2Z3QA

Crystal structure of the il-15/il-15ra complex
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
119
structure length
114
Chain Sequence
AMAISNWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the IL-15-IL-15Ralpha complex, a cytokine-receptor unit presented in trans
pubmed doi rcsb
molecule keywords Interleukin-15
molecule tags Cytokine/cytokine receptor
source organism Homo sapiens
total genus 40
structure length 114
sequence length 119
chains with identical sequence C
ec nomenclature
pdb deposition date 2007-06-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1250.70 Mainly Alpha Up-down Bundle Growth Hormone; Chain: A; Growth Hormone; Chain: A; 2z3qA00
4GS7A 3TGXB 2Z3QA 2OQPA 2Z3RA 2PSMA 2XQBA
chains in the Genus database with same CATH superfamily
1N1FA 2XUTA 1HZIA 1JLIA 5KNHI 4U4WA 4DOHA 4QIQA 3DI2A 1D9CA 2R93D 2B8ZA 1PW6A 1BGDA 1HWHA 1RHGA 3DLQI 5D72A 2R7ZD 1YKBA 1PVHB 1M4AA 3NCFA 2D48A 1INRA 1FG9A 4U4TA 4BBRD 3D85C 5EQIA 3LB6A 1GNCA 4D2DA 5L6YC 1CYLA 4A3ED 1EXZA 1M4RA 2JA5D 3G9VB 4D2CA 1F45B 1QVNA 1HULA 4FA8E 4UVMA 4BBSD 2CYKA 3LB6B 3OQ3A 3HOVD 5A2OA 5D28B 1EKUA 2IL6A 3H0GD 5IYCD 2JA8D 3UEZE 4GRWA 1ITIA 2LAGA 1EVSA 4J05A 2L3OA 1BGCA 1IRLA 1NBPA 3UF5A 1IK0A 2B90A 1IARA 1BUYA 1EMRA 1HWGA 4XNJA 3HMXB 2C35A 3H3VE 1ALUA 2Z3RA 4A3FD 4PS4A 3L5XA 4GC0A 1I1RB 2CFQA 3DUHC 4A3MD 1A7MA 4O9HA 3PO3D 1PV6A 3WCYI 4OAAA 4LDSA 5LQBA 3I4ND 3G6DA 5IYDD 5D6KA 1HIKA 3I4MD 4ZW9A 4NN5A 2INTA 3O7PA 3QT2C 4YQXA 1Y1WD 1ETEA 4JREA 2B8YA 2PSMA 3HOXD 1FYHA 4IKVA 2JA7D 2O26A 5C7XA 3QB7A 1LK3A 4BXXD 5D70A 4YDYI 2B8UA 4BY1D 5EQHA 5C3ED 1BP3A 3WDOA 1RFBA 5FLMD 3IRHA 3DI3A 3L5WI 1RCBA 1BBNA 3BPNA 4OH3A 4NEJA 1P9MB 4YUEC 4IKWA 2L3YA 3SE3B 5TS9A 3PIWA 1A22A 4IU9A 1PV7A 4IKXA 3OG6A 1CSGA 2B8XA 2O6IA 2Q14A 2CFPA 2XQBA 5FHXA 1J7VL 1EERA 5D58A 1M4BA 4A3GD 4IKZA 2D9QA 1Y14A 3BESL 4EXPA 3INKC 2B91A 2VUMD 4APSA 3HHRA 3NPZA 2B63D 1Y6KL 4GS7A 5D59A 2Q7NB 1GA3A 1V7NV 3NCEA 5IYBD 4A3LD 4IKYA 4DKEA 1BGEA 2LMSA 3HOYD 4ZWBA 3HOWD 1Y1VD 5C44D 4NEMA 2OQPA 5IP7D 4WRLB 3D48P 4DKDA 5D22A 3D87A 3MZGA 4A3ID 3SE4B 5EQGA 3QWRB 4JR9A 4Q65A 1WU3I 5D71A 3QAZA 4A3BD 4TPHA 5GXBA 4Z5RD 2Q98A 4IU8A 4XNIA 4ZYRA 3EW3A 1Z7CA 3N0PA 2ILKA 5A2NA 3UF2A 3O7QA 4TPJA 5E4EA 4DKCA 1Y6ML 4TPGA 3TGXB 4GBYA 2H24A 1PY2A 4A3DD 5IP9D 2JA6D 1CD9A 3Q1SI 2B5IA 3BPLA 1BCNA 1IJZA 1ITFA 2HYMB 2Z3QA 4YPGC 3BPOA 4LEPA 1D9GA 4NN6A 3PO2D 4O6KA 4ZWCA 1M47A 3VA2A 1PGRA 3HOZD 1AU1A 4MHLA 1AXIA 4JA3A 3UX9A 1PW4A 3N06A 1CN4C 4X51A 1HIJA 4W6VA 1M48A 1V7MV 1ILKA 1F6FA 4J4LC 2V8NA 1LQSL 4DKFA 3HOUD 4U4VA 1LKIA 4ZS7A 3B5KA 1CNT1 1B5LA 3QB1A 1Y6NL 1ITLA 1M4CA 5C65A 4NKQC 4EXNA 1ITMA 4LRLA 4D2BA 1WCMD 4NI9A 1KF9A 2ERJD 3AYHA 4YBQA 3NCBA 3DGCL 4ZF7A 4A3CD 1VLKA 1RW5A 2O27A 3NCCA 4A3JD 2Y5YA 5C4XD 3PIVA 4NN7A 1SCFA 1AX8A 3OG4A 4GBZA 4CNIC 4A93D 4YB9D 2R92D 1HUWA 1Z92A 3EJJA 3HHCA 1IL6A 2GMFA 1HGUA 4BY7D 4RS1A 4PYPA 2E9WC 3S9DA 5FUCA 4NI7A 2KZ1A 4A3KD 3FKID 4I77Z 1M49A
chains in the Genus database with same CATH topology
1N1FA 3HHRA 3N06A 1CN4C 4X51A 3DUHC 4A3MD 1HIJA 3NPZA 1HZIA 1JLIA 2B63D 1A7MA 1M48A 1V7MV 4O9HA 3PO3D 1Y6KL 3WCYI 4GS7A 5KNHI 1ILKA 2Q7NB 1V7NV 3NCEA 1GA3A 1F6FA 5LQBA 3I4ND 4DOHA 3DI2A 5IYBD 4A3LD 1D9CA 4DKEA 2R93D 3G6DA 4J4LC 5IYDD 2B8ZA 1BGEA 1HIKA 2LMSA 3I4MD 1PW6A 1LQSL 4DKFA 3HOUD 1LKIA 1BGDA 1HWHA 4NN5A 2INTA 1RHGA 3DLQI 3QT2C 4ZS7A 3HOYD 3HOWD 4YQXA 1Y1VD 5D72A 1Y1WD 2R7ZD 5C44D 1YKBA 4NEMA 1PVHB 1M4AA 1ETEA 2OQPA 2D48A 1CNT1 1INRA 1FG9A 2B8YA 2PSMA 3B5KA 3NCFA 5IP7D 3HOXD 1B5LA 4BBRD 1FYHA 3D85C 4WRLB 3QB1A 3D48P 1Y6NL 1ITLA 4DKDA 3LB6A 5D22A 1GNCA 1M4CA 3D87A 2JA7D 3MZGA 5L6YC 2O26A 4A3ID 4NKQC 5C7XA 1CYLA 3SE4B 3QB7A 1LK3A 3QWRB 4EXNA 4A3ED 1EXZA 1M4RA 1ITMA 4BXXD 4LRLA 5D70A 1WCMD 4YDYI 2JA5D 4NI9A 3G9VB 2B8UA 1WU3I 1KF9A 1F45B 1QVNA 1HULA 5D71A 4FA8E 4BY1D 2ERJD 3QAZA 5C3ED 4A3BD 3AYHA 1BP3A 4BBSD 3NCBA 3DGCL 4Z5RD 4ZF7A 2Q98A 2CYKA 3LB6B 1RFBA 1VLKA 3OQ3A 4A3CD 5FLMD 3HOVD 3IRHA 1RW5A 5D28B 1EKUA 2O27A 3DI3A 3L5WI 3NCCA 1RCBA 1BBNA 4A3JD 3BPNA 2IL6A 3EW3A 5C4XD 4NEJA 1P9MB 3PIVA 4YUEC 1Z7CA 3H0GD 4NN7A 1SCFA 5IYCD 2JA8D 3UEZE 3N0PA 4GRWA 2L3YA 2ILKA 3SE3B 3UF2A 1ITIA 2LAGA 1AX8A 5TS9A 3PIWA 1EVSA 1A22A 5E4EA 3OG4A 4DKCA 1Y6ML 4CNIC 2L3OA 1BGCA 1IRLA 1NBPA 3UF5A 4A93D 2R92D 1IK0A 3TGXB 1HUWA 2B90A 2H24A 1PY2A 1IARA 4A3DD 1Z92A 5IP9D 3EJJA 3OG6A 2JA6D 1CD9A 3Q1SI 3HHCA 1IL6A 2B5IA 2GMFA 3BPLA 1CSGA 1HGUA 1BUYA 1BCNA 4BY7D 4RS1A 1EMRA 2B8XA 1IJZA 2O6IA 1ITFA 1HWGA 2HYMB 2Q14A 2E9WC 2XQBA 2Z3QA 5FUCA 3S9DA 4YPGC 4NI7A 5FHXA 1J7VL 3BPOA 3HMXB 1EERA 2C35A 1D9GA 3H3VE 1M4BA 2KZ1A 1ALUA 4NN6A 4A3KD 3PO2D 4A3GD 2Z3RA 2D9QA 4A3FD 1Y14A 4I77Z 4O6KA 1M47A 4PS4A 3BESL 4EXPA 3FKID 3VA2A 3INKC 1PGRA 2B91A 3HOZD 1AU1A 4MHLA 1AXIA 3UX9A 3L5XA 1M49A 2VUMD 1I1RB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GS7 A;  3TGX B;  2Z3Q A;  2OQP A;  2Z3R A;  2PSM A;  2XQB A; 
#chains in the Genus database with same CATH topology
 1N1F A;  2XUT A;  1HZI A;  1JLI A;  5KNH I;  4U4W A;  4DOH A;  4QIQ A;  3DI2 A;  1D9C A;  2R93 D;  2B8Z A;  1PW6 A;  1BGD A;  1HWH A;  1RHG A;  3DLQ I;  5D72 A;  2R7Z D;  1YKB A;  1PVH B;  1M4A A;  3NCF A;  2D48 A;  1INR A;  1FG9 A;  4U4T A;  4BBR D;  3D85 C;  5EQI A;  3LB6 A;  1GNC A;  4D2D A;  5L6Y C;  1CYL A;  4A3E D;  1EXZ A;  1M4R A;  2JA5 D;  3G9V B;  4D2C A;  1F45 B;  1QVN A;  1HUL A;  4FA8 E;  4UVM A;  4BBS D;  2CYK A;  3LB6 B;  3OQ3 A;  3HOV D;  5A2O A;  5D28 B;  1EKU A;  2IL6 A;  3H0G D;  5IYC D;  2JA8 D;  3UEZ E;  4GRW A;  1ITI A;  2LAG A;  1EVS A;  4J05 A;  2L3O A;  1BGC A;  1IRL A;  1NBP A;  3UF5 A;  1IK0 A;  2B90 A;  1IAR A;  1BUY A;  1EMR A;  1HWG A;  4XNJ A;  3HMX B;  2C35 A;  3H3V E;  1ALU A;  2Z3R A;  4A3F D;  4PS4 A;  3L5X A;  4GC0 A;  1I1R B;  2CFQ A;  3DUH C;  4A3M D;  1A7M A;  4O9H A;  3PO3 D;  1PV6 A;  3WCY I;  4OAA A;  4LDS A;  5LQB A;  3I4N D;  3G6D A;  5IYD D;  5D6K A;  1HIK A;  3I4M D;  4ZW9 A;  4NN5 A;  2INT A;  3O7P A;  3QT2 C;  4YQX A;  1Y1W D;  1ETE A;  4JRE A;  2B8Y A;  2PSM A;  3HOX D;  1FYH A;  4IKV A;  2JA7 D;  2O26 A;  5C7X A;  3QB7 A;  1LK3 A;  4BXX D;  5D70 A;  4YDY I;  2B8U A;  4BY1 D;  5EQH A;  5C3E D;  1BP3 A;  3WDO A;  1RFB A;  5FLM D;  3IRH A;  3DI3 A;  3L5W I;  1RCB A;  1BBN A;  3BPN A;  4OH3 A;  4NEJ A;  1P9M B;  4YUE C;  4IKW A;  2L3Y A;  3SE3 B;  5TS9 A;  3PIW A;  1A22 A;  4IU9 A;  1PV7 A;  4IKX A;  3OG6 A;  1CSG A;  2B8X A;  2O6I A;  2Q14 A;  2CFP A;  2XQB A;  5FHX A;  1J7V L;  1EER A;  5D58 A;  1M4B A;  4A3G D;  4IKZ A;  2D9Q A;  1Y14 A;  3BES L;  4EXP A;  3INK C;  2B91 A;  2VUM D;  4APS A;  3HHR A;  3NPZ A;  2B63 D;  1Y6K L;  4GS7 A;  5D59 A;  2Q7N B;  1GA3 A;  1V7N V;  3NCE A;  5IYB D;  4A3L D;  4IKY A;  4DKE A;  1BGE A;  2LMS A;  3HOY D;  4ZWB A;  3HOW D;  1Y1V D;  5C44 D;  4NEM A;  2OQP A;  5IP7 D;  4WRL B;  3D48 P;  4DKD A;  5D22 A;  3D87 A;  3MZG A;  4A3I D;  3SE4 B;  5EQG A;  3QWR B;  4JR9 A;  4Q65 A;  1WU3 I;  5D71 A;  3QAZ A;  4A3B D;  4TPH A;  5GXB A;  4Z5R D;  2Q98 A;  4IU8 A;  4XNI A;  4ZYR A;  3EW3 A;  1Z7C A;  3N0P A;  2ILK A;  5A2N A;  3UF2 A;  3O7Q A;  4TPJ A;  5E4E A;  4DKC A;  1Y6M L;  4TPG A;  3TGX B;  4GBY A;  2H24 A;  1PY2 A;  4A3D D;  5IP9 D;  2JA6 D;  1CD9 A;  3Q1S I;  2B5I A;  3BPL A;  1BCN A;  1IJZ A;  1ITF A;  2HYM B;  2Z3Q A;  4YPG C;  3BPO A;  4LEP A;  1D9G A;  4NN6 A;  3PO2 D;  4O6K A;  4ZWC A;  1M47 A;  3VA2 A;  1PGR A;  3HOZ D;  1AU1 A;  4MHL A;  1AXI A;  4JA3 A;  3UX9 A;  1PW4 A;  3N06 A;  1CN4 C;  4X51 A;  1HIJ A;  4W6V A;  1M48 A;  1V7M V;  1ILK A;  1F6F A;  4J4L C;  2V8N A;  1LQS L;  4DKF A;  3HOU D;  4U4V A;  1LKI A;  4ZS7 A;  3B5K A;  1CNT 1;  1B5L A;  3QB1 A;  1Y6N L;  1ITL A;  1M4C A;  5C65 A;  4NKQ C;  4EXN A;  1ITM A;  4LRL A;  4D2B A;  1WCM D;  4NI9 A;  1KF9 A;  2ERJ D;  3AYH A;  4YBQ A;  3NCB A;  3DGC L;  4ZF7 A;  4A3C D;  1VLK A;  1RW5 A;  2O27 A;  3NCC A;  4A3J D;  2Y5Y A;  5C4X D;  3PIV A;  4NN7 A;  1SCF A;  1AX8 A;  3OG4 A;  4GBZ A;  4CNI C;  4A93 D;  4YB9 D;  2R92 D;  1HUW A;  1Z92 A;  3EJJ A;  3HHC A;  1IL6 A;  2GMF A;  1HGU A;  4BY7 D;  4RS1 A;  4PYP A;  2E9W C;  3S9D A;  5FUC A;  4NI7 A;  2KZ1 A;  4A3K D;  3FKI D;  4I77 Z;  1M49 A; 
#chains in the Genus database with same CATH homology
 1N1F A;  3HHR A;  3N06 A;  1CN4 C;  4X51 A;  3DUH C;  4A3M D;  1HIJ A;  3NPZ A;  1HZI A;  1JLI A;  2B63 D;  1A7M A;  1M48 A;  1V7M V;  4O9H A;  3PO3 D;  1Y6K L;  3WCY I;  4GS7 A;  5KNH I;  1ILK A;  2Q7N B;  1V7N V;  3NCE A;  1GA3 A;  1F6F A;  5LQB A;  3I4N D;  4DOH A;  3DI2 A;  5IYB D;  4A3L D;  1D9C A;  4DKE A;  2R93 D;  3G6D A;  4J4L C;  5IYD D;  2B8Z A;  1BGE A;  1HIK A;  2LMS A;  3I4M D;  1PW6 A;  1LQS L;  4DKF A;  3HOU D;  1LKI A;  1BGD A;  1HWH A;  4NN5 A;  2INT A;  1RHG A;  3DLQ I;  3QT2 C;  4ZS7 A;  3HOY D;  3HOW D;  4YQX A;  1Y1V D;  5D72 A;  1Y1W D;  2R7Z D;  5C44 D;  1YKB A;  4NEM A;  1PVH B;  1M4A A;  1ETE A;  2OQP A;  2D48 A;  1CNT 1;  1INR A;  1FG9 A;  2B8Y A;  2PSM A;  3B5K A;  3NCF A;  5IP7 D;  3HOX D;  1B5L A;  4BBR D;  1FYH A;  3D85 C;  4WRL B;  3QB1 A;  3D48 P;  1Y6N L;  1ITL A;  4DKD A;  3LB6 A;  5D22 A;  1GNC A;  1M4C A;  3D87 A;  2JA7 D;  3MZG A;  5L6Y C;  2O26 A;  4A3I D;  4NKQ C;  5C7X A;  1CYL A;  3SE4 B;  3QB7 A;  1LK3 A;  3QWR B;  4EXN A;  4A3E D;  1EXZ A;  1M4R A;  1ITM A;  4BXX D;  4LRL A;  5D70 A;  1WCM D;  4YDY I;  2JA5 D;  4NI9 A;  3G9V B;  2B8U A;  1WU3 I;  1KF9 A;  1F45 B;  1QVN A;  1HUL A;  5D71 A;  4FA8 E;  4BY1 D;  2ERJ D;  3QAZ A;  5C3E D;  4A3B D;  3AYH A;  1BP3 A;  4BBS D;  3NCB A;  3DGC L;  4Z5R D;  4ZF7 A;  2Q98 A;  2CYK A;  3LB6 B;  1RFB A;  1VLK A;  3OQ3 A;  4A3C D;  5FLM D;  3HOV D;  3IRH A;  1RW5 A;  5D28 B;  1EKU A;  2O27 A;  3DI3 A;  3L5W I;  3NCC A;  1RCB A;  1BBN A;  4A3J D;  3BPN A;  2IL6 A;  3EW3 A;  5C4X D;  4NEJ A;  1P9M B;  3PIV A;  4YUE C;  1Z7C A;  3H0G D;  4NN7 A;  1SCF A;  5IYC D;  2JA8 D;  3UEZ E;  3N0P A;  4GRW A;  2L3Y A;  2ILK A;  3SE3 B;  3UF2 A;  1ITI A;  2LAG A;  1AX8 A;  5TS9 A;  3PIW A;  1EVS A;  1A22 A;  5E4E A;  3OG4 A;  4DKC A;  1Y6M L;  4CNI C;  2L3O A;  1BGC A;  1IRL A;  1NBP A;  3UF5 A;  4A93 D;  2R92 D;  1IK0 A;  3TGX B;  1HUW A;  2B90 A;  2H24 A;  1PY2 A;  1IAR A;  4A3D D;  1Z92 A;  5IP9 D;  3EJJ A;  3OG6 A;  2JA6 D;  1CD9 A;  3Q1S I;  3HHC A;  1IL6 A;  2B5I A;  2GMF A;  3BPL A;  1CSG A;  1HGU A;  1BUY A;  1BCN A;  4BY7 D;  4RS1 A;  1EMR A;  2B8X A;  1IJZ A;  2O6I A;  1ITF A;  1HWG A;  2HYM B;  2Q14 A;  2E9W C;  2XQB A;  2Z3Q A;  5FUC A;  3S9D A;  4YPG C;  4NI7 A;  5FHX A;  1J7V L;  3BPO A;  3HMX B;  1EER A;  2C35 A;  1D9G A;  3H3V E;  1M4B A;  2KZ1 A;  1ALU A;  4NN6 A;  4A3K D;  3PO2 D;  4A3G D;  2Z3R A;  2D9Q A;  4A3F D;  1Y14 A;  4I77 Z;  4O6K A;  1M47 A;  4PS4 A;  3BES L;  4EXP A;  3FKI D;  3VA2 A;  3INK C;  1PGR A;  2B91 A;  3HOZ D;  1AU1 A;  4MHL A;  1AXI A;  3UX9 A;  3L5X A;  1M49 A;  2VUM D;  1I1R B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...