2Z5HA

Crystal structure of the head-to-tail junction of tropomyosin complexed with a fragment of tnt
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
49
structure length
49
Chain Sequence
GELLSKNYHLENEVARLKKLVDDLEDELYAQKLKYKAISEELDHALNDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for tropomyosin overlap in thin (actin) filaments and the generation of a molecular swivel by troponin-T
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Contractile protein
molecule keywords General control protein GCN4 and Tropomyosin alpha-1 chain
total genus 23
structure length 49
sequence length 49
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2007-07-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2z5hA00
3A2AA 2WPQA 5AVWB 1J2JB 2N9BA 2VRSA 4EOTA 1NAFA 5AW9B 3TYYA 3VMZA 1JUNA 1GD2E 1MFZA 3M06A 3IR9A 2H7HA 1GZLA 2JJLA 1FAVA 1SLQA 2C9LY 1HUCA 1T2KD 2WTYA 2W6AA 3M0AA 3TK1A 1KQLA 3HE4A 1YYCA 2XV5A 5AW5B 4B86A 5AW0B 2R32A 1GU4A 5AVSB 2E43A 1GU5A 3O8ZA 1MV8A 2P7JA 1S9KE 1NWQA 1A02F 2C9NY 3HE4B 1OWAA 5APSA 5APXA 5AVTB 4C7NA 4RESB 4I6MC 3B8EB 5AVUB 3UIAA 5CMZA 1G2CB 3A7OA 3M91A 5AW8B 2KP8A 2XZRA 3HE5B 4HYTB 2ZXEB 5APQA 1A02J 1JNMA 3MGNA 5APUA 1H88A 2YO3A 1H89A 1CI6B 1CSBA 3P8MC 1X8YA 2P2UA 5AVXB 4XE5B 3SWFA 2BASA 2Q5UA 3V4QA 2XU6A 3T97A 3HTKA 5APTA 1GK6A 2YO2A 4GT1A 1HJBA 4JYCA 5APWA 2Z5IA 1HWTC 5AW3B 5AVVB 3V5BA 2Q3IA 1GK4A 2W27A 2R5BA 2P67A 2WPSA 4KHXA 5AVZB 3LIDA 3M9HA 3TNUB 5AVYB 3TNUA 1MUUA 3MD0A 3VMYA 1SP4A 1GTWA 3KQGA 5AW1B 4AYCA 1S9KD 2R5DA 2YNYA 5AW7B 1CZQA 2WWWA 4M3LA 3M0DA 3NTNA 4LC1A 2QM7A 1FOSF 3VYIA 5AVRB 3M9BA 1FOSE 3L35A 3NXSA 1HBWA 3A3YB 5AW2B 3VMXA 3L37A 1OXZA 5APVA 3NFQA 2Q7CA 1H8AA 5AW4B 2R3CA 3P7KA 2QM8A 4C7NB 1T2KC 1CI6A 2IPPA 3LIEA 3A5TA 4AUWA 5AW6B 3OAKA 1IO4A 4I2LC 3VN0A 2WPRA 3V4WA 2WT7B 3L36A 2E42A 4GKGA 5AVQB 4DZOA 5APYA 3HE5A 4AQRD 3KDPB 4JYBA 3VTPC 1DH3A 4C46A 2ZFCA 3P32A 3NMDA 2Z5HA 3I5CA 2WT7A
chains in the Genus database with same CATH superfamily
1QVFO 1JMMA 3KXDA 3MTUE 4K35A 4HH2A 1OVVA 4LLHA 3L74D 2E74B 3B5NA 4EOTA 3RK3D 3L72J 3TYYA 1BCCD 1EQ7A 1SQBE 1BSNA 4BXLA 5H2FE 1IK9A 5CBOA 3BRTB 3BVHA 2WSSH 1YJWP 1K8AQ 5TISE 2FFDB 1AJYA 4L74A 1Y9BA 3CI9A 1BDCA 2KK7A 2HFED 1YJNP 1YHQP 1IFDA 3PHLA 2WTYA 4WY4A 1LTJA 2W6AA 3CL3D 3L73E 3M0AA 4EIJA 1SQQJ 1VQKP 3B4SA 2JR8A 1S4XA 1VPCA 3F89A 2KI7B 4D6TD 2XV5A 2FYUD 4OGQC 2JEEA 2E5YA 1GL2A 3M0DC 5AW0B 2FKWB 4N78E 1VQ6P 1W2BO 3CXHE 1ZXGA 1MV8A 1YI2P 3WUVA 1FZCA 1NWQA 4W80A 2A06G 3L72G 5APXA 2FYNC 1QEXA 3CLQA 5KLIC 2V7QH 1K04A 2KSEA 4I6MC 1BCCJ 2D2CD 2W6BA 5AVUB 1X22A 5CMZA 3H6PA 3UIAA 4OWFA 2OTJP 1BE3J 2FY8A 1SQPE 2KXPB 4EI2A 5CCHC 5CJ4A 3H1LJ 3S9OA 2QJKC 1JY3N 1KYOE 2KUBA 1K05A 2LKMA 2C0XA 3AEBC 2HPCA 1VQ8P 2ZYDA 2I1KA 3G3ZA 3PLNA 2A45G 2AXCA 2E76C 1KYOH 1L0NJ 3SWFA 4Z1MH 2PGDA 1T6AA 4HJGH 1N73A 2ZJSE 3RBZA 3H1KJ 1URQC 1SVFA 2XU6A 3U1AA 1PP9E 2QJKB 2H43A 5APWA 1JEKA 3MP7B 1SQXK 1FZEA 3CMEP 1SQVK 5AVVB 1NHLA 1NU1D 2FYNB 5BVZA 3U1CA 4Y99B 1NTMK 3EWKA 1L0LG 2P67A 1LP1A 1SFCA 4GOFA 2YIUC 3TF5A 4R4MA 4PV1D 2QJYC 3B5ND 4KHXA 2A06E 2FYZA 2JKVA 2N1TD 1BGYD 1E5WA 2BCCD 2O01H 4L75A 3H1KD 1NVOA 5AVYB 2OARA 3TNUB 1FOSF 2ZT9B 3SFEC 3JCUH 3CWBD 5E79H 1VQPP 1QL2A 1NU1G 1ZP0C 4IL6H 4Y99C 1PL5A 1ZV8A 2AEMA 1L0NG 1U57A 2N9YB 1GW3A 3KQGA 4NPDA 1J1EC 1LWUA 1YTZT 4NPFX 5AW1B 4AYCA 2RMZA 5DJTB 1RY3A 3HRNA 1CZQA 2FXPA 4M3LA 3EQ2A 1SQPK 5E79E 3ZDMA 1GDTA 1PZQA 2HLOA 3MHVA 4D6TE 2FFDC 1BGYJ 1ZW0A 2BCCJ 3AEGC 3B5NB 3ABVC 3NTNA 4MN4C 4N6JA 2G8YA 3L35A 4PV1B 1FOSE 3PP5A 3SWYA 3TGUG 1NAYA 3CD6P 2E74C 2P58A 4JBZA 1FZAA 5AW2B 2E75D 4CPGA 3C1LA 1NKNA 1OXZA 2PFXA 2NRGA 2QRXA 1EZVE 1FBMA 4BWNA 1RF0C 1OW6A 3E7KA 5L8RJ 3L75G 1KQSO 4WY4B 2LXCB 3QWOC 3LIEA 1KILE 2FYUJ 2HG5D 1P84H 2HODA 4W7YA 3OAKA 1IO4A 1IJDB 3C8VA 3II6A 1EZVD 2QJPB 1SQXE 1SQXJ 1NGMB 1DIPA 2C0WA 1H0TB 1GL2B 1OW8A 4IL6X 1NTKE 4L73A 2NPSB 3V4WA 2I8DA 5APYA 1VQ9P 2KS1A 1NKZB 2WZ7A 4C46A 2WSFJ 2ZFCA 3NMDA 2WPVB 3H1LD 2GUVA 2WPQA 1KILA 5AVWB 2N9BA 1KC8Q 1EDLA 1KB9I 3EFFK 3GF3A 3Q5RA 1BGYE 2BCCE 2H8PD 3E1IA 2O1JA 3VMZA 3BASA 2OYHB 1JUNA 3M06A 4A7PA 2D2CC 2KZIA 3FWNA 1FAVA 3G71P 1M57D 1L4AD 1R5LA 2O3JA 3BCCE 1QX8A 3H1HJ 3L4FA 2ZYAA 3AE6C 3QH9A 1VQMP 5TISH 3TK1A 1VF5C 1KQLA 1N7LA 1NU1E 1PP9G 4H13B 3KPEA 3PJSK 3L74E 1N86A 4B86A 3Q5SA 1VQ4P 1KQGB 2AEFA 1QLED 1Q86Q 5B5EH 2E43A 2QJYB 4L76A 4ASVA 1JY3P 1SFCD 1MFTA 1S9KE 5KLVD 2ZVOB 1JY2P 2IX7C 2M5AA 1RHZB 4PD4H 1VQ7P 1NTKD 1SFCB 2WSCH 1NTMG 2IBZD 4PJ0H 2QIWA 3V2PA 4C7NA 3TGUE 1AFOA 3HD7B 3L72D 1NTZJ 4YPCA 5AW8B 1PGPA 4PD4E 2KP8A 4LGDE 5KAIE 3HE5B 5GTIE 1A02J 1VQNP 4IL6E 2QG4A 2M5AB 2MKVA 2FXMA 1OMIA 2OQQA 3H1KE 1KYOD 3HUSC 3K5BA 2YMKA 3RK2B 3O6QB 5KLVG 1H88A 1L0NE 3B5NC 3P8CE 1H89A 1KORA 3CC7P 1CSBA 3P8MC 1ZRTD 2N1TC 3GHGA 1X8YA 2P2UA 3KHUA 4XE5B 5AVXB 3H1JJ 2ZVNB 2OYIA 2BASA 1DX7A 2K9JA 3GMAA 1EDIA 1M8OB 3VOPA 5KAFE 5KJ7C 1Q81Q 1N73C 1M7LA 3H1LE 3IF4A 1SQPJ 3T97A 3L71D 3HTKA 1LTIC 1SQVJ 2KYVA 1GK6A 2L5GB 2OGUA 2A45H 3CXHD 4GT1A 2M0BA 3H32B 1JM0A 3L73D 3AEAC 1WT6A 5AW3B 1ZOYC 1R5SA 2ZXXA 1JCDA 1FJKA 1GK4A 3H1JD 2W27A 4Y28J 2R3SA 1E79H 1JY2N 1QVGO 1RF1A 3A0BH 3ITKA 4I7ZB 5GTHH 2JWAA 4U3FJ 2WPSA 4H44D 5AVZB 3WU2E 2E75C 3PRJA 3M9HA 1GL2D 1SQVG 2AEJA 1BE3D 3L73G 1JTHB 2WITA 3H1IE 4IFMA 4IOIH 1S5LH 3WU2H 2IYPA 4ZNCA 1LTGC 1L0LK 1X9VA 2QSIA 4JPZB 1SQBK 3S4RA 2GA1A 3L70E 3RGUA 3SWKA 2JO1A 1K9MQ 1RF1C 3AEEC 1L0LD 2HR3A 2M3BA 3CWBJ 2R5DA 2YNYA 4WB4A 5BU8B 1S9KD 5KLVJ 3CMAP 1LTBC 2H89C 3AE3C 3L75E 2XNDH 3D6YA 4UB8H 2KLVA 3L70D 3VYIA 2E5TA 2P10A 3M9BA 3NXSA 3FGAD 2ITAA 5KAIH 1L0NK 3WMM0 1R8EA 1SS1A 2GUSA 2KIKA 1PIXA 2NPSC 4OVNF 1NTMJ 3BRVB 5APVA 3NFQA 3Q1MA 2M3EA 1T3JA 2KZJA 5AW4B 3BCCG 1H8AA 4D6TG 3RK3B 2PP6A 1VL2A 1G1IA 1Q2NA 3AE5C 5B66H 1M1JA 3G6EP 3CPWO 3FWLA 1FZCB 2A45I 3MUDC 2BEQD 3VMAA 2W8ZA 3AE2C 3BATA 5CCGC 2HYNA 1SQQD 1N2DC 2Q6QA 4K3AA 4YXDC 2B88A 2WPRA 1EZVG 4GKGA 4H44B 4OGQB 2AXTE 1VQOP 3SSUA 1PGJA 4GIFA 3KDPB 4UB8E 1N73B 4HKZH 1KB9D 4UB6H 3H1IG 3L71J 1S2EA 2K88A 2Q3EA 1IFMA 3I55P 3D71A 4C7RA 1TU3F 1KN7A 2Z5HA 3AE4C 1WRGA 3HUSB 5CJ0A 3VP8A 3JC22 1BCCG 3A2AA 1JMBA 3CX5E 4H0LD 1KILB 1M56D 1L0ND 1IFNA 1J2JB 2FBWC 1KMIZ 2ZYGA 1IZNB 1L0LE 1NAFA 3P8CD 5AW9B 5B5EE 4ZMDA 2OYHA 2RKLA 1Q90D 1GD2E 3AE1C 2E75B 1DD3A 4PJ0E 3USSA 4EYYQ 5CBNA 2RN0A 3H1ID 5KJ7A 5KLVK 1YJ9P 2K3RA 2B89A 4HB1A 3WUTA 1S5LX 1HUCA 1USDA 3CCJP 3TGUD 3Q2YA 1T2KD 2C9LY 1SQVE 4JF7A 2W6JH 1KQFB 1URQD 1NJIQ 1AA0A 3R2PA 1KTMA 4ZKPA 1LNQA 2O01N 2IFNA 3RK2D 3CC2P 1LWUC 1NTME 1Y47A 2RH0A 1XTGB 2J59M 2WSFH 2KNCA 3H1JE 5AW5B 2Q9IA 1SQQK 5CHXA 4ZKUA 2R32A 1DEEG 5AVSB 1AQTA 1N7SC 1U7MA 3O8ZA 3G4SP 1S1CX 3AE9C 2P7JA 3L75J 3GG2A 1OWAA 5AVTB 2YXRB 1FU1A 2E76B 2KNCB 3W68A 4RO0A 1YQ3C 3CWBE 3GF7A 4IFFA 3B8EB 1NTZE 1G2CB 3HTKB 3L70J 3M91A 4H0LB 3TGUJ 3CCMP 5KKZC 1FZFA 4N3YB 2XZRA 2G3AA 5APQA 2ZXEB 2PAJA 3H1IJ 2BEZF 3RK3C 1BGYG 2BCCG 2I1JA 1S72P 1JNMA 2FYUK 1IC2A 2NZ2A 3G9RA 1J1DB 1M1JC 3MGNA 4YTPC 2Z4EA 1HH0A 2OTKE 1CI6B 1FE6A 1GL2C 1P84I 1PGOA 2SPZA 3L74J 3SFDC 3I56P 1VF5B 3Q3DA 1VQLP 4ASWA 1NU1J 2Q5UA 3GLMA 1OIPA 1LT9B 3IAOA 1NH4A 2OTLP 1LTTC 1RE3A 3T97B 1QGKB 3F5HA 2HODB 1JTHA 2YO2A 2E74D 3BCCJ 3H1HE 1IFJA 2Z5IA 1KILC 1HWTC 1KB9E 3FXEA 1LTJB 2Y0EA 3CCVP 1L2PA 1NTKK 3A0HE 1UIIA 1IFPA 1BDDA 2Q3IA 3V5BA 4WWIA 5CCHA 5K5GB 3N4XA 2R5BA 1ZR4A 3BCCD 4OH8B 3CCLP 1J1EB 1KB9H 2NPSD 1ZLLA 2WSEJ 1FDIA 5KTBA 2LXBA 1ZR2A 2A06D 1X0TA 2J58A 3CWBG 3A0BE 1MUUA 5CCHD 2POHA 3MD0A 1ZMEC 1T3UA 1NO4A 4JQ0D 1LTJC 1NTZD 3W67A 3CCSP 2YXQB 5CCGD 3LW5H 4WY4D 1NTKJ 1NTZK 5TJHA 4I7ZC 1USEA 1YQ4C 4IFDK 2KS1B 1KV4A 5AW7B 2WWWA 1RE3C 3M0DA 1HGVA 1DEBA 2QM7A 2FYUE 3C9IA 3CXHI 2M8RA 3H1LG 3OW2O 2KB7P 1SQBG 1BE3G 2CPBA 1ZRTE 3AE8C 3HD7D 3L70G 1YITP 3VMXA 1GMJA 3L37A 2KSJA 5KKZB 2Q7CA 1PPJD 2JWDA 2WMMA 1L4AC 1RE4C 2WSEH 2N1TA 2R3CA 3GHGC 2QM8A 3M9QA 3OJAB 3IFMA 3P7KA 2WQYC 2Y9ZA 2IPPA 1W2EA 1OVRA 5APTA 1KYOI 3AE7C 5AW6B 4PV1C 1N7SA 1SQPD 1SQBD 2IFMA 3IN6A 4H13D 4I2LC 4TT3H 3H1JG 5KAFH 2ZT9C 5B66E 2N1TB 2WT7B 1SQQG 3L36A 1XTCC 2E42A 1PPJG 3CX5D 2MJZA 2V7QJ 1EC5A 1L4AB 3HE5A 3VP9A 4JYBA 3O6QA 3VTPC 4AQRD 3V6IA 4BRYB 1HF9A 1DH3A 1LJ2A 3FXDA 4DJGA 2IDBA 1JO5A 4QMAA 1OX3A 3I5CA 2WT7A 1T8ZA 5GTHE 4O9BA 3V2NA 1K73Q 2ZAEB 2VRSA 2QA4P 3HD7A 1LWUB 2YIUB 1OVUA 1FC2C 1JCCA 1AVYA 5EFWB 1MFZA 1PGQA 3KYQA 3IR9A 1GZLA 1URQA 3GW6A 2JJLA 1SLQA 5C39A 2IZ1A 3L71G 2XKMA 3RL0D 4U7JA 1CW5A 3CCUP 1VQ5P 1NOHA 3H32A 1PP9J 1PFIA 1JY3O 1OZHA 2P1JA 1AV1A 5KJ7D 5GTIH 3TSIA 3Q5PA 3E1RA 2B87B 3TDKA 2YKOA 3AECC 1YYCA 1IK7A 1RH5B 1YTZI 2JDIH 3HE4A 5M1BA 1URQB 3L75D 4YXWH 1M90Q 1W5CE 1RF1B 3JCUE 2IBZE 2IYOA 1PP9D 4TLFA 1HGZA 1X79B 2D2CB 3H1HD 4WVZA 5CCGA 4W7ZA 1Q7YQ 1MKMA 1GU4A 1GU5A 3D70A 2Y0CA 3MZWB 3PH0A 4D6TJ 1A02F 2C9NY 3HE4B 5APSA 1JOCA 1Y8AA 1BE3E 3U59A 4RESB 4H44C 4EDFA 3EFGA 1JB0J 3H25A 1KFMA 1FZBA 1KILD 1G2CA 2KOGA 3A7OA 1LT9C 4I1LA 1LTSC 2XNXA 2LR2A 3PTZA 4HYTB 1FZGA 1EZVI 3A0HH 4DCKA 4GODA 3R4YA 1FZCC 5APUA 1NYHA 2QJPC 4NPEA 2UWJE 4U3FD 3RBXA 2YO3A 3AEFC 2HPCB 2FFDA 3KZIE 2QE7H 1RF0A 2L91A 4OGQD 4UB6E 3RL0B 1LGHB 1EDKA 1LTAC 1SQXG 1ZN5A 2IZ0A 4RKUJ 1N8RQ 2H88C 1P84E 1FDMA 3V4QA 1FJPA 3CX5I 3L71E 3L73J 2FYUG 2O1KA 1S5LE 1H0TA 1VF5D 3AEDC 2OYOA 2R44A 4DT0A 2K37A 1HJBA 4WY4C 2KLUA 1YIJP 1AVOA 1J1DC 1M1JB 2YKQA 3MIWA 4JYCA 2FXOA 4U3FG 1EDJA 2J5UA 2Y0DA 2GM4A 2OYIC 2B9BA 1KZUB 1FDOA 1NTMD 2IBZG 1SFCC 1SQXD 3CCQP 1SQBJ 1PV3A 1RQUA 2YKPA 1NU1K 3HD7C 1BSHA 2WVRA 4RJTA 1SQVD 1N7SB 1HVVA 4PD4D 3LIDA 2E76D 3JSVC 3HUSA 1SQPG 1NTKG 1OW7A 2QVAA 5H2FH 3TNUA 2QEXP 2Y9YA 1EXJA 3VMYA 1PPJE 4GOEA 1DD4A 4R4LA 1QL1A 4BRYA 2CK3H 5DJUB 5KLIB 1SP4A 1Q82Q 1GTWA 1BCCE 4H13C 4KJMA 3RK3E 2W83C 2ZT9D 1AQ5A 2WSCJ 3KZIH 5KLVE 2CPSA 1RE4A 3B71A 3S1KA 2K9YA 2IBZI 1KFNA 4LC1A 1L0LJ 2AXTH 1D7MA 5AVRB 2JP3A 1WMKA 2XDJA 1HTLC 1JY2O 4XFJA 1HBWA 3A3YB 4KT0J 1NTZG 1G1JA 1L4AA 3N7NA 2OYIB 3LW5J 2OYHC 2O01J 4WBAA 1VDFA 2K9JB 3RL0g 1SQQE 3V2QA 1FS0E 4DOJA 1T2KC 3CX5H 3WUUA 2W90A 4U3FE 4C7NB 1GW4A 2PRRA 1LT1A 1CI6A 1Z56A 2Q1KA 3A5TA 2DW3A 1IFIA 1LP1B 3RK2C 4XA4A 4AUWA 4H0LC 3V2RA 3CCEP 3OA7A 3H1KG 1M1KQ 3CC4P 1RQVA 4PD4I 1LT9A 3D6ZA 3FX0A 3L74G 3VN0A 2K1AA 3CXHH 3RL0C 5BU5A 1EXIA 2NPSA 2V4HA 3CCRP 1KD1Q 5AVQB 1N7SD 3L72E 4DZOA 1HJ0A 3GHGB 4GDOA 1S3JA 4N78D 1U7JA 2H7HA 1MZ9A 1YBKA 3H1HG 1OFCX 1P84D 3P32A 3MUDA 2B87A 2YMYA 1UIXA
chains in the Genus database with same CATH topology
1JMMA 4LLHA 3MTUE 4HH2A 3B5NA 4EOTA 3RK3D 3TYYA 1EQ7A 1IK9A 3BRTB 3BVHA 2FFDB 3CI9A 2HFED 1IFDA 2WTYA 4WY4A 1LTJA 2W6AA 3CL3D 3M0AA 4EIJA 1VPCA 2XV5A 2JEEA 3M0DC 1GL2A 5AW0B 2FKWB 4N78E 1MV8A 1FZCA 1NWQA 4W80A 5APXA 3CLQA 4I6MC 3UIAA 2W6BA 5AVUB 5CMZA 3H6PA 1N73B 5CCHC 5CJ4A 1JY3N 2LKMA 2C0XA 2HPCA 2I1KA 3G3ZA 2A45G 3SWFA 1N73A 1URQC 1SVFA 2XU6A 3U1AA 5APWA 1SQXK 1FZEA 1SQVK 5AVVB 1NHLA 5BVZA 3U1CA 4Y99B 1NTMK 2P67A 1SFCA 4KHXA 3B5ND 2FYZA 2N1TD 1E5WA 2O01H 3TNUB 5AVYB 2OARA 1QL2A 4Y99C 1ZV8A 3KQGA 1GW3A 1J1EC 1LWUA 1YTZT 5AW1B 4AYCA 1RY3A 3HRNA 1CZQA 4M3LA 3EQ2A 1SQPK 1GDTA 2HLOA 2FFDC 3NTNA 3B5NB 4N6JA 1FOSE 3L35A 3PP5A 3SWYA 1FZAA 5AW2B 1NKNA 1OXZA 1FBMA 1RF0C 4WY4B 3LIEA 2HG5D 2HODA 4W7YA 3OAKA 1IO4A 1IJDB 3II6A 2C0WA 1GL2B 3V4WA 2NPSB 5APYA 1NKZB 2WZ7A 4C46A 2ZFCA 3NMDA 2GUVA 2WPQA 1KILA 5AVWB 2N9BA 2H8PD 3E1IA 2O1JA 3VMZA 3BASA 2OYHB 1JUNA 3M06A 1FAVA 1L4AD 3L4FA 3TK1A 1KQLA 1N7LA 3KPEA 4B86A 1N86A 2E43A 1JY3P 1SFCD 1S9KE 1JY2P 2IX7C 1SFCB 2WSCH 3V2PA 1AFOA 4C7NA 3HD7B 5AW8B 2KP8A 4LGDE 3HE5B 1A02J 2FXMA 3HUSC 3RK2B 1H88A 3P8CE 3B5NC 1H89A 1CSBA 3P8MC 2N1TC 3GHGA 2H43A 1X8YA 2P2UA 5AVXB 4XE5B 2BASA 3VOPA 5KJ7C 1N73C 1M7LA 3T97A 3HTKA 1LTIC 2KYVA 2L5GB 1GK6A 4GT1A 5APTA 2A45H 3H32B 1WT6A 5AW3B 1JCDA 1FJKA 1GK4A 2W27A 1RF1A 1JY2N 2WPSA 5AVZB 3M9HA 1GL2D 4IFMA 1JTHB 2WITA 4IFDK 1LTGC 1L0LK 1X9VA 1SQBK 1RF1C 4WB4A 2M3BA 5BU8B 1S9KD 2R5DA 2YNYA 1LTBC 2KLVA 3VYIA 3M9BA 3NXSA 1L0NK 3WMM0 2GUSA 2NPSC 3BRVB 5APVA 3NFQA 1T3JA 1H8AA 5AW4B 3RK3B 2PP6A 1G1IA 1M1JA 1FZCB 2A45I 3BATA 5CCGC 2HYNA 1N2DC 2WPRA 4GKGA 4GIFA 3KDPB 1IFMA 4C7RA 2Z5HA 1WRGA 3HUSB 5CJ0A 3VP8A 3A2AA 1KILB 3P8CD 1IFNA 1J2JB 1DX7A 1NAFA 5AW9B 2OYHA 1GD2E 2H7HA 5KJ7A 5KLVK 2C9LY 1HUCA 1T2KD 4JF7A 1URQD 3R2PA 4ZKPA 3RK2D 2IFNA 1LWUC 1XTGB 2J59M 2WSFH 5AW5B 2Q9IA 1SQQK 5CHXA 4ZKUA 2R32A 5AVSB 1N7SC 3O8ZA 2P7JA 1OWAA 5AVTB 1FU1A 4IFFA 3B8EB 1G2CB 3HTKB 3M91A 1FZFA 4N3YB 2XZRA 5APQA 2ZXEB 2PAJA 3RK3C 1JNMA 2I1JA 2FYUK 1IC2A 1J1DB 1M1JC 3MGNA 2Z4EA 1HH0A 1CI6B 1GL2C 2Q5UA 1LT9B 1NH4A 1LTTC 1RE3A 2HODB 1JTHA 2YO2A 1IFJA 2Z5IA 1KILC 1HWTC 1LTJB 1NTKK 5CCHA 3V5BA 2Q3IA 3N4XA 2R5BA 1ZR4A 4OH8B 1J1EB 2NPSD 1ZLLA 1ZR2A 5KTBA 2J58A 5CCHD 1MUUA 2POHA 3MD0A 1T3UA 1NO4A 1LTJC 5CCGD 3LW5H 4WY4D 1NTZK 5AW7B 2WWWA 1RE3C 3M0DA 1HGVA 1DEBA 2QM7A 1FOSF 3C9IA 2M8RA 2KB7P 2CPBA 3HD7D 3VMXA 3L37A 2KSJA 2Q7CA 2WSEH 1L4AC 1RE4C 2N1TA 2R3CA 3P7KA 2QM8A 3GHGC 3M9QA 3IFMA 2IPPA 1W2EA 5AW6B 1N7SA 2IFMA 4I2LC 2N1TB 2WT7B 3L36A 2E42A 1XTCC 2MJZA 3HE5A 1L4AB 3VP9A 4AQRD 2OYIA 4JYBA 3VTPC 1DH3A 1JO5A 3I5CA 2WT7A 1T8ZA 4O9BA 3V2NA 2VRSA 3HD7A 1LWUB 1JCCA 1MFZA 3KYQA 3IR9A 1GZLA 1URQA 2JJLA 1SLQA 3RL0D 2XKMA 1CW5A 1NOHA 3H32A 1PFIA 1JY3O 2P1JA 5KJ7D 3TSIA 2YKOA 3HE4A 1YYCA 1YTZI 1URQB 1RF1B 1HGZA 1X79B 1GU4A 5CCGA 1GU5A 4W7ZA 2C9NY 1A02F 3HE4B 5APSA 1JOCA 3U59A 4RESB 3EFGA 1KFMA 1FZBA 1G2CA 1KILD 2KOGA 3A7OA 1LT9C 4I1LA 1LTSC 2XNXA 1FZGA 4HYTB 1FZCC 5APUA 2HPCB 2FFDA 2YO3A 1RF0A 3RL0B 1LGHB 1ZN5A 1LTAC 1FDMA 3V4QA 1FJPA 2O1KA 1HJBA 4WY4C 1J1DC 1M1JB 2YKQA 3MIWA 4JYCA 2GM4A 2OYIC 1KZUB 1SFCC 2YKPA 1NU1K 3HD7C 1N7SB 1HVVA 3LIDA 3HUSA 3TNUA 3VMYA 1QL1A 1SP4A 1GTWA 1AQ5A 2YMYA 2CPSA 1RE4A 1KFNA 4LC1A 5AVRB 2XDJA 1HTLC 1JY2O 1HBWA 3A3YB 1G1JA 1L4AA 3N7NA 2OYIB 2OYHC 4WBAA 1VDFA 3V2QA 4DOJA 1T2KC 4C7NB 1GW4A 1CI6A 1Z56A 3A5TA 1IFIA 3RK2C 4XA4A 4AUWA 3V2RA 3OA7A 1LT9A 3VN0A 5BU5A 3RL0C 2NPSA 5AVQB 1N7SD 4DZOA 3GHGB 4N78D 1MZ9A 3P32A 3MUDA 3OJAB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A2A A;  2WPQ A;  5AVW B;  1J2J B;  2N9B A;  2VRS A;  4EOT A;  1NAF A;  5AW9 B;  3TYY A;  3VMZ A;  1JUN A;  1GD2 E;  1MFZ A;  3M06 A;  3IR9 A;  2H7H A;  1GZL A;  2JJL A;  1FAV A;  1SLQ A;  2C9L Y;  1HUC A;  1T2K D;  2WTY A;  2W6A A;  3M0A A;  3TK1 A;  1KQL A;  3HE4 A;  1YYC A;  2XV5 A;  5AW5 B;  4B86 A;  5AW0 B;  2R32 A;  1GU4 A;  5AVS B;  2E43 A;  1GU5 A;  3O8Z A;  1MV8 A;  2P7J A;  1S9K E;  1NWQ A;  1A02 F;  2C9N Y;  3HE4 B;  1OWA A;  5APS A;  5APX A;  5AVT B;  4C7N A;  4RES B;  4I6M C;  3B8E B;  5AVU B;  3UIA A;  5CMZ A;  1G2C B;  3A7O A;  3M91 A;  5AW8 B;  2KP8 A;  2XZR A;  3HE5 B;  4HYT B;  2ZXE B;  5APQ A;  1A02 J;  1JNM A;  3MGN A;  5APU A;  1H88 A;  2YO3 A;  1H89 A;  1CI6 B;  1CSB A;  3P8M C;  1X8Y A;  2P2U A;  5AVX B;  4XE5 B;  3SWF A;  2BAS A;  2Q5U A;  3V4Q A;  2XU6 A;  3T97 A;  3HTK A;  5APT A;  1GK6 A;  2YO2 A;  4GT1 A;  1HJB A;  4JYC A;  5APW A;  2Z5I A;  1HWT C;  5AW3 B;  5AVV B;  3V5B A;  2Q3I A;  1GK4 A;  2W27 A;  2R5B A;  2P67 A;  2WPS A;  4KHX A;  5AVZ B;  3LID A;  3M9H A;  3TNU B;  5AVY B;  3TNU A;  1MUU A;  3MD0 A;  3VMY A;  1SP4 A;  1GTW A;  3KQG A;  5AW1 B;  4AYC A;  1S9K D;  2R5D A;  2YNY A;  5AW7 B;  1CZQ A;  2WWW A;  4M3L A;  3M0D A;  3NTN A;  4LC1 A;  2QM7 A;  1FOS F;  3VYI A;  5AVR B;  3M9B A;  1FOS E;  3L35 A;  3NXS A;  1HBW A;  3A3Y B;  5AW2 B;  3VMX A;  3L37 A;  1OXZ A;  5APV A;  3NFQ A;  2Q7C A;  1H8A A;  5AW4 B;  2R3C A;  3P7K A;  2QM8 A;  4C7N B;  1T2K C;  1CI6 A;  2IPP A;  3LIE A;  3A5T A;  4AUW A;  5AW6 B;  3OAK A;  1IO4 A;  4I2L C;  3VN0 A;  2WPR A;  3V4W A;  2WT7 B;  3L36 A;  2E42 A;  4GKG A;  5AVQ B;  4DZO A;  5APY A;  3HE5 A;  4AQR D;  3KDP B;  4JYB A;  3VTP C;  1DH3 A;  4C46 A;  2ZFC A;  3P32 A;  3NMD A;  2Z5H A;  3I5C A;  2WT7 A; 
#chains in the Genus database with same CATH topology
 1QVF O;  1JMM A;  3KXD A;  3MTU E;  4K35 A;  4HH2 A;  1OVV A;  4LLH A;  3L74 D;  2E74 B;  3B5N A;  4EOT A;  3RK3 D;  3L72 J;  3TYY A;  1BCC D;  1EQ7 A;  1SQB E;  1BSN A;  4BXL A;  5H2F E;  1IK9 A;  5CBO A;  3BRT B;  3BVH A;  2WSS H;  1YJW P;  1K8A Q;  5TIS E;  2FFD B;  1AJY A;  4L74 A;  1Y9B A;  3CI9 A;  1BDC A;  2KK7 A;  2HFE D;  1YJN P;  1YHQ P;  1IFD A;  3PHL A;  2WTY A;  4WY4 A;  1LTJ A;  2W6A A;  3CL3 D;  3L73 E;  3M0A A;  4EIJ A;  1SQQ J;  1VQK P;  3B4S A;  2JR8 A;  1S4X A;  1VPC A;  3F89 A;  2KI7 B;  4D6T D;  2XV5 A;  2FYU D;  4OGQ C;  2JEE A;  2E5Y A;  1GL2 A;  3M0D C;  5AW0 B;  2FKW B;  4N78 E;  1VQ6 P;  1W2B O;  3CXH E;  1ZXG A;  1MV8 A;  1YI2 P;  3WUV A;  1FZC A;  1NWQ A;  4W80 A;  2A06 G;  3L72 G;  5APX A;  2FYN C;  1QEX A;  3CLQ A;  5KLI C;  2V7Q H;  1K04 A;  2KSE A;  4I6M C;  1BCC J;  2D2C D;  2W6B A;  5AVU B;  1X22 A;  5CMZ A;  3H6P A;  3UIA A;  4OWF A;  2OTJ P;  1BE3 J;  2FY8 A;  1SQP E;  2KXP B;  4EI2 A;  5CCH C;  5CJ4 A;  3H1L J;  3S9O A;  2QJK C;  1JY3 N;  1KYO E;  2KUB A;  1K05 A;  2LKM A;  2C0X A;  3AEB C;  2HPC A;  1VQ8 P;  2ZYD A;  2I1K A;  3G3Z A;  3PLN A;  2A45 G;  2AXC A;  2E76 C;  1KYO H;  1L0N J;  3SWF A;  4Z1M H;  2PGD A;  1T6A A;  4HJG H;  1N73 A;  2ZJS E;  3RBZ A;  3H1K J;  1URQ C;  1SVF A;  2XU6 A;  3U1A A;  1PP9 E;  2QJK B;  2H43 A;  5APW A;  1JEK A;  3MP7 B;  1SQX K;  1FZE A;  3CME P;  1SQV K;  5AVV B;  1NHL A;  1NU1 D;  2FYN B;  5BVZ A;  3U1C A;  4Y99 B;  1NTM K;  3EWK A;  1L0L G;  2P67 A;  1LP1 A;  1SFC A;  4GOF A;  2YIU C;  3TF5 A;  4R4M A;  4PV1 D;  2QJY C;  3B5N D;  4KHX A;  2A06 E;  2FYZ A;  2JKV A;  2N1T D;  1BGY D;  1E5W A;  2BCC D;  2O01 H;  4L75 A;  3H1K D;  1NVO A;  5AVY B;  2OAR A;  3TNU B;  1FOS F;  2ZT9 B;  3SFE C;  3JCU H;  3CWB D;  5E79 H;  1VQP P;  1QL2 A;  1NU1 G;  1ZP0 C;  4IL6 H;  4Y99 C;  1PL5 A;  1ZV8 A;  2AEM A;  1L0N G;  1U57 A;  2N9Y B;  1GW3 A;  3KQG A;  4NPD A;  1J1E C;  1LWU A;  1YTZ T;  4NPF X;  5AW1 B;  4AYC A;  2RMZ A;  5DJT B;  1RY3 A;  3HRN A;  1CZQ A;  2FXP A;  4M3L A;  3EQ2 A;  1SQP K;  5E79 E;  3ZDM A;  1GDT A;  1PZQ A;  2HLO A;  3MHV A;  4D6T E;  2FFD C;  1BGY J;  1ZW0 A;  2BCC J;  3AEG C;  3B5N B;  3ABV C;  3NTN A;  4MN4 C;  4N6J A;  2G8Y A;  3L35 A;  4PV1 B;  1FOS E;  3PP5 A;  3SWY A;  3TGU G;  1NAY A;  3CD6 P;  2E74 C;  2P58 A;  4JBZ A;  1FZA A;  5AW2 B;  2E75 D;  4CPG A;  3C1L A;  1NKN A;  1OXZ A;  2PFX A;  2NRG A;  2QRX A;  1EZV E;  1FBM A;  4BWN A;  1RF0 C;  1OW6 A;  3E7K A;  5L8R J;  3L75 G;  1KQS O;  4WY4 B;  2LXC B;  3QWO C;  3LIE A;  1KIL E;  2FYU J;  2HG5 D;  1P84 H;  2HOD A;  4W7Y A;  3OAK A;  1IO4 A;  1IJD B;  3C8V A;  3II6 A;  1EZV D;  2QJP B;  1SQX E;  1SQX J;  1NGM B;  1DIP A;  2C0W A;  1H0T B;  1GL2 B;  1OW8 A;  4IL6 X;  1NTK E;  4L73 A;  2NPS B;  3V4W A;  2I8D A;  5APY A;  1VQ9 P;  2KS1 A;  1NKZ B;  2WZ7 A;  4C46 A;  2WSF J;  2ZFC A;  3NMD A;  2WPV B;  3H1L D;  2GUV A;  2WPQ A;  1KIL A;  5AVW B;  2N9B A;  1KC8 Q;  1EDL A;  1KB9 I;  3EFF K;  3GF3 A;  3Q5R A;  1BGY E;  2BCC E;  2H8P D;  3E1I A;  2O1J A;  3VMZ A;  3BAS A;  2OYH B;  1JUN A;  3M06 A;  4A7P A;  2D2C C;  2KZI A;  3FWN A;  1FAV A;  3G71 P;  1M57 D;  1L4A D;  1R5L A;  2O3J A;  3BCC E;  1QX8 A;  3H1H J;  3L4F A;  2ZYA A;  3AE6 C;  3QH9 A;  1VQM P;  5TIS H;  3TK1 A;  1VF5 C;  1KQL A;  1N7L A;  1NU1 E;  1PP9 G;  4H13 B;  3KPE A;  3PJS K;  3L74 E;  1N86 A;  4B86 A;  3Q5S A;  1VQ4 P;  1KQG B;  2AEF A;  1QLE D;  1Q86 Q;  5B5E H;  2E43 A;  2QJY B;  4L76 A;  4ASV A;  1JY3 P;  1SFC D;  1MFT A;  1S9K E;  5KLV D;  2ZVO B;  1JY2 P;  2IX7 C;  2M5A A;  1RHZ B;  4PD4 H;  1VQ7 P;  1NTK D;  1SFC B;  2WSC H;  1NTM G;  2IBZ D;  4PJ0 H;  2QIW A;  3V2P A;  4C7N A;  3TGU E;  1AFO A;  3HD7 B;  3L72 D;  1NTZ J;  4YPC A;  5AW8 B;  1PGP A;  4PD4 E;  2KP8 A;  4LGD E;  5KAI E;  3HE5 B;  5GTI E;  1A02 J;  1VQN P;  4IL6 E;  2QG4 A;  2M5A B;  2MKV A;  2FXM A;  1OMI A;  2OQQ A;  3H1K E;  1KYO D;  3HUS C;  3K5B A;  2YMK A;  3RK2 B;  3O6Q B;  5KLV G;  1H88 A;  1L0N E;  3B5N C;  3P8C E;  1H89 A;  1KOR A;  3CC7 P;  1CSB A;  3P8M C;  1ZRT D;  2N1T C;  3GHG A;  1X8Y A;  2P2U A;  3KHU A;  4XE5 B;  5AVX B;  3H1J J;  2ZVN B;  2OYI A;  2BAS A;  1DX7 A;  2K9J A;  3GMA A;  1EDI A;  1M8O B;  3VOP A;  5KAF E;  5KJ7 C;  1Q81 Q;  1N73 C;  1M7L A;  3H1L E;  3IF4 A;  1SQP J;  3T97 A;  3L71 D;  3HTK A;  1LTI C;  1SQV J;  2KYV A;  1GK6 A;  2L5G B;  2OGU A;  2A45 H;  3CXH D;  4GT1 A;  2M0B A;  3H32 B;  1JM0 A;  3L73 D;  3AEA C;  1WT6 A;  5AW3 B;  1ZOY C;  1R5S A;  2ZXX A;  1JCD A;  1FJK A;  1GK4 A;  3H1J D;  2W27 A;  4Y28 J;  2R3S A;  1E79 H;  1JY2 N;  1QVG O;  1RF1 A;  3A0B H;  3ITK A;  4I7Z B;  5GTH H;  2JWA A;  4U3F J;  2WPS A;  4H44 D;  5AVZ B;  3WU2 E;  2E75 C;  3PRJ A;  3M9H A;  1GL2 D;  1SQV G;  2AEJ A;  1BE3 D;  3L73 G;  1JTH B;  2WIT A;  3H1I E;  4IFM A;  4IOI H;  1S5L H;  3WU2 H;  2IYP A;  4ZNC A;  1LTG C;  1L0L K;  1X9V A;  2QSI A;  4JPZ B;  1SQB K;  3S4R A;  2GA1 A;  3L70 E;  3RGU A;  3SWK A;  2JO1 A;  1K9M Q;  1RF1 C;  3AEE C;  1L0L D;  2HR3 A;  2M3B A;  3CWB J;  2R5D A;  2YNY A;  4WB4 A;  5BU8 B;  1S9K D;  5KLV J;  3CMA P;  1LTB C;  2H89 C;  3AE3 C;  3L75 E;  2XND H;  3D6Y A;  4UB8 H;  2KLV A;  3L70 D;  3VYI A;  2E5T A;  2P10 A;  3M9B A;  3NXS A;  3FGA D;  2ITA A;  5KAI H;  1L0N K;  3WMM 0;  1R8E A;  1SS1 A;  2GUS A;  2KIK A;  1PIX A;  2NPS C;  4OVN F;  1NTM J;  3BRV B;  5APV A;  3NFQ A;  3Q1M A;  2M3E A;  1T3J A;  2KZJ A;  5AW4 B;  3BCC G;  1H8A A;  4D6T G;  3RK3 B;  2PP6 A;  1VL2 A;  1G1I A;  1Q2N A;  3AE5 C;  5B66 H;  1M1J A;  3G6E P;  3CPW O;  3FWL A;  1FZC B;  2A45 I;  3MUD C;  2BEQ D;  3VMA A;  2W8Z A;  3AE2 C;  3BAT A;  5CCG C;  2HYN A;  1SQQ D;  1N2D C;  2Q6Q A;  4K3A A;  4YXD C;  2B88 A;  2WPR A;  1EZV G;  4GKG A;  4H44 B;  4OGQ B;  2AXT E;  1VQO P;  3SSU A;  1PGJ A;  4GIF A;  3KDP B;  4UB8 E;  1N73 B;  4HKZ H;  1KB9 D;  4UB6 H;  3H1I G;  3L71 J;  1S2E A;  2K88 A;  2Q3E A;  1IFM A;  3I55 P;  3D71 A;  4C7R A;  1TU3 F;  1KN7 A;  2Z5H A;  3AE4 C;  1WRG A;  3HUS B;  5CJ0 A;  3VP8 A;  3JC2 2;  1BCC G;  3A2A A;  1JMB A;  3CX5 E;  4H0L D;  1KIL B;  1M56 D;  1L0N D;  1IFN A;  1J2J B;  2FBW C;  1KMI Z;  2ZYG A;  1IZN B;  1L0L E;  1NAF A;  3P8C D;  5AW9 B;  5B5E E;  4ZMD A;  2OYH A;  2RKL A;  1Q90 D;  1GD2 E;  3AE1 C;  2E75 B;  1DD3 A;  4PJ0 E;  3USS A;  4EYY Q;  5CBN A;  2RN0 A;  3H1I D;  5KJ7 A;  5KLV K;  1YJ9 P;  2K3R A;  2B89 A;  4HB1 A;  3WUT A;  1S5L X;  1HUC A;  1USD A;  3CCJ P;  3TGU D;  3Q2Y A;  1T2K D;  2C9L Y;  1SQV E;  4JF7 A;  2W6J H;  1KQF B;  1URQ D;  1NJI Q;  1AA0 A;  3R2P A;  1KTM A;  4ZKP A;  1LNQ A;  2O01 N;  2IFN A;  3RK2 D;  3CC2 P;  1LWU C;  1NTM E;  1Y47 A;  2RH0 A;  1XTG B;  2J59 M;  2WSF H;  2KNC A;  3H1J E;  5AW5 B;  2Q9I A;  1SQQ K;  5CHX A;  4ZKU A;  2R32 A;  1DEE G;  5AVS B;  1AQT A;  1N7S C;  1U7M A;  3O8Z A;  3G4S P;  1S1C X;  3AE9 C;  2P7J A;  3L75 J;  3GG2 A;  1OWA A;  5AVT B;  2YXR B;  1FU1 A;  2E76 B;  2KNC B;  3W68 A;  4RO0 A;  1YQ3 C;  3CWB E;  3GF7 A;  4IFF A;  3B8E B;  1NTZ E;  1G2C B;  3HTK B;  3L70 J;  3M91 A;  4H0L B;  3TGU J;  3CCM P;  5KKZ C;  1FZF A;  4N3Y B;  2XZR A;  2G3A A;  5APQ A;  2ZXE B;  2PAJ A;  3H1I J;  2BEZ F;  3RK3 C;  1BGY G;  2BCC G;  2I1J A;  1S72 P;  1JNM A;  2FYU K;  1IC2 A;  2NZ2 A;  3G9R A;  1J1D B;  1M1J C;  3MGN A;  4YTP C;  2Z4E A;  1HH0 A;  2OTK E;  1CI6 B;  1FE6 A;  1GL2 C;  1P84 I;  1PGO A;  2SPZ A;  3L74 J;  3SFD C;  3I56 P;  1VF5 B;  3Q3D A;  1VQL P;  4ASW A;  1NU1 J;  2Q5U A;  3GLM A;  1OIP A;  1LT9 B;  3IAO A;  1NH4 A;  2OTL P;  1LTT C;  1RE3 A;  3T97 B;  1QGK B;  3F5H A;  2HOD B;  1JTH A;  2YO2 A;  2E74 D;  3BCC J;  3H1H E;  1IFJ A;  2Z5I A;  1KIL C;  1HWT C;  1KB9 E;  3FXE A;  1LTJ B;  2Y0E A;  3CCV P;  1L2P A;  1NTK K;  3A0H E;  1UII A;  1IFP A;  1BDD A;  2Q3I A;  3V5B A;  4WWI A;  5CCH A;  5K5G B;  3N4X A;  2R5B A;  1ZR4 A;  3BCC D;  4OH8 B;  3CCL P;  1J1E B;  1KB9 H;  2NPS D;  1ZLL A;  2WSE J;  1FDI A;  5KTB A;  2LXB A;  1ZR2 A;  2A06 D;  1X0T A;  2J58 A;  3CWB G;  3A0B E;  1MUU A;  5CCH D;  2POH A;  3MD0 A;  1ZME C;  1T3U A;  1NO4 A;  4JQ0 D;  1LTJ C;  1NTZ D;  3W67 A;  3CCS P;  2YXQ B;  5CCG D;  3LW5 H;  4WY4 D;  1NTK J;  1NTZ K;  5TJH A;  4I7Z C;  1USE A;  1YQ4 C;  4IFD K;  2KS1 B;  1KV4 A;  5AW7 B;  2WWW A;  1RE3 C;  3M0D A;  1HGV A;  1DEB A;  2QM7 A;  2FYU E;  3C9I A;  3CXH I;  2M8R A;  3H1L G;  3OW2 O;  2KB7 P;  1SQB G;  1BE3 G;  2CPB A;  1ZRT E;  3AE8 C;  3HD7 D;  3L70 G;  1YIT P;  3VMX A;  1GMJ A;  3L37 A;  2KSJ A;  5KKZ B;  2Q7C A;  1PPJ D;  2JWD A;  2WMM A;  1L4A C;  1RE4 C;  2WSE H;  2N1T A;  2R3C A;  3GHG C;  2QM8 A;  3M9Q A;  3OJA B;  3IFM A;  3P7K A;  2WQY C;  2Y9Z A;  2IPP A;  1W2E A;  1OVR A;  5APT A;  1KYO I;  3AE7 C;  5AW6 B;  4PV1 C;  1N7S A;  1SQP D;  1SQB D;  2IFM A;  3IN6 A;  4H13 D;  4I2L C;  4TT3 H;  3H1J G;  5KAF H;  2ZT9 C;  5B66 E;  2N1T B;  2WT7 B;  1SQQ G;  3L36 A;  1XTC C;  2E42 A;  1PPJ G;  3CX5 D;  2MJZ A;  2V7Q J;  1EC5 A;  1L4A B;  3HE5 A;  3VP9 A;  4JYB A;  3O6Q A;  3VTP C;  4AQR D;  3V6I A;  4BRY B;  1HF9 A;  1DH3 A;  1LJ2 A;  3FXD A;  4DJG A;  2IDB A;  1JO5 A;  4QMA A;  1OX3 A;  3I5C A;  2WT7 A;  1T8Z A;  5GTH E;  4O9B A;  3V2N A;  1K73 Q;  2ZAE B;  2VRS A;  2QA4 P;  3HD7 A;  1LWU B;  2YIU B;  1OVU A;  1FC2 C;  1JCC A;  1AVY A;  5EFW B;  1MFZ A;  1PGQ A;  3KYQ A;  3IR9 A;  1GZL A;  1URQ A;  3GW6 A;  2JJL A;  1SLQ A;  5C39 A;  2IZ1 A;  3L71 G;  2XKM A;  3RL0 D;  4U7J A;  1CW5 A;  3CCU P;  1VQ5 P;  1NOH A;  3H32 A;  1PP9 J;  1PFI A;  1JY3 O;  1OZH A;  2P1J A;  1AV1 A;  5KJ7 D;  5GTI H;  3TSI A;  3Q5P A;  3E1R A;  2B87 B;  3TDK A;  2YKO A;  3AEC C;  1YYC A;  1IK7 A;  1RH5 B;  1YTZ I;  2JDI H;  3HE4 A;  5M1B A;  1URQ B;  3L75 D;  4YXW H;  1M90 Q;  1W5C E;  1RF1 B;  3JCU E;  2IBZ E;  2IYO A;  1PP9 D;  4TLF A;  1HGZ A;  1X79 B;  2D2C B;  3H1H D;  4WVZ A;  5CCG A;  4W7Z A;  1Q7Y Q;  1MKM A;  1GU4 A;  1GU5 A;  3D70 A;  2Y0C A;  3MZW B;  3PH0 A;  4D6T J;  1A02 F;  2C9N Y;  3HE4 B;  5APS A;  1JOC A;  1Y8A A;  1BE3 E;  3U59 A;  4RES B;  4H44 C;  4EDF A;  3EFG A;  1JB0 J;  3H25 A;  1KFM A;  1FZB A;  1KIL D;  1G2C A;  2KOG A;  3A7O A;  1LT9 C;  4I1L A;  1LTS C;  2XNX A;  2LR2 A;  3PTZ A;  4HYT B;  1FZG A;  1EZV I;  3A0H H;  4DCK A;  4GOD A;  3R4Y A;  1FZC C;  5APU A;  1NYH A;  2QJP C;  4NPE A;  2UWJ E;  4U3F D;  3RBX A;  2YO3 A;  3AEF C;  2HPC B;  2FFD A;  3KZI E;  2QE7 H;  1RF0 A;  2L91 A;  4OGQ D;  4UB6 E;  3RL0 B;  1LGH B;  1EDK A;  1LTA C;  1SQX G;  1ZN5 A;  2IZ0 A;  4RKU J;  1N8R Q;  2H88 C;  1P84 E;  1FDM A;  3V4Q A;  1FJP A;  3CX5 I;  3L71 E;  3L73 J;  2FYU G;  2O1K A;  1S5L E;  1H0T A;  1VF5 D;  3AED C;  2OYO A;  2R44 A;  4DT0 A;  2K37 A;  1HJB A;  4WY4 C;  2KLU A;  1YIJ P;  1AVO A;  1J1D C;  1M1J B;  2YKQ A;  3MIW A;  4JYC A;  2FXO A;  4U3F G;  1EDJ A;  2J5U A;  2Y0D A;  2GM4 A;  2OYI C;  2B9B A;  1KZU B;  1FDO A;  1NTM D;  2IBZ G;  1SFC C;  1SQX D;  3CCQ P;  1SQB J;  1PV3 A;  1RQU A;  2YKP A;  1NU1 K;  3HD7 C;  1BSH A;  2WVR A;  4RJT A;  1SQV D;  1N7S B;  1HVV A;  4PD4 D;  3LID A;  2E76 D;  3JSV C;  3HUS A;  1SQP G;  1NTK G;  1OW7 A;  2QVA A;  5H2F H;  3TNU A;  2QEX P;  2Y9Y A;  1EXJ A;  3VMY A;  1PPJ E;  4GOE A;  1DD4 A;  4R4L A;  1QL1 A;  4BRY A;  2CK3 H;  5DJU B;  5KLI B;  1SP4 A;  1Q82 Q;  1GTW A;  1BCC E;  4H13 C;  4KJM A;  3RK3 E;  2W83 C;  2ZT9 D;  1AQ5 A;  2WSC J;  3KZI H;  5KLV E;  2CPS A;  1RE4 A;  3B71 A;  3S1K A;  2K9Y A;  2IBZ I;  1KFN A;  4LC1 A;  1L0L J;  2AXT H;  1D7M A;  5AVR B;  2JP3 A;  1WMK A;  2XDJ A;  1HTL C;  1JY2 O;  4XFJ A;  1HBW A;  3A3Y B;  4KT0 J;  1NTZ G;  1G1J A;  1L4A A;  3N7N A;  2OYI B;  3LW5 J;  2OYH C;  2O01 J;  4WBA A;  1VDF A;  2K9J B;  3RL0 g;  1SQQ E;  3V2Q A;  1FS0 E;  4DOJ A;  1T2K C;  3CX5 H;  3WUU A;  2W90 A;  4U3F E;  4C7N B;  1GW4 A;  2PRR A;  1LT1 A;  1CI6 A;  1Z56 A;  2Q1K A;  3A5T A;  2DW3 A;  1IFI A;  1LP1 B;  3RK2 C;  4XA4 A;  4AUW A;  4H0L C;  3V2R A;  3CCE P;  3OA7 A;  3H1K G;  1M1K Q;  3CC4 P;  1RQV A;  4PD4 I;  1LT9 A;  3D6Z A;  3FX0 A;  3L74 G;  3VN0 A;  2K1A A;  3CXH H;  3RL0 C;  5BU5 A;  1EXI A;  2NPS A;  2V4H A;  3CCR P;  1KD1 Q;  5AVQ B;  1N7S D;  3L72 E;  4DZO A;  1HJ0 A;  3GHG B;  4GDO A;  1S3J A;  4N78 D;  1U7J A;  2H7H A;  1MZ9 A;  1YBK A;  3H1H G;  1OFC X;  1P84 D;  3P32 A;  3MUD A;  2B87 A;  2YMY A;  1UIX A; 
#chains in the Genus database with same CATH homology
 1JMM A;  4LLH A;  3MTU E;  4HH2 A;  3B5N A;  4EOT A;  3RK3 D;  3TYY A;  1EQ7 A;  1IK9 A;  3BRT B;  3BVH A;  2FFD B;  3CI9 A;  2HFE D;  1IFD A;  2WTY A;  4WY4 A;  1LTJ A;  2W6A A;  3CL3 D;  3M0A A;  4EIJ A;  1VPC A;  2XV5 A;  2JEE A;  3M0D C;  1GL2 A;  5AW0 B;  2FKW B;  4N78 E;  1MV8 A;  1FZC A;  1NWQ A;  4W80 A;  5APX A;  3CLQ A;  4I6M C;  3UIA A;  2W6B A;  5AVU B;  5CMZ A;  3H6P A;  1N73 B;  5CCH C;  5CJ4 A;  1JY3 N;  2LKM A;  2C0X A;  2HPC A;  2I1K A;  3G3Z A;  2A45 G;  3SWF A;  1N73 A;  1URQ C;  1SVF A;  2XU6 A;  3U1A A;  5APW A;  1SQX K;  1FZE A;  1SQV K;  5AVV B;  1NHL A;  5BVZ A;  3U1C A;  4Y99 B;  1NTM K;  2P67 A;  1SFC A;  4KHX A;  3B5N D;  2FYZ A;  2N1T D;  1E5W A;  2O01 H;  3TNU B;  5AVY B;  2OAR A;  1QL2 A;  4Y99 C;  1ZV8 A;  3KQG A;  1GW3 A;  1J1E C;  1LWU A;  1YTZ T;  5AW1 B;  4AYC A;  1RY3 A;  3HRN A;  1CZQ A;  4M3L A;  3EQ2 A;  1SQP K;  1GDT A;  2HLO A;  2FFD C;  3NTN A;  3B5N B;  4N6J A;  1FOS E;  3L35 A;  3PP5 A;  3SWY A;  1FZA A;  5AW2 B;  1NKN A;  1OXZ A;  1FBM A;  1RF0 C;  4WY4 B;  3LIE A;  2HG5 D;  2HOD A;  4W7Y A;  3OAK A;  1IO4 A;  1IJD B;  3II6 A;  2C0W A;  1GL2 B;  3V4W A;  2NPS B;  5APY A;  1NKZ B;  2WZ7 A;  4C46 A;  2ZFC A;  3NMD A;  2GUV A;  2WPQ A;  1KIL A;  5AVW B;  2N9B A;  2H8P D;  3E1I A;  2O1J A;  3VMZ A;  3BAS A;  2OYH B;  1JUN A;  3M06 A;  1FAV A;  1L4A D;  3L4F A;  3TK1 A;  1KQL A;  1N7L A;  3KPE A;  4B86 A;  1N86 A;  2E43 A;  1JY3 P;  1SFC D;  1S9K E;  1JY2 P;  2IX7 C;  1SFC B;  2WSC H;  3V2P A;  1AFO A;  4C7N A;  3HD7 B;  5AW8 B;  2KP8 A;  4LGD E;  3HE5 B;  1A02 J;  2FXM A;  3HUS C;  3RK2 B;  1H88 A;  3P8C E;  3B5N C;  1H89 A;  1CSB A;  3P8M C;  2N1T C;  3GHG A;  2H43 A;  1X8Y A;  2P2U A;  5AVX B;  4XE5 B;  2BAS A;  3VOP A;  5KJ7 C;  1N73 C;  1M7L A;  3T97 A;  3HTK A;  1LTI C;  2KYV A;  2L5G B;  1GK6 A;  4GT1 A;  5APT A;  2A45 H;  3H32 B;  1WT6 A;  5AW3 B;  1JCD A;  1FJK A;  1GK4 A;  2W27 A;  1RF1 A;  1JY2 N;  2WPS A;  5AVZ B;  3M9H A;  1GL2 D;  4IFM A;  1JTH B;  2WIT A;  4IFD K;  1LTG C;  1L0L K;  1X9V A;  1SQB K;  1RF1 C;  4WB4 A;  2M3B A;  5BU8 B;  1S9K D;  2R5D A;  2YNY A;  1LTB C;  2KLV A;  3VYI A;  3M9B A;  3NXS A;  1L0N K;  3WMM 0;  2GUS A;  2NPS C;  3BRV B;  5APV A;  3NFQ A;  1T3J A;  1H8A A;  5AW4 B;  3RK3 B;  2PP6 A;  1G1I A;  1M1J A;  1FZC B;  2A45 I;  3BAT A;  5CCG C;  2HYN A;  1N2D C;  2WPR A;  4GKG A;  4GIF A;  3KDP B;  1IFM A;  4C7R A;  2Z5H A;  1WRG A;  3HUS B;  5CJ0 A;  3VP8 A;  3A2A A;  1KIL B;  3P8C D;  1IFN A;  1J2J B;  1DX7 A;  1NAF A;  5AW9 B;  2OYH A;  1GD2 E;  2H7H A;  5KJ7 A;  5KLV K;  2C9L Y;  1HUC A;  1T2K D;  4JF7 A;  1URQ D;  3R2P A;  4ZKP A;  3RK2 D;  2IFN A;  1LWU C;  1XTG B;  2J59 M;  2WSF H;  5AW5 B;  2Q9I A;  1SQQ K;  5CHX A;  4ZKU A;  2R32 A;  5AVS B;  1N7S C;  3O8Z A;  2P7J A;  1OWA A;  5AVT B;  1FU1 A;  4IFF A;  3B8E B;  1G2C B;  3HTK B;  3M91 A;  1FZF A;  4N3Y B;  2XZR A;  5APQ A;  2ZXE B;  2PAJ A;  3RK3 C;  1JNM A;  2I1J A;  2FYU K;  1IC2 A;  1J1D B;  1M1J C;  3MGN A;  2Z4E A;  1HH0 A;  1CI6 B;  1GL2 C;  2Q5U A;  1LT9 B;  1NH4 A;  1LTT C;  1RE3 A;  2HOD B;  1JTH A;  2YO2 A;  1IFJ A;  2Z5I A;  1KIL C;  1HWT C;  1LTJ B;  1NTK K;  5CCH A;  3V5B A;  2Q3I A;  3N4X A;  2R5B A;  1ZR4 A;  4OH8 B;  1J1E B;  2NPS D;  1ZLL A;  1ZR2 A;  5KTB A;  2J58 A;  5CCH D;  1MUU A;  2POH A;  3MD0 A;  1T3U A;  1NO4 A;  1LTJ C;  5CCG D;  3LW5 H;  4WY4 D;  1NTZ K;  5AW7 B;  2WWW A;  1RE3 C;  3M0D A;  1HGV A;  1DEB A;  2QM7 A;  1FOS F;  3C9I A;  2M8R A;  2KB7 P;  2CPB A;  3HD7 D;  3VMX A;  3L37 A;  2KSJ A;  2Q7C A;  2WSE H;  1L4A C;  1RE4 C;  2N1T A;  2R3C A;  3P7K A;  2QM8 A;  3GHG C;  3M9Q A;  3IFM A;  2IPP A;  1W2E A;  5AW6 B;  1N7S A;  2IFM A;  4I2L C;  2N1T B;  2WT7 B;  3L36 A;  2E42 A;  1XTC C;  2MJZ A;  3HE5 A;  1L4A B;  3VP9 A;  4AQR D;  2OYI A;  4JYB A;  3VTP C;  1DH3 A;  1JO5 A;  3I5C A;  2WT7 A;  1T8Z A;  4O9B A;  3V2N A;  2VRS A;  3HD7 A;  1LWU B;  1JCC A;  1MFZ A;  3KYQ A;  3IR9 A;  1GZL A;  1URQ A;  2JJL A;  1SLQ A;  3RL0 D;  2XKM A;  1CW5 A;  1NOH A;  3H32 A;  1PFI A;  1JY3 O;  2P1J A;  5KJ7 D;  3TSI A;  2YKO A;  3HE4 A;  1YYC A;  1YTZ I;  1URQ B;  1RF1 B;  1HGZ A;  1X79 B;  1GU4 A;  5CCG A;  1GU5 A;  4W7Z A;  2C9N Y;  1A02 F;  3HE4 B;  5APS A;  1JOC A;  3U59 A;  4RES B;  3EFG A;  1KFM A;  1FZB A;  1G2C A;  1KIL D;  2KOG A;  3A7O A;  1LT9 C;  4I1L A;  1LTS C;  2XNX A;  1FZG A;  4HYT B;  1FZC C;  5APU A;  2HPC B;  2FFD A;  2YO3 A;  1RF0 A;  3RL0 B;  1LGH B;  1ZN5 A;  1LTA C;  1FDM A;  3V4Q A;  1FJP A;  2O1K A;  1HJB A;  4WY4 C;  1J1D C;  1M1J B;  2YKQ A;  3MIW A;  4JYC A;  2GM4 A;  2OYI C;  1KZU B;  1SFC C;  2YKP A;  1NU1 K;  3HD7 C;  1N7S B;  1HVV A;  3LID A;  3HUS A;  3TNU A;  3VMY A;  1QL1 A;  1SP4 A;  1GTW A;  1AQ5 A;  2YMY A;  2CPS A;  1RE4 A;  1KFN A;  4LC1 A;  5AVR B;  2XDJ A;  1HTL C;  1JY2 O;  1HBW A;  3A3Y B;  1G1J A;  1L4A A;  3N7N A;  2OYI B;  2OYH C;  4WBA A;  1VDF A;  3V2Q A;  4DOJ A;  1T2K C;  4C7N B;  1GW4 A;  1CI6 A;  1Z56 A;  3A5T A;  1IFI A;  3RK2 C;  4XA4 A;  4AUW A;  3V2R A;  3OA7 A;  1LT9 A;  3VN0 A;  5BU5 A;  3RL0 C;  2NPS A;  5AVQ B;  1N7S D;  4DZO A;  3GHG B;  4N78 D;  1MZ9 A;  3P32 A;  3MUD A;  3OJA B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...