2Z5HA

Crystal structure of the head-to-tail junction of tropomyosin complexed with a fragment of tnt
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
49
structure length
49
Chain Sequence
GELLSKNYHLENEVARLKKLVDDLEDELYAQKLKYKAISEELDHALNDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for tropomyosin overlap in thin (actin) filaments and the generation of a molecular swivel by troponin-T
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Contractile protein
molecule keywords General control protein GCN4 and Tropomyosin alpha-1 chain
total genus 23
structure length 49
sequence length 49
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2007-07-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2z5hA00
2XV5A 3M91A 4JYBA 2YNYA 2JJLA 2KP8A 3M9BA 3IR9A 5AW3B 2WT7B 5APWA 3V4QA 4I2LC 2P67A 3TYYA 1MV8A 3M0DA 1YYCA 2WTYA 2R5DA 1A02F 1H89A 3T97A 2XU6A 2Z5IA 3KDPB 1GTWA 1KQLA 5AVXB 3A5TA 5AVYB 3TNUB 2C9LY 3HE5A 2WPRA 4AUWA 2VRSA 3KQGA 1HJBA 3TNUA 4C46A 2WPQA 4AQRD 5AVQB 1T2KD 2XZRA 4GT1A 1OWAA 1GZLA 3M06A 1GU5A 3A7OA 2Q7CA 3A3YB 3VN0A 3HE4B 5APXA 4C7NA 1MUUA 4KHXA 1OXZA 2WT7A 2YO2A 1S9KE 3NTNA 1GU4A 5AW4B 5AW0B 1GK6A 5AVUB 4RESB 3OAKA 1NWQA 2E43A 3L35A 1HBWA 1G2CB 3HE5B 2WWWA 5APTA 1T2KC 3VTPC 5AW5B 1CSBA 1JUNA 5AVRB 3VMXA 3HTKA 2E42A 1GD2E 5APSA 1S9KD 2N9BA 1NAFA 1SLQA 3VYIA 5AVWB 3P7KA 1GK4A 3L37A 4HYTB 4EOTA 1CZQA 4AYCA 1FOSF 1JNMA 3B8EB 3NXSA 4I6MC 3UIAA 2BASA 5APQA 5APUA 3LIDA 3NFQA 5AVVB 3VMZA 3O8ZA 2H7HA 1MFZA 5CMZA 1CI6B 2IPPA 3P8MC 5AW7B 2Q5UA 2R32A 4M3LA 4B86A 5AW2B 5AW9B 3M9HA 2W27A 2Q3IA 4XE5B 2WPSA 5AVTB 3MD0A 3TK1A 1H8AA 2ZXEB 2R5BA 5AW1B 4C7NB 5AW8B 1IO4A 4DZOA 3I5CA 3P32A 2QM8A 3NMDA 4GKGA 5APVA 3V4WA 3M0AA 5AW6B 5APYA 2C9NY 2P2UA 1H88A 1DH3A 5AVSB 3VMYA 1SP4A 4JYCA 3LIEA 3V5BA 1CI6A 3A2AA 1HUCA 4LC1A 1HWTC 3MGNA 2QM7A 2W6AA 2P7JA 1FAVA 1J2JB 2ZFCA 1A02J 3SWFA 2Z5HA 5AVZB 1FOSE 2R3CA 2YO3A 3HE4A 1X8YA 3L36A
chains in the Genus database with same CATH superfamily
3M91A 2HYNA 1SQXJ 1SQPD 3U1CA 1NGMB 2M5AB 1NTKK 1EZVG 3H1IJ 5APWA 3G6EP 1SQXG 2XNDH 5B5EE 2WSSH 1JTHA 2AXTH 2R5DA 4GIFA 2JWDA 4PD4I 1H89A 1GTWA 2Z5IA 1GDTA 5AVXB 3V2PA 3A5TA 1KYOI 2V4HA 3CCJP 3P8CD 3I55P 1M1JB 4AUWA 1YTZT 3SWYA 1URQD 1YBKA 3H6PA 5E79E 1FZFA 1U7MA 1SQVK 2BCCD 1EZVI 5H2FH 3CMAP 1LTJB 1QGKB 3RK2B 2GUSA 4BRYA 1Q7YQ 1VQLP 1T2KD 3CD6P 3O6QA 1RE4A 1ZRTE 4ZKUA 1LT1A 1BGYE 1SQBG 1N73A 1JMMA 3II6A 1BDDA 4OGQD 1LTBC 1Q90D 2Q7CA 3A3YB 4PD4H 3PH0A 2P10A 3F89A 3GMAA 1S2EA 4GOEA 4WBAA 2B9BA 1VQ8P 2QJPB 3N7NA 1KYOH 1SQBJ 3HD7C 4GOFA 3VP8A 1OXZA 4ZKPA 2YO2A 3KZIE 1YITP 3H1LD 5AW4B 2HR3A 2WSEJ 4L75A 1PPJE 3SSUA 2W90A 1BCCJ 1GW3A 2ZXXA 3A0HH 3E1RA 4N6JA 4U3FG 3MUDC 1UIIA 3USSA 2WMMA 4YXDC 1IFNA 1IFIA 3V2NA 5CJ4A 1RE3C 1G2CB 4U3FJ 5APTA 1K05A 2FFDC 1DX7A 1LTSC 1ZN5A 3KPEA 2O01N 2FXMA 1QVGO 1NTMG 1SQQG 3MHVA 2ZT9C 1PP9G 2A06D 2CK3H 1BE3J 3TGUJ 1X79B 2OYIC 3Q2YA 2Y0DA 2QJPC 1KTMA 3AE8C 2ZYGA 5KLVD 2H89C 2ZVOB 3L70G 3VYIA 4IL6X 2N1TA 4BXLA 3L73G 1QX8A 4WY4A 2HPCA 1L0LK 5E79H 3JCUH 3AE3C 5AVWB 5BU8B 3L73J 1L4AD 4EOTA 1T3UA 5KLIC 3CCEP 2A06E 1T8ZA 4K3AA 4L76A 3UIAA 1LNQA 4I6MC 5APQA 3TDKA 3CX5H 2ZYDA 3HRNA 3LIDA 4UB6E 1ZV8A 1NOHA 2QSIA 3L70D 1OW8A 5K5GB 1YJWP 3HUSC 2H7HA 1NTKD 3L72D 4EIJA 4U7JA 5CMZA 1L0LG 2KI7B 1LTIC 3ABVC 3RL0g 3T97B 1CI6B 2IPPA 2WPVB 3P8MC 4C7RA 4PD4D 2I1JA 2MKVA 5AW2B 2JDIH 1KILB 3BRTB 5AW9B 4O9BA 2Q1KA 1GL2A 2LXCB 2W27A 3JC22 1URQA 3CWBJ 1FU1A 2KNCA 1OVVA 2KUBA 2KSJA 2ZYAA 1YQ4C 1U7JA 5AVTB 1UIXA 1RF0C 2Y0CA 2O01J 1LTJC 4K35A 2PGDA 4WY4C 1LJ2A 1SFCA 2QJYC 1VQ5P 3CWBG 3FGAD 5AW8B 2FKWB 1NTZG 2Y9ZA 3P32A 1JY2O 2KS1A 3JSVC 3Q5RA 3V4WA 1S3JA 1T6AA 2C9NY 3B5ND 1PV3A 2P2UA 3IF4A 3A0BH 1PGOA 1IZNB 1MZ9A 2IX7C 1Z56A 1NTZJ 2IBZE 3CWBE 1JB0J 5AVSB 1IC2A 2OYHC 2FYNB 3D70A 5L8RJ 2QJKB 3V5BA 3L74G 1CI6A 3AE5C 1HWTC 3MGNA 1NHLA 2PRRA 2QM7A 1FAVA 3FWNA 1BGYD 1GL2D 1NTMJ 1SQQJ 4W7ZA 2KLVA 3WUVA 1BSHA 1FJPA 1Q2NA 1HF9A 1OW7A 2Q3EA 2M5AA 2W8ZA 1VQPP 1KC8Q 4H44D 1S4XA 2W6BA 3MP7B 1BCCE 4XA4A 2KB7P 3MTUE 2KSEA 2O1JA 1SFCD 2KP8A 3H1KE 1JTHB 3IR9A 1EDKA 1L0LE 2N1TD 2QG4A 3M9BA 3RL0C 3H1JE 3W68A 5KKZB 1HGZA 2FYNC 3CCQP 1YHQP 1MV8A 3M0DA 2OYHB 3BCCG 2IFNA 3AECC 2WTYA 2YIUC 1X22A 1A02F 1PIXA 1NJIQ 1FE6A 4OGQC 1KB9I 3L73E 3KDPB 5H2FE 3L71J 3EFFK 3L70E 1H0TB 5AVYB 4IL6E 3C9IA 3HE5A 1PFIA 3GHGA 4RO0A 2K88A 1QEXA 1SQPE 2RKLA 1S5LE 2VRSA 5BU5A 1HJBA 1VQ7P 3TNUA 1L4AA 4C46A 3QH9A 2QA4P 1URQC 2WPQA 2O3JA 5AVQB 3BVHA 3H1LE 4N78E 4GT1A 1ZOYC 2G3AA 4H13B 1JCDA 3LW5J 1NH4A 1PZQA 2Y9YA 1OMIA 2C0XA 1N7SC 4QMAA 5GTHE 1R5LA 4RJTA 3A7OA 3TGUE 2M0BA 2YIUB 1ZLLA 1QVFO 2WSEH 1AJYA 1VQMP 1TU3F 3MUDA 1S9KE 1GU4A 3H1HD 3QWOC 2AEMA 1GK6A 5AW0B 5CBOA 3V2RA 1ZRTD 1FJKA 2E75B 5AVUB 3OAKA 4HJGH 2RMZA 3L35A 4YTPC 3RBXA 3TGUG 5CCHC 3Q5PA 2QEXP 1SQVE 1SQBE 1HJ0A 2WWWA 1IFJA 4YPCA 4XFJA 3VTPC 1KQSO 3CMEP 3CC7P 1H0TA 2L91A 1Y8AA 2FY8A 2POHA 2NPSB 3CXHE 4H44B 1YJNP 5AVRB 1EZVD 1N7SA 2Z4EA 1IFDA 1RE4C 5KAIH 1ZR2A 2E42A 5M1BA 4PV1C 2IZ1A 1S9KD 1AVYA 2A45H 3U1AA 3H25A 4WVZA 1N73B 2N9BA 2K9JA 2KZJA 3V2QA 2AEJA 2DW3A 2Q6QA 5GTIE 1PP9D 1S72P 3L4FA 1G1JA 1JY2P 2ITAA 1IO4A 2N1TC 3JCUE 3RL0D 1NKZB 5TISH 4AYCA 1EZVE 2YKPA 5KLVG 1OFCX 2KLUA 2V7QH 1LWUB 2HLOA 3B8EB 4H44C 4ZMDA 1NTZK 2BASA 1LWUC 3WMM0 2OQQA 2E74C 5DJTB 5APUA 1W2BO 3SFDC 2FFDB 2OTJP 1JOCA 1L0ND 3VMZA 2K1AA 2A45I 4R4MA 2KXPB 4IFDK 3AE7C 2IBZD 1MFZA 2OARA 4PJ0H 5KJ7D 2BEZF 3M9QA 1IK7A 1M7LA 3G71P 5AW7B 1N7SD 1NAYA 2D2CD 2WQYC 2WSCJ 3RK3C 1VF5B 3H1LG 1PGQA 2D2CB 2XNXA 2YKOA 4NPDA 2QJKC 3A0HE 4B86A 3CC4P 1XTCC 3HD7B 1EXJA 1NTKG 1RY3A 1SQXK 2M3EA 3CCLP 1AFOA 2YXQB 2K9JB 1DIPA 3K5BA 1NU1E 1Y47A 3O6QB 2M3BA 5CHXA 5KLIB 1ZW0A 3D6ZA 3L75J 3AE1C 5AW1B 2P58A 1IFMA 1KORA 3C1LA 3L75G 1E5WA 1USDA 2ZAEB 2FYUK 3BCCE 1YIJP 1JY3N 1OW6A 2QIWA 2ZT9B 5KKZC 3NMDA 2FXPA 3GW6A 4GKGA 4D6TG 4Z1MH 1KB9E 1DEBA 3L73D 5APYA 3FXEA 1SFCC 2JKVA 4EDFA 4EI2A 1OIPA 1JCCA 3AE9C 1BE3E 3L72E 1VQOP 2QVAA 3H32B 1SP4A 2CPBA 3M0DC 3FX0A 1RE3A 2WVRA 2PAJA 2LXBA 2ZVNB 2NPSD 4UB6H 5TISE 4D6TJ 1GL2C 1VQ9P 1BDCA 1HUCA 2AXTE 3MZWB 1GL2B 3EQ2A 1PGJA 2E76D 5DJUB 3L72J 4H0LB 1VQ6P 1J2JB 1LT9C 2E76B 2GUVA 2ZFCA 3HD7A 4ZNCA 1RF1C 3L72G 4DOJA 2AXCA 3PHLA 1FOSE 1WT6A 2A45G 3BCCJ 3G4SP 2KIKA 1SFCB 4PV1B 1M56D 2HG5D 2HPCB 4JYBA 2FBWC 3B5NC 3L71E 3L70J 1N73C 4I2LC 2JWAA 3KYQA 3B4SA 1YYCA 5B66E 3L75E 3WU2H 5CCGC 1M90Q 1W5CE 1EDLA 1LTAC 1KQLA 1L0LJ 1NU1G 2XDJA 3H1KJ 2BEQD 1IFPA 1P84I 3TNUB 4DT0A 3CCSP 1N7LA 1WMKA 2LR2A 2C9LY 3VMAA 3KQGA 1WRGA 4WWIA 4AQRD 1NTME 1SQQE 2OYOA 2Q9IA 3AE4C 1GZLA 2QE7H 2W6JH 1IJDB 1NTZD 2K37A 2ZJSE 3CI9A 3S4RA 1GU5A 3AEAC 1N2DC 1FZAA 5EFWB 1NU1D 3VN0A 3AEFC 1YQ3C 3C8VA 1MFTA 1S5LH 1MUUA 1OVUA 4KHXA 3CX5I 3TSIA 3NTNA 3H1JD 2PFXA 3IAOA 5KLVE 3B5NA 1AVOA 2JP3A 4RESB 2E43A 2KYVA 2WITA 1HBWA 1X0TA 2B87B 3HE5B 1LTGC 1NO4A 4JBZA 3S9OA 1T2KC 1L4AC 5AW5B 4TT3H 3L74J 1CSBA 4EYYQ 1L4AB 3H1HG 2HODB 3VMXA 2V7QJ 3HTKA 4HH2A 4Y99C 1EQ7A 1M1KQ 3OW2O 5APSA 3IN6A 1RF0A 1SQVJ 4RKUJ 3RBZA 3V6IA 1SVFA 1PPJD 2D2CC 3RK3D 1XTGB 3GF7A 1NAFA 2LKMA 1YJ9P 2JR8A 1KV4A 5KJ7C 3BRVB 2I1KA 3WUUA 1SQVG 3P7KA 1GK4A 1YTZI 3CXHD 3GLMA 3L37A 1CZQA 1OZHA 5CCGA 2E74D 2IDBA 1KILC 3U59A 2N9YB 3L71D 3CCUP 1FOSF 1JNMA 1KFMA 1QL2A 1SQBK 3NXSA 3A0BE 4PJ0E 4KT0J 3GF3A 4H0LD 4Y99B 1PL5A 3NFQA 3HD7D 1IK9A 2IYOA 3F5HA 3R2PA 4DJGA 3Q1MA 3AE2C 1AA0A 1SQPG 5KAIE 1KYOD 1VQKP 1N7SB 1YI2P 3H1LJ 1FZBA 2Y0EA 3KHUA 1Q86Q 4OWFA 1HGVA 2R32A 3E1IA 2WSFH 3SFEC 4GODA 1R8EA 5GTIH 1SQPJ 1GW4A 1S5LX 1SQXD 2OTLP 1KN7A 2RN0A 1L0NE 3CX5D 3WUTA 5B66H 2Q3IA 1NTMK 1RQUA 1SQQK 2WPSA 2BCCJ 2IYPA 2J59M 3AE6C 2E75C 2OGUA 2PP6A 1FS0E 3EWKA 3G3ZA 1BE3D 3H1JJ 1FDOA 2BCCG 1RF1B 2R5BA 2ZXEB 3BATA 3N4XA 1EDJA 1LWUA 3PRJA 2H43A 1KILD 1SS1A 3I5CA 2QJYB 4R4LA 1L0NK 1KB9H 4Y28J 3S1KA 2FFDA 4I7ZB 5APVA 2KK7A 1K8AQ 3KXDA 5AW6B 4I7ZC 2FYUG 2GA1A 1SQBD 1JY2N 2IBZI 3W67A 2M8RA 1J1EC 3P8CE 1DH3A 1X9VA 1D7MA 3GG2A 3VMYA 1LTTC 1NYHA 1BE3G 2FYZA 3CL3D 4JYCA 1EXIA 1KQGB 3LIEA 1VQ4P 1EC5A 1QL1A 5BVZA 2BCCE 2QRXA 1AV1A 2YXRB 3A2AA 1JO5A 4U3FD 1PP9J 2N1TB 2G8YA 1L0NJ 5C39A 1FZEA 4WY4B 5KTBA 2P7JA 1LTJA 2E5TA 3L74E 4IFMA 3D71A 1VQNP 1L0NG 1NTZE 2J5UA 3MIWA 1K9MQ 4NPEA 1CW5A 1S1CX 1A02J 2IBZG 2FYUD 2Z5HA 3OJAB 1HH0A 1HVVA 2K3RA 1KZUB 2YO3A 3HE4A 4C7NB 1X8YA 2W83C 4BWNA 2I8DA 4YXWH 5KLVJ 2XV5A 4IOIH 1RF1A 1J1EB 2JJLA 2YNYA 5AW3B 2WT7B 4HKZH 2OTKE 4JQ0D 3V4QA 4IL6H 2GM4A 2P67A 4HB1A 3TYYA 3RK3B 4LGDE 3PJSK 1USEA 1VL2A 2IZ0A 2YKQA 2XU6A 4H13D 3T97A 3H1IE 1DEEG 2HFED 1G2CA 4OH8B 2J58A 1J1DB 1KYOE 2WPRA 2JO1A 3AEBC 3CPWO 1JY3P 1JEKA 4DCKA 2FXOA 1M1JA 3H1HE 1FDMA 1VF5D 3PLNA 3TF5A 2XZRA 3L75D 1OWAA 5CBNA 2P1JA 1AQ5A 4A7PA 5KLVK 3BASA 3M06A 1K73Q 4BRYB 4NPFX 5CCGD 4D6TD 4OGQB 5CJ0A 2B88A 2B89A 1NTKJ 3HE4B 2R3SA 2H88C 5APXA 4C7NA 3RK2D 3AEGC 3CLQA 3CCMP 2WSCH 2WT7A 1Q82Q 1N8RQ 1NTMD 1SQQD 3ITKA 1H88A 2UWJE 2B87A 1BSNA 3GHGC 1NVOA 2A06G 3AEEC 4CPGA 1ZMEC 4WY4D 1KB9D 2NZ2A 1NWQA 1W2EA 1ZXGA 5B5EH 1M1JC 1PP9E 2H8PD 1KFNA 1U57A 3HTKB 3I56P 1SQPK 1LT9B 2E76C 3CWBD 1KD1Q 2JEEA 3FWLA 2OYIA 1JUNA 3G9RA 1M8OB 2E74B 2FYUJ 2NPSC 3VP9A 3CCRP 2YMYA 3H32A 4U3FE 1GD2E 3B71A 1FZCA 1FDIA 1P84D 4LLHA 1JMBA 4UB8E 3CX5E 1KILA 4L73A 1SLQA 1KMIZ 3H1IG 1OX3A 1DD3A 1QLED 3EFGA 4HYTB 4ASVA 5TJHA 1FC2C 1PPJG 1L0LD 5KAFH 1BGYG 3IFMA 2MJZA 3HUSA 5GTHH 3RGUA 1P84E 5AVVB 1NU1J 2AEFA 3RK2C 3O8ZA 3H1ID 2R44A 1BGYJ 2IFMA 4JF7A 1OVRA 3RL0B 2HODA 2SPZA 2XKMA 3L71G 1GMJA 3H1KG 5CCHA 1G1IA 2NRGA 1LT9A 2OYIB 3CC2P 2Q5UA 3BCCD 1RHZB 4M3LA 1E79H 3Q3DA 3Q5SA 4W7YA 5KJ7A 1M57D 1VF5C 1ZR4A 1LP1A 4KJMA 2ZT9D 2KZIA 3M9HA 1FZGA 3H1JG 1FZCB 1J1DC 1RH5B 2FYUE 2O01H 4XE5B 1FZCC 3LW5H 4JPZB 3CCVP 1JM0A 3MD0A 3E7KA 3TK1A 4I1LA 1BCCG 4D6TE 4ASWA 1H8AA 3SWKA 1URQB 1FBMA 2KNCB 1LGHB 3H1KD 1NU1K 4H13C 1Y9BA 2E5YA 3VOPA 4DZOA 1SQXE 2WSFJ 2E75D 2KOGA 2QM8A 3ZDMA 1L2PA 2CPSA 3L74D 2OYHA 1DD4A 3M0AA 3HUSB 2C0WA 1P84H 3CXHI 1MKMA 1ZP0C 3FXDA 1JY3O 2NPSA 3OA7A 2KS1B 1VDFA 3PP5A 3R4YA 1SQVD 3B5NB 4IFFA 1VPCA 1NTKE 3KZIH 1KQFB 4L74A 5KAFE 3PTZA 1Q81Q 4UB8H 1BCCD 4W80A 3GHGB 1RQVA 4N3YB 4PV1D 1AQTA 1KILE 4PD4E 3WU2E 1HTLC 4LC1A 2L5GB 4MN4C 4N78D 1PGPA 2W6AA 1NKNA 3RK3E 1R5SA 2K9YA 3AEDC 4GDOA 1N86A 4TLFA 2RH0A 1LP1B 3H1HJ 4WB4A 3TGUD 5CCHD 3SWFA 4H0LC 1K04A 1T3JA 2YMKA 5AVZB 3D6YA 2O1KA 2R3CA 1EDIA 3CXHH 4OVNF 2WZ7A 3L36A
chains in the Genus database with same CATH topology
3M91A 2HYNA 3U1CA 1NTKK 5APWA 1JTHA 4GIFA 2R5DA 1H89A 1GTWA 2Z5IA 1GDTA 5AVXB 3V2PA 3A5TA 3P8CD 1M1JB 4AUWA 1YTZT 3SWYA 1URQD 3H6PA 1FZFA 1SQVK 1LTJB 3RK2B 2GUSA 1T2KD 1RE4A 4ZKUA 1N73A 1JMMA 3II6A 1LTBC 2Q7CA 3A3YB 3N7NA 3HD7C 3VP8A 4ZKPA 1OXZA 2YO2A 5AW4B 1GW3A 4N6JA 1IFNA 1IFIA 3V2NA 5CJ4A 1RE3C 1G2CB 5APTA 2FFDC 1DX7A 1LTSC 1ZN5A 3KPEA 2FXMA 1X79B 2OYIC 3VYIA 2N1TA 2HPCA 4WY4A 1L0LK 5AVWB 5BU8B 1L4AD 4EOTA 1T3UA 1T8ZA 3UIAA 4I6MC 5APQA 3LIDA 1ZV8A 1NOHA 2H7HA 3HUSC 4EIJA 5CMZA 1LTIC 1CI6B 2IPPA 3P8MC 4C7RA 2I1JA 5AW2B 1KILB 3BRTB 5AW9B 4O9BA 1GL2A 2W27A 1URQA 1FU1A 2KSJA 5AVTB 1RF0C 1LTJC 4WY4C 1SFCA 5AW8B 2FKWB 3P32A 1JY2O 3V4WA 2C9NY 3B5ND 2P2UA 1MZ9A 5AVSB 2IX7C 1Z56A 1IC2A 2OYHC 3V5BA 1CI6A 1HWTC 3MGNA 1NHLA 2QM7A 1FAVA 1GL2D 4W7ZA 2KLVA 2W6BA 4XA4A 2KB7P 3MTUE 2O1JA 1SFCD 2KP8A 3M9BA 1JTHB 3IR9A 2N1TD 3RL0C 2OYHB 1HGZA 1MV8A 3M0DA 2IFNA 2WTYA 1A02F 3KDPB 5AVYB 3C9IA 3HE5A 1PFIA 3GHGA 2VRSA 5BU5A 1HJBA 3TNUA 1L4AA 4C46A 1URQC 2WPQA 5AVQB 3BVHA 4N78E 4GT1A 1JCDA 1NH4A 2C0XA 1N7SC 3A7OA 1ZLLA 2WSEH 3MUDA 1S9KE 1GU4A 5AW0B 1GK6A 3V2RA 1FJKA 5AVUB 3OAKA 3L35A 5CCHC 2WWWA 1IFJA 3VTPC 2POHA 2Z4EA 2NPSB 5AVRB 1N7SA 1IFDA 1RE4C 1ZR2A 2E42A 1S9KD 2A45H 3U1AA 1N73B 2N9BA 3V2QA 3L4FA 1G1JA 1JY2P 2N1TC 3RL0D 1NKZB 4AYCA 2YKPA 1LWUB 2HLOA 3B8EB 1NTZK 2BASA 1LWUC 3WMM0 5APUA 2FFDB 1JOCA 3VMZA 2A45I 4IFDK 2OARA 1MFZA 5KJ7D 3M9QA 1M7LA 5AW7B 1N7SD 3RK3C 4B86A 2XNXA 2YKOA 1XTCC 3HD7B 1RY3A 1SQXK 1AFOA 5CHXA 2M3BA 5AW1B 1IFMA 1E5WA 2FYUK 1JY3N 3NMDA 4GKGA 1DEBA 5APYA 1SFCC 1JCCA 3H32B 1SP4A 2CPBA 3M0DC 1RE3A 2PAJA 2NPSD 1GL2C 1HUCA 1GL2B 3EQ2A 1J2JB 1LT9C 2GUVA 2ZFCA 3HD7A 1RF1C 4DOJA 1FOSE 1WT6A 2A45G 1SFCB 2HG5D 2HPCB 4JYBA 3B5NC 1N73C 4I2LC 3KYQA 1YYCA 5CCGC 1LTAC 1KQLA 2XDJA 3TNUB 2C9LY 1N7LA 3KQGA 1WRGA 4AQRD 2Q9IA 1GZLA 1IJDB 3CI9A 1GU5A 1N2DC 1FZAA 3VN0A 1MUUA 4KHXA 3TSIA 3NTNA 3B5NA 4RESB 2E43A 2KYVA 2WITA 1HBWA 3HE5B 1LTGC 1NO4A 1T2KC 1L4AC 5AW5B 1CSBA 1L4AB 2HODB 3VMXA 3HTKA 4HH2A 4Y99C 1EQ7A 5APSA 1RF0A 1SVFA 3RK3D 1XTGB 1NAFA 2LKMA 5KJ7C 3BRVB 2I1KA 3P7KA 1GK4A 1YTZI 3L37A 1CZQA 5CCGA 1KILC 3U59A 1FOSF 1JNMA 1KFMA 1QL2A 1SQBK 3NXSA 4Y99B 3NFQA 3HD7D 1IK9A 3R2PA 1N7SB 1FZBA 1HGVA 2R32A 3E1IA 2WSFH 1GW4A 2Q3IA 1NTMK 1SQQK 4WBAA 2WPSA 2J59M 3G3ZA 2PP6A 3HRNA 1RF1B 3N4XA 2R5BA 2ZXEB 3BATA 1LWUA 2H43A 1KILD 1IO4A 3I5CA 1L0NK 2FFDA 5APVA 5AW6B 1JY2N 2M8RA 1J1EC 3P8CE 1DH3A 1X9VA 3VMYA 1LTTC 4JYCA 2FYZA 3CL3D 3LIEA 1JO5A 1QL1A 5BVZA 3A2AA 2N1TB 1FZEA 4WY4B 5KTBA 2P7JA 1LTJA 4IFMA 3MIWA 1CW5A 1A02J 3OJAB 2Z5HA 1HH0A 1HVVA 2YO3A 1KZUB 3HE4A 4C7NB 1X8YA 1AQ5A 1RF1A 2XV5A 1J1EB 2JJLA 2YNYA 5AW3B 2WT7B 3V4QA 2GM4A 2P67A 3TYYA 3RK3B 4LGDE 2YKQA 3T97A 2XU6A 2HFED 1G2CA 4OH8B 2J58A 1J1DB 2WPRA 1JY3P 1FDMA 1M1JA 2XZRA 1OWAA 2P1JA 5KLVK 3BASA 3M06A 5CCGD 5CJ0A 3HE4B 5APXA 4C7NA 3RK2D 3CLQA 2WSCH 2WT7A 3GHGC 1FJPA 4WY4D 1NWQA 1W2EA 1M1JC 2H8PD 1KFNA 3HTKB 1SQPK 1LT9B 2OYIA 2JEEA 1JUNA 1GD2E 2NPSC 3VP9A 2YMYA 3H32A 1FZCA 4LLHA 1KILA 1SLQA 3EFGA 4HYTB 3IFMA 2MJZA 3HUSA 5AVVB 3RK2C 3O8ZA 4JF7A 2IFMA 3RL0B 2HODA 2XKMA 5CCHA 1G1IA 1LT9A 2OYIB 2Q5UA 4M3LA 4W7YA 5KJ7A 1ZR4A 3M9HA 1FZGA 1FZCB 1J1DC 4XE5B 2O01H 1FZCC 3LW5H 3MD0A 3TK1A 4I1LA 1H8AA 1URQB 1FBMA 1LGHB 1NU1K 3VOPA 4DZOA 2KOGA 2QM8A 2OYHA 2CPSA 3M0AA 3HUSB 2C0WA 3OA7A 3PP5A 1JY3O 2NPSA 1H88A 1VDFA 3B5NB 4IFFA 1VPCA 4W80A 3GHGB 4N3YB 1HTLC 4LC1A 2L5GB 4N78D 2W6AA 1NKNA 1N86A 4WB4A 5CCHD 3SWFA 1T3JA 5AVZB 2O1KA 2R3CA 2WZ7A 3L36A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XV5 A;  3M91 A;  4JYB A;  2YNY A;  2JJL A;  2KP8 A;  3M9B A;  3IR9 A;  5AW3 B;  2WT7 B;  5APW A;  3V4Q A;  4I2L C;  2P67 A;  3TYY A;  1MV8 A;  3M0D A;  1YYC A;  2WTY A;  2R5D A;  1A02 F;  1H89 A;  3T97 A;  2XU6 A;  2Z5I A;  3KDP B;  1GTW A;  1KQL A;  5AVX B;  3A5T A;  5AVY B;  3TNU B;  2C9L Y;  3HE5 A;  2WPR A;  4AUW A;  2VRS A;  3KQG A;  1HJB A;  3TNU A;  4C46 A;  2WPQ A;  4AQR D;  5AVQ B;  1T2K D;  2XZR A;  4GT1 A;  1OWA A;  1GZL A;  3M06 A;  1GU5 A;  3A7O A;  2Q7C A;  3A3Y B;  3VN0 A;  3HE4 B;  5APX A;  4C7N A;  1MUU A;  4KHX A;  1OXZ A;  2WT7 A;  2YO2 A;  1S9K E;  3NTN A;  1GU4 A;  5AW4 B;  5AW0 B;  1GK6 A;  5AVU B;  4RES B;  3OAK A;  1NWQ A;  2E43 A;  3L35 A;  1HBW A;  1G2C B;  3HE5 B;  2WWW A;  5APT A;  1T2K C;  3VTP C;  5AW5 B;  1CSB A;  1JUN A;  5AVR B;  3VMX A;  3HTK A;  2E42 A;  1GD2 E;  5APS A;  1S9K D;  2N9B A;  1NAF A;  1SLQ A;  3VYI A;  5AVW B;  3P7K A;  1GK4 A;  3L37 A;  4HYT B;  4EOT A;  1CZQ A;  4AYC A;  1FOS F;  1JNM A;  3B8E B;  3NXS A;  4I6M C;  3UIA A;  2BAS A;  5APQ A;  5APU A;  3LID A;  3NFQ A;  5AVV B;  3VMZ A;  3O8Z A;  2H7H A;  1MFZ A;  5CMZ A;  1CI6 B;  2IPP A;  3P8M C;  5AW7 B;  2Q5U A;  2R32 A;  4M3L A;  4B86 A;  5AW2 B;  5AW9 B;  3M9H A;  2W27 A;  2Q3I A;  4XE5 B;  2WPS A;  5AVT B;  3MD0 A;  3TK1 A;  1H8A A;  2ZXE B;  2R5B A;  5AW1 B;  4C7N B;  5AW8 B;  1IO4 A;  4DZO A;  3I5C A;  3P32 A;  2QM8 A;  3NMD A;  4GKG A;  5APV A;  3V4W A;  3M0A A;  5AW6 B;  5APY A;  2C9N Y;  2P2U A;  1H88 A;  1DH3 A;  5AVS B;  3VMY A;  1SP4 A;  4JYC A;  3LIE A;  3V5B A;  1CI6 A;  3A2A A;  1HUC A;  4LC1 A;  1HWT C;  3MGN A;  2QM7 A;  2W6A A;  2P7J A;  1FAV A;  1J2J B;  2ZFC A;  1A02 J;  3SWF A;  2Z5H A;  5AVZ B;  1FOS E;  2R3C A;  2YO3 A;  3HE4 A;  1X8Y A;  3L36 A; 
#chains in the Genus database with same CATH topology
 3M91 A;  2HYN A;  1SQX J;  1SQP D;  3U1C A;  1NGM B;  2M5A B;  1NTK K;  1EZV G;  3H1I J;  5APW A;  3G6E P;  1SQX G;  2XND H;  5B5E E;  2WSS H;  1JTH A;  2AXT H;  2R5D A;  4GIF A;  2JWD A;  4PD4 I;  1H89 A;  1GTW A;  2Z5I A;  1GDT A;  5AVX B;  3V2P A;  3A5T A;  1KYO I;  2V4H A;  3CCJ P;  3P8C D;  3I55 P;  1M1J B;  4AUW A;  1YTZ T;  3SWY A;  1URQ D;  1YBK A;  3H6P A;  5E79 E;  1FZF A;  1U7M A;  1SQV K;  2BCC D;  1EZV I;  5H2F H;  3CMA P;  1LTJ B;  1QGK B;  3RK2 B;  2GUS A;  4BRY A;  1Q7Y Q;  1VQL P;  1T2K D;  3CD6 P;  3O6Q A;  1RE4 A;  1ZRT E;  4ZKU A;  1LT1 A;  1BGY E;  1SQB G;  1N73 A;  1JMM A;  3II6 A;  1BDD A;  4OGQ D;  1LTB C;  1Q90 D;  2Q7C A;  3A3Y B;  4PD4 H;  3PH0 A;  2P10 A;  3F89 A;  3GMA A;  1S2E A;  4GOE A;  4WBA A;  2B9B A;  1VQ8 P;  2QJP B;  3N7N A;  1KYO H;  1SQB J;  3HD7 C;  4GOF A;  3VP8 A;  1OXZ A;  4ZKP A;  2YO2 A;  3KZI E;  1YIT P;  3H1L D;  5AW4 B;  2HR3 A;  2WSE J;  4L75 A;  1PPJ E;  3SSU A;  2W90 A;  1BCC J;  1GW3 A;  2ZXX A;  3A0H H;  3E1R A;  4N6J A;  4U3F G;  3MUD C;  1UII A;  3USS A;  2WMM A;  4YXD C;  1IFN A;  1IFI A;  3V2N A;  5CJ4 A;  1RE3 C;  1G2C B;  4U3F J;  5APT A;  1K05 A;  2FFD C;  1DX7 A;  1LTS C;  1ZN5 A;  3KPE A;  2O01 N;  2FXM A;  1QVG O;  1NTM G;  1SQQ G;  3MHV A;  2ZT9 C;  1PP9 G;  2A06 D;  2CK3 H;  1BE3 J;  3TGU J;  1X79 B;  2OYI C;  3Q2Y A;  2Y0D A;  2QJP C;  1KTM A;  3AE8 C;  2ZYG A;  5KLV D;  2H89 C;  2ZVO B;  3L70 G;  3VYI A;  4IL6 X;  2N1T A;  4BXL A;  3L73 G;  1QX8 A;  4WY4 A;  2HPC A;  1L0L K;  5E79 H;  3JCU H;  3AE3 C;  5AVW B;  5BU8 B;  3L73 J;  1L4A D;  4EOT A;  1T3U A;  5KLI C;  3CCE P;  2A06 E;  1T8Z A;  4K3A A;  4L76 A;  3UIA A;  1LNQ A;  4I6M C;  5APQ A;  3TDK A;  3CX5 H;  2ZYD A;  3HRN A;  3LID A;  4UB6 E;  1ZV8 A;  1NOH A;  2QSI A;  3L70 D;  1OW8 A;  5K5G B;  1YJW P;  3HUS C;  2H7H A;  1NTK D;  3L72 D;  4EIJ A;  4U7J A;  5CMZ A;  1L0L G;  2KI7 B;  1LTI C;  3ABV C;  3RL0 g;  3T97 B;  1CI6 B;  2IPP A;  2WPV B;  3P8M C;  4C7R A;  4PD4 D;  2I1J A;  2MKV A;  5AW2 B;  2JDI H;  1KIL B;  3BRT B;  5AW9 B;  4O9B A;  2Q1K A;  1GL2 A;  2LXC B;  2W27 A;  3JC2 2;  1URQ A;  3CWB J;  1FU1 A;  2KNC A;  1OVV A;  2KUB A;  2KSJ A;  2ZYA A;  1YQ4 C;  1U7J A;  5AVT B;  1UIX A;  1RF0 C;  2Y0C A;  2O01 J;  1LTJ C;  4K35 A;  2PGD A;  4WY4 C;  1LJ2 A;  1SFC A;  2QJY C;  1VQ5 P;  3CWB G;  3FGA D;  5AW8 B;  2FKW B;  1NTZ G;  2Y9Z A;  3P32 A;  1JY2 O;  2KS1 A;  3JSV C;  3Q5R A;  3V4W A;  1S3J A;  1T6A A;  2C9N Y;  3B5N D;  1PV3 A;  2P2U A;  3IF4 A;  3A0B H;  1PGO A;  1IZN B;  1MZ9 A;  2IX7 C;  1Z56 A;  1NTZ J;  2IBZ E;  3CWB E;  1JB0 J;  5AVS B;  1IC2 A;  2OYH C;  2FYN B;  3D70 A;  5L8R J;  2QJK B;  3V5B A;  3L74 G;  1CI6 A;  3AE5 C;  1HWT C;  3MGN A;  1NHL A;  2PRR A;  2QM7 A;  1FAV A;  3FWN A;  1BGY D;  1GL2 D;  1NTM J;  1SQQ J;  4W7Z A;  2KLV A;  3WUV A;  1BSH A;  1FJP A;  1Q2N A;  1HF9 A;  1OW7 A;  2Q3E A;  2M5A A;  2W8Z A;  1VQP P;  1KC8 Q;  4H44 D;  1S4X A;  2W6B A;  3MP7 B;  1BCC E;  4XA4 A;  2KB7 P;  3MTU E;  2KSE A;  2O1J A;  1SFC D;  2KP8 A;  3H1K E;  1JTH B;  3IR9 A;  1EDK A;  1L0L E;  2N1T D;  2QG4 A;  3M9B A;  3RL0 C;  3H1J E;  3W68 A;  5KKZ B;  1HGZ A;  2FYN C;  3CCQ P;  1YHQ P;  1MV8 A;  3M0D A;  2OYH B;  3BCC G;  2IFN A;  3AEC C;  2WTY A;  2YIU C;  1X22 A;  1A02 F;  1PIX A;  1NJI Q;  1FE6 A;  4OGQ C;  1KB9 I;  3L73 E;  3KDP B;  5H2F E;  3L71 J;  3EFF K;  3L70 E;  1H0T B;  5AVY B;  4IL6 E;  3C9I A;  3HE5 A;  1PFI A;  3GHG A;  4RO0 A;  2K88 A;  1QEX A;  1SQP E;  2RKL A;  1S5L E;  2VRS A;  5BU5 A;  1HJB A;  1VQ7 P;  3TNU A;  1L4A A;  4C46 A;  3QH9 A;  2QA4 P;  1URQ C;  2WPQ A;  2O3J A;  5AVQ B;  3BVH A;  3H1L E;  4N78 E;  4GT1 A;  1ZOY C;  2G3A A;  4H13 B;  1JCD A;  3LW5 J;  1NH4 A;  1PZQ A;  2Y9Y A;  1OMI A;  2C0X A;  1N7S C;  4QMA A;  5GTH E;  1R5L A;  4RJT A;  3A7O A;  3TGU E;  2M0B A;  2YIU B;  1ZLL A;  1QVF O;  2WSE H;  1AJY A;  1VQM P;  1TU3 F;  3MUD A;  1S9K E;  1GU4 A;  3H1H D;  3QWO C;  2AEM A;  1GK6 A;  5AW0 B;  5CBO A;  3V2R A;  1ZRT D;  1FJK A;  2E75 B;  5AVU B;  3OAK A;  4HJG H;  2RMZ A;  3L35 A;  4YTP C;  3RBX A;  3TGU G;  5CCH C;  3Q5P A;  2QEX P;  1SQV E;  1SQB E;  1HJ0 A;  2WWW A;  1IFJ A;  4YPC A;  4XFJ A;  3VTP C;  1KQS O;  3CME P;  3CC7 P;  1H0T A;  2L91 A;  1Y8A A;  2FY8 A;  2POH A;  2NPS B;  3CXH E;  4H44 B;  1YJN P;  5AVR B;  1EZV D;  1N7S A;  2Z4E A;  1IFD A;  1RE4 C;  5KAI H;  1ZR2 A;  2E42 A;  5M1B A;  4PV1 C;  2IZ1 A;  1S9K D;  1AVY A;  2A45 H;  3U1A A;  3H25 A;  4WVZ A;  1N73 B;  2N9B A;  2K9J A;  2KZJ A;  3V2Q A;  2AEJ A;  2DW3 A;  2Q6Q A;  5GTI E;  1PP9 D;  1S72 P;  3L4F A;  1G1J A;  1JY2 P;  2ITA A;  1IO4 A;  2N1T C;  3JCU E;  3RL0 D;  1NKZ B;  5TIS H;  4AYC A;  1EZV E;  2YKP A;  5KLV G;  1OFC X;  2KLU A;  2V7Q H;  1LWU B;  2HLO A;  3B8E B;  4H44 C;  4ZMD A;  1NTZ K;  2BAS A;  1LWU C;  3WMM 0;  2OQQ A;  2E74 C;  5DJT B;  5APU A;  1W2B O;  3SFD C;  2FFD B;  2OTJ P;  1JOC A;  1L0N D;  3VMZ A;  2K1A A;  2A45 I;  4R4M A;  2KXP B;  4IFD K;  3AE7 C;  2IBZ D;  1MFZ A;  2OAR A;  4PJ0 H;  5KJ7 D;  2BEZ F;  3M9Q A;  1IK7 A;  1M7L A;  3G71 P;  5AW7 B;  1N7S D;  1NAY A;  2D2C D;  2WQY C;  2WSC J;  3RK3 C;  1VF5 B;  3H1L G;  1PGQ A;  2D2C B;  2XNX A;  2YKO A;  4NPD A;  2QJK C;  3A0H E;  4B86 A;  3CC4 P;  1XTC C;  3HD7 B;  1EXJ A;  1NTK G;  1RY3 A;  1SQX K;  2M3E A;  3CCL P;  1AFO A;  2YXQ B;  2K9J B;  1DIP A;  3K5B A;  1NU1 E;  1Y47 A;  3O6Q B;  2M3B A;  5CHX A;  5KLI B;  1ZW0 A;  3D6Z A;  3L75 J;  3AE1 C;  5AW1 B;  2P58 A;  1IFM A;  1KOR A;  3C1L A;  3L75 G;  1E5W A;  1USD A;  2ZAE B;  2FYU K;  3BCC E;  1YIJ P;  1JY3 N;  1OW6 A;  2QIW A;  2ZT9 B;  5KKZ C;  3NMD A;  2FXP A;  3GW6 A;  4GKG A;  4D6T G;  4Z1M H;  1KB9 E;  1DEB A;  3L73 D;  5APY A;  3FXE A;  1SFC C;  2JKV A;  4EDF A;  4EI2 A;  1OIP A;  1JCC A;  3AE9 C;  1BE3 E;  3L72 E;  1VQO P;  2QVA A;  3H32 B;  1SP4 A;  2CPB A;  3M0D C;  3FX0 A;  1RE3 A;  2WVR A;  2PAJ A;  2LXB A;  2ZVN B;  2NPS D;  4UB6 H;  5TIS E;  4D6T J;  1GL2 C;  1VQ9 P;  1BDC A;  1HUC A;  2AXT E;  3MZW B;  1GL2 B;  3EQ2 A;  1PGJ A;  2E76 D;  5DJU B;  3L72 J;  4H0L B;  1VQ6 P;  1J2J B;  1LT9 C;  2E76 B;  2GUV A;  2ZFC A;  3HD7 A;  4ZNC A;  1RF1 C;  3L72 G;  4DOJ A;  2AXC A;  3PHL A;  1FOS E;  1WT6 A;  2A45 G;  3BCC J;  3G4S P;  2KIK A;  1SFC B;  4PV1 B;  1M56 D;  2HG5 D;  2HPC B;  4JYB A;  2FBW C;  3B5N C;  3L71 E;  3L70 J;  1N73 C;  4I2L C;  2JWA A;  3KYQ A;  3B4S A;  1YYC A;  5B66 E;  3L75 E;  3WU2 H;  5CCG C;  1M90 Q;  1W5C E;  1EDL A;  1LTA C;  1KQL A;  1L0L J;  1NU1 G;  2XDJ A;  3H1K J;  2BEQ D;  1IFP A;  1P84 I;  3TNU B;  4DT0 A;  3CCS P;  1N7L A;  1WMK A;  2LR2 A;  2C9L Y;  3VMA A;  3KQG A;  1WRG A;  4WWI A;  4AQR D;  1NTM E;  1SQQ E;  2OYO A;  2Q9I A;  3AE4 C;  1GZL A;  2QE7 H;  2W6J H;  1IJD B;  1NTZ D;  2K37 A;  2ZJS E;  3CI9 A;  3S4R A;  1GU5 A;  3AEA C;  1N2D C;  1FZA A;  5EFW B;  1NU1 D;  3VN0 A;  3AEF C;  1YQ3 C;  3C8V A;  1MFT A;  1S5L H;  1MUU A;  1OVU A;  4KHX A;  3CX5 I;  3TSI A;  3NTN A;  3H1J D;  2PFX A;  3IAO A;  5KLV E;  3B5N A;  1AVO A;  2JP3 A;  4RES B;  2E43 A;  2KYV A;  2WIT A;  1HBW A;  1X0T A;  2B87 B;  3HE5 B;  1LTG C;  1NO4 A;  4JBZ A;  3S9O A;  1T2K C;  1L4A C;  5AW5 B;  4TT3 H;  3L74 J;  1CSB A;  4EYY Q;  1L4A B;  3H1H G;  2HOD B;  3VMX A;  2V7Q J;  3HTK A;  4HH2 A;  4Y99 C;  1EQ7 A;  1M1K Q;  3OW2 O;  5APS A;  3IN6 A;  1RF0 A;  1SQV J;  4RKU J;  3RBZ A;  3V6I A;  1SVF A;  1PPJ D;  2D2C C;  3RK3 D;  1XTG B;  3GF7 A;  1NAF A;  2LKM A;  1YJ9 P;  2JR8 A;  1KV4 A;  5KJ7 C;  3BRV B;  2I1K A;  3WUU A;  1SQV G;  3P7K A;  1GK4 A;  1YTZ I;  3CXH D;  3GLM A;  3L37 A;  1CZQ A;  1OZH A;  5CCG A;  2E74 D;  2IDB A;  1KIL C;  3U59 A;  2N9Y B;  3L71 D;  3CCU P;  1FOS F;  1JNM A;  1KFM A;  1QL2 A;  1SQB K;  3NXS A;  3A0B E;  4PJ0 E;  4KT0 J;  3GF3 A;  4H0L D;  4Y99 B;  1PL5 A;  3NFQ A;  3HD7 D;  1IK9 A;  2IYO A;  3F5H A;  3R2P A;  4DJG A;  3Q1M A;  3AE2 C;  1AA0 A;  1SQP G;  5KAI E;  1KYO D;  1VQK P;  1N7S B;  1YI2 P;  3H1L J;  1FZB A;  2Y0E A;  3KHU A;  1Q86 Q;  4OWF A;  1HGV A;  2R32 A;  3E1I A;  2WSF H;  3SFE C;  4GOD A;  1R8E A;  5GTI H;  1SQP J;  1GW4 A;  1S5L X;  1SQX D;  2OTL P;  1KN7 A;  2RN0 A;  1L0N E;  3CX5 D;  3WUT A;  5B66 H;  2Q3I A;  1NTM K;  1RQU A;  1SQQ K;  2WPS A;  2BCC J;  2IYP A;  2J59 M;  3AE6 C;  2E75 C;  2OGU A;  2PP6 A;  1FS0 E;  3EWK A;  3G3Z A;  1BE3 D;  3H1J J;  1FDO A;  2BCC G;  1RF1 B;  2R5B A;  2ZXE B;  3BAT A;  3N4X A;  1EDJ A;  1LWU A;  3PRJ A;  2H43 A;  1KIL D;  1SS1 A;  3I5C A;  2QJY B;  4R4L A;  1L0N K;  1KB9 H;  4Y28 J;  3S1K A;  2FFD A;  4I7Z B;  5APV A;  2KK7 A;  1K8A Q;  3KXD A;  5AW6 B;  4I7Z C;  2FYU G;  2GA1 A;  1SQB D;  1JY2 N;  2IBZ I;  3W67 A;  2M8R A;  1J1E C;  3P8C E;  1DH3 A;  1X9V A;  1D7M A;  3GG2 A;  3VMY A;  1LTT C;  1NYH A;  1BE3 G;  2FYZ A;  3CL3 D;  4JYC A;  1EXI A;  1KQG B;  3LIE A;  1VQ4 P;  1EC5 A;  1QL1 A;  5BVZ A;  2BCC E;  2QRX A;  1AV1 A;  2YXR B;  3A2A A;  1JO5 A;  4U3F D;  1PP9 J;  2N1T B;  2G8Y A;  1L0N J;  5C39 A;  1FZE A;  4WY4 B;  5KTB A;  2P7J A;  1LTJ A;  2E5T A;  3L74 E;  4IFM A;  3D71 A;  1VQN P;  1L0N G;  1NTZ E;  2J5U A;  3MIW A;  1K9M Q;  4NPE A;  1CW5 A;  1S1C X;  1A02 J;  2IBZ G;  2FYU D;  2Z5H A;  3OJA B;  1HH0 A;  1HVV A;  2K3R A;  1KZU B;  2YO3 A;  3HE4 A;  4C7N B;  1X8Y A;  2W83 C;  4BWN A;  2I8D A;  4YXW H;  5KLV J;  2XV5 A;  4IOI H;  1RF1 A;  1J1E B;  2JJL A;  2YNY A;  5AW3 B;  2WT7 B;  4HKZ H;  2OTK E;  4JQ0 D;  3V4Q A;  4IL6 H;  2GM4 A;  2P67 A;  4HB1 A;  3TYY A;  3RK3 B;  4LGD E;  3PJS K;  1USE A;  1VL2 A;  2IZ0 A;  2YKQ A;  2XU6 A;  4H13 D;  3T97 A;  3H1I E;  1DEE G;  2HFE D;  1G2C A;  4OH8 B;  2J58 A;  1J1D B;  1KYO E;  2WPR A;  2JO1 A;  3AEB C;  3CPW O;  1JY3 P;  1JEK A;  4DCK A;  2FXO A;  1M1J A;  3H1H E;  1FDM A;  1VF5 D;  3PLN A;  3TF5 A;  2XZR A;  3L75 D;  1OWA A;  5CBN A;  2P1J A;  1AQ5 A;  4A7P A;  5KLV K;  3BAS A;  3M06 A;  1K73 Q;  4BRY B;  4NPF X;  5CCG D;  4D6T D;  4OGQ B;  5CJ0 A;  2B88 A;  2B89 A;  1NTK J;  3HE4 B;  2R3S A;  2H88 C;  5APX A;  4C7N A;  3RK2 D;  3AEG C;  3CLQ A;  3CCM P;  2WSC H;  2WT7 A;  1Q82 Q;  1N8R Q;  1NTM D;  1SQQ D;  3ITK A;  1H88 A;  2UWJ E;  2B87 A;  1BSN A;  3GHG C;  1NVO A;  2A06 G;  3AEE C;  4CPG A;  1ZME C;  4WY4 D;  1KB9 D;  2NZ2 A;  1NWQ A;  1W2E A;  1ZXG A;  5B5E H;  1M1J C;  1PP9 E;  2H8P D;  1KFN A;  1U57 A;  3HTK B;  3I56 P;  1SQP K;  1LT9 B;  2E76 C;  3CWB D;  1KD1 Q;  2JEE A;  3FWL A;  2OYI A;  1JUN A;  3G9R A;  1M8O B;  2E74 B;  2FYU J;  2NPS C;  3VP9 A;  3CCR P;  2YMY A;  3H32 A;  4U3F E;  1GD2 E;  3B71 A;  1FZC A;  1FDI A;  1P84 D;  4LLH A;  1JMB A;  4UB8 E;  3CX5 E;  1KIL A;  4L73 A;  1SLQ A;  1KMI Z;  3H1I G;  1OX3 A;  1DD3 A;  1QLE D;  3EFG A;  4HYT B;  4ASV A;  5TJH A;  1FC2 C;  1PPJ G;  1L0L D;  5KAF H;  1BGY G;  3IFM A;  2MJZ A;  3HUS A;  5GTH H;  3RGU A;  1P84 E;  5AVV B;  1NU1 J;  2AEF A;  3RK2 C;  3O8Z A;  3H1I D;  2R44 A;  1BGY J;  2IFM A;  4JF7 A;  1OVR A;  3RL0 B;  2HOD A;  2SPZ A;  2XKM A;  3L71 G;  1GMJ A;  3H1K G;  5CCH A;  1G1I A;  2NRG A;  1LT9 A;  2OYI B;  3CC2 P;  2Q5U A;  3BCC D;  1RHZ B;  4M3L A;  1E79 H;  3Q3D A;  3Q5S A;  4W7Y A;  5KJ7 A;  1M57 D;  1VF5 C;  1ZR4 A;  1LP1 A;  4KJM A;  2ZT9 D;  2KZI A;  3M9H A;  1FZG A;  3H1J G;  1FZC B;  1J1D C;  1RH5 B;  2FYU E;  2O01 H;  4XE5 B;  1FZC C;  3LW5 H;  4JPZ B;  3CCV P;  1JM0 A;  3MD0 A;  3E7K A;  3TK1 A;  4I1L A;  1BCC G;  4D6T E;  4ASW A;  1H8A A;  3SWK A;  1URQ B;  1FBM A;  2KNC B;  1LGH B;  3H1K D;  1NU1 K;  4H13 C;  1Y9B A;  2E5Y A;  3VOP A;  4DZO A;  1SQX E;  2WSF J;  2E75 D;  2KOG A;  2QM8 A;  3ZDM A;  1L2P A;  2CPS A;  3L74 D;  2OYH A;  1DD4 A;  3M0A A;  3HUS B;  2C0W A;  1P84 H;  3CXH I;  1MKM A;  1ZP0 C;  3FXD A;  1JY3 O;  2NPS A;  3OA7 A;  2KS1 B;  1VDF A;  3PP5 A;  3R4Y A;  1SQV D;  3B5N B;  4IFF A;  1VPC A;  1NTK E;  3KZI H;  1KQF B;  4L74 A;  5KAF E;  3PTZ A;  1Q81 Q;  4UB8 H;  1BCC D;  4W80 A;  3GHG B;  1RQV A;  4N3Y B;  4PV1 D;  1AQT A;  1KIL E;  4PD4 E;  3WU2 E;  1HTL C;  4LC1 A;  2L5G B;  4MN4 C;  4N78 D;  1PGP A;  2W6A A;  1NKN A;  3RK3 E;  1R5S A;  2K9Y A;  3AED C;  4GDO A;  1N86 A;  4TLF A;  2RH0 A;  1LP1 B;  3H1H J;  4WB4 A;  3TGU D;  5CCH D;  3SWF A;  4H0L C;  1K04 A;  1T3J A;  2YMK A;  5AVZ B;  3D6Y A;  2O1K A;  2R3C A;  1EDI A;  3CXH H;  4OVN F;  2WZ7 A;  3L36 A; 
#chains in the Genus database with same CATH homology
 3M91 A;  2HYN A;  3U1C A;  1NTK K;  5APW A;  1JTH A;  4GIF A;  2R5D A;  1H89 A;  1GTW A;  2Z5I A;  1GDT A;  5AVX B;  3V2P A;  3A5T A;  3P8C D;  1M1J B;  4AUW A;  1YTZ T;  3SWY A;  1URQ D;  3H6P A;  1FZF A;  1SQV K;  1LTJ B;  3RK2 B;  2GUS A;  1T2K D;  1RE4 A;  4ZKU A;  1N73 A;  1JMM A;  3II6 A;  1LTB C;  2Q7C A;  3A3Y B;  3N7N A;  3HD7 C;  3VP8 A;  4ZKP A;  1OXZ A;  2YO2 A;  5AW4 B;  1GW3 A;  4N6J A;  1IFN A;  1IFI A;  3V2N A;  5CJ4 A;  1RE3 C;  1G2C B;  5APT A;  2FFD C;  1DX7 A;  1LTS C;  1ZN5 A;  3KPE A;  2FXM A;  1X79 B;  2OYI C;  3VYI A;  2N1T A;  2HPC A;  4WY4 A;  1L0L K;  5AVW B;  5BU8 B;  1L4A D;  4EOT A;  1T3U A;  1T8Z A;  3UIA A;  4I6M C;  5APQ A;  3LID A;  1ZV8 A;  1NOH A;  2H7H A;  3HUS C;  4EIJ A;  5CMZ A;  1LTI C;  1CI6 B;  2IPP A;  3P8M C;  4C7R A;  2I1J A;  5AW2 B;  1KIL B;  3BRT B;  5AW9 B;  4O9B A;  1GL2 A;  2W27 A;  1URQ A;  1FU1 A;  2KSJ A;  5AVT B;  1RF0 C;  1LTJ C;  4WY4 C;  1SFC A;  5AW8 B;  2FKW B;  3P32 A;  1JY2 O;  3V4W A;  2C9N Y;  3B5N D;  2P2U A;  1MZ9 A;  5AVS B;  2IX7 C;  1Z56 A;  1IC2 A;  2OYH C;  3V5B A;  1CI6 A;  1HWT C;  3MGN A;  1NHL A;  2QM7 A;  1FAV A;  1GL2 D;  4W7Z A;  2KLV A;  2W6B A;  4XA4 A;  2KB7 P;  3MTU E;  2O1J A;  1SFC D;  2KP8 A;  3M9B A;  1JTH B;  3IR9 A;  2N1T D;  3RL0 C;  2OYH B;  1HGZ A;  1MV8 A;  3M0D A;  2IFN A;  2WTY A;  1A02 F;  3KDP B;  5AVY B;  3C9I A;  3HE5 A;  1PFI A;  3GHG A;  2VRS A;  5BU5 A;  1HJB A;  3TNU A;  1L4A A;  4C46 A;  1URQ C;  2WPQ A;  5AVQ B;  3BVH A;  4N78 E;  4GT1 A;  1JCD A;  1NH4 A;  2C0X A;  1N7S C;  3A7O A;  1ZLL A;  2WSE H;  3MUD A;  1S9K E;  1GU4 A;  5AW0 B;  1GK6 A;  3V2R A;  1FJK A;  5AVU B;  3OAK A;  3L35 A;  5CCH C;  2WWW A;  1IFJ A;  3VTP C;  2POH A;  2Z4E A;  2NPS B;  5AVR B;  1N7S A;  1IFD A;  1RE4 C;  1ZR2 A;  2E42 A;  1S9K D;  2A45 H;  3U1A A;  1N73 B;  2N9B A;  3V2Q A;  3L4F A;  1G1J A;  1JY2 P;  2N1T C;  3RL0 D;  1NKZ B;  4AYC A;  2YKP A;  1LWU B;  2HLO A;  3B8E B;  1NTZ K;  2BAS A;  1LWU C;  3WMM 0;  5APU A;  2FFD B;  1JOC A;  3VMZ A;  2A45 I;  4IFD K;  2OAR A;  1MFZ A;  5KJ7 D;  3M9Q A;  1M7L A;  5AW7 B;  1N7S D;  3RK3 C;  4B86 A;  2XNX A;  2YKO A;  1XTC C;  3HD7 B;  1RY3 A;  1SQX K;  1AFO A;  5CHX A;  2M3B A;  5AW1 B;  1IFM A;  1E5W A;  2FYU K;  1JY3 N;  3NMD A;  4GKG A;  1DEB A;  5APY A;  1SFC C;  1JCC A;  3H32 B;  1SP4 A;  2CPB A;  3M0D C;  1RE3 A;  2PAJ A;  2NPS D;  1GL2 C;  1HUC A;  1GL2 B;  3EQ2 A;  1J2J B;  1LT9 C;  2GUV A;  2ZFC A;  3HD7 A;  1RF1 C;  4DOJ A;  1FOS E;  1WT6 A;  2A45 G;  1SFC B;  2HG5 D;  2HPC B;  4JYB A;  3B5N C;  1N73 C;  4I2L C;  3KYQ A;  1YYC A;  5CCG C;  1LTA C;  1KQL A;  2XDJ A;  3TNU B;  2C9L Y;  1N7L A;  3KQG A;  1WRG A;  4AQR D;  2Q9I A;  1GZL A;  1IJD B;  3CI9 A;  1GU5 A;  1N2D C;  1FZA A;  3VN0 A;  1MUU A;  4KHX A;  3TSI A;  3NTN A;  3B5N A;  4RES B;  2E43 A;  2KYV A;  2WIT A;  1HBW A;  3HE5 B;  1LTG C;  1NO4 A;  1T2K C;  1L4A C;  5AW5 B;  1CSB A;  1L4A B;  2HOD B;  3VMX A;  3HTK A;  4HH2 A;  4Y99 C;  1EQ7 A;  5APS A;  1RF0 A;  1SVF A;  3RK3 D;  1XTG B;  1NAF A;  2LKM A;  5KJ7 C;  3BRV B;  2I1K A;  3P7K A;  1GK4 A;  1YTZ I;  3L37 A;  1CZQ A;  5CCG A;  1KIL C;  3U59 A;  1FOS F;  1JNM A;  1KFM A;  1QL2 A;  1SQB K;  3NXS A;  4Y99 B;  3NFQ A;  3HD7 D;  1IK9 A;  3R2P A;  1N7S B;  1FZB A;  1HGV A;  2R32 A;  3E1I A;  2WSF H;  1GW4 A;  2Q3I A;  1NTM K;  1SQQ K;  4WBA A;  2WPS A;  2J59 M;  3G3Z A;  2PP6 A;  3HRN A;  1RF1 B;  3N4X A;  2R5B A;  2ZXE B;  3BAT A;  1LWU A;  2H43 A;  1KIL D;  1IO4 A;  3I5C A;  1L0N K;  2FFD A;  5APV A;  5AW6 B;  1JY2 N;  2M8R A;  1J1E C;  3P8C E;  1DH3 A;  1X9V A;  3VMY A;  1LTT C;  4JYC A;  2FYZ A;  3CL3 D;  3LIE A;  1JO5 A;  1QL1 A;  5BVZ A;  3A2A A;  2N1T B;  1FZE A;  4WY4 B;  5KTB A;  2P7J A;  1LTJ A;  4IFM A;  3MIW A;  1CW5 A;  1A02 J;  3OJA B;  2Z5H A;  1HH0 A;  1HVV A;  2YO3 A;  1KZU B;  3HE4 A;  4C7N B;  1X8Y A;  1AQ5 A;  1RF1 A;  2XV5 A;  1J1E B;  2JJL A;  2YNY A;  5AW3 B;  2WT7 B;  3V4Q A;  2GM4 A;  2P67 A;  3TYY A;  3RK3 B;  4LGD E;  2YKQ A;  3T97 A;  2XU6 A;  2HFE D;  1G2C A;  4OH8 B;  2J58 A;  1J1D B;  2WPR A;  1JY3 P;  1FDM A;  1M1J A;  2XZR A;  1OWA A;  2P1J A;  5KLV K;  3BAS A;  3M06 A;  5CCG D;  5CJ0 A;  3HE4 B;  5APX A;  4C7N A;  3RK2 D;  3CLQ A;  2WSC H;  2WT7 A;  3GHG C;  1FJP A;  4WY4 D;  1NWQ A;  1W2E A;  1M1J C;  2H8P D;  1KFN A;  3HTK B;  1SQP K;  1LT9 B;  2OYI A;  2JEE A;  1JUN A;  1GD2 E;  2NPS C;  3VP9 A;  2YMY A;  3H32 A;  1FZC A;  4LLH A;  1KIL A;  1SLQ A;  3EFG A;  4HYT B;  3IFM A;  2MJZ A;  3HUS A;  5AVV B;  3RK2 C;  3O8Z A;  4JF7 A;  2IFM A;  3RL0 B;  2HOD A;  2XKM A;  5CCH A;  1G1I A;  1LT9 A;  2OYI B;  2Q5U A;  4M3L A;  4W7Y A;  5KJ7 A;  1ZR4 A;  3M9H A;  1FZG A;  1FZC B;  1J1D C;  4XE5 B;  2O01 H;  1FZC C;  3LW5 H;  3MD0 A;  3TK1 A;  4I1L A;  1H8A A;  1URQ B;  1FBM A;  1LGH B;  1NU1 K;  3VOP A;  4DZO A;  2KOG A;  2QM8 A;  2OYH A;  2CPS A;  3M0A A;  3HUS B;  2C0W A;  3OA7 A;  3PP5 A;  1JY3 O;  2NPS A;  1H88 A;  1VDF A;  3B5N B;  4IFF A;  1VPC A;  4W80 A;  3GHG B;  4N3Y B;  1HTL C;  4LC1 A;  2L5G B;  4N78 D;  2W6A A;  1NKN A;  1N86 A;  4WB4 A;  5CCH D;  3SWF A;  1T3J A;  5AVZ B;  2O1K A;  2R3C A;  2WZ7 A;  3L36 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...