2Z5BA

Crystal structure of a novel chaperone complex for yeast 20s proteasome assembly
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
147
structure length
127
Chain Sequence
MLVKTISRTIESQPTLDVIATLPADDRSKKIPISLVVGFKQESSSLSCYYYAIPLMRSNVVGIPLLDTKDDRIRDMARHMATIISERFNRPCYVTWSSLPSEDPSMLVANHLYILKKCLDLLKTELG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein YPL144W
publication title Crystal structure of a chaperone complex that contributes to the assembly of yeast 20S proteasomes
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Chaperone
total genus 32
structure length 127
sequence length 147
ec nomenclature
pdb deposition date 2007-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10448 POC3_POC4 20S proteasome chaperone assembly proteins 3 and 4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.100 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 2z5bA00
2Z5CA 2Z5BA
chains in the Genus database with same CATH superfamily
4B3ME 2BR2A 3L7ZB 1XNQI 2XEXA 1H73A 3ZM7A 4DV4I 4JI0E 3ZKBA 4OO1A 4DUZI 2PNMA 4JI1E 4LF5E 1ZM3A 1WUUA 4EMDA 2O3ZA 4XTJA 2NN6A 1NHJA 4DV1I 1DARA 2EFGA 4DV3E 4USMA 4DR4E 2Z5BA 3PS3A 2UU9E 1YH8A 5LL6R 4JI7I 2E5LE 2WP8B 2PNZA 1S16A 4DV6E 2DEIA 1P42A 2GQ0A 4IZJB 4JV5E 1PVGA 4R1FA 2PO1B 4BA2B 1HNZI 1B63A 4YY3I 2GS8A 1R6LA 3T1HE 4YHHE 4PU9A 5GMDA 4DR5I 2C37A 4DPWA 4DUYI 2J7KA 1J5EI 2UUAI 3L7ZA 4LFBI 4P52A 3PYDA 2ZM6E 2UXBE 2Z5CB 4LF6I 4IFDB 2VESA 3F0NA 2X36A 1QZRA 4AM3A 2BA0D 2UUBE 5GMEA 4X64E 3H1CA 3B82A 2UXDI 1Z0VA 4DV0I 4M1KA 3J7AM 4JI8I 4DXLA 1HNWE 4HXZA 2LJPA 4OKGA 4USKA 3WU4A 3NZKA 4OO1F 1Y4UA 3B78A 2X7IA 1PKPA 4OX9I 1RHYA 5LMUI 5K36C 2WP8A 4FW5A 3K17A 1KKHA 4X65E 2F4VE 2GO3A 1BKNA 4DV7E 3M85D 1ZXNA 2R42A 4X66E 4IZJA 4JI4I 2IESA 2NN6F 3P3CA 1IBMI 1FKAE 2PO1A 4OO1D 1ZM9A 4BA2A 1MX0A 1Z0EA 5K36B 3ZZTA 1Z5CA 3PYGA 1UEKA 5EL9A 4LF4I 5C0XC 2NN6D 4KHPI 4N3OA 3Q1QA 4LPFA 3QT8A 3U1YA 3GMEA 2HK3A 1OYPA 4U3BA 1H7SA 1H72C 2PO0A 4QNJA 4K0KI 2Z5CA 2HFSA 2C39A 3GONA 4PRXA 5C0XB 4IFDA 2Z5EA 1XHKA 5DRRA 4NXNE 4DR2I 4DV2E 1R6MA 5IWAE 1I94I 2BA1G 4QNKA 1PIEA 3CDJA 4DU8A 4GKJI 1N33I 4FW6A 4WUCA 1Z0CA 2VQFI 1B62A 1N0UA 3OTOE 4JI6E 1HR0E 4FW4A 1VISA 4FWDA 4WUBA 4DPUA 4LF7E 1FJGI 3ZKDA 2V2VA 4DV5I 4AQYI 2PO2B 4B3MI 3J81Q 2UXCE 1Z5AA 2IOPA 2ZITA 2O1TA 3HULA 3PRYA 4JI0I 1KTVA 5K36A 4JI1I 4LF5I 2O1WA 4B3SE 4DPXA 3P3EA 1XNRE 3PS2A 4DR7E 4OO1E 2NPFA 2VF3A 4BA1B 1N34E 4WUDA 4DR4I 2BV3A 2UU9I 2HFUA 1HNXE 1EI1A 2NN6E 4IZJD 3CWVA 5JEAC 4LFCE 4J3DA 4X62I 2E1RA 3WU3A 1Z0WA 4JV5I 2WNRB 1Z0GA 1RREA 1N32E 1OYSA 4URLA 4JG4A 3T1HI 4AIDA 4JI2E 4IFDF 4JI7E 1Y4SA 5JEAB 4YHHI 4HACB 3B4TA 2CG9A 2C38B 2PO2A 4DR3E 1Y60A 4LCGA 4HYMA 4B3TE 2ZM6I 2JEBB 2UXBI 4IFDD 4LF8E 1FWLA 2V2QA 3GCMA 3QT5A 1IBKE 3P76A 1K47A 2UUBI 4X64I 3LNUA 5BR8I 5DROA 3PYFA 1XMOE 4DU7A 2J65A 1Z59A 1HNWI 1HK7A 4DR1E 2F1DA 4BA1A 5K36F 3JAMQ 4UTGA 2A2CA 4HY1A 4JI3E 3PYEA 4X65I 2F4VI 3Q6MA 1FWKA 4LOMA 4X66I 4JI5E 2VQEE 5DRQA 2WNRA 3LPSA 4GQUA 5K36D 1S4EA 4KQVA 1NZ0A 2UUCE 4LFAI 4MYUA 5JEAA 4NXME 4HACA 4DPTA 1USVA 2BR2B 2C38A 4GKKE 3ZZUA 1ELOA 2NN6C 3T1YE 4DR6E 5C0XD 4LF4E 1UDNA 4NXNI 4ZVIA 2HK2A 5LMNE 2CZ9A 4DV2I 1NHHA 1UDQA 4MDTA 1OYRA 3HKMA 4IFDE 2R3VA 4LCFA 3OTOI 4JI6I 4K0KE 1HR0I 2V2ZA 1N36E 2JT2A 3J81C 3J80C 4LF7I 1IBLE 1H74A 4JYAE 1Y6ZA 3V2UC 2ZBKB 3J80Q 4RPFA 1I94E 1OJ4A 4FW7A 2UXCI 4MU4A 4LF9E 2V34A 4B3RE 1U2RA 2VQFE 1XMQE 1KVKA 1ZM2A 2AJ4A 2HHHE 4B3SI 3QT7A 3U1KA 2IERA 2BA1D 1XNQE 4OZEA 1UDSA 1A6FA 3J7AG 5ELWA 4DR7I 5K36E 3H4LA 4PRVA 4DV3I 4DV4E 2V8PA 2GO4A 3GLLA 4MU0A 4ISAA 4DUZE 1N34I 4UT4A 2E5LI 3Q6NA 4AIMA 5C0XA 2BM1A 1HNXI 3M7ND 2O1UA 5JEAF 4DV6I 5FWKA 4LFCI 4DV1E 1N32I 5L3JA 5DNXA 5C0XE 1UDOA 4MU1A 4MU3A 5JEAD 4MYTA 4JI2I 2JEAB 5DRPA 1MG7A 2BA0G 1VI7A 3UHMA 1NHIA 4IS9A 4DR3I 4MQYA 3B8HA 4X62E 2DEJA 1HNZE 1Z5BA 4B3TI 4IZKB 2A2DA 5DNLA 4YY3E 4LF8I 3WU5A 1IBKI 1XXEA 4DR5E 2HKJA 3M85G 4IFDC 1FNMA 1N0VC 4DUYE 1J5EE 2UUAE 4LFBE 1XMOI 2O1VA 4U3DA 4DR1I 3JAMC 3K1JA 2PO0B 4ED4A 4LF6E 1Z0BA 3CDIA 5A2QC 2BM0A 2C39B 2OI2A 4FW3A 2JE6B 5A2QQ 4JI3I 2WW4A 4DV7I 1Y5YA 4DPYA 1ZXMA 2UXDE 5EKWA 5BR8E 4DV0E 4JI8E 1USUA 4JI5I 2VQEI 2CVEA 3V5RA 3HJCA 2UUCI 4OX9E 5C0XF 1KIJA 5LMUE 1YHCA 4OO1C 1H7UA 4NBQA 2JEAA 4NXMI 2PNLA 1D6TA 3K85A 1E3HA 3ZZ0A 4JI4E 1IBME 4GKKI 5IT9C 1E3PA 3D4JA 2JEBA 2Q2EB 1MU5A 3DD6A 4Z7CA 4IZKA 4OO1B 3T1YI 4I3HA 4DR6I 5IT9Q 5JEAE 4LFAE 3P3GA 4P7AA 2IOQA 5IWAI 5LMNI 4KHPE 2NN6B 2AE8A 1EA6A 2Z5BB 3KRNA 4FN5A 1N36I 2PNZB 4DR2E 2JE6A 1IBLI 4JYAI 2HKEA 1ZM4A 3QT6A 5FLXC 4GKJE 1N33E 3PS1A 4LF9I 5FLXQ 2CGEA 4B3RI 4FWHA 1XMQI 4FW9A 3P06A 2HHHI 3LTOA 1FI4A 1FJGE 4Z7YA 2C37B 3M6AA 4DV5E 4AQYE 4FWGA 3WU6A 4LCHA 1Z0TA 3M7NG 1RR9A 1XNRI
chains in the Genus database with same CATH topology
4B3ME 1XNQI 2XEXA 1H73A 3ZM7A 4DV4I 4JI0E 3ZKBA 4DUZI 4JI1E 2PNMA 4LF5E 1ZM3A 1WUUA 4EMDA 4XTJA 1NHJA 4DV1I 1DARA 2EFGA 4DV3E 4USMA 4DR4E 2Z5BA 2UU9E 5LL6R 4JI7I 2E5LE 1S16A 4DV6E 2DEIA 2GQ0A 4IZJB 4JV5E 1PVGA 4R1FA 1HNZI 1B63A 4YY3I 2GS8A 3T1HE 4YHHE 4PU9A 5GMDA 4DR5I 4DPWA 4DUYI 2J7KA 1J5EI 2UUAI 4LFBI 4P52A 3PYDA 2ZM6E 2UXBE 2Z5CB 4LF6I 3F0NA 2X36A 1QZRA 2UUBE 5GMEA 4X64E 3B82A 2UXDI 1Z0VA 4DV0I 4M1KA 3J7AM 4JI8I 4DXLA 1HNWE 4HXZA 2LJPA 4USKA 3WU4A 1Y4UA 3B78A 2X7IA 1PKPA 4OX9I 5LMUI 4X65E 3K17A 1KKHA 2F4VE 4DV7E 1BKNA 1ZXNA 2R42A 4X66E 4IZJA 4JI4I 1IBMI 1FKAE 1ZM9A 1MX0A 1Z0EA 3ZZTA 1Z5CA 3PYGA 1UEKA 4LF4I 4KHPI 4N3OA 3Q1QA 3QT8A 2HK3A 1H7SA 1H72C 4K0KI 2Z5CA 2HFSA 3GONA 4PRXA 2Z5EA 1XHKA 4NXNE 4DR2I 4DV2E 5IWAE 1I94I 1PIEA 4DU8A 4GKJI 1N33I 4WUCA 1Z0CA 2VQFI 1B62A 1N0UA 3OTOE 4JI6E 1HR0E 1VISA 4FWDA 4WUBA 4DPUA 4LF7E 1FJGI 3ZKDA 2V2VA 4DV5I 4AQYI 4B3MI 3J81Q 2UXCE 1Z5AA 2IOPA 2ZITA 2O1TA 3HULA 3PRYA 4JI0I 1KTVA 4JI1I 4LF5I 2O1WA 4B3SE 4DPXA 1XNRE 4DR7E 2NPFA 2VF3A 1N34E 4WUDA 4DR4I 2BV3A 2UU9I 2HFUA 1HNXE 1EI1A 4IZJD 3CWVA 4LFCE 4X62I 2E1RA 3WU3A 1Z0WA 4JV5I 1Z0GA 1RREA 1N32E 4URLA 4JG4A 3T1HI 4JI2E 4JI7E 1Y4SA 4YHHI 4HACB 2CG9A 4DR3E 4HYMA 4B3TE 2ZM6I 2UXBI 4LF8E 1FWLA 2V2QA 1IBKE 3QT5A 1K47A 2UUBI 4X64I 3LNUA 5BR8I 3PYFA 1XMOE 4DU7A 1Z59A 1HNWI 1HK7A 4DR1E 3JAMQ 4UTGA 2A2CA 4HY1A 4JI3E 3PYEA 4X65I 2F4VI 3Q6MA 1FWKA 4X66I 4JI5E 2VQEE 3LPSA 1S4EA 4KQVA 1NZ0A 2UUCE 4LFAI 4MYUA 4NXME 4HACA 4DPTA 1USVA 4GKKE 3ZZUA 1ELOA 3T1YE 4DR6E 4LF4E 4NXNI 4ZVIA 2HK2A 5LMNE 2CZ9A 4DV2I 1NHHA 2R3VA 3OTOI 4JI6I 4K0KE 1HR0I 2V2ZA 1N36E 3J81C 3J80C 4LF7I 1IBLE 1H74A 4JYAE 1Y6ZA 3V2UC 2ZBKB 3J80Q 4RPFA 1I94E 1OJ4A 2UXCI 4LF9E 2V34A 4B3RE 1U2RA 2VQFE 1XMQE 1KVKA 1ZM2A 2AJ4A 2HHHE 4B3SI 3QT7A 1XNQE 1A6FA 3J7AG 4DR7I 3H4LA 4PRVA 4DV3I 4DV4E 2V8PA 4DUZE 1N34I 4UT4A 2E5LI 3Q6NA 2BM1A 1HNXI 2O1UA 4DV6I 5FWKA 4LFCI 4DV1E 1N32I 5L3JA 4MYTA 4JI2I 1MG7A 1NHIA 4DR3I 3B8HA 4X62E 2DEJA 1HNZE 1Z5BA 4B3TI 4IZKB 2A2DA 4YY3E 4LF8I 3WU5A 1IBKI 4DR5E 2HKJA 1FNMA 1N0VC 4DUYE 1J5EE 2UUAE 4LFBE 1XMOI 2O1VA 4DR1I 3JAMC 3K1JA 4ED4A 4LF6E 1Z0BA 5A2QC 2BM0A 2OI2A 5A2QQ 4JI3I 2WW4A 4DV7I 4DPYA 1ZXMA 2UXDE 5BR8E 4DV0E 4JI8E 1USUA 4JI5I 2VQEI 3V5RA 3HJCA 2UUCI 4OX9E 1KIJA 5LMUE 1H7UA 4NXMI 2PNLA 1D6TA 3K85A 3ZZ0A 4JI4E 1IBME 4GKKI 5IT9C 3D4JA 2Q2EB 1MU5A 5IT9Q 4Z7CA 4IZKA 3T1YI 4I3HA 4DR6I 4LFAE 4P7AA 2IOQA 5IWAI 5LMNI 4KHPE 1EA6A 2Z5BB 4FN5A 1N36I 4DR2E 1IBLI 4JYAI 2HKEA 1ZM4A 3QT6A 5FLXC 4GKJE 1N33E 4LF9I 5FLXQ 2CGEA 4B3RI 4FWHA 1XMQI 4FW9A 3P06A 2HHHI 3LTOA 1FI4A 1FJGE 4Z7YA 3M6AA 4DV5E 4AQYE 4FWGA 3WU6A 1Z0TA 1RR9A 1XNRI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z5C A;  2Z5B A; 
#chains in the Genus database with same CATH topology
 4B3M E;  2BR2 A;  3L7Z B;  1XNQ I;  2XEX A;  1H73 A;  3ZM7 A;  4DV4 I;  4JI0 E;  3ZKB A;  4OO1 A;  4DUZ I;  2PNM A;  4JI1 E;  4LF5 E;  1ZM3 A;  1WUU A;  4EMD A;  2O3Z A;  4XTJ A;  2NN6 A;  1NHJ A;  4DV1 I;  1DAR A;  2EFG A;  4DV3 E;  4USM A;  4DR4 E;  2Z5B A;  3PS3 A;  2UU9 E;  1YH8 A;  5LL6 R;  4JI7 I;  2E5L E;  2WP8 B;  2PNZ A;  1S16 A;  4DV6 E;  2DEI A;  1P42 A;  2GQ0 A;  4IZJ B;  4JV5 E;  1PVG A;  4R1F A;  2PO1 B;  4BA2 B;  1HNZ I;  1B63 A;  4YY3 I;  2GS8 A;  1R6L A;  3T1H E;  4YHH E;  4PU9 A;  5GMD A;  4DR5 I;  2C37 A;  4DPW A;  4DUY I;  2J7K A;  1J5E I;  2UUA I;  3L7Z A;  4LFB I;  4P52 A;  3PYD A;  2ZM6 E;  2UXB E;  2Z5C B;  4LF6 I;  4IFD B;  2VES A;  3F0N A;  2X36 A;  1QZR A;  4AM3 A;  2BA0 D;  2UUB E;  5GME A;  4X64 E;  3H1C A;  3B82 A;  2UXD I;  1Z0V A;  4DV0 I;  4M1K A;  3J7A M;  4JI8 I;  4DXL A;  1HNW E;  4HXZ A;  2LJP A;  4OKG A;  4USK A;  3WU4 A;  3NZK A;  4OO1 F;  1Y4U A;  3B78 A;  2X7I A;  1PKP A;  4OX9 I;  1RHY A;  5LMU I;  5K36 C;  2WP8 A;  4FW5 A;  3K17 A;  1KKH A;  4X65 E;  2F4V E;  2GO3 A;  1BKN A;  4DV7 E;  3M85 D;  1ZXN A;  2R42 A;  4X66 E;  4IZJ A;  4JI4 I;  2IES A;  2NN6 F;  3P3C A;  1IBM I;  1FKA E;  2PO1 A;  4OO1 D;  1ZM9 A;  4BA2 A;  1MX0 A;  1Z0E A;  5K36 B;  3ZZT A;  1Z5C A;  3PYG A;  1UEK A;  5EL9 A;  4LF4 I;  5C0X C;  2NN6 D;  4KHP I;  4N3O A;  3Q1Q A;  4LPF A;  3QT8 A;  3U1Y A;  3GME A;  2HK3 A;  1OYP A;  4U3B A;  1H7S A;  1H72 C;  2PO0 A;  4QNJ A;  4K0K I;  2Z5C A;  2HFS A;  2C39 A;  3GON A;  4PRX A;  5C0X B;  4IFD A;  2Z5E A;  1XHK A;  5DRR A;  4NXN E;  4DR2 I;  4DV2 E;  1R6M A;  5IWA E;  1I94 I;  2BA1 G;  4QNK A;  1PIE A;  3CDJ A;  4DU8 A;  4GKJ I;  1N33 I;  4FW6 A;  4WUC A;  1Z0C A;  2VQF I;  1B62 A;  1N0U A;  3OTO E;  4JI6 E;  1HR0 E;  4FW4 A;  1VIS A;  4FWD A;  4WUB A;  4DPU A;  4LF7 E;  1FJG I;  3ZKD A;  2V2V A;  4DV5 I;  4AQY I;  2PO2 B;  4B3M I;  3J81 Q;  2UXC E;  1Z5A A;  2IOP A;  2ZIT A;  2O1T A;  3HUL A;  3PRY A;  4JI0 I;  1KTV A;  5K36 A;  4JI1 I;  4LF5 I;  2O1W A;  4B3S E;  4DPX A;  3P3E A;  1XNR E;  3PS2 A;  4DR7 E;  4OO1 E;  2NPF A;  2VF3 A;  4BA1 B;  1N34 E;  4WUD A;  4DR4 I;  2BV3 A;  2UU9 I;  2HFU A;  1HNX E;  1EI1 A;  2NN6 E;  4IZJ D;  3CWV A;  5JEA C;  4LFC E;  4J3D A;  4X62 I;  2E1R A;  3WU3 A;  1Z0W A;  4JV5 I;  2WNR B;  1Z0G A;  1RRE A;  1N32 E;  1OYS A;  4URL A;  4JG4 A;  3T1H I;  4AID A;  4JI2 E;  4IFD F;  4JI7 E;  1Y4S A;  5JEA B;  4YHH I;  4HAC B;  3B4T A;  2CG9 A;  2C38 B;  2PO2 A;  4DR3 E;  1Y60 A;  4LCG A;  4HYM A;  4B3T E;  2ZM6 I;  2JEB B;  2UXB I;  4IFD D;  4LF8 E;  1FWL A;  2V2Q A;  3GCM A;  3QT5 A;  1IBK E;  3P76 A;  1K47 A;  2UUB I;  4X64 I;  3LNU A;  5BR8 I;  5DRO A;  3PYF A;  1XMO E;  4DU7 A;  2J65 A;  1Z59 A;  1HNW I;  1HK7 A;  4DR1 E;  2F1D A;  4BA1 A;  5K36 F;  3JAM Q;  4UTG A;  2A2C A;  4HY1 A;  4JI3 E;  3PYE A;  4X65 I;  2F4V I;  3Q6M A;  1FWK A;  4LOM A;  4X66 I;  4JI5 E;  2VQE E;  5DRQ A;  2WNR A;  3LPS A;  4GQU A;  5K36 D;  1S4E A;  4KQV A;  1NZ0 A;  2UUC E;  4LFA I;  4MYU A;  5JEA A;  4NXM E;  4HAC A;  4DPT A;  1USV A;  2BR2 B;  2C38 A;  4GKK E;  3ZZU A;  1ELO A;  2NN6 C;  3T1Y E;  4DR6 E;  5C0X D;  4LF4 E;  1UDN A;  4NXN I;  4ZVI A;  2HK2 A;  5LMN E;  2CZ9 A;  4DV2 I;  1NHH A;  1UDQ A;  4MDT A;  1OYR A;  3HKM A;  4IFD E;  2R3V A;  4LCF A;  3OTO I;  4JI6 I;  4K0K E;  1HR0 I;  2V2Z A;  1N36 E;  2JT2 A;  3J81 C;  3J80 C;  4LF7 I;  1IBL E;  1H74 A;  4JYA E;  1Y6Z A;  3V2U C;  2ZBK B;  3J80 Q;  4RPF A;  1I94 E;  1OJ4 A;  4FW7 A;  2UXC I;  4MU4 A;  4LF9 E;  2V34 A;  4B3R E;  1U2R A;  2VQF E;  1XMQ E;  1KVK A;  1ZM2 A;  2AJ4 A;  2HHH E;  4B3S I;  3QT7 A;  3U1K A;  2IER A;  2BA1 D;  1XNQ E;  4OZE A;  1UDS A;  1A6F A;  3J7A G;  5ELW A;  4DR7 I;  5K36 E;  3H4L A;  4PRV A;  4DV3 I;  4DV4 E;  2V8P A;  2GO4 A;  3GLL A;  4MU0 A;  4ISA A;  4DUZ E;  1N34 I;  4UT4 A;  2E5L I;  3Q6N A;  4AIM A;  5C0X A;  2BM1 A;  1HNX I;  3M7N D;  2O1U A;  5JEA F;  4DV6 I;  5FWK A;  4LFC I;  4DV1 E;  1N32 I;  5L3J A;  5DNX A;  5C0X E;  1UDO A;  4MU1 A;  4MU3 A;  5JEA D;  4MYT A;  4JI2 I;  2JEA B;  5DRP A;  1MG7 A;  2BA0 G;  1VI7 A;  3UHM A;  1NHI A;  4IS9 A;  4DR3 I;  4MQY A;  3B8H A;  4X62 E;  2DEJ A;  1HNZ E;  1Z5B A;  4B3T I;  4IZK B;  2A2D A;  5DNL A;  4YY3 E;  4LF8 I;  3WU5 A;  1IBK I;  1XXE A;  4DR5 E;  2HKJ A;  3M85 G;  4IFD C;  1FNM A;  1N0V C;  4DUY E;  1J5E E;  2UUA E;  4LFB E;  1XMO I;  2O1V A;  4U3D A;  4DR1 I;  3JAM C;  3K1J A;  2PO0 B;  4ED4 A;  4LF6 E;  1Z0B A;  3CDI A;  5A2Q C;  2BM0 A;  2C39 B;  2OI2 A;  4FW3 A;  2JE6 B;  5A2Q Q;  4JI3 I;  2WW4 A;  4DV7 I;  1Y5Y A;  4DPY A;  1ZXM A;  2UXD E;  5EKW A;  5BR8 E;  4DV0 E;  4JI8 E;  1USU A;  4JI5 I;  2VQE I;  2CVE A;  3V5R A;  3HJC A;  2UUC I;  4OX9 E;  5C0X F;  1KIJ A;  5LMU E;  1YHC A;  4OO1 C;  1H7U A;  4NBQ A;  2JEA A;  4NXM I;  2PNL A;  1D6T A;  3K85 A;  1E3H A;  3ZZ0 A;  4JI4 E;  1IBM E;  4GKK I;  5IT9 C;  1E3P A;  3D4J A;  2JEB A;  2Q2E B;  1MU5 A;  3DD6 A;  4Z7C A;  4IZK A;  4OO1 B;  3T1Y I;  4I3H A;  4DR6 I;  5IT9 Q;  5JEA E;  4LFA E;  3P3G A;  4P7A A;  2IOQ A;  5IWA I;  5LMN I;  4KHP E;  2NN6 B;  2AE8 A;  1EA6 A;  2Z5B B;  3KRN A;  4FN5 A;  1N36 I;  2PNZ B;  4DR2 E;  2JE6 A;  1IBL I;  4JYA I;  2HKE A;  1ZM4 A;  3QT6 A;  5FLX C;  4GKJ E;  1N33 E;  3PS1 A;  4LF9 I;  5FLX Q;  2CGE A;  4B3R I;  4FWH A;  1XMQ I;  4FW9 A;  3P06 A;  2HHH I;  3LTO A;  1FI4 A;  1FJG E;  4Z7Y A;  2C37 B;  3M6A A;  4DV5 E;  4AQY E;  4FWG A;  3WU6 A;  4LCH A;  1Z0T A;  3M7N G;  1RR9 A;  1XNR I; 
#chains in the Genus database with same CATH homology
 4B3M E;  1XNQ I;  2XEX A;  1H73 A;  3ZM7 A;  4DV4 I;  4JI0 E;  3ZKB A;  4DUZ I;  4JI1 E;  2PNM A;  4LF5 E;  1ZM3 A;  1WUU A;  4EMD A;  4XTJ A;  1NHJ A;  4DV1 I;  1DAR A;  2EFG A;  4DV3 E;  4USM A;  4DR4 E;  2Z5B A;  2UU9 E;  5LL6 R;  4JI7 I;  2E5L E;  1S16 A;  4DV6 E;  2DEI A;  2GQ0 A;  4IZJ B;  4JV5 E;  1PVG A;  4R1F A;  1HNZ I;  1B63 A;  4YY3 I;  2GS8 A;  3T1H E;  4YHH E;  4PU9 A;  5GMD A;  4DR5 I;  4DPW A;  4DUY I;  2J7K A;  1J5E I;  2UUA I;  4LFB I;  4P52 A;  3PYD A;  2ZM6 E;  2UXB E;  2Z5C B;  4LF6 I;  3F0N A;  2X36 A;  1QZR A;  2UUB E;  5GME A;  4X64 E;  3B82 A;  2UXD I;  1Z0V A;  4DV0 I;  4M1K A;  3J7A M;  4JI8 I;  4DXL A;  1HNW E;  4HXZ A;  2LJP A;  4USK A;  3WU4 A;  1Y4U A;  3B78 A;  2X7I A;  1PKP A;  4OX9 I;  5LMU I;  4X65 E;  3K17 A;  1KKH A;  2F4V E;  4DV7 E;  1BKN A;  1ZXN A;  2R42 A;  4X66 E;  4IZJ A;  4JI4 I;  1IBM I;  1FKA E;  1ZM9 A;  1MX0 A;  1Z0E A;  3ZZT A;  1Z5C A;  3PYG A;  1UEK A;  4LF4 I;  4KHP I;  4N3O A;  3Q1Q A;  3QT8 A;  2HK3 A;  1H7S A;  1H72 C;  4K0K I;  2Z5C A;  2HFS A;  3GON A;  4PRX A;  2Z5E A;  1XHK A;  4NXN E;  4DR2 I;  4DV2 E;  5IWA E;  1I94 I;  1PIE A;  4DU8 A;  4GKJ I;  1N33 I;  4WUC A;  1Z0C A;  2VQF I;  1B62 A;  1N0U A;  3OTO E;  4JI6 E;  1HR0 E;  1VIS A;  4FWD A;  4WUB A;  4DPU A;  4LF7 E;  1FJG I;  3ZKD A;  2V2V A;  4DV5 I;  4AQY I;  4B3M I;  3J81 Q;  2UXC E;  1Z5A A;  2IOP A;  2ZIT A;  2O1T A;  3HUL A;  3PRY A;  4JI0 I;  1KTV A;  4JI1 I;  4LF5 I;  2O1W A;  4B3S E;  4DPX A;  1XNR E;  4DR7 E;  2NPF A;  2VF3 A;  1N34 E;  4WUD A;  4DR4 I;  2BV3 A;  2UU9 I;  2HFU A;  1HNX E;  1EI1 A;  4IZJ D;  3CWV A;  4LFC E;  4X62 I;  2E1R A;  3WU3 A;  1Z0W A;  4JV5 I;  1Z0G A;  1RRE A;  1N32 E;  4URL A;  4JG4 A;  3T1H I;  4JI2 E;  4JI7 E;  1Y4S A;  4YHH I;  4HAC B;  2CG9 A;  4DR3 E;  4HYM A;  4B3T E;  2ZM6 I;  2UXB I;  4LF8 E;  1FWL A;  2V2Q A;  1IBK E;  3QT5 A;  1K47 A;  2UUB I;  4X64 I;  3LNU A;  5BR8 I;  3PYF A;  1XMO E;  4DU7 A;  1Z59 A;  1HNW I;  1HK7 A;  4DR1 E;  3JAM Q;  4UTG A;  2A2C A;  4HY1 A;  4JI3 E;  3PYE A;  4X65 I;  2F4V I;  3Q6M A;  1FWK A;  4X66 I;  4JI5 E;  2VQE E;  3LPS A;  1S4E A;  4KQV A;  1NZ0 A;  2UUC E;  4LFA I;  4MYU A;  4NXM E;  4HAC A;  4DPT A;  1USV A;  4GKK E;  3ZZU A;  1ELO A;  3T1Y E;  4DR6 E;  4LF4 E;  4NXN I;  4ZVI A;  2HK2 A;  5LMN E;  2CZ9 A;  4DV2 I;  1NHH A;  2R3V A;  3OTO I;  4JI6 I;  4K0K E;  1HR0 I;  2V2Z A;  1N36 E;  3J81 C;  3J80 C;  4LF7 I;  1IBL E;  1H74 A;  4JYA E;  1Y6Z A;  3V2U C;  2ZBK B;  3J80 Q;  4RPF A;  1I94 E;  1OJ4 A;  2UXC I;  4LF9 E;  2V34 A;  4B3R E;  1U2R A;  2VQF E;  1XMQ E;  1KVK A;  1ZM2 A;  2AJ4 A;  2HHH E;  4B3S I;  3QT7 A;  1XNQ E;  1A6F A;  3J7A G;  4DR7 I;  3H4L A;  4PRV A;  4DV3 I;  4DV4 E;  2V8P A;  4DUZ E;  1N34 I;  4UT4 A;  2E5L I;  3Q6N A;  2BM1 A;  1HNX I;  2O1U A;  4DV6 I;  5FWK A;  4LFC I;  4DV1 E;  1N32 I;  5L3J A;  4MYT A;  4JI2 I;  1MG7 A;  1NHI A;  4DR3 I;  3B8H A;  4X62 E;  2DEJ A;  1HNZ E;  1Z5B A;  4B3T I;  4IZK B;  2A2D A;  4YY3 E;  4LF8 I;  3WU5 A;  1IBK I;  4DR5 E;  2HKJ A;  1FNM A;  1N0V C;  4DUY E;  1J5E E;  2UUA E;  4LFB E;  1XMO I;  2O1V A;  4DR1 I;  3JAM C;  3K1J A;  4ED4 A;  4LF6 E;  1Z0B A;  5A2Q C;  2BM0 A;  2OI2 A;  5A2Q Q;  4JI3 I;  2WW4 A;  4DV7 I;  4DPY A;  1ZXM A;  2UXD E;  5BR8 E;  4DV0 E;  4JI8 E;  1USU A;  4JI5 I;  2VQE I;  3V5R A;  3HJC A;  2UUC I;  4OX9 E;  1KIJ A;  5LMU E;  1H7U A;  4NXM I;  2PNL A;  1D6T A;  3K85 A;  3ZZ0 A;  4JI4 E;  1IBM E;  4GKK I;  5IT9 C;  3D4J A;  2Q2E B;  1MU5 A;  5IT9 Q;  4Z7C A;  4IZK A;  3T1Y I;  4I3H A;  4DR6 I;  4LFA E;  4P7A A;  2IOQ A;  5IWA I;  5LMN I;  4KHP E;  1EA6 A;  2Z5B B;  4FN5 A;  1N36 I;  4DR2 E;  1IBL I;  4JYA I;  2HKE A;  1ZM4 A;  3QT6 A;  5FLX C;  4GKJ E;  1N33 E;  4LF9 I;  5FLX Q;  2CGE A;  4B3R I;  4FWH A;  1XMQ I;  4FW9 A;  3P06 A;  2HHH I;  3LTO A;  1FI4 A;  1FJG E;  4Z7Y A;  3M6A A;  4DV5 E;  4AQY E;  4FWG A;  3WU6 A;  1Z0T A;  1RR9 A;  1XNR I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...