2Z3QB

Crystal structure of the il-15/il-15ra complex
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
81
structure length
81
Chain Sequence
b'AISITCPPPMSVEHADIWVKSYSLYSRERYICNSGFKRKAGTSSLTECVLNKATNVAHWTTPSLKCIRDPALVHQRPAPPS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Interleukin-15
publication title Crystal structure of the IL-15-IL-15Ralpha complex, a cytokine-receptor unit presented in trans
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine/cytokine receptor
total genus 14
structure length 81
sequence length 81
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-06-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.230 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 2z3qB01
3NFPI 2Z3QB 2B5ID 2Z3RB 2ERSA 1Z92B 2ERJA 2PSMC 4GS7D 3IU3I
chains in the Genus database with same CATH superfamily
4A3EL 1WCML 2XJTA 5M5WL 1PFYA 1B71A 5IYDL 3J7Y1 4GS7D 2Y0SP 1FHHA 2MS3A 6RXNA 2PMZP 4UY81 5K2ME 3S1NL 3GTJL 4A3CL 1QCVA 3S15L 2XJRA 3GTPL 5FJ8L 3GTGL 4JAFA 3LNLA 3GTML 3M4OL 1BQ9A 1QQTA 2JI1A 2DSXA 4AR5A 1TWHL 1Y1VL 3B08B 4ZN1B 2AQCA 4AYBP 2GMGA 3CQZL 2CKAA 2JA8L 2H12A 2XJPA 3LPEB 1RDVA 1YUXA 2K2DA 1WJVA 1RYTA 3HAXC 3LWRB 3S14L 1R0IA 5C3EL 4POGA 5MFPA 5MGNA 3NFPI 4AI2A 4LHLA 5JVG1 2A6HD 5IP9L 3SS2A 3QVDA 2E2JL 4JADA 3A44A 4C3IL 2B63L 2XJVA 2NVTL 4U671 4AHYA 3PWFA 3HJYB 2VL6A 2V0EA 3HOZL 5FLML 2AUSB 3HKZP 2APOB 4AI1A 3FKIL 2E2IL 1DVBA 3H9BA 2HVYC 1C09A 4AI0A 3LWPB 4ZN3B 1IRNA 1FHMA 1VZGA 4POFA 5GADc 4JAGA 8RXNA 1VZHA 4AHZA 2A6ED 4B8CD 2CR8A 3H9CA 2LCQA 1I50L 3IU3I 1R0GA 3VPBE 4A3FL 2L0ZA 1ODHA 3S1ML 4X6AL 3LWQB 3S2HL 4A93L 2O5JD 7RXNA 3PIO1 4TVMA 4A3IL 1BQ8A 3RZDL 2Z3QB 2V0FA 5M5YL 2NVXL 3FDJA 2VUML 4YWLA 3S2DL 4LHNA 1H7VA 2C6AA 1DX8A 3PZAA 4A3KL 1YK4A 4AI3A 1SMUA 3S17L 1S30A 1IU6A 1PFUA 4XXBB 2J9UB 2AYJA 4BBRL 2E2HL 4A3DL 2ZIXA 1F4LA 3K35A 2M4YA 3S1RL 3GTQL 2A68D 2JA7L 1VZIA 1T9OA 5DM61 1I6HL 3H99A 1BE7A 3I4NL 1LKPA 2NVYL 4A3ML 2A69D 4Y52L 3KYXA 1JYBA 4BY1L 3PO3L 5GAEc 2RFKB 3P8BA 3RZTA 1R0HA 3S16L 3HOUL 5M3FL 1NNQA 1ZRPA 1R0JA 3LWVB 5EINC 2C6BA 5M3ML 1BFYA 4WFN1 1PZXA 2JA5L 5JVH1 1RYQA 2JI2A 1R9TL 4A3LL 3PO2L 4C2M1 4QIWP 4RXNA 3KYYA 5IP7L 4XGHA 4AHXA 5H1Sc 5AN9H 1B2JA 5GAHc 4E6YA 2B5ID 2RDVA 3P2AA 2XJUA 3K7AL 3LWOB 2WB1P 2PVXA 1I3QL 4BXXL 1T9PA 5AI3A 2EY4E 5C4XL 3H0GL 3GTOL 3I4ML 5MFZA 1P7PA 3H97A 5IY0A 3B0AB 5IYBL 1LKOA 1E8JA 1S2ZA 5AI2A 2PPTA 3H3VM 3PKIA 4BY7L 3QQCE 2NYDA 3KYVA 1SMMA 3HOYL 2M4VA 5C44L 5DM71 1PFVA 2CKCA 5MF6A 4A3GL 3WWNB 3GTKL 2WAQP 5MLC3 3S1QL 5EIOC 1IU5A 2M6OA 3M3YL 4G6BA 5M5XL 1NXEA 5RXNA 1IW7D 1S24A 2ERSA 4C3JL 1RB9A 2PVEA 1RWDA 1BRFA 3HOVL 3HOWL 2V3BB 1OWCA 1Z92B 3MSUA 1CAAA 5GAGc 2R7ZL 3PKJA 4C3HL 1R0FA 2R93L 3PL5A 1OWBA 1B13A 1LKMA 2XJSA 1T9QA 3MQKB 4A3JL 3RZ6A 3WWLA 1YUZA 4BBSL 4A3BL 2JA6L 2PSMC 2KKDA 3GTLL 1CADA 1TWFL 4YWMA 4ME3A 1TWCL 3JR7A 1VCXA 3PIP1 2HR5A 1K83L 2M6PA 3KYUA 3RYGA 1SFOL 4AR4A 2PYAA 1QYBA 3MPSA 1YV1A 1YK5A 1RDGA 4V196 4TPUA 1Y1WL 2BE5D 1IROA 1LTLA 4AR3A 2XJQA 1B2OA 2ERJA 3HJWB 3ZG6A 2Z3RB 2JI3A 4Y7NL 1SMWA 4K9FA 3HOXL 2QL0A 3J7Z1 1PFWA 5C4JL 2R92L 1NXGA 4JAEA 4AR6A 2NVQL 5IYCL 2KN9A 1TWGL 2YU9L 1TWAL 4AHWA 3RZOL 3KYWA
chains in the Genus database with same CATH topology
4JAGA 2XJTA 8RXNA 1VZHA 2V3BB 1OWCA 1Z92B 3MSUA 1B71A 1CAAA 2JI2A 5GAGc 3J7Y1 4GS7D 1FHHA 2MS3A 4AHZA 6RXNA 2A6ED 4B8CD 3PKJA 4UY81 5K2ME 2CR8A 2LCQA 1R0FA 3IU3I 1R0GA 1QCVA 4RXNA 3VPBE 2L0ZA 1ODHA 2XJRA 3KYYA 4XGHA 1OWBA 1B13A 1LKMA 4AHXA 5H1Sc 2O5JD 5AN9H 1B2JA 2XJSA 1T9QA 4JAFA 7RXNA 5GAHc 3RZ6A 3PIO1 4TVMA 4E6YA 3LNLA 2B5ID 3WWLA 1BQ8A 1YUZA 1BQ9A 2RDVA 2JI1A 2PSMC 2KKDA 3P2AA 2XJUA 2V0FA 2Z3QB 2DSXA 4AR5A 1CADA 2PVXA 4YWLA 3B08B 1H7VA 4LHNA 4YWMA 4ZN1B 1T9PA 2C6AA 4ME3A 5AI3A 2GMGA 1DX8A 3PZAA 1VCXA 3PIP1 1YK4A 2HR5A 1SMUA 2CKAA 4AI3A 2M6PA 3KYUA 3RYGA 1S30A 4AR4A 1IU6A 2H12A 2PYAA 2XJPA 1RDVA 1YUXA 2K2DA 3LPEB 5MFZA 1WJVA 1QYBA 5IY0A 1RYTA 3B0AB 3MPSA 1LKOA 4XXBB 2J9UB 2AYJA 1YV1A 1YK5A 1RDGA 4V196 1E8JA 1S2ZA 4TPUA 5AI2A 1R0IA 2ZIXA 3K35A 2PPTA 4POGA 5MFPA 2M4YA 5MGNA 2BE5D 3NFPI 1IROA 3PKIA 4AI2A 2A68D 1VZIA 1T9OA 4LHLA 5DM61 3QQCE 1LTLA 2NYDA 5JVG1 3KYVA 1BE7A 4AR3A 1LKPA 1SMMA 2A6HD 2M4VA 5DM71 2XJQA 2CKCA 5MF6A 2A69D 1B2OA 3KYXA 3SS2A 3QVDA 1JYBA 2ERJA 4JADA 5GAEc 3A44A 3ZG6A 3WWNB 2Z3RB 3P8BA 5MLC3 2JI3A 2XJVA 3RZTA 1SMWA 4K9FA 4U671 1R0HA 4AHYA 2QL0A 5EIOC 1IU5A 2M6OA 3PWFA 2VL6A 2V0EA 4G6BA 3J7Z1 1NXEA 4AI1A 5RXNA 1IW7D 1NNQA 1ZRPA 1NXGA 1R0JA 4JAEA 1S24A 2ERSA 4AR6A 1RB9A 1DVBA 5EINC 2PVEA 2C6BA 1RWDA 2KN9A 1BFYA 1BRFA 1C09A 4WFN1 4AI0A 4AHWA 4ZN3B 1IRNA 1FHMA 3KYWA 1VZGA 4POFA 5GADc 5JVH1 1RYQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NFP I;  2Z3Q B;  2B5I D;  2Z3R B;  2ERS A;  1Z92 B;  2ERJ A;  2PSM C;  4GS7 D;  3IU3 I; 
#chains in the Genus database with same CATH topology
 4A3E L;  1WCM L;  2XJT A;  5M5W L;  1PFY A;  1B71 A;  5IYD L;  3J7Y 1;  4GS7 D;  2Y0S P;  1FHH A;  2MS3 A;  6RXN A;  2PMZ P;  4UY8 1;  5K2M E;  3S1N L;  3GTJ L;  4A3C L;  1QCV A;  3S15 L;  2XJR A;  3GTP L;  5FJ8 L;  3GTG L;  4JAF A;  3LNL A;  3GTM L;  3M4O L;  1BQ9 A;  1QQT A;  2JI1 A;  2DSX A;  4AR5 A;  1TWH L;  1Y1V L;  3B08 B;  4ZN1 B;  2AQC A;  4AYB P;  2GMG A;  3CQZ L;  2CKA A;  2JA8 L;  2H12 A;  2XJP A;  3LPE B;  1RDV A;  1YUX A;  2K2D A;  1WJV A;  1RYT A;  3HAX C;  3LWR B;  3S14 L;  1R0I A;  5C3E L;  4POG A;  5MFP A;  5MGN A;  3NFP I;  4AI2 A;  4LHL A;  5JVG 1;  2A6H D;  5IP9 L;  3SS2 A;  3QVD A;  2E2J L;  4JAD A;  3A44 A;  4C3I L;  2B63 L;  2XJV A;  2NVT L;  4U67 1;  4AHY A;  3PWF A;  3HJY B;  2VL6 A;  2V0E A;  3HOZ L;  5FLM L;  2AUS B;  3HKZ P;  2APO B;  4AI1 A;  3FKI L;  2E2I L;  1DVB A;  3H9B A;  2HVY C;  1C09 A;  4AI0 A;  3LWP B;  4ZN3 B;  1IRN A;  1FHM A;  1VZG A;  4POF A;  5GAD c;  4JAG A;  8RXN A;  1VZH A;  4AHZ A;  2A6E D;  4B8C D;  2CR8 A;  3H9C A;  2LCQ A;  1I50 L;  3IU3 I;  1R0G A;  3VPB E;  4A3F L;  2L0Z A;  1ODH A;  3S1M L;  4X6A L;  3LWQ B;  3S2H L;  4A93 L;  2O5J D;  7RXN A;  3PIO 1;  4TVM A;  4A3I L;  1BQ8 A;  3RZD L;  2Z3Q B;  2V0F A;  5M5Y L;  2NVX L;  3FDJ A;  2VUM L;  4YWL A;  3S2D L;  4LHN A;  1H7V A;  2C6A A;  1DX8 A;  3PZA A;  4A3K L;  1YK4 A;  4AI3 A;  1SMU A;  3S17 L;  1S30 A;  1IU6 A;  1PFU A;  4XXB B;  2J9U B;  2AYJ A;  4BBR L;  2E2H L;  4A3D L;  2ZIX A;  1F4L A;  3K35 A;  2M4Y A;  3S1R L;  3GTQ L;  2A68 D;  2JA7 L;  1VZI A;  1T9O A;  5DM6 1;  1I6H L;  3H99 A;  1BE7 A;  3I4N L;  1LKP A;  2NVY L;  4A3M L;  2A69 D;  4Y52 L;  3KYX A;  1JYB A;  4BY1 L;  3PO3 L;  5GAE c;  2RFK B;  3P8B A;  3RZT A;  1R0H A;  3S16 L;  3HOU L;  5M3F L;  1NNQ A;  1ZRP A;  1R0J A;  3LWV B;  5EIN C;  2C6B A;  5M3M L;  1BFY A;  4WFN 1;  1PZX A;  2JA5 L;  5JVH 1;  1RYQ A;  2JI2 A;  1R9T L;  4A3L L;  3PO2 L;  4C2M 1;  4QIW P;  4RXN A;  3KYY A;  5IP7 L;  4XGH A;  4AHX A;  5H1S c;  5AN9 H;  1B2J A;  5GAH c;  4E6Y A;  2B5I D;  2RDV A;  3P2A A;  2XJU A;  3K7A L;  3LWO B;  2WB1 P;  2PVX A;  1I3Q L;  4BXX L;  1T9P A;  5AI3 A;  2EY4 E;  5C4X L;  3H0G L;  3GTO L;  3I4M L;  5MFZ A;  1P7P A;  3H97 A;  5IY0 A;  3B0A B;  5IYB L;  1LKO A;  1E8J A;  1S2Z A;  5AI2 A;  2PPT A;  3H3V M;  3PKI A;  4BY7 L;  3QQC E;  2NYD A;  3KYV A;  1SMM A;  3HOY L;  2M4V A;  5C44 L;  5DM7 1;  1PFV A;  2CKC A;  5MF6 A;  4A3G L;  3WWN B;  3GTK L;  2WAQ P;  5MLC 3;  3S1Q L;  5EIO C;  1IU5 A;  2M6O A;  3M3Y L;  4G6B A;  5M5X L;  1NXE A;  5RXN A;  1IW7 D;  1S24 A;  2ERS A;  4C3J L;  1RB9 A;  2PVE A;  1RWD A;  1BRF A;  3HOV L;  3HOW L;  2V3B B;  1OWC A;  1Z92 B;  3MSU A;  1CAA A;  5GAG c;  2R7Z L;  3PKJ A;  4C3H L;  1R0F A;  2R93 L;  3PL5 A;  1OWB A;  1B13 A;  1LKM A;  2XJS A;  1T9Q A;  3MQK B;  4A3J L;  3RZ6 A;  3WWL A;  1YUZ A;  4BBS L;  4A3B L;  2JA6 L;  2PSM C;  2KKD A;  3GTL L;  1CAD A;  1TWF L;  4YWM A;  4ME3 A;  1TWC L;  3JR7 A;  1VCX A;  3PIP 1;  2HR5 A;  1K83 L;  2M6P A;  3KYU A;  3RYG A;  1SFO L;  4AR4 A;  2PYA A;  1QYB A;  3MPS A;  1YV1 A;  1YK5 A;  1RDG A;  4V19 6;  4TPU A;  1Y1W L;  2BE5 D;  1IRO A;  1LTL A;  4AR3 A;  2XJQ A;  1B2O A;  2ERJ A;  3HJW B;  3ZG6 A;  2Z3R B;  2JI3 A;  4Y7N L;  1SMW A;  4K9F A;  3HOX L;  2QL0 A;  3J7Z 1;  1PFW A;  5C4J L;  2R92 L;  1NXG A;  4JAE A;  4AR6 A;  2NVQ L;  5IYC L;  2KN9 A;  1TWG L;  2YU9 L;  1TWA L;  4AHW A;  3RZO L;  3KYW A; 
#chains in the Genus database with same CATH homology
 4JAG A;  2XJT A;  8RXN A;  1VZH A;  2V3B B;  1OWC A;  1Z92 B;  3MSU A;  1B71 A;  1CAA A;  2JI2 A;  5GAG c;  3J7Y 1;  4GS7 D;  1FHH A;  2MS3 A;  4AHZ A;  6RXN A;  2A6E D;  4B8C D;  3PKJ A;  4UY8 1;  5K2M E;  2CR8 A;  2LCQ A;  1R0F A;  3IU3 I;  1R0G A;  1QCV A;  4RXN A;  3VPB E;  2L0Z A;  1ODH A;  2XJR A;  3KYY A;  4XGH A;  1OWB A;  1B13 A;  1LKM A;  4AHX A;  5H1S c;  2O5J D;  5AN9 H;  1B2J A;  2XJS A;  1T9Q A;  4JAF A;  7RXN A;  5GAH c;  3RZ6 A;  3PIO 1;  4TVM A;  4E6Y A;  3LNL A;  2B5I D;  3WWL A;  1BQ8 A;  1YUZ A;  1BQ9 A;  2RDV A;  2JI1 A;  2PSM C;  2KKD A;  3P2A A;  2XJU A;  2V0F A;  2Z3Q B;  2DSX A;  4AR5 A;  1CAD A;  2PVX A;  4YWL A;  3B08 B;  1H7V A;  4LHN A;  4YWM A;  4ZN1 B;  1T9P A;  2C6A A;  4ME3 A;  5AI3 A;  2GMG A;  1DX8 A;  3PZA A;  1VCX A;  3PIP 1;  1YK4 A;  2HR5 A;  1SMU A;  2CKA A;  4AI3 A;  2M6P A;  3KYU A;  3RYG A;  1S30 A;  4AR4 A;  1IU6 A;  2H12 A;  2PYA A;  2XJP A;  1RDV A;  1YUX A;  2K2D A;  3LPE B;  5MFZ A;  1WJV A;  1QYB A;  5IY0 A;  1RYT A;  3B0A B;  3MPS A;  1LKO A;  4XXB B;  2J9U B;  2AYJ A;  1YV1 A;  1YK5 A;  1RDG A;  4V19 6;  1E8J A;  1S2Z A;  4TPU A;  5AI2 A;  1R0I A;  2ZIX A;  3K35 A;  2PPT A;  4POG A;  5MFP A;  2M4Y A;  5MGN A;  2BE5 D;  3NFP I;  1IRO A;  3PKI A;  4AI2 A;  2A68 D;  1VZI A;  1T9O A;  4LHL A;  5DM6 1;  3QQC E;  1LTL A;  2NYD A;  5JVG 1;  3KYV A;  1BE7 A;  4AR3 A;  1LKP A;  1SMM A;  2A6H D;  2M4V A;  5DM7 1;  2XJQ A;  2CKC A;  5MF6 A;  2A69 D;  1B2O A;  3KYX A;  3SS2 A;  3QVD A;  1JYB A;  2ERJ A;  4JAD A;  5GAE c;  3A44 A;  3ZG6 A;  3WWN B;  2Z3R B;  3P8B A;  5MLC 3;  2JI3 A;  2XJV A;  3RZT A;  1SMW A;  4K9F A;  4U67 1;  1R0H A;  4AHY A;  2QL0 A;  5EIO C;  1IU5 A;  2M6O A;  3PWF A;  2VL6 A;  2V0E A;  4G6B A;  3J7Z 1;  1NXE A;  4AI1 A;  5RXN A;  1IW7 D;  1NNQ A;  1ZRP A;  1NXG A;  1R0J A;  4JAE A;  1S24 A;  2ERS A;  4AR6 A;  1RB9 A;  1DVB A;  5EIN C;  2PVE A;  2C6B A;  1RWD A;  2KN9 A;  1BFY A;  1BRF A;  1C09 A;  4WFN 1;  4AI0 A;  4AHW A;  4ZN3 B;  1IRN A;  1FHM A;  3KYW A;  1VZG A;  4POF A;  5GAD c;  5JVH 1;  1RYQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...