB 1MRDL 4NQEA 3IVKB 4CMHB 1VFAB 3UPAA 3K46A 3QUZA 4XNQB 3WS3B 5FDWB 5D1ZB 2VAJA 4GKOA 4EBQL 1ULVA 4HKJB 2D4FA 2HT2D 4WUUA 3VWKB 1U8PA 4G9DB 3VFUA 4LBEA 1Z9LA 4UIKH 5I16B 5CUSH 3PV6A 4TOYL 3ZHDA 1IGYB 2DKUA 4XH2B 2UYLA 1PVHA 3OWEA 4OQTA 1U91A 3JV5A 5BCAA 3VXNB 2BVTA 5D71L 2XRAL 5JMOC 2MJWA 3PE9A 4PJAE 5DUPH 2B4CL 4HJGB 3U0PB 5GGUA 2ED8A 3NN8A 3ALPA 3GSRB 2P24B 3Q1SH 5DYOB 5F7WC 3CVHH 4OLZH 3ULVD 5TDPA 4NO0B 3MLRH 1R0AH 4PJFF 4K23H 3QCVL 4LU5L 4WWKB 4PJ7B 4KWUA 2I9TB 4RWYH 2Y9RT 3SEPA 4I3SH 3DETC 1MHEA 5HYQB 5BRZA 1MI5D 4M6OL 1EGJA 3IDGB 3ULVE 2KKQA 1DLFH 3HI5H 4RA3A 1RZ8B 1TTUA 1ETZB 2PXYD 3HAEG 5DD1L 1U3HD 2NY5H 1FNSH 3WKML 2H3NA 1U2CA 3V6ZB 2A6JA 5EWIL 1OCWL 3EGSA 2VISA 1JZ3A 1OSPL 1MRCL 4X6DA 3QNYB 4DN4H 3QQ9C 3HPLB 4TRPL 4H1LB 4RRPA 3PDGA 2EDXA 3O45B 2EKJA 5IBUB 1CDCA 2Q8AH 1HXMA 2D7TH 2YK1H 3CLEH 3R06A 4NM8L 3LQAL 4V1DB 1I7ZA 4KROB 4JZOB 3SKUD 1HYRC 3B9KC 3PWLA 2JE8A 4WJ5B 3SKJL 5JMRA 3ALWA 1XH3B 3BP4A 2XWJB 1IAIL 5E94B 3BWUC 3OR6A 1VEMA 2F5AL 3SBWA 3DOSA 1T1YA 2K1MA 5I75B 1D5XB 3N85H 3NCCB 4K8RH 2F8XC 1H3VA 5MI0C 1CTOA 4OGYL 4UQ2A 1E4KC 1KLUA 3GSVA 3ZL4H 1MELA 2E7CA 3O9WB 3BT2H 1JHKL 2Y6SC 1YUHA 3IB4A 2GYSA 1QNZH 4MAUL 3RWEA 3T2PA 3STLA 3IAQA 1T0MB 1T2XA 1X44A 3NACL 5FF6A 2YD1A 3ULUD 3KPQA 4LRNH 5HBBA 3AREA 3O0RH 3QA3B 1J8HB 1VFOA 5SV4A 5FYJE 4NC0B 4KRPC 3PV7A 3BXNA 4ODHL 2WLZA 1X5FA 4GSDH 2X4TA 5CD5D 1HCVA 3H6JA 1CFVL 2V7NB 4XNUH 4PJBA 4Q2ZA 5J1TC 3WXWH 1PW3A 2O5XL 5GSVB 4L8SB 4Y2DD 2CDGA 1P69B 5FYJL 4NRZB 5CSGA 4L9DA 3PL6A 4PJ7F 4ALAL 4P5MB 3OKDB 5DK2A 5IBTH 3HMWL 4NQVA 4U1JA 3V6FA 3MROB 2X7LB 1JZ5A 4PD4J 3MJ7B 1F8TH 3ARRA 4AIZB 2X1XR 4TN9A 4LHUB 1NGXA 4OLVH 2NX5B 1FVDB 3HLAB 5IMKA 1W2KT 4I4WB 4XI5D 1UT9A 3BGFB 3FB7B 4M3KB 1I3GL 1UQSB 1NAMH 2FX9L 3ARFB 1TETL 4QOKD 3RGVC 1RZJL 2X09A 2CSPA 2GSGB 4HXBL 2MHAB 4WGWB 3RY6A 4XNZB 5BMFL 4GMSH 1CLZL 4MXVE 4WVRA 5J57B 5EDXA 1WISA 4HQQH 4D0BB 3UZEA 2VDKH 1RIVL 4NZUL 5D1QA 1EAPA 3MFFA 3VWJA 4LBEB 3AS2A 1RUQH 4QOKE 4JN2B 2QSCL 5DT1L 4AMKH 1AGBA 2FBJH 2VABA 4ENEC 2GHWB 1CICD 5D2NA 2AK1H 4I8DA 4LRIA 1OT2A 4Y4HD 2BCKA 5CSZA 3TZVC 3TV3L 3WFCH 4S1DC 2Z91A 2Y36L 5CGYC 5KS9A 2PYFA 4ONHA 5GGUB 4NOFA 3WMSA 3NN8B 1ED3A 2O61B 4GXVH 4C83B 1RJLB 1R3LA 4WO4C 3ARDA 2PCPB 5HHXH 5IQ7L 2NY0D 2IC2A 4CN1A 3HNSH 3RTQB 3OG6B 5FB8A 4WTWA 3CVIH 4X5XB 4UQ3A 5C9JB 3GBMH 3QEQA 2BY0A 3OB0H 1D6VH 3PWUA 1RZ7L 1DQQA 1IL1A 3OJDA 4QTHA 3HFMH 3UJJH 3KYAA 2E27L 4LCIL 5ESVA 3WCYA 3CH8A 1U8NA 4TYUA 1HH9B 4YE4L 4U0QB 5CEXA 4CVXB 4LLWA 2UWEE 4LAQL 5D2LE 5D7SL 5JPMB 3AROA 1FNFA 2JELH 3OGCA 5DMGC 3H8NA 4XWOD 2X4RA 3I6KA 1OWWA 1N5YH 2A6JB 4PGDA 5EZJA 4RIRB 3H9SA 4LAJH 2IFFL 1BOGA 1C5BL 4MZ2A 1EO7A 4X6DB 3T08A 4ERSL 3TFKC 3WD5H 1KULA 3TA3A 3LQMA 1J10A 1UM4L 3MRLA 3RPIA 3QUXA 5HGAB 3V52H 1J1OL 2Y7QB 3K1DA 4Y16B 3QQ3A 1MCPL 3F5WA 4XT1C 5DRZB 1BFVH 1IC5L 4WI6A 1PYWB 4IIQA 4PRHD 2P8PA 3DXAA 2XKUA 4G7VL 4LF3A 1OAUL 1E4WH 1KCVH 4JZJC 2VLJD 4XAKD 4JE4B 4Q97A 3MGAA 1KN2H 4YUEH 1KTLA 1OAZH 4LEOA 2NZ9D 5AD0A 5FHAL 4PRHE 3ARVA 3KPOB 3STLB 5E99L 3P4LA 4JB9H 4YQXH 5E8PA 5A2KH 2HFGL 3LKSA 1WZ1H 2IAMD 7CGTA 3MNWA 5GSRA 4NGHL 3OB0K 3T3PE 2YZ8A 2W9EL 3NCYP 1YJDH 2CR3A 3F7RA 3NTCL 3U9UB 4WFED 3T4YB 3X12B 2AV7B 3CCHA 3QDAA 1QR1B 4ONOA 1XIWD 1W72A 3KYMA 3G6JE 3Q5OA 5JOEA 3PL6B 4C56A 1M05A 1RVFL 3Q6GH 4FNLH 4YHLL 3V6FB 2J3SA 5KVMC 1ONQB 3S37X 1N6QL 1YEJL 1G6RL 3UEZA 1CFSB 2P46B 4K07A 3WFZA 2P5WA 4I0PB 4WGVB 5H37H 1ZTXL 5CINH 5L9DL 4PP1C 3WE6B 1XF4B 5E0QA 3REWA 1BVKA 3NCBB 5KSAC 1TMCB 1I7RA 4TUKL 1MEXL 5H8DA 3BEVB 4EZMA 3NZHH 4X6DF 5I1AA 5IP4A 1WFTA 4S0TD 4UAOC 2ITDA 2J8UE 1FO0A 3WFBH 4GAJL 3A67L 2BMKA 4FXGA 2BSSB 4JY5H 1BAFH 2CLVB 4DVBA 2H32B 4EOWH 4F57H 1KNOA 5FAAA 4D0CB 5I71B 3V79C 4NKMA 4LLVA 5E9DE 3QIWB 2XZQL 2E6JA 4NO2B 3LKRB 3OHXA 4ONHB 2Q86B 5DR5H 4LVEA 4KTEH 4JKLA 5F9JA 1R3LB 2NR6D 1B2WH 1INQA 4OSUH 3A6OA 3W11D 3IETA 1I3VA 4IRJA 3U2SA 4R97C 5C0BD 4DZ8B 3NPSB 4ZUTB 2XZAH 4UQ3B 3BD3A 4PG2A 1JGLH 4M4PA 3TLRA 1OOAA 1IL1B 2Z4QA 4O9HL 4BSWB 3MV11 5KN5A 1T04A 1KCRH 3HG1B 3QUYB 3BPLC 3FN9A 4UOW0 2QQLH 3TN0D 3CFBB 4PJGE 5GGVH 5AZ2L 4R6UA 3DVFA 4I5BA 5DHYA 2WIIA 4Y19D 1R3IH 4YGVB 3TH2T 2CDFA 1YY9C 3O2VL 3DX6B 3T3ME 1G7MB 1DVFC 3EYQD 2FJFA 3S98A 3V6OC 4MJ4A 2VWEE 2YRPA 5IB4B 4HV8A 4H5SB 3WIHA 1EFXA 3QUXB 1KSRA 1IQWH 2EZ0C 2DB8A 4PJEA 5INDB 3B43A 3LD8C 1IGML 2QLVB 4YHNB 5JXAH 1M1SA 3CFCH 3PQYA 4Y19E 3TO4B 3BH9B 4UT6L 3GIVA 3OL2A 2HRPH 3O3BA 2Z0BA 1YEKL 4HWZA 1FVCA 4P5KB 5GZND 3ZDZF 3C2AL 2GTWA 5KZCB 5IROA 5ITFA 4LSUL 5BQ7B 1I8KA 4EI5D 4GBXB 3RNKB 4I48B 4JM2A 4XGZA 4HDIA 1SQ2N 2X4NB 5CEYA 2HMID 3BZDA 1NDMA 2EDNA 5HVHC 4XP4L 1U8JA 5JW5B 2CLRA 3HAEA 3X17A 2B2XH 2DQIH 1LNUB 1MJ7L 5I74B 5CILL 5HHNA 1BIHA 2F8OA 3GMRA 4OLWL 4XMPH 4MA3A 5IUSA 4M9PA 5L2KB 1DR9A 1IM3A 3CX5J 4Y1AE 3EYSL 2GFBB 3FKUS 3O11B 3GMLA 1H3PH 4R2GD 4NIKB 1LQSR 1LHZA 4U6HB 2OI9B 4OF3A 1RU9H 3U36B 1MJJB 4AIOA 3I75B 5EZLA 4HWUA 4KJYB 1HQ4B 2YPLA 5C2BL 3AB0C 3VFSB 5IMMB 5CKAA 4LL9A 1T5WB 4F2MB 2B1AL 3LEXB 2VLRD 4X6FA 1GZQA 1CXKA 2JB5L 3W9DA 3WN5A 1BVKB 4LVNB 3D85B 4H1LG 3L95A 5IBUG 3KYOA 4H25A 5E00A 3HNTL 1UXWB 3KPSB 4JPWL 1WIOA 2AJXH 3MJ9H 5IHUH 1JPFB 3V0VA 4GUPB 3LAFA 3Q3GA 4HH9A 2VLRE 2YC1A 4OLUH 2BMKB 5FDYA 4MNQB 1A21A 4FXGB 4FMFA 3I2CH 1TJGL 2J6EL 2FWOA 1AJ7H 1N8ZA 4WV1C 4Y4FB 2F53D 4NKMB 3UTQB 2YKLH 2V2XA 5DWUL 2QADB 4KFZC 1A0QH 5IOPB 1G7IA 1DQDH 1LK2A 3OHXB 4S1RL 4KKNA 3ELAT 5L0QB 2GTZA 4MQ7B 1AE6L 4QRRD 1XF2B 1OVZA 4N0YL 3QXDB 4OCSL 4Y5XA 4OBRA 3N1FC 4LLUA 3EHBD 4GQPH 4KDWA 4IRJB 3U2SB 4UT9L 3VXSB 2F53E 3K4ZA 3NMEA 2L7UA 3K8MA 3GGWA 4OKVB 4UNVA 4WCYH 3OKEA 3FOMA 1YECL 2WLYA 2HFFB 3WV0A 5GRUL 2BFVH 2DOCA 4PV9A 4MD4B 4MGXA 1J8KA 2NXZD 3OSKA 4QRRE 4N1CA 3BISA 1KJMA 4FQLH 3B9KD 2GITA 1YEHL 3SE4C 4L4VE 2OK0L 5GQBA 1JE6A 1QRNA 5IKCB 3ARBA 3UJTH 5C0RL 1U42A 1KJ2A 3UBXI 3NFNA 5L88H 5GGSB 2DJ4A 2VH5L 1G7QA 3DROA 2VTFA 1UXSA 4OQ1A 2FJFB 4XPAL 2H2SC 1OTSC 3O4OB 1N6UA 3MV8D 4MA7H 2FDBP 3JTSA 4EIZC 4CW1A 2Y6SD 3LRGA 1KF9B 4Z5RB 5KVEL 2XQYG 4PJEB 1TZGL 2R0ZH 1NKOA 3KWWB 5TFSL 5FECA 4YDLB 3GIVB 1N4XH 5M7QA 1W0VA 5EU6B 4AYFA 1FVCB 5C0AB 4U6YA 2BNUB 2H9GA 4KRPD 4NKOA 3MV8E 1LDPL 5I18L 4LARH 1J88A 4F7EB 2BP3A 1D9KA 2VLKB 3BPCA 3S35H 1U9KA 5H94B 1BZ7B 1NJ9A 2JF1A 1WFUA 3LKPB 1BX2B 1ZLSH 5DJXA 4Y5VB 3MBEA 2YA2A 3CFEA 1WIPA 4EQ3A 4K9EH 2VLLA 1GSMA 1EO8H 1VFMA 3MV7A 5FYKE 2DLFL 2H6PB 4QY8B 1Q9OB 4JFDE 5ICYA 4Q6YA 2ERJB 1U8JB 4FXKB 1R3KB 1G7PB 4YPGA 1I1AC 1ORSA 2FNBA 1CI5A 1IT9L 1QSVA 4XMLL 3RGVD 1GYAA 3N06B 3U79A 5CAYB 2EDEA 25C8L 5B3JF 3QG6A 1S7XB 1NGZA 4G8GA 2G60L 2QQKL 3GMLB 2WANA 2BHUA 2F54A 2WBJA 4P4KB 1I7UA 3SY0A 4YAQA 1EVUA 2BHZA 3DUSA 3QIUB 2WBKA 1CVSC 4LVOB 1PZ5A 4P49A 5BOZG 4JY4B 5KSBE 3VGHA 5GS0H 5I9QB 4RGNB 5E6ZA 3ZE1F 5HHMB 1U6AH 2D0FA 3W0WB 1A1OA 1OGTB 2NW2A 3FO9A 3LOWA 3HMXA 3L95B 3KYOB 3SKMB 1U8KA 4J3UA 4PGEA 4Y4KD 2PYED 4LQ1A 5HD8C 4GMTH 3UTSE 4HH9B 2GCYB 2MQ0A 2EDFA 4PJEF 1I1RA 5C0GB 5TQ0L 1MFBH 3TVMD 5DA4A 4X9FA 2FRGP 1HHGB 2RCSL 5DJ2A 4LSQH 4P2QA 4X7CC 1WAAE 4F9LC 1T2QH 3CFDB 5T3XD 2HLAB 3FQWA 3RWHA 4JPKH 2BNQD 1EHXA 1DUZB 1NCDH 2P4AB 1EFQA 2A77H 4IDJH 2VDRH 3MRJA 3T0AA 5IB3A 3MYJB 3MRPA 1WUNT 1J05A 4LLUB 5DMGD 3DBXB 5CBAB 4U1MB 5IVXA 4WI4A 4BELD 3FOMB 3O4LE 3LH2H 3U6RA 3QFJA 2BNQE 3TFKD 4GRLB 4ZXBD 2IGFL 3GI8H 3VFTA 5DJ6A 3LDBB 1DSFL 1IAMA 3VXRD 1ACYH 3O3DB 3S9DB 3I3DA 4D2NA 2QKIA 3L3HA 4Y89A 4O00A 3WHXB 1NANI 3SCMB 4B5EA 3GKWH 3EDJA 4EN3A 5E8DH 4U3CA 2EICA 4KMLB 5I66B 1MVFA 1VPOH 4UIKL 3WLBA 5CUSL 2XPGB 4YHOH 3DTXA 3VXRE 2AJ3A 3CC5A 4QHNA 5DTFB 4N0CC 4WHYG 4ELME 2OR8A 3L3DB 4ZAKC 5JDSB 4GG6A 3FQTA 2VXTH 3CAFA 5DUPL 1EEZB 4PTUA 2RJMA 3MV9A 5FO8A 1ZLWH 5TF1H 1P6AB 3KS0J 4F7CB 1CF8H 3UBXB 4XCNA 1E4XH 1IGCH 1FP5A 1F11A 2R29H 3EO9H 3Q1SL 2ESVD 4QWWD 3CVHL 3AY4C 4MS8C 4OLZL 5AUMA 2A74A 2HYMA 3MLRL 3CSYA 4K23L 4QRPB 4F7TB 4F8TA 2AQ1A 4G6JL 2RQ8A 4O2FB 3IXAB 1HH6A 4I3SL 4PJDB 5LGJA 3EJYC 1TQCC 2UY6A 1DE4B 2IANE 3DGCR 4DZBA 3L3IA 5I30H 1HWHB 3VDBA 1NLDH 2ESVE 2V9RA 3DURB 4GO6B 4P9MH 1JI2A 2KZWA 4KK5C 1DLFL 4KJQD 3HI5L 5IVZA 5L8LB 4YPGB 1FFPA 3V0AC 1WZMA 2NY5L 3O2DA 4XCCH 1FNSL 2ATKB 2BSRA 2R9HD 1HDMA 1QHPA 2D3VA 4PP1D 1EBPA 3S88L 2NPLX 4DN4L 1NGZB 1YY8B 4F8QA 4OV5B 3FO2B 4AL8H 2O93L 2Q8AL 2D7TL 2YK1L 3CLEL 4YAQB 5EIQA 3SY0B 4P57A 5KVGH 2IEPA 3D69B 1AGDA 5BW7C 5DHXB 4MD5A 4X99B 2V2TA 1R24A 3MGTA 3RZWA 3BIKA 5D1XC 3N85L 1K6QH 4K8RL 5FUCC 2NW2B 3FT3A 1ZLWK 3ZL4L 1MCIA 4Z6AT 3ARSA 3BT2L 2FJGA 1U8KB 2ZOKB 3SOBH 3P4MB 2AEPH 1QNZL 2VYRE 5IESH 1BJ8A 2HFTA 4Q58C 4ZNEA 1P7HL 4JFFB 3BYYA 5IR1A 1V3JA 3MOQA 3VCLA 4LRNL 2UVEA 3O0RL 5C71A 4LPCA 5EBGA 1JNLH 4P2QB 4CMMA 4GSDL 1WBXB 1FYTD 1RMFH 2HT3C 4OFDA 3TYFA 1PEWA 4XNUL 4KDTC 3WXWL 3DYOA 5DEFA 2DICA 3KLAA 1MCSA 1RJYA 5DURB 5GGQH 1FC1A 3CXDH 3M07A 3MRPB 4JFYA 4ONGH 1EMTH 1F8TL 5DJZA 2ARJA 4L5FH 4OLVL 2E6PA 3CPLB 3TGXA 4HUNB 5T3ZH 3WHE0 4ZTPH 1FNEA 1EERB 1DVFD 1EEYA 3IS0X 3U6RB 1KGCE 3MCKA 4AG4H 3QCUH 3VFTB 4G8EA 5F21B 3GIZH 1NAMB 4GMSL 4ZDHB 3MO1A 2NY2D 5HVWA 3GK8H 1P1ZB 2CIIB 4HQQL 2VDKL 3IJYA 3GSXA 4X7EC 3OXSA 5DD6A 1KT2B 1UKQA 2MKLC 2OSLA 4EN3B 3I6LD 3SDCA 2Z31B 4P2OC 1IGTB 2AXJA 2EDWA 3LKOA 4AMKL 3DO7A 2FBJL 1RUPH 2W0LA 3QH3A 4FZ8H 2Q7YA 2X4OA 1U3HA 1ZT7A 1HHHA 3WFCL 3QNXA 2I26N 4PTUB 3L5IA 3OX8B 2XA8H 3HB3D 4PGJA 1GH7A 4HIEB 1FIEA 3JTTB 4GXVL 2OR7A 1DQMH 4N1EA 1F11B 2VKXA 2F15A 4U1IA 3NA4A 1X5GA 2A74B 2V5MA 5HHXL 3HNSL 2VZUA 3F7YA 5BJTA 3L3OB 1P84K 4JO2L 5FA4A 5F3BA 3CVIL 4S1SH 3BJ91 1S7TB 2AABH 1RZKC 3GBML 2H26B 4Z0BH 4M7LT 3CD4A 3WO3B 1D6VL 1F6FB 1I4FA 4WEMB 4E41B 5DZOA 3HFML 3UJJL 4XBPB 2G9HB 4JANA 1HNGA 4NC1E 1KTKE 4MJ6B 3WDHA 1PBYA 3CLFH 5DJ8A 5J89A 1ZVYA 4JO4H 1HKFA 4FFWD 4P46D 4PB9H 3C5ZB 4LLQA 2LFGA 4RBPH 4XCYB 5ANMB 2JELL 4JDTH 1NC4D 2BSRB 2VMFA 3HUJB 5GRJH 1N5YL 5L2JB 5DJ0A 2J4WH 2YD6A 5IVXF 4LP4A 3WD5L 1JVKA 4Z7UB 3W5NA 5T3XH 4QKXB 1FL3A 3V52L 1X5IA 1KYOK 1LP9A 3KPPA 3HE6C 1QG3A 4OZHE 3TCLB 3AU1B 5F8QC 4ZO7A 3W2DL 1YYMH 1A1NB 1BFVL 4P57B 5F97E 3TESA 2FLBT 2W60A 4GKNB 3U48A 2M8XA 1UFUA 3BW9A 1T4KA 2AJZA 1EH9A 2V2TB 4CMHC 4XRCA 5KAQF 1E4WL 1KCVL 3DV4B 4NHUA 4P3CL 2EYTA 5D1ZC 3HZKA 2MCG1 3VWKC 1KN2L 1WT5A 3N50A 3VRIB 3X13B 5C0FA 4YUEL 1MCBA 3Q6FB 5IM7A 3N9GH 2X4UB 2FJHB 2ARWA 1OAZL 1EPFA 4R8WH 5IW1A 5TE6H 3FQRB 3P4NA 5LGKA 4Z7NE 4JB9L 4YQXL 1F3JA 3S6CA 4Z77A 4HLZH 3VGAC 2P7TB 4YXKH 5CZXD 4YIQA 1WZ1L 3PHOA 5FV2A 4XVJH 3ZYZA 2FYYB 1AC6A 4PJAB 4X6CE 1KB5H 3UC0L 1EHNA 3DGGB 2DQFA 4P2RD 5GGVY 4GS7B 5FGSA 5CJXC 4PLJC 2XY1A 3KLAB 1EHAA 4ZYKB 5E2WH 5TGBA 5JLZA 3Q6GL 3E2HB 3C60A 3UMTA 4FNLL 1YEFH 4WWKC 2IBZY 5J3HD 2K3TA 5FA3A 1K4CA 3QI9C 1ZA3B 5J1SC 2B0SH 3MUHL 4FP8H 2WUBH 4WHTB 1EEYB 1NBVH 2H2SD 2WQ8A 1OTSD 5CINL 4XZUA 4FXLA 4PY8I 1T80A 3I9GH 3BHBB 4U2YA 3QDMA 3Q48A 2UWEA 5C2UB 4QYOB 5D2LA 2IPTH 2NQCA 2EE2A 2EH8H 2O26U 3NZHL 3IJYB 5ADOL 3IRPX 3GSXB 3CU7A 5DSCB 1UCTA 4Z7UF 4FTVD 2OSLB 5A1AA 2C7UA 3WFBL 2GY5A 1XGQA 2AQ2A 3QAZB 4JY5L 1BAFL 3V5DB 4LVHB 4EOWL 1QACA 3IDNB 4H20H 4F57L 2CUMA 1GAFH 5CFHA 2D7MA 4P48A 1CVRA 2PXYB 1X4YA 1QVOA 1U3HB 3ZZ1A 2XYCA 5K9KB 1AHWA 2A2QT 3BGMB 4M48H 1I1CA 5DR5L 4FTVE 1XF3B 4KTEL 4LNVA 3IDIA 5E8OB 1B2WL 4EDWH 4F3FA 5BVJA 2IBBA 4OSUL 3LSOB 3MZTA 5TDNB 4MDJB 3O3AB 3TJHC 5JHDE 2Q76A 5F3BB 4YHYB 2VXQH 3BQUD 4DOHE 3AXLB 3QPQC 4PJ5E 2DL2A 1JGLL 4HUUA 2OTWA 1TZIA 4LASH 5B39A 3MJGX 4CNIB 3D0LB 3C6LC 4PJAF 4LKXA 1AQDA 1KCRL 3BZ4B 1KPRB 4JANB 2QQLL 4QRQA 5GGVL 2MMXA 3FFCD 3SGDH 1LO3H 1SEBA 3RI5F 1J7VR 4BFEA 4POZC 5GS1B 4NBYB 1R3IL 1FLTX 1Q9LA 1X6NA 4L8SC 1CR9H 5HHOD 2EE3A 2X4SB 1T21B 2YWZA 4YHMH 2EXWC 4RGOH 1FH5H 1M7DB 3S5LA 2F74B 2BNRA 1NUGA 3VGFA 5E5RB 4QHMA 1IQWL 1P4BH 4CADA 1WBYB 4MSWA 3PJSA 3BGFC 3BN9C 5HGDA 5JXAL 3CFCL 3RA7L 4CU6A 3ULVF 2CDEA 2YEZA 4AT6B 5GXBB 5FO7A 1MIMH 4LCYA 2HRPL 4R4ND 4Y2DB 4XNZC 4OM1H 1X3DA 3QUZC 1RJZB 2F5BL 3G5XA 4OF8A 3VRJB 4PPTA 5EPMA 5HVFB 4JFEE 2J8UA 4I18A 1MY7A 1E28A 2DQJH 4JQIH 4QOKB 3IXTA 1KIRA 4X9BA 3UBXG 4Z76A 5E08L 4JKPH 3T8XA 4KH2A 3FO1A 5E9DA 4KY1H 3TH3T 4KVNH 5EIIB 1FE8L 2B2XL 2P45B 5JOFA 1T66C 2Y07L 4XHQA 2DQIL 3FQXB 3MJ8A 1MCKA 2I9LA 3VE0A 4LQFH 4YBLC 4XMPL 2DQFB 3SDXE 5IVNA 1B0GB 2BVUA 2CPCA 4WW2B 2ZCHH 5E03A 4QGTA 2D31A 1I3RA 1T03H 1H3PL 2DLHA 3RTQC 4PRPD 1RU9L 5K9JL 4U1GB 1CICB 1FPTH 5FA3B 2NMSA 4Y4HB 1AO7D 1TVBA 2DYPD 3D39D 2EECA 1UZ8A 4S2SB 1DTUA 4XCFL 1RURH 1S5HA 4OJFH 1WCBA 2VZ1A 1JTPA 2DIBA 4OIIH 3O3EB 3CFJA 3RL1B 3FN0H 1FNAA 1URLA 1F42A 3T0ED 1ZGLB 4E5XB 2NY0B 1P7QA 4ZQKB 3VD4A 3U46A 2Y5TB 4PRBA 1VGKA 5D2LB 4L4TD 3QULA 3PWNB 1AO7E 3PP3H 2AJXL 3STZA 3MJ9L 4ZSOA 3P2TA 4NPYA 5IHUL 1PDKA 4Y5YA 5DDHA 3M1BB 3I2CL 3G5VB 3HHRB 4NQTA 1AJ7L 4J3OC 3T0EE 3GJFB 4EI6B 4OUUA 1A14H 3BZEA 3VD7A 2GK0A 2YKLL 4DKDC 3EJYD 2UUDH 1CZ8H 3WL9A 1A0QL 3GSWB 1QLEH 1DQDL 2D9QB 4QHUA 5IGXH 4MXVF 3RWFB 2DM2A 2XTJD 1R5WB 3EYOB 3IDIB 2ICEB 4KK5D 5TH2B 1XEDA 2SEBB 3HRZA 1K3ZA 5ILTH 3QUKB 4Z7VE 3QEHB 4WCYL 1JPTH 1T3FA 2HKHH 4PREA 5BVPH 4CAGA 4PRHB 5DMKA 3HC0B 2BFVL 5D6CB 2XTJE 2DMKA 4LKXB 2DRUA 3EDEA 1PY4A 5CP7B 4UDUB 3MGOA 2VLJB 5HHVH 4FQLL 3AAZA 4WW2F 4YEFA 4PJ9A 1BM3H 1FRGH 3BP6B 4ZMAT 4YO0A 4ELKB 4R90H 2HWZL 4GH7B 3UAJC 2E3VA 4R0LB 1Q9LB 3TBWA 4Y1AA 3UJTL 5L88L 5IMLA 3PL6C 1E6JH 5D1XD 3WNOA 3VH8A 3G6JB 5EU3A 1G84A 4HUVB 5HYSA 3CMGA 4MA7L 1KCUL 4PG9B 1E4XI 5EU4A 3RJQB 1P53A 3I02A 5I1KH 1PAMA 1MH5B 5EOQH 4YHIA 3PP3K 1JNJA 2IAMB 1ZT4A 2R0ZL 3PJSB 1IC1A 2IH1B 1KTDA 4I0PC 5GZOC 1N4XL 2UWEF 5FO7B 5D2LF 4ZFFA 2WWKT 4NT6A 1AKJD 2JIXD 2VZOA 3MOBH 3A6CH 43CAA 1YNTA 3LRHA 1G7HB 2Z92B 4NN7C 2VZTA 4NCDA 2UUDK 4LARL 2AK4A 4J12A 2V2WB 2HT3D 3D25A 4L9LA 3RWCB 1R6VA 5FKAA 2J6EA 3S35L 5EPMB 1ZLSL 4GRWF 4MA1C 4OKDA 5DO2C 2BOBA 4K9EL 1KIQA 3U7WH 2AXFB 1EO8L 2FX8H 3MRGB 3IXTB 5I71C 4HIJA 3RNQA 2DBJA 3FO1B 2CD0A 3QIWC 3WIFB 5E9DB 3VFVB 5JOFB 1FV1A 2IG2H 1AGCA 5JXEA 4M1CC 1CDIA 4FQQA 3MJ8B 3VE0B 2QSTA 4ODTH 4HF5H 4QHKJ 1OARH 2CKBH 1DUYB 2P1YA 1W0WA 4L29B 1GHFH 2OL3B 3THMH 5CEZH 1LE9A 4WUKH 5E7FA 4DJMA 4U05A 2APFA 1FQ9C 2GQHA 3G5YB 2P48B 1F4XH 1S5IH 3RGHA 3OXRB 4OFKA 3NPSC 4YDKH 2VL5B 4UNUA 1UEYA 2C4FU 3S8WA 4XNYH 4BK4A 4RWHA 4O02H 3TIEA 4APQA 3MBXH 1RY7B 5GS0L 3QUYC 3T3PF 1WCBB 2NLJA 4WENB 5EOTA 5C0JA 4H88H 1U6AL 4PJGB 1B6DA 1MREL 1C12B 2WNGA 2A83B 4L3ED 1OQOA 3G6JF 4L4VA 4HJJH 3CFKB 3BZFB 5F7KC 1UA6H 4X98A 3VGBA 5LAXB 5EU5A 1R3JA 4PBWD 5I1LB 1NL0H 4GMTL 4FFVD 4Y5YB 1R3HA 1I8MB 4J3SA 3QUXC 4QTIH 3V0WH 4PR5B 1QKZH 1A7NH 1MFBL 3FMGL 3TN0B 4PYGA 3VGEA 1LO5B 3V6BR 4JQVA 4WI9A 1JIBA 1XF5A 5F93C 3QDGD 4LSQL 4L3EE 3TO4C 4U7MA 5T33H 1WJ3A 1T2QL 5DK3A 4IIQC 1UH4A 4X7SH 4TTDD 4Y19B 4LOUC 4JPKL 2DWDA 2X4QA 3FONA 1NCDL 2YPKB 4QHUB 5FYLH 1CD8A 2A77L 2DQUH 1VEOA 4IDJL 2VDRL 32C2B 3FB6B 4I2XE 3MV8A 1U8HA 2FGZA 2ZSWB 3O2WH 4GBXC 1A3LH 5FKPA 2J8UF 4F58H 4NUJB 3FTGA 1SMOA 4XNMA 3QDGE 3QBTB 4HD9A 1BHGA 3AC0A 3GKZA 1KCLA 3LH2L 2CUIA 3BD5A 3GI8L 3SDYH 4LPXA 4JFDA 4CGTA 2LVCA 2JJTC 3QQ4A 5F7DB 1ACYL 3DPBA 4TULL 4JFXA 4X7TA 4JDZA 5EO1B 4UTAH 3GRWA 1TNNA 4MNHB 4QF1B 1J1XH 3O6FA 4EI5B 3WUWB 2R1XB 4GW4B 4DKEH 1FGVL 3EBAA 3GKWL 3RFZC 5E8DL 1MVUA 5GIRA 4R4BB 4HEME 4XBGB 2OI9C 4TNVF 5EC1B 1QFHA 4JKWA 4WFFD 5F70A 3NIGE 4AEHH 4JPVL 4YHOL 1HILB 5DFVC