2Z5BA

Crystal structure of a novel chaperone complex for yeast 20s proteasome assembly
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
147
structure length
127
Chain Sequence
MLVKTISRTIESQPTLDVIATLPADDRSKKIPISLVVGFKQESSSLSCYYYAIPLMRSNVVGIPLLDTKDDRIRDMARHMATIISERFNRPCYVTWSSLPSEDPSMLVANHLYILKKCLDLLKTELG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein YPL144W
publication title Crystal structure of a chaperone complex that contributes to the assembly of yeast 20S proteasomes
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Chaperone
total genus 32
structure length 127
sequence length 147
ec nomenclature
pdb deposition date 2007-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10448 POC3_POC4 20S proteasome chaperone assembly proteins 3 and 4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.100 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 2z5bA00
2Z5BA 2Z5CA
chains in the Genus database with same CATH superfamily
4NXMI 4JI1I 2BA0D 3JAMQ 2HKJA 4BA1A 4DUYE 5LL6R 4OX9E 1FWLA 5C0XA 3PS1A 5BR8E 1XMOI 4DUYI 1I94E 4OX9I 5GMDA 4X64E 2C39B 5BR8I 2NN6E 3P3CA 4DR7E 1I94I 3GLLA 4OO1F 3J80Q 3M6AA 3K1JA 4ISAA 1S4EA 2UXDE 2C39A 4DR7I 2DEJA 2F4VE 2R42A 2PNMA 2UXDI 4X66E 4OO1D 2BA1D 2O1UA 2X7IA 4QNKA 4P52A 4B3MI 4IZKB 4X66I 4USMA 1H7UA 5JEAB 4WUDA 3OTOE 4IZKA 2NN6C 2JT2A 5JEAA 4IFDF 2ZBKB 5LMUE 4JI8E 4KHPE 2C37B 1MU5A 4NXNI 2UUBE 1ZM3A 5LMUI 4DR4E 4DPYA 4JI8I 4KHPI 4IFDD 4LF8E 2V34A 1KTVA 2C37A 2HKEA 2OI2A 1EA6A 1ZXNA 4DR4I 4ZVIA 3ZZTA 5K36E 1N33I 2A2CA 4MU1A 4YHHE 3CDJA 1Y6ZA 3CDIA 4M1KA 4NBQA 1Y4UA 4YHHI 5C0XE 1OYRA 1MX0A 4JI5E 1WUUA 4BA2B 4X62E 2UUAE 4JI4E 1XMQI 4DV0I 1XNRE 4JI5I 1B62A 3M85D 2UUAI 4IZJD 4BA2A 3LTOA 2NN6B 4DPWA 1QZRA 4MYTA 2PO2B 1XNQE 2VQEE 4HYMA 2NN6A 2R3VA 1XNQI 2VQEI 2PO2A 4DV3I 1Y60A 4LF9E 1ZXMA 5DNXA 4U3BA 2NN6F 3GONA 5L3JA 1OYPA 2XEXA 1Z5BA 3D4JA 3P3GA 1N36E 4LF9I 4AIDA 4FW3A 4FW6A 3B8HA 4P7AA 1HNXE 5JEAE 2C38B 4WUBA 1FWKA 1H7SA 1NHIA 2BA0G 2PNZB 1N36I 1HR0E 1HNXI 1KVKA 1RR9A 2ZM6E 3P76A 1ZM2A 2C38A 1IBME 2BM1A 4MDTA 3PS2A 4I3HA 5LMNE 1HR0I 2PNZA 2Z5CB 2ZM6I 4R1FA 4DV7E 1IBMI 4LF7E 3QT6A 4DR3I 2E1RA 2Z5CA 4HY1A 1PKPA 5DNLA 1HNWE 4U3DA 4LF7I 2WP8B 1N0VC 1HNWI 3J81Q 2WP8A 4DR5E 2BA1G 4EMDA 4OZEA 1KIJA 5FLXQ 3JAMC 4LF5E 5K36F 1FNMA 1OJ4A 2UXBE 3ZKDA 1FJGE 4GQUA 5ELWA 4LF5I 1N34E 1S16A 3F0NA 2DEIA 3PRYA 4PU9A 5C0XF 2UXBI 3LNUA 1FJGI 5K36D 4X64I 2UUCE 1N34I 2HHHE 2GQ0A 3QT5A 4FW4A 3J80C 1Z0EA 1YHCA 2UUCI 2HHHI 1H72C 5C0XD 2IOPA 2Q2EB 3B4TA 2F4VI 4RPFA 2AJ4A 4DU7A 5IWAE 1Z0VA 5DROA 4LFAE 3UHMA 3K85A 5IWAI 1XHKA 4YY3E 4HACB 1UDQA 3WU5A 4LFAI 1Z5CA 3DD6A 3OTOI 5A2QQ 5GMEA 3WU6A 4HACA 3M85G 2ZITA 5JEAF 2UUBI 4AIMA 4JYAE 2V8PA 2BR2B 4LF8I 3ZKBA 4MU3A 2IESA 2IOQA 5JEAD 4JYAI 1Y4SA 4MU4A 1J5EE 2X36A 4DR2E 3M7ND 1E3HA 2BR2A 2V2VA 4DR2I 3KRNA 4FW9A 4X62I 4MU0A 4JI4I 1XNRI 1UDNA 1YH8A 4N3OA 4JI3E 2UXCE 4IS9A 3U1KA 3P3EA 4JI3I 2UXCI 2PO0B 3H1CA 2VQFE 4LCHA 1P42A 1VISA 4DPUA 2PO0A 2GO4A 2NPFA 4DV6E 4HXZA 2VQFI 1Y5YA 4DV4E 1Z59A 4LF4E 3ZZUA 4DV6I 4GKKE 4DV4I 4LF4I 2NN6D 4GKKI 2LJPA 4FWGA 4USKA 2BV3A 2CG9A 2O1WA 1FKAE 4ED4A 4OO1C 5LMNI 4JI2E 1USUA 4JG4A 4UTGA 4DU8A 3T1HE 1N32E 4DV7I 2GO3A 2J7KA 2JEBB 4AM3A 4JI0E 1N32I 4LCFA 4DXLA 4LF6E 2PO1B 2JEBA 4JI0I 4UT4A 1U2RA 2Z5BB 3J81C 4LFCE 4LF6I 3B82A 2PO1A 1KKHA 1VI7A 4DR5I 4LFCI 1Z0WA 4FN5A 2Z5BA 5FLXC 4IFDC 4K0KE 4DV5E 5IT9Q 1FI4A 2IERA 3HKMA 2V2ZA 4K0KI 3GCMA 2JEAB 3ZZ0A 1BKNA 2HK2A 5FWKA 4OO1B 3PYEA 2HFUA 4JI6E 1XMOE 1Z0TA 3L7ZB 2E5LE 2JEAA 2A2DA 2CVEA 1NHHA 1A6FA 3PYDA 4AQYE 4JI6I 4OO1A 2WNRB 2E5LI 3J7AG 4DUZE 4X65E 3L7ZA 1IBKE 4XTJA 4AQYI 1IBLE 1H74A 2WNRA 3GMEA 4DUZI 3M7NG 1ZM4A 4X65I 1IBKI 1RREA 3Q1QA 4FWDA 1USVA 1IBLI 4FWHA 4QNJA 3K17A 3H4LA 4YY3I 1N0UA 4DPTA 4B3ME 1Z0CA 4IFDB 5A2QC 4LCGA 3P06A 2V2QA 3CWVA 2HFSA 4DV2E 1DARA 4OKGA 3V2UC 5EL9A 4IFDA 3PYGA 4B3RE 2JE6B 3WU4A 4DV2I 2GS8A 3B78A 4DR6E 1UEKA 2HK3A 4GKJE 4B3RI 3U1YA 4NXNE 4DR6I 2VESA 2JE6A 1PVGA 3PS3A 4GKJI 1D6TA 4KQVA 2CGEA 1XXEA 1Z5AA 1J5EI 1Z0GA 3HULA 4IZJB 1PIEA 1N33E 3WU3A 1RHYA 1H73A 1EI1A 4IZJA 4DPXA 4LFBE 2J65A 4B3SE 4LFBI 1XMQE 4DV0E 3ZM7A 4B3SI 4OO1E 4Z7CA 1R6MA 1NHJA 2CZ9A 1R6LA 4PRXA 4URLA 4DV1E 3T1YE 1B63A 4DV3E 2O1VA 2VF3A 3QT8A 5K36C 1OYSA 2F1DA 4DV1I 3T1YI 2PNLA 2UU9E 2AE8A 2Z5EA 5C0XC 4IFDE 4LPFA 3PYFA 2UU9I 4WUCA 4JV5E 1UDOA 1UDSA 4DR1E 1E3PA 3Q6NA 4FW7A 4JI2I 5DRQA 4PRVA 4JV5I 1ZM9A 3T1HI 2O3ZA 4J3DA 1HNZE 1Z0BA 2EFGA 5DRRA 4DR1I 5DRPA 3QT7A 4MYUA 4Z7YA 1ELOA 1NZ0A 1HNZI 3LPSA 4DR3E 4FW5A 4MQYA 3J7AM 3V5RA 1MG7A 4B3TE 5EKWA 3HJCA 4JI7E 4LOMA 2BM0A 2O1TA 3NZKA 4B3TI 5K36B 1HK7A 5IT9C 4JI7I 4NXME 4JI1E 4BA1B 3Q6MA 4DV5I 5JEAC 1K47A 2WW4A 5K36A 5C0XB
chains in the Genus database with same CATH topology
4NXMI 4JI1I 3JAMQ 2HKJA 4DUYE 5LL6R 4OX9E 1FWLA 5BR8E 1XMOI 4DUYI 1I94E 4OX9I 5GMDA 4X64E 5BR8I 4DR7E 1I94I 3J80Q 3M6AA 3K1JA 1S4EA 2UXDE 4DR7I 2DEJA 2F4VE 2R42A 2PNMA 2UXDI 4X66E 2O1UA 2X7IA 4P52A 4B3MI 4IZKB 4X66I 4USMA 1H7UA 4WUDA 3OTOE 4IZKA 2ZBKB 5LMUE 4JI8E 4KHPE 1MU5A 4NXNI 2UUBE 1ZM3A 5LMUI 4DR4E 4DPYA 4JI8I 4KHPI 4LF8E 2V34A 1KTVA 2HKEA 2OI2A 1EA6A 1ZXNA 4DR4I 4ZVIA 3ZZTA 1N33I 2A2CA 4YHHE 1Y6ZA 4M1KA 1Y4UA 4YHHI 1MX0A 4JI5E 1WUUA 4X62E 2UUAE 4JI4E 1XMQI 4DV0I 1XNRE 4JI5I 1B62A 2UUAI 4IZJD 3LTOA 4DPWA 1QZRA 4MYTA 1XNQE 2VQEE 4HYMA 2R3VA 1XNQI 2VQEI 4DV3I 4LF9E 1ZXMA 3GONA 5L3JA 2XEXA 1Z5BA 3D4JA 1N36E 4LF9I 3B8HA 4P7AA 1HNXE 4WUBA 1FWKA 1H7SA 1NHIA 1N36I 1HR0E 1HNXI 1KVKA 1RR9A 2ZM6E 1ZM2A 1IBME 2BM1A 4I3HA 5LMNE 1HR0I 2Z5CB 2ZM6I 4R1FA 4DV7E 1IBMI 4LF7E 3QT6A 4DR3I 2E1RA 2Z5CA 4HY1A 1PKPA 1HNWE 4LF7I 1N0VC 1HNWI 3J81Q 4DR5E 4EMDA 1KIJA 5FLXQ 3JAMC 4LF5E 1FNMA 1OJ4A 2UXBE 3ZKDA 1FJGE 4LF5I 1N34E 1S16A 3F0NA 2DEIA 3PRYA 4PU9A 2UXBI 3LNUA 1FJGI 4X64I 2UUCE 1N34I 2HHHE 2GQ0A 3QT5A 3J80C 1Z0EA 2UUCI 2HHHI 1H72C 2IOPA 2Q2EB 2F4VI 4RPFA 2AJ4A 4DU7A 5IWAE 1Z0VA 4LFAE 3K85A 5IWAI 1XHKA 4YY3E 4HACB 3WU5A 4LFAI 1Z5CA 3OTOI 5A2QQ 5GMEA 3WU6A 4HACA 2ZITA 2UUBI 4JYAE 2V8PA 4LF8I 3ZKBA 2IOQA 4JYAI 1Y4SA 1J5EE 2X36A 4DR2E 2V2VA 4DR2I 4FW9A 4X62I 4JI4I 1XNRI 4N3OA 4JI3E 2UXCE 4JI3I 2UXCI 2VQFE 1VISA 4DPUA 2NPFA 4DV6E 4HXZA 2VQFI 4DV4E 1Z59A 4LF4E 3ZZUA 4DV6I 4GKKE 4DV4I 4LF4I 4GKKI 2LJPA 4FWGA 4USKA 2BV3A 2CG9A 2O1WA 1FKAE 4ED4A 5LMNI 4JI2E 1USUA 4JG4A 4UTGA 4DU8A 3T1HE 1N32E 4DV7I 2J7KA 4JI0E 1N32I 4DXLA 4LF6E 4JI0I 4UT4A 1U2RA 2Z5BB 3J81C 4LFCE 4LF6I 3B82A 1KKHA 4DR5I 4LFCI 1Z0WA 4FN5A 2Z5BA 5FLXC 4K0KE 4DV5E 5IT9Q 1FI4A 2V2ZA 4K0KI 3ZZ0A 1BKNA 2HK2A 5FWKA 3PYEA 2HFUA 4JI6E 1XMOE 1Z0TA 2E5LE 2A2DA 1NHHA 1A6FA 3PYDA 4AQYE 4JI6I 2E5LI 3J7AG 4DUZE 4X65E 1IBKE 4XTJA 4AQYI 1IBLE 1H74A 4DUZI 3Q1QA 1ZM4A 4X65I 1IBKI 1RREA 4FWDA 1USVA 1IBLI 4FWHA 3K17A 3H4LA 4YY3I 4DPTA 1N0UA 4B3ME 1Z0CA 5A2QC 3P06A 2V2QA 3CWVA 2HFSA 4DV2E 1DARA 3V2UC 3PYGA 4B3RE 3WU4A 4DV2I 2GS8A 3B78A 4DR6E 1UEKA 2HK3A 4GKJE 4B3RI 4NXNE 4DR6I 1PVGA 1D6TA 4GKJI 4KQVA 2CGEA 1Z5AA 1J5EI 1Z0GA 3HULA 4IZJB 1PIEA 1N33E 3WU3A 1H73A 1EI1A 4IZJA 4DPXA 4LFBE 4B3SE 4LFBI 1XMQE 4DV0E 3ZM7A 4B3SI 4Z7CA 1NHJA 2CZ9A 4PRXA 4URLA 4DV1E 3T1YE 1B63A 4DV3E 2O1VA 2VF3A 3QT8A 4DV1I 3T1YI 2PNLA 2UU9E 2Z5EA 3PYFA 2UU9I 4WUCA 4JV5E 4DR1E 3Q6NA 4JI2I 4PRVA 4JV5I 1ZM9A 3T1HI 1HNZE 1Z0BA 2EFGA 4DR1I 3QT7A 4MYUA 4Z7YA 1ELOA 1NZ0A 1HNZI 3LPSA 4DR3E 3J7AM 3V5RA 1MG7A 4B3TE 3HJCA 4JI7E 2BM0A 2O1TA 4B3TI 1HK7A 5IT9C 4JI7I 4NXME 4JI1E 3Q6MA 4DV5I 1K47A 2WW4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z5B A;  2Z5C A; 
#chains in the Genus database with same CATH topology
 4NXM I;  4JI1 I;  2BA0 D;  3JAM Q;  2HKJ A;  4BA1 A;  4DUY E;  5LL6 R;  4OX9 E;  1FWL A;  5C0X A;  3PS1 A;  5BR8 E;  1XMO I;  4DUY I;  1I94 E;  4OX9 I;  5GMD A;  4X64 E;  2C39 B;  5BR8 I;  2NN6 E;  3P3C A;  4DR7 E;  1I94 I;  3GLL A;  4OO1 F;  3J80 Q;  3M6A A;  3K1J A;  4ISA A;  1S4E A;  2UXD E;  2C39 A;  4DR7 I;  2DEJ A;  2F4V E;  2R42 A;  2PNM A;  2UXD I;  4X66 E;  4OO1 D;  2BA1 D;  2O1U A;  2X7I A;  4QNK A;  4P52 A;  4B3M I;  4IZK B;  4X66 I;  4USM A;  1H7U A;  5JEA B;  4WUD A;  3OTO E;  4IZK A;  2NN6 C;  2JT2 A;  5JEA A;  4IFD F;  2ZBK B;  5LMU E;  4JI8 E;  4KHP E;  2C37 B;  1MU5 A;  4NXN I;  2UUB E;  1ZM3 A;  5LMU I;  4DR4 E;  4DPY A;  4JI8 I;  4KHP I;  4IFD D;  4LF8 E;  2V34 A;  1KTV A;  2C37 A;  2HKE A;  2OI2 A;  1EA6 A;  1ZXN A;  4DR4 I;  4ZVI A;  3ZZT A;  5K36 E;  1N33 I;  2A2C A;  4MU1 A;  4YHH E;  3CDJ A;  1Y6Z A;  3CDI A;  4M1K A;  4NBQ A;  1Y4U A;  4YHH I;  5C0X E;  1OYR A;  1MX0 A;  4JI5 E;  1WUU A;  4BA2 B;  4X62 E;  2UUA E;  4JI4 E;  1XMQ I;  4DV0 I;  1XNR E;  4JI5 I;  1B62 A;  3M85 D;  2UUA I;  4IZJ D;  4BA2 A;  3LTO A;  2NN6 B;  4DPW A;  1QZR A;  4MYT A;  2PO2 B;  1XNQ E;  2VQE E;  4HYM A;  2NN6 A;  2R3V A;  1XNQ I;  2VQE I;  2PO2 A;  4DV3 I;  1Y60 A;  4LF9 E;  1ZXM A;  5DNX A;  4U3B A;  2NN6 F;  3GON A;  5L3J A;  1OYP A;  2XEX A;  1Z5B A;  3D4J A;  3P3G A;  1N36 E;  4LF9 I;  4AID A;  4FW3 A;  4FW6 A;  3B8H A;  4P7A A;  1HNX E;  5JEA E;  2C38 B;  4WUB A;  1FWK A;  1H7S A;  1NHI A;  2BA0 G;  2PNZ B;  1N36 I;  1HR0 E;  1HNX I;  1KVK A;  1RR9 A;  2ZM6 E;  3P76 A;  1ZM2 A;  2C38 A;  1IBM E;  2BM1 A;  4MDT A;  3PS2 A;  4I3H A;  5LMN E;  1HR0 I;  2PNZ A;  2Z5C B;  2ZM6 I;  4R1F A;  4DV7 E;  1IBM I;  4LF7 E;  3QT6 A;  4DR3 I;  2E1R A;  2Z5C A;  4HY1 A;  1PKP A;  5DNL A;  1HNW E;  4U3D A;  4LF7 I;  2WP8 B;  1N0V C;  1HNW I;  3J81 Q;  2WP8 A;  4DR5 E;  2BA1 G;  4EMD A;  4OZE A;  1KIJ A;  5FLX Q;  3JAM C;  4LF5 E;  5K36 F;  1FNM A;  1OJ4 A;  2UXB E;  3ZKD A;  1FJG E;  4GQU A;  5ELW A;  4LF5 I;  1N34 E;  1S16 A;  3F0N A;  2DEI A;  3PRY A;  4PU9 A;  5C0X F;  2UXB I;  3LNU A;  1FJG I;  5K36 D;  4X64 I;  2UUC E;  1N34 I;  2HHH E;  2GQ0 A;  3QT5 A;  4FW4 A;  3J80 C;  1Z0E A;  1YHC A;  2UUC I;  2HHH I;  1H72 C;  5C0X D;  2IOP A;  2Q2E B;  3B4T A;  2F4V I;  4RPF A;  2AJ4 A;  4DU7 A;  5IWA E;  1Z0V A;  5DRO A;  4LFA E;  3UHM A;  3K85 A;  5IWA I;  1XHK A;  4YY3 E;  4HAC B;  1UDQ A;  3WU5 A;  4LFA I;  1Z5C A;  3DD6 A;  3OTO I;  5A2Q Q;  5GME A;  3WU6 A;  4HAC A;  3M85 G;  2ZIT A;  5JEA F;  2UUB I;  4AIM A;  4JYA E;  2V8P A;  2BR2 B;  4LF8 I;  3ZKB A;  4MU3 A;  2IES A;  2IOQ A;  5JEA D;  4JYA I;  1Y4S A;  4MU4 A;  1J5E E;  2X36 A;  4DR2 E;  3M7N D;  1E3H A;  2BR2 A;  2V2V A;  4DR2 I;  3KRN A;  4FW9 A;  4X62 I;  4MU0 A;  4JI4 I;  1XNR I;  1UDN A;  1YH8 A;  4N3O A;  4JI3 E;  2UXC E;  4IS9 A;  3U1K A;  3P3E A;  4JI3 I;  2UXC I;  2PO0 B;  3H1C A;  2VQF E;  4LCH A;  1P42 A;  1VIS A;  4DPU A;  2PO0 A;  2GO4 A;  2NPF A;  4DV6 E;  4HXZ A;  2VQF I;  1Y5Y A;  4DV4 E;  1Z59 A;  4LF4 E;  3ZZU A;  4DV6 I;  4GKK E;  4DV4 I;  4LF4 I;  2NN6 D;  4GKK I;  2LJP A;  4FWG A;  4USK A;  2BV3 A;  2CG9 A;  2O1W A;  1FKA E;  4ED4 A;  4OO1 C;  5LMN I;  4JI2 E;  1USU A;  4JG4 A;  4UTG A;  4DU8 A;  3T1H E;  1N32 E;  4DV7 I;  2GO3 A;  2J7K A;  2JEB B;  4AM3 A;  4JI0 E;  1N32 I;  4LCF A;  4DXL A;  4LF6 E;  2PO1 B;  2JEB A;  4JI0 I;  4UT4 A;  1U2R A;  2Z5B B;  3J81 C;  4LFC E;  4LF6 I;  3B82 A;  2PO1 A;  1KKH A;  1VI7 A;  4DR5 I;  4LFC I;  1Z0W A;  4FN5 A;  2Z5B A;  5FLX C;  4IFD C;  4K0K E;  4DV5 E;  5IT9 Q;  1FI4 A;  2IER A;  3HKM A;  2V2Z A;  4K0K I;  3GCM A;  2JEA B;  3ZZ0 A;  1BKN A;  2HK2 A;  5FWK A;  4OO1 B;  3PYE A;  2HFU A;  4JI6 E;  1XMO E;  1Z0T A;  3L7Z B;  2E5L E;  2JEA A;  2A2D A;  2CVE A;  1NHH A;  1A6F A;  3PYD A;  4AQY E;  4JI6 I;  4OO1 A;  2WNR B;  2E5L I;  3J7A G;  4DUZ E;  4X65 E;  3L7Z A;  1IBK E;  4XTJ A;  4AQY I;  1IBL E;  1H74 A;  2WNR A;  3GME A;  4DUZ I;  3M7N G;  1ZM4 A;  4X65 I;  1IBK I;  1RRE A;  3Q1Q A;  4FWD A;  1USV A;  1IBL I;  4FWH A;  4QNJ A;  3K17 A;  3H4L A;  4YY3 I;  1N0U A;  4DPT A;  4B3M E;  1Z0C A;  4IFD B;  5A2Q C;  4LCG A;  3P06 A;  2V2Q A;  3CWV A;  2HFS A;  4DV2 E;  1DAR A;  4OKG A;  3V2U C;  5EL9 A;  4IFD A;  3PYG A;  4B3R E;  2JE6 B;  3WU4 A;  4DV2 I;  2GS8 A;  3B78 A;  4DR6 E;  1UEK A;  2HK3 A;  4GKJ E;  4B3R I;  3U1Y A;  4NXN E;  4DR6 I;  2VES A;  2JE6 A;  1PVG A;  3PS3 A;  4GKJ I;  1D6T A;  4KQV A;  2CGE A;  1XXE A;  1Z5A A;  1J5E I;  1Z0G A;  3HUL A;  4IZJ B;  1PIE A;  1N33 E;  3WU3 A;  1RHY A;  1H73 A;  1EI1 A;  4IZJ A;  4DPX A;  4LFB E;  2J65 A;  4B3S E;  4LFB I;  1XMQ E;  4DV0 E;  3ZM7 A;  4B3S I;  4OO1 E;  4Z7C A;  1R6M A;  1NHJ A;  2CZ9 A;  1R6L A;  4PRX A;  4URL A;  4DV1 E;  3T1Y E;  1B63 A;  4DV3 E;  2O1V A;  2VF3 A;  3QT8 A;  5K36 C;  1OYS A;  2F1D A;  4DV1 I;  3T1Y I;  2PNL A;  2UU9 E;  2AE8 A;  2Z5E A;  5C0X C;  4IFD E;  4LPF A;  3PYF A;  2UU9 I;  4WUC A;  4JV5 E;  1UDO A;  1UDS A;  4DR1 E;  1E3P A;  3Q6N A;  4FW7 A;  4JI2 I;  5DRQ A;  4PRV A;  4JV5 I;  1ZM9 A;  3T1H I;  2O3Z A;  4J3D A;  1HNZ E;  1Z0B A;  2EFG A;  5DRR A;  4DR1 I;  5DRP A;  3QT7 A;  4MYU A;  4Z7Y A;  1ELO A;  1NZ0 A;  1HNZ I;  3LPS A;  4DR3 E;  4FW5 A;  4MQY A;  3J7A M;  3V5R A;  1MG7 A;  4B3T E;  5EKW A;  3HJC A;  4JI7 E;  4LOM A;  2BM0 A;  2O1T A;  3NZK A;  4B3T I;  5K36 B;  1HK7 A;  5IT9 C;  4JI7 I;  4NXM E;  4JI1 E;  4BA1 B;  3Q6M A;  4DV5 I;  5JEA C;  1K47 A;  2WW4 A;  5K36 A;  5C0X B; 
#chains in the Genus database with same CATH homology
 4NXM I;  4JI1 I;  3JAM Q;  2HKJ A;  4DUY E;  5LL6 R;  4OX9 E;  1FWL A;  5BR8 E;  1XMO I;  4DUY I;  1I94 E;  4OX9 I;  5GMD A;  4X64 E;  5BR8 I;  4DR7 E;  1I94 I;  3J80 Q;  3M6A A;  3K1J A;  1S4E A;  2UXD E;  4DR7 I;  2DEJ A;  2F4V E;  2R42 A;  2PNM A;  2UXD I;  4X66 E;  2O1U A;  2X7I A;  4P52 A;  4B3M I;  4IZK B;  4X66 I;  4USM A;  1H7U A;  4WUD A;  3OTO E;  4IZK A;  2ZBK B;  5LMU E;  4JI8 E;  4KHP E;  1MU5 A;  4NXN I;  2UUB E;  1ZM3 A;  5LMU I;  4DR4 E;  4DPY A;  4JI8 I;  4KHP I;  4LF8 E;  2V34 A;  1KTV A;  2HKE A;  2OI2 A;  1EA6 A;  1ZXN A;  4DR4 I;  4ZVI A;  3ZZT A;  1N33 I;  2A2C A;  4YHH E;  1Y6Z A;  4M1K A;  1Y4U A;  4YHH I;  1MX0 A;  4JI5 E;  1WUU A;  4X62 E;  2UUA E;  4JI4 E;  1XMQ I;  4DV0 I;  1XNR E;  4JI5 I;  1B62 A;  2UUA I;  4IZJ D;  3LTO A;  4DPW A;  1QZR A;  4MYT A;  1XNQ E;  2VQE E;  4HYM A;  2R3V A;  1XNQ I;  2VQE I;  4DV3 I;  4LF9 E;  1ZXM A;  3GON A;  5L3J A;  2XEX A;  1Z5B A;  3D4J A;  1N36 E;  4LF9 I;  3B8H A;  4P7A A;  1HNX E;  4WUB A;  1FWK A;  1H7S A;  1NHI A;  1N36 I;  1HR0 E;  1HNX I;  1KVK A;  1RR9 A;  2ZM6 E;  1ZM2 A;  1IBM E;  2BM1 A;  4I3H A;  5LMN E;  1HR0 I;  2Z5C B;  2ZM6 I;  4R1F A;  4DV7 E;  1IBM I;  4LF7 E;  3QT6 A;  4DR3 I;  2E1R A;  2Z5C A;  4HY1 A;  1PKP A;  1HNW E;  4LF7 I;  1N0V C;  1HNW I;  3J81 Q;  4DR5 E;  4EMD A;  1KIJ A;  5FLX Q;  3JAM C;  4LF5 E;  1FNM A;  1OJ4 A;  2UXB E;  3ZKD A;  1FJG E;  4LF5 I;  1N34 E;  1S16 A;  3F0N A;  2DEI A;  3PRY A;  4PU9 A;  2UXB I;  3LNU A;  1FJG I;  4X64 I;  2UUC E;  1N34 I;  2HHH E;  2GQ0 A;  3QT5 A;  3J80 C;  1Z0E A;  2UUC I;  2HHH I;  1H72 C;  2IOP A;  2Q2E B;  2F4V I;  4RPF A;  2AJ4 A;  4DU7 A;  5IWA E;  1Z0V A;  4LFA E;  3K85 A;  5IWA I;  1XHK A;  4YY3 E;  4HAC B;  3WU5 A;  4LFA I;  1Z5C A;  3OTO I;  5A2Q Q;  5GME A;  3WU6 A;  4HAC A;  2ZIT A;  2UUB I;  4JYA E;  2V8P A;  4LF8 I;  3ZKB A;  2IOQ A;  4JYA I;  1Y4S A;  1J5E E;  2X36 A;  4DR2 E;  2V2V A;  4DR2 I;  4FW9 A;  4X62 I;  4JI4 I;  1XNR I;  4N3O A;  4JI3 E;  2UXC E;  4JI3 I;  2UXC I;  2VQF E;  1VIS A;  4DPU A;  2NPF A;  4DV6 E;  4HXZ A;  2VQF I;  4DV4 E;  1Z59 A;  4LF4 E;  3ZZU A;  4DV6 I;  4GKK E;  4DV4 I;  4LF4 I;  4GKK I;  2LJP A;  4FWG A;  4USK A;  2BV3 A;  2CG9 A;  2O1W A;  1FKA E;  4ED4 A;  5LMN I;  4JI2 E;  1USU A;  4JG4 A;  4UTG A;  4DU8 A;  3T1H E;  1N32 E;  4DV7 I;  2J7K A;  4JI0 E;  1N32 I;  4DXL A;  4LF6 E;  4JI0 I;  4UT4 A;  1U2R A;  2Z5B B;  3J81 C;  4LFC E;  4LF6 I;  3B82 A;  1KKH A;  4DR5 I;  4LFC I;  1Z0W A;  4FN5 A;  2Z5B A;  5FLX C;  4K0K E;  4DV5 E;  5IT9 Q;  1FI4 A;  2V2Z A;  4K0K I;  3ZZ0 A;  1BKN A;  2HK2 A;  5FWK A;  3PYE A;  2HFU A;  4JI6 E;  1XMO E;  1Z0T A;  2E5L E;  2A2D A;  1NHH A;  1A6F A;  3PYD A;  4AQY E;  4JI6 I;  2E5L I;  3J7A G;  4DUZ E;  4X65 E;  1IBK E;  4XTJ A;  4AQY I;  1IBL E;  1H74 A;  4DUZ I;  3Q1Q A;  1ZM4 A;  4X65 I;  1IBK I;  1RRE A;  4FWD A;  1USV A;  1IBL I;  4FWH A;  3K17 A;  3H4L A;  4YY3 I;  4DPT A;  1N0U A;  4B3M E;  1Z0C A;  5A2Q C;  3P06 A;  2V2Q A;  3CWV A;  2HFS A;  4DV2 E;  1DAR A;  3V2U C;  3PYG A;  4B3R E;  3WU4 A;  4DV2 I;  2GS8 A;  3B78 A;  4DR6 E;  1UEK A;  2HK3 A;  4GKJ E;  4B3R I;  4NXN E;  4DR6 I;  1PVG A;  1D6T A;  4GKJ I;  4KQV A;  2CGE A;  1Z5A A;  1J5E I;  1Z0G A;  3HUL A;  4IZJ B;  1PIE A;  1N33 E;  3WU3 A;  1H73 A;  1EI1 A;  4IZJ A;  4DPX A;  4LFB E;  4B3S E;  4LFB I;  1XMQ E;  4DV0 E;  3ZM7 A;  4B3S I;  4Z7C A;  1NHJ A;  2CZ9 A;  4PRX A;  4URL A;  4DV1 E;  3T1Y E;  1B63 A;  4DV3 E;  2O1V A;  2VF3 A;  3QT8 A;  4DV1 I;  3T1Y I;  2PNL A;  2UU9 E;  2Z5E A;  3PYF A;  2UU9 I;  4WUC A;  4JV5 E;  4DR1 E;  3Q6N A;  4JI2 I;  4PRV A;  4JV5 I;  1ZM9 A;  3T1H I;  1HNZ E;  1Z0B A;  2EFG A;  4DR1 I;  3QT7 A;  4MYU A;  4Z7Y A;  1ELO A;  1NZ0 A;  1HNZ I;  3LPS A;  4DR3 E;  3J7A M;  3V5R A;  1MG7 A;  4B3T E;  3HJC A;  4JI7 E;  2BM0 A;  2O1T A;  4B3T I;  1HK7 A;  5IT9 C;  4JI7 I;  4NXM E;  4JI1 E;  3Q6M A;  4DV5 I;  1K47 A;  2WW4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...