2Z5BA

Crystal structure of a novel chaperone complex for yeast 20s proteasome assembly
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
147
structure length
127
Chain Sequence
MLVKTISRTIESQPTLDVIATLPADDRSKKIPISLVVGFKQESSSLSCYYYAIPLMRSNVVGIPLLDTKDDRIRDMARHMATIISERFNRPCYVTWSSLPSEDPSMLVANHLYILKKCLDLLKTELG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a chaperone complex that contributes to the assembly of yeast 20S proteasomes
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Chaperone
molecule keywords Protein YPL144W
total genus 32
structure length 127
sequence length 147
ec nomenclature
pdb deposition date 2007-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10448 POC3_POC4 20S proteasome chaperone assembly proteins 3 and 4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.100 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 2z5bA00
2Z5BA 2Z5CA
chains in the Genus database with same CATH superfamily
1XNRE 3J7AG 2JEBB 4J3DA 1UDOA 4PU9A 4R1FA 5JEAA 4LF8I 4DR4I 3ZZTA 5JEAB 4DV4E 4MYTA 2UU9E 2CGEA 2WP8A 5JEAC 2PNZA 1NHHA 4MU3A 3JAMQ 5JEAE 1DARA 1PKPA 2JE6B 3B82A 4AIMA 5A2QQ 2J7KA 1ZXMA 2ZM6E 2LJPA 1J5EI 1NZ0A 1S4EA 1N32E 1H7UA 4BA1A 1OYRA 4IFDB 4UTGA 4P52A 4DV1I 1IBKE 4GKJE 2NN6B 3QT7A 2C39B 1OJ4A 2ZM6I 4HXZA 1J5EE 4FN5A 2AJ4A 3V5RA 1HR0I 2HKEA 4DU7A 4DR5I 1YH8A 4LF9E 2ZBKB 1OYPA 2PO0B 3QT5A 4DPYA 2NN6A 1UDQA 1Z0EA 4DV3I 2V2VA 4OX9E 4LFAE 4BA1B 4X65E 4IFDE 1H74A 3NZKA 2O1VA 2JEAB 4Z7CA 5LMNI 3J81Q 4JI4E 2NN6D 2ZITA 5DROA 1OYSA 1Z0CA 4JI3E 5JEAF 2IOPA 2Z5CB 3J80C 2UXBI 3Q6MA 3QT8A 1N33E 4JI1I 2WW4A 3F0NA 4B3ME 4OZEA 2PNLA 4IZKA 2VESA 1N34I 3K1JA 5IT9C 4NXMI 4GKKI 2R3VA 4IFDA 1N36E 3PS1A 3B4TA 2NN6E 4NXME 4URLA 4OO1D 4LFCI 4WUDA 1RREA 4NXNI 2BM1A 4YY3I 2O1WA 1ZXNA 1Z5BA 4DV6I 4DR2I 4B3SE 4IZJD 2CZ9A 2WP8B 4X62I 5K36A 4DR1E 1HNWE 5C0XA 2OI2A 4DV6E 4DR2E 2VQEE 2UUBI 1VISA 2V2ZA 5K36C 4OO1F 4K0KE 3CWVA 4NBQA 2C38A 1FWLA 3LNUA 5IWAE 4Z7YA 3DD6A 4JI2I 5K36D 1PVGA 2DEJA 1Y60A 4JI0I 3PYEA 2PO1A 4JI7I 3P76A 1UDNA 2VQFE 4AM3A 4B3TI 1FNMA 4JI1E 5C0XF 3WU6A 1IBMI 4DXLA 3T1HE 1H72C 2VQFI 1MU5A 4MQYA 4B3TE 4I3HA 3ZKBA 1KKHA 4LPFA 2V34A 2O1UA 1Z5CA 4HACA 4YHHE 3Q6NA 3D4JA 2E5LI 1N36I 4BA2B 2UXDE 3Q1QA 4LCFA 4FWHA 1KIJA 3WU3A 4DPXA 4DR6I 2UXCI 2CG9A 1FKAE 4DR7I 4PRVA 2O1TA 4JI6I 1K47A 1XNQI 5LL6R 1HNWI 4PRXA 4MU1A 2BM0A 3T1YE 3PS2A 2PNZB 2VQEI 4LF4E 1Z5AA 1IBLE 4K0KI 2PO0A 4OO1B 1USUA 4MU4A 2BA0G 4DV5E 1EA6A 5IWAI 3H1CA 4MDTA 4USKA 2BA1D 4AIDA 4X66I 1P42A 3UHMA 3J7AM 4DV5I 2GQ0A 3CDIA 4JI7E 5FLXC 5C0XC 3HULA 2HHHI 2GO4A 1Z0BA 4N3OA 5JEAD 3ZZUA 3GLLA 1XHKA 2UUCE 4EMDA 4DR5E 2IERA 4YHHI 2V2QA 3QT6A 4LF7E 2C38B 2UUAI 2JEBA 2C39A 3OTOI 3M85G 2NPFA 3JAMC 4LFAI 1QZRA 1XXEA 1XMOE 1Y4SA 4X64I 2UUAE 2UXCE 5DRRA 4HYMA 1D6TA 1E3PA 2EFGA 2Z5EA 3H4LA 5DNXA 4DUYI 4JI6E 1RR9A 4JI5E 4JV5I 1XMOI 4X64E 4LF4I 4FWDA 4JG4A 4B3RI 2BR2B 3ZKDA 1H73A 4OO1E 4BA2A 4JV5E 2UXBE 2Q2EB 4DR4E 4IS9A 3PYFA 4X66E 2UU9I 2IOQA 4B3MI 4JI8I 4ISAA 3U1YA 4DV1E 3L7ZA 1IBKI 3PYGA 3ZZ0A 1N34E 1B63A 3PYDA 4JI8E 2PNMA 1ZM3A 4LF9I 5C0XE 5FWKA 3M7NG 4YY3E 4NXNE 3KRNA 5FLXQ 3GONA 3U1KA 5DRPA 4GKJI 4DV3E 4LCGA 1ZM2A 3CDJA 4X65I 4GQUA 1Y5YA 2GO3A 1ZM9A 4HY1A 4X62E 1HK7A 1HR0E 4U3BA 1Y4UA 4JI4I 4ED4A 2HKJA 4OO1C 2HK2A 4HACB 3M7ND 4JI3I 4JI5I 4RPFA 4JYAI 1N33I 4LF8E 5GMEA 5C0XD 4JYAE 2HK3A 4FWGA 1Z0WA 1IBME 4GKKE 2PO2A 1NHIA 1I94E 1Z0GA 3LPSA 4FW5A 1FI4A 4LFCE 2NN6C 1R6MA 1I94I 3PRYA 2VF3A 4KHPI 1E3HA 2E1RA 2V8PA 1MX0A 4B3SI 3GCMA 2WNRB 4LFBE 2F1DA 4DUZE 4AQYI 4DR1I 4DPUA 2UUBE 5EL9A 3WU4A 2PO2B 2CVEA 4UT4A 4DV0E 4DUZI 4QNJA 4AQYE 3HJCA 4FW6A 3T1YI 4DR3I 2JEAA 2PO1B 4OX9I 2A2CA 1HNXI 3LTOA 4JI0E 1UEKA 4DR3E 1N0VC 1RHYA 4FW9A 3P3GA 5LMNE 2WNRA 4DV7E 5L3JA 5IT9Q 5EKWA 4IFDD 4FW4A 2X36A 1U2RA 3T1HI 1BKNA 4OO1A 4JI2E 2BA0D 5K36B 1KTVA 5BR8I 3J80Q 4LF6I 5K36E 1H7SA 4IZJA 3V2UC 5A2QC 1KVKA 2C37A 2UXDI 1FJGE 2A2DA 5BR8E 3P06A 2IESA 2R42A 3K85A 2F4VE 4KHPE 1VI7A 3WU5A 3P3CA 1FJGI 1Z0VA 1WUUA 3PS3A 1N0UA 3K17A 4LFBI 2JT2A 2F4VI 3P3EA 4XTJA 1Z59A 2HFUA 1Y6ZA 3B8HA 2XEXA 1IBLI 4DV0I 4DV2E 1ZM4A 4KQVA 2O3ZA 3J81C 4DR6E 2DEIA 2J65A 4QNKA 2AE8A 4M1KA 1Z0TA 1S16A 4MYUA 4DV4I 1HNXE 4DV2I 1PIEA 1XNQE 2X7IA 3B78A 2BA1G 1A6FA 4MU0A 4DV7I 4DU8A 3ZM7A 2HHHE 1USVA 5DRQA 2C37B 2Z5BB 3GMEA 5LMUI 4WUCA 3HKMA 1NHJA 1N32I 4IFDF 1R6LA 4P7AA 5K36F 2UUCI 4LF6E 4IFDC 2NN6F 1MG7A 5LMUE 4LF5E 5C0XB 2HFSA 2Z5CA 4DPWA 4ZVIA 5GMDA 4LF7I 2Z5BA 1EI1A 3L7ZB 2BV3A 1XMQI 4LF5I 1B62A 1HNZI 4LOMA 2E5LE 1UDSA 2GS8A 5ELWA 3M85D 1XMQE 1YHCA 3M6AA 4DUYE 2BR2A 4FW7A 1HNZE 5DNLA 4DPTA 4WUBA 1XNRI 4IZKB 1FWKA 4FW3A 4DR7E 4OKGA 2JE6A 4IZJB 4U3DA 1ELOA 4USMA 3OTOE 4B3RE 4LCHA
chains in the Genus database with same CATH topology
1XNRE 3J7AG 4PU9A 4R1FA 4DR4I 4LF8I 3ZZTA 4DV4E 4MYTA 2UU9E 2CGEA 3JAMQ 1NHHA 1DARA 1PKPA 3B82A 5A2QQ 2J7KA 1ZXMA 2ZM6E 2LJPA 1J5EI 1NZ0A 1S4EA 1N32E 1H7UA 4UTGA 4P52A 4DV1I 1IBKE 4GKJE 3QT7A 2ZM6I 1OJ4A 1J5EE 4HXZA 4FN5A 2AJ4A 3V5RA 1HR0I 2HKEA 4DU7A 4DR5I 4LF9E 2ZBKB 3QT5A 4DPYA 1Z0EA 4DV3I 2V2VA 4OX9E 4LFAE 4X65E 1H74A 2O1VA 4Z7CA 5LMNI 3J81Q 4JI4E 2ZITA 1Z0CA 4JI3E 2IOPA 2Z5CB 3J80C 2UXBI 3Q6MA 3QT8A 1N33E 4JI1I 2WW4A 3F0NA 4B3ME 2PNLA 4IZKA 1N34I 3K1JA 5IT9C 4NXMI 4GKKI 2R3VA 1N36E 4NXME 4URLA 4LFCI 4WUDA 1RREA 4NXNI 2BM1A 4YY3I 2O1WA 1ZXNA 1Z5BA 4DV6I 4DR2I 4B3SE 4IZJD 2CZ9A 4X62I 4DR1E 1HNWE 2OI2A 4DV6E 4DR2E 2VQEE 2UUBI 1VISA 2V2ZA 4K0KE 3CWVA 1FWLA 3LNUA 5IWAE 4Z7YA 4JI2I 1PVGA 2DEJA 4JI0I 3PYEA 4JI7I 2VQFE 4B3TI 1FNMA 4JI1E 3WU6A 1IBMI 4DXLA 3T1HE 1H72C 2VQFI 1MU5A 4B3TE 4I3HA 3ZKBA 1KKHA 2V34A 2O1UA 1Z5CA 4HACA 4YHHE 3Q6NA 3D4JA 2E5LI 1N36I 2UXDE 3Q1QA 4FWHA 1KIJA 3WU3A 4DPXA 4DR6I 2UXCI 2CG9A 1FKAE 4DR7I 4PRVA 2O1TA 4JI6I 1K47A 1XNQI 5LL6R 1HNWI 4PRXA 3T1YE 2BM0A 4LF4E 2VQEI 1Z5AA 1IBLE 4K0KI 1USUA 4DV5E 1EA6A 5IWAI 4USKA 4X66I 3J7AM 4DV5I 2GQ0A 4JI7E 5FLXC 3HULA 2HHHI 1Z0BA 4N3OA 3ZZUA 1XHKA 2UUCE 4EMDA 4DR5E 4YHHI 2V2QA 3QT6A 4LF7E 2UUAI 3OTOI 2NPFA 3JAMC 4LFAI 1QZRA 1XMOE 2UUAE 1Y4SA 4X64I 2UXCE 4HYMA 1D6TA 2Z5EA 2EFGA 3H4LA 4DUYI 4JI6E 1RR9A 4JI5E 4JV5I 1XMOI 4X64E 4LF4I 4FWDA 4JG4A 4B3RI 3ZKDA 1H73A 4JV5E 2UXBE 2Q2EB 4DR4E 3PYFA 4X66E 2UU9I 2IOQA 4B3MI 4JI8I 4DV1E 1IBKI 3PYGA 3ZZ0A 1N34E 1B63A 3PYDA 4JI8E 2PNMA 1ZM3A 4LF9I 5FWKA 4YY3E 4NXNE 5FLXQ 3GONA 4GKJI 4DV3E 1ZM2A 4X65I 1ZM9A 4HY1A 4X62E 1HK7A 1HR0E 1Y4UA 4JI4I 4ED4A 2HKJA 2HK2A 4HACB 4JI3I 4JI5I 4RPFA 4JYAI 1N33I 4LF8E 5GMEA 4JYAE 2HK3A 4FWGA 1Z0WA 1IBME 4GKKE 1NHIA 1I94E 1Z0GA 3LPSA 1FI4A 4LFCE 1I94I 3PRYA 2VF3A 4KHPI 2E1RA 2V8PA 1MX0A 4B3SI 4LFBE 4DUZE 4AQYI 4DR1I 4DPUA 2UUBE 3WU4A 4UT4A 4DV0E 4DUZI 4AQYE 3HJCA 3T1YI 4DR3I 4OX9I 2A2CA 1HNXI 3LTOA 4JI0E 1UEKA 4DR3E 1N0VC 4FW9A 5LMNE 4DV7E 5L3JA 5IT9Q 2X36A 1U2RA 3T1HI 1BKNA 4JI2E 1KTVA 5BR8I 3J80Q 4LF6I 1H7SA 4IZJA 3V2UC 5A2QC 1KVKA 2UXDI 1FJGE 2A2DA 5BR8E 3P06A 2R42A 3K85A 2F4VE 4KHPE 3WU5A 1FJGI 1Z0VA 1WUUA 1N0UA 3K17A 4LFBI 2F4VI 4XTJA 1Z59A 2HFUA 1Y6ZA 3B8HA 2XEXA 1IBLI 4DV0I 4DV2E 1ZM4A 4KQVA 3J81C 4DR6E 2DEIA 4M1KA 1Z0TA 1S16A 4MYUA 4DV4I 1HNXE 4DV2I 1PIEA 1XNQE 2X7IA 3B78A 1A6FA 4DV7I 4DU8A 3ZM7A 2HHHE 1USVA 2Z5BB 5LMUI 4WUCA 1NHJA 1N32I 4P7AA 2UUCI 4LF6E 4LF5E 1MG7A 5LMUE 2HFSA 2Z5CA 4DPWA 4ZVIA 5GMDA 4LF7I 2Z5BA 1EI1A 2BV3A 1XMQI 4LF5I 1B62A 1HNZI 2E5LE 2GS8A 1XMQE 3M6AA 4DUYE 1HNZE 4DPTA 4WUBA 1XNRI 4IZKB 1FWKA 4DR7E 4B3RE 4IZJB 3OTOE 1ELOA 4USMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z5B A;  2Z5C A; 
#chains in the Genus database with same CATH topology
 1XNR E;  3J7A G;  2JEB B;  4J3D A;  1UDO A;  4PU9 A;  4R1F A;  5JEA A;  4LF8 I;  4DR4 I;  3ZZT A;  5JEA B;  4DV4 E;  4MYT A;  2UU9 E;  2CGE A;  2WP8 A;  5JEA C;  2PNZ A;  1NHH A;  4MU3 A;  3JAM Q;  5JEA E;  1DAR A;  1PKP A;  2JE6 B;  3B82 A;  4AIM A;  5A2Q Q;  2J7K A;  1ZXM A;  2ZM6 E;  2LJP A;  1J5E I;  1NZ0 A;  1S4E A;  1N32 E;  1H7U A;  4BA1 A;  1OYR A;  4IFD B;  4UTG A;  4P52 A;  4DV1 I;  1IBK E;  4GKJ E;  2NN6 B;  3QT7 A;  2C39 B;  1OJ4 A;  2ZM6 I;  4HXZ A;  1J5E E;  4FN5 A;  2AJ4 A;  3V5R A;  1HR0 I;  2HKE A;  4DU7 A;  4DR5 I;  1YH8 A;  4LF9 E;  2ZBK B;  1OYP A;  2PO0 B;  3QT5 A;  4DPY A;  2NN6 A;  1UDQ A;  1Z0E A;  4DV3 I;  2V2V A;  4OX9 E;  4LFA E;  4BA1 B;  4X65 E;  4IFD E;  1H74 A;  3NZK A;  2O1V A;  2JEA B;  4Z7C A;  5LMN I;  3J81 Q;  4JI4 E;  2NN6 D;  2ZIT A;  5DRO A;  1OYS A;  1Z0C A;  4JI3 E;  5JEA F;  2IOP A;  2Z5C B;  3J80 C;  2UXB I;  3Q6M A;  3QT8 A;  1N33 E;  4JI1 I;  2WW4 A;  3F0N A;  4B3M E;  4OZE A;  2PNL A;  4IZK A;  2VES A;  1N34 I;  3K1J A;  5IT9 C;  4NXM I;  4GKK I;  2R3V A;  4IFD A;  1N36 E;  3PS1 A;  3B4T A;  2NN6 E;  4NXM E;  4URL A;  4OO1 D;  4LFC I;  4WUD A;  1RRE A;  4NXN I;  2BM1 A;  4YY3 I;  2O1W A;  1ZXN A;  1Z5B A;  4DV6 I;  4DR2 I;  4B3S E;  4IZJ D;  2CZ9 A;  2WP8 B;  4X62 I;  5K36 A;  4DR1 E;  1HNW E;  5C0X A;  2OI2 A;  4DV6 E;  4DR2 E;  2VQE E;  2UUB I;  1VIS A;  2V2Z A;  5K36 C;  4OO1 F;  4K0K E;  3CWV A;  4NBQ A;  2C38 A;  1FWL A;  3LNU A;  5IWA E;  4Z7Y A;  3DD6 A;  4JI2 I;  5K36 D;  1PVG A;  2DEJ A;  1Y60 A;  4JI0 I;  3PYE A;  2PO1 A;  4JI7 I;  3P76 A;  1UDN A;  2VQF E;  4AM3 A;  4B3T I;  1FNM A;  4JI1 E;  5C0X F;  3WU6 A;  1IBM I;  4DXL A;  3T1H E;  1H72 C;  2VQF I;  1MU5 A;  4MQY A;  4B3T E;  4I3H A;  3ZKB A;  1KKH A;  4LPF A;  2V34 A;  2O1U A;  1Z5C A;  4HAC A;  4YHH E;  3Q6N A;  3D4J A;  2E5L I;  1N36 I;  4BA2 B;  2UXD E;  3Q1Q A;  4LCF A;  4FWH A;  1KIJ A;  3WU3 A;  4DPX A;  4DR6 I;  2UXC I;  2CG9 A;  1FKA E;  4DR7 I;  4PRV A;  2O1T A;  4JI6 I;  1K47 A;  1XNQ I;  5LL6 R;  1HNW I;  4PRX A;  4MU1 A;  2BM0 A;  3T1Y E;  3PS2 A;  2PNZ B;  2VQE I;  4LF4 E;  1Z5A A;  1IBL E;  4K0K I;  2PO0 A;  4OO1 B;  1USU A;  4MU4 A;  2BA0 G;  4DV5 E;  1EA6 A;  5IWA I;  3H1C A;  4MDT A;  4USK A;  2BA1 D;  4AID A;  4X66 I;  1P42 A;  3UHM A;  3J7A M;  4DV5 I;  2GQ0 A;  3CDI A;  4JI7 E;  5FLX C;  5C0X C;  3HUL A;  2HHH I;  2GO4 A;  1Z0B A;  4N3O A;  5JEA D;  3ZZU A;  3GLL A;  1XHK A;  2UUC E;  4EMD A;  4DR5 E;  2IER A;  4YHH I;  2V2Q A;  3QT6 A;  4LF7 E;  2C38 B;  2UUA I;  2JEB A;  2C39 A;  3OTO I;  3M85 G;  2NPF A;  3JAM C;  4LFA I;  1QZR A;  1XXE A;  1XMO E;  1Y4S A;  4X64 I;  2UUA E;  2UXC E;  5DRR A;  4HYM A;  1D6T A;  1E3P A;  2EFG A;  2Z5E A;  3H4L A;  5DNX A;  4DUY I;  4JI6 E;  1RR9 A;  4JI5 E;  4JV5 I;  1XMO I;  4X64 E;  4LF4 I;  4FWD A;  4JG4 A;  4B3R I;  2BR2 B;  3ZKD A;  1H73 A;  4OO1 E;  4BA2 A;  4JV5 E;  2UXB E;  2Q2E B;  4DR4 E;  4IS9 A;  3PYF A;  4X66 E;  2UU9 I;  2IOQ A;  4B3M I;  4JI8 I;  4ISA A;  3U1Y A;  4DV1 E;  3L7Z A;  1IBK I;  3PYG A;  3ZZ0 A;  1N34 E;  1B63 A;  3PYD A;  4JI8 E;  2PNM A;  1ZM3 A;  4LF9 I;  5C0X E;  5FWK A;  3M7N G;  4YY3 E;  4NXN E;  3KRN A;  5FLX Q;  3GON A;  3U1K A;  5DRP A;  4GKJ I;  4DV3 E;  4LCG A;  1ZM2 A;  3CDJ A;  4X65 I;  4GQU A;  1Y5Y A;  2GO3 A;  1ZM9 A;  4HY1 A;  4X62 E;  1HK7 A;  1HR0 E;  4U3B A;  1Y4U A;  4JI4 I;  4ED4 A;  2HKJ A;  4OO1 C;  2HK2 A;  4HAC B;  3M7N D;  4JI3 I;  4JI5 I;  4RPF A;  4JYA I;  1N33 I;  4LF8 E;  5GME A;  5C0X D;  4JYA E;  2HK3 A;  4FWG A;  1Z0W A;  1IBM E;  4GKK E;  2PO2 A;  1NHI A;  1I94 E;  1Z0G A;  3LPS A;  4FW5 A;  1FI4 A;  4LFC E;  2NN6 C;  1R6M A;  1I94 I;  3PRY A;  2VF3 A;  4KHP I;  1E3H A;  2E1R A;  2V8P A;  1MX0 A;  4B3S I;  3GCM A;  2WNR B;  4LFB E;  2F1D A;  4DUZ E;  4AQY I;  4DR1 I;  4DPU A;  2UUB E;  5EL9 A;  3WU4 A;  2PO2 B;  2CVE A;  4UT4 A;  4DV0 E;  4DUZ I;  4QNJ A;  4AQY E;  3HJC A;  4FW6 A;  3T1Y I;  4DR3 I;  2JEA A;  2PO1 B;  4OX9 I;  2A2C A;  1HNX I;  3LTO A;  4JI0 E;  1UEK A;  4DR3 E;  1N0V C;  1RHY A;  4FW9 A;  3P3G A;  5LMN E;  2WNR A;  4DV7 E;  5L3J A;  5IT9 Q;  5EKW A;  4IFD D;  4FW4 A;  2X36 A;  1U2R A;  3T1H I;  1BKN A;  4OO1 A;  4JI2 E;  2BA0 D;  5K36 B;  1KTV A;  5BR8 I;  3J80 Q;  4LF6 I;  5K36 E;  1H7S A;  4IZJ A;  3V2U C;  5A2Q C;  1KVK A;  2C37 A;  2UXD I;  1FJG E;  2A2D A;  5BR8 E;  3P06 A;  2IES A;  2R42 A;  3K85 A;  2F4V E;  4KHP E;  1VI7 A;  3WU5 A;  3P3C A;  1FJG I;  1Z0V A;  1WUU A;  3PS3 A;  1N0U A;  3K17 A;  4LFB I;  2JT2 A;  2F4V I;  3P3E A;  4XTJ A;  1Z59 A;  2HFU A;  1Y6Z A;  3B8H A;  2XEX A;  1IBL I;  4DV0 I;  4DV2 E;  1ZM4 A;  4KQV A;  2O3Z A;  3J81 C;  4DR6 E;  2DEI A;  2J65 A;  4QNK A;  2AE8 A;  4M1K A;  1Z0T A;  1S16 A;  4MYU A;  4DV4 I;  1HNX E;  4DV2 I;  1PIE A;  1XNQ E;  2X7I A;  3B78 A;  2BA1 G;  1A6F A;  4MU0 A;  4DV7 I;  4DU8 A;  3ZM7 A;  2HHH E;  1USV A;  5DRQ A;  2C37 B;  2Z5B B;  3GME A;  5LMU I;  4WUC A;  3HKM A;  1NHJ A;  1N32 I;  4IFD F;  1R6L A;  4P7A A;  5K36 F;  2UUC I;  4LF6 E;  4IFD C;  2NN6 F;  1MG7 A;  5LMU E;  4LF5 E;  5C0X B;  2HFS A;  2Z5C A;  4DPW A;  4ZVI A;  5GMD A;  4LF7 I;  2Z5B A;  1EI1 A;  3L7Z B;  2BV3 A;  1XMQ I;  4LF5 I;  1B62 A;  1HNZ I;  4LOM A;  2E5L E;  1UDS A;  2GS8 A;  5ELW A;  3M85 D;  1XMQ E;  1YHC A;  3M6A A;  4DUY E;  2BR2 A;  4FW7 A;  1HNZ E;  5DNL A;  4DPT A;  4WUB A;  1XNR I;  4IZK B;  1FWK A;  4FW3 A;  4DR7 E;  4OKG A;  2JE6 A;  4IZJ B;  4U3D A;  1ELO A;  4USM A;  3OTO E;  4B3R E;  4LCH A; 
#chains in the Genus database with same CATH homology
 1XNR E;  3J7A G;  4PU9 A;  4R1F A;  4DR4 I;  4LF8 I;  3ZZT A;  4DV4 E;  4MYT A;  2UU9 E;  2CGE A;  3JAM Q;  1NHH A;  1DAR A;  1PKP A;  3B82 A;  5A2Q Q;  2J7K A;  1ZXM A;  2ZM6 E;  2LJP A;  1J5E I;  1NZ0 A;  1S4E A;  1N32 E;  1H7U A;  4UTG A;  4P52 A;  4DV1 I;  1IBK E;  4GKJ E;  3QT7 A;  2ZM6 I;  1OJ4 A;  1J5E E;  4HXZ A;  4FN5 A;  2AJ4 A;  3V5R A;  1HR0 I;  2HKE A;  4DU7 A;  4DR5 I;  4LF9 E;  2ZBK B;  3QT5 A;  4DPY A;  1Z0E A;  4DV3 I;  2V2V A;  4OX9 E;  4LFA E;  4X65 E;  1H74 A;  2O1V A;  4Z7C A;  5LMN I;  3J81 Q;  4JI4 E;  2ZIT A;  1Z0C A;  4JI3 E;  2IOP A;  2Z5C B;  3J80 C;  2UXB I;  3Q6M A;  3QT8 A;  1N33 E;  4JI1 I;  2WW4 A;  3F0N A;  4B3M E;  2PNL A;  4IZK A;  1N34 I;  3K1J A;  5IT9 C;  4NXM I;  4GKK I;  2R3V A;  1N36 E;  4NXM E;  4URL A;  4LFC I;  4WUD A;  1RRE A;  4NXN I;  2BM1 A;  4YY3 I;  2O1W A;  1ZXN A;  1Z5B A;  4DV6 I;  4DR2 I;  4B3S E;  4IZJ D;  2CZ9 A;  4X62 I;  4DR1 E;  1HNW E;  2OI2 A;  4DV6 E;  4DR2 E;  2VQE E;  2UUB I;  1VIS A;  2V2Z A;  4K0K E;  3CWV A;  1FWL A;  3LNU A;  5IWA E;  4Z7Y A;  4JI2 I;  1PVG A;  2DEJ A;  4JI0 I;  3PYE A;  4JI7 I;  2VQF E;  4B3T I;  1FNM A;  4JI1 E;  3WU6 A;  1IBM I;  4DXL A;  3T1H E;  1H72 C;  2VQF I;  1MU5 A;  4B3T E;  4I3H A;  3ZKB A;  1KKH A;  2V34 A;  2O1U A;  1Z5C A;  4HAC A;  4YHH E;  3Q6N A;  3D4J A;  2E5L I;  1N36 I;  2UXD E;  3Q1Q A;  4FWH A;  1KIJ A;  3WU3 A;  4DPX A;  4DR6 I;  2UXC I;  2CG9 A;  1FKA E;  4DR7 I;  4PRV A;  2O1T A;  4JI6 I;  1K47 A;  1XNQ I;  5LL6 R;  1HNW I;  4PRX A;  3T1Y E;  2BM0 A;  4LF4 E;  2VQE I;  1Z5A A;  1IBL E;  4K0K I;  1USU A;  4DV5 E;  1EA6 A;  5IWA I;  4USK A;  4X66 I;  3J7A M;  4DV5 I;  2GQ0 A;  4JI7 E;  5FLX C;  3HUL A;  2HHH I;  1Z0B A;  4N3O A;  3ZZU A;  1XHK A;  2UUC E;  4EMD A;  4DR5 E;  4YHH I;  2V2Q A;  3QT6 A;  4LF7 E;  2UUA I;  3OTO I;  2NPF A;  3JAM C;  4LFA I;  1QZR A;  1XMO E;  2UUA E;  1Y4S A;  4X64 I;  2UXC E;  4HYM A;  1D6T A;  2Z5E A;  2EFG A;  3H4L A;  4DUY I;  4JI6 E;  1RR9 A;  4JI5 E;  4JV5 I;  1XMO I;  4X64 E;  4LF4 I;  4FWD A;  4JG4 A;  4B3R I;  3ZKD A;  1H73 A;  4JV5 E;  2UXB E;  2Q2E B;  4DR4 E;  3PYF A;  4X66 E;  2UU9 I;  2IOQ A;  4B3M I;  4JI8 I;  4DV1 E;  1IBK I;  3PYG A;  3ZZ0 A;  1N34 E;  1B63 A;  3PYD A;  4JI8 E;  2PNM A;  1ZM3 A;  4LF9 I;  5FWK A;  4YY3 E;  4NXN E;  5FLX Q;  3GON A;  4GKJ I;  4DV3 E;  1ZM2 A;  4X65 I;  1ZM9 A;  4HY1 A;  4X62 E;  1HK7 A;  1HR0 E;  1Y4U A;  4JI4 I;  4ED4 A;  2HKJ A;  2HK2 A;  4HAC B;  4JI3 I;  4JI5 I;  4RPF A;  4JYA I;  1N33 I;  4LF8 E;  5GME A;  4JYA E;  2HK3 A;  4FWG A;  1Z0W A;  1IBM E;  4GKK E;  1NHI A;  1I94 E;  1Z0G A;  3LPS A;  1FI4 A;  4LFC E;  1I94 I;  3PRY A;  2VF3 A;  4KHP I;  2E1R A;  2V8P A;  1MX0 A;  4B3S I;  4LFB E;  4DUZ E;  4AQY I;  4DR1 I;  4DPU A;  2UUB E;  3WU4 A;  4UT4 A;  4DV0 E;  4DUZ I;  4AQY E;  3HJC A;  3T1Y I;  4DR3 I;  4OX9 I;  2A2C A;  1HNX I;  3LTO A;  4JI0 E;  1UEK A;  4DR3 E;  1N0V C;  4FW9 A;  5LMN E;  4DV7 E;  5L3J A;  5IT9 Q;  2X36 A;  1U2R A;  3T1H I;  1BKN A;  4JI2 E;  1KTV A;  5BR8 I;  3J80 Q;  4LF6 I;  1H7S A;  4IZJ A;  3V2U C;  5A2Q C;  1KVK A;  2UXD I;  1FJG E;  2A2D A;  5BR8 E;  3P06 A;  2R42 A;  3K85 A;  2F4V E;  4KHP E;  3WU5 A;  1FJG I;  1Z0V A;  1WUU A;  1N0U A;  3K17 A;  4LFB I;  2F4V I;  4XTJ A;  1Z59 A;  2HFU A;  1Y6Z A;  3B8H A;  2XEX A;  1IBL I;  4DV0 I;  4DV2 E;  1ZM4 A;  4KQV A;  3J81 C;  4DR6 E;  2DEI A;  4M1K A;  1Z0T A;  1S16 A;  4MYU A;  4DV4 I;  1HNX E;  4DV2 I;  1PIE A;  1XNQ E;  2X7I A;  3B78 A;  1A6F A;  4DV7 I;  4DU8 A;  3ZM7 A;  2HHH E;  1USV A;  2Z5B B;  5LMU I;  4WUC A;  1NHJ A;  1N32 I;  4P7A A;  2UUC I;  4LF6 E;  4LF5 E;  1MG7 A;  5LMU E;  2HFS A;  2Z5C A;  4DPW A;  4ZVI A;  5GMD A;  4LF7 I;  2Z5B A;  1EI1 A;  2BV3 A;  1XMQ I;  4LF5 I;  1B62 A;  1HNZ I;  2E5L E;  2GS8 A;  1XMQ E;  3M6A A;  4DUY E;  1HNZ E;  4DPT A;  4WUB A;  1XNR I;  4IZK B;  1FWK A;  4DR7 E;  4B3R E;  4IZJ B;  3OTO E;  1ELO A;  4USM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...