2Z5HA

Crystal structure of the head-to-tail junction of tropomyosin complexed with a fragment of tnt
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
49
structure length
49
Chain Sequence
b'GELLSKNYHLENEVARLKKLVDDLEDELYAQKLKYKAISEELDHALNDM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords General control protein GCN4 and Tropomyosin alpha-1 chain
publication title Structural basis for tropomyosin overlap in thin (actin) filaments and the generation of a molecular swivel by troponin-T
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Contractile protein
total genus 23
structure length 49
sequence length 49
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2007-07-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2z5hA00
4B86A 1GZLA 4GT1A 1J2JB 4C7NA 1GD2E 1OWAA 4I2LC 5APYA 3VTPC 1SP4A 2QM7A 1JUNA 2W27A 4JYBA 3T97A 4DZOA 1MFZA 2N9BA 5CMZA 1H88A 1GU4A 1GU5A 5AVZB 3TNUB 3MD0A 1A02J 3M06A 1DH3A 2E42A 2Q3IA 4JYCA 1FOSF 5AVXB 3HE5B 2XZRA 3L37A 3V4QA 2KP8A 1MV8A 1H8AA 3P7KA 1YYCA 2R5BA 2BASA 2Q5UA 1HWTC 2YO3A 2WPRA 1GK4A 2R32A 2H7HA 4GKGA 5AW1B 2P7JA 5AVVB 1CI6B 1GTWA 1HBWA 1S9KD 3TNUA 3NMDA 3UIAA 4C46A 3KQGA 5AVRB 5AVUB 1KQLA 2ZFCA 3M0DA 3L36A 5APQA 3TK1A 3VMZA 3V4WA 4AUWA 1HUCA 2JJLA 3P32A 2Z5IA 2W6AA 3HE5A 3M9HA 3OAKA 5APWA 2VRSA 5AVTB 2R3CA 2C9LY 1G2CB 5AVYB 2XV5A 2Z5HA 5AVQB 4HYTB 3VMXA 4RESB 5APXA 3IR9A 1NAFA 1HJBA 1FOSE 2IPPA 2WT7B 1CI6A 3TYYA 2YNYA 2R5DA 3O8ZA 2P67A 2YO2A 2ZXEB 5AW5B 3LIEA 5AW9B 5AW7B 5AW6B 3SWFA 1NWQA 2Q7CA 3NXSA 5AW4B 3B8EB 4I6MC 2E43A 1T2KD 1FAVA 3M91A 2XU6A 3I5CA 5AW8B 4EOTA 1CSBA 5APTA 3HE4B 1CZQA 4C7NB 1SLQA 4AYCA 5APUA 3A2AA 2WPQA 2WT7A 1GK6A 3M0AA 3A5TA 4AQRD 1JNMA 3HTKA 4XE5B 5APVA 3KDPB 3L35A 3NTNA 1OXZA 5AW3B 5AW2B 1S9KE 1IO4A 1H89A 5AW0B 3NFQA 3VN0A 3A3YB 3VYIA 1X8YA 2P2UA 5APSA 1A02F 2C9NY 3LIDA 2WPSA 4M3LA 3A7OA 4KHXA 3V5BA 3VMYA 4LC1A 5AVWB 5AVSB 3P8MC 2WWWA 1MUUA 3MGNA 1T2KC 2QM8A 2WTYA 3M9BA 3HE4A
chains in the Genus database with same CATH superfamily
1GD2E 2E75D 2NRGA 3Q2YA 4N78E 1IZNB 2LXBA 3BVHA 5BVZA 1G1JA 2FXPA 4D6TG 5AVXB 1NVOA 4H13C 1NU1J 4H44B 4UB6E 5CCHD 2OYIA 4L73A 1VQ4P 1SQPE 1NHLA 1SQVE 3RL0D 2V7QH 1HUCA 2JJLA 4H44C 3L73J 4WY4D 3M9HA 1ZV8A 2FXOA 4XA4A 2AEJA 1UIXA 1PV3A 1VQNP 2LKMA 1NU1K 5E79E 1OFCX 2YO2A 2K3RA 1R5SA 3KHUA 1QL2A 5GTHH 3KZIH 1PPJG 2IX7C 3I5CA 1VQ9P 3Q5PA 4AYCA 3BCCE 2E74D 4EIJA 2FYUE 2HPCB 2M5AA 3FXEA 2CPSA 3HTKA 4PJ0H 1OMIA 4TT3H 5AW0B 2I1KA 1NTKG 3FGAD 1OIPA 3AE1C 2KXPB 3EFFK 1NTMJ 3CX5H 2BCCD 4B86A 1J2JB 1KYOI 2W27A 3R4YA 5KLVJ 5GTIH 3GW6A 2ZVNB 1JEKA 1FOSF 3CCJP 2JWAA 3HRNA 3HE5B 3V2QA 2XZRA 1MZ9A 5B5EH 2BASA 5KAFE 3L74E 1VQLP 1NTMK 1Z56A 1BE3G 1CI6B 1RY3A 3VMZA 1ZRTD 4IFMA 2A45G 5KLVK 1OW8A 3CX5D 2KIKA 2HFED 1HJBA 1RF1A 1KORA 1IK7A 1SQBE 1LTAC 3VP8A 3H1HE 3TYYA 1EXJA 1URQB 2K9JB 2KS1A 1QGKB 1N73A 2YKQA 1KZUB 1KYOH 1LT9B 1FZBA 3IAOA 3N4XA 3BATA 1URQC 3L75E 3M0AA 1BCCG 3NTNA 2WITA 2Q3EA 1FC2C 4EI2A 3AE7C 2A06G 1U7MA 3JCUE 4LGDE 3M9QA 1JO5A 1LT9C 5KKZB 2WQYC 3WMM0 4C7NA 2MKVA 3TNUB 3Q1MA 3Q3DA 4C7RA 3CCSP 2NPSD 2W8ZA 1JY3O 1SQQE 3P8CD 1KYOD 3D70A 5KKZC 2LR2A 4EYYQ 4PD4H 1J1DB 3TGUD 4DT0A 1KV4A 3S9OA 1MFTA 1NGMB 4L75A 2E5TA 2WVRA 2E75B 2H8PD 2O01H 3H1KD 1AFOA 1EDJA 1SFCD 1VF5D 1J1DC 2AXTH 3RK2D 3O6QB 2Z5HA 5KAIH 1KTMA 1PGJA 1RE3A 3AEFC 2IPPA 2E75C 1HH0A 2Y9YA 2O3JA 1DEEG 1SQPG 1RQVA 3H1JD 2Q7CA 1SQVG 4PD4D 5KJ7A 2WSCJ 2N1TD 1U57A 3HE4B 3TF5A 1SLQA 1BSNA 5EFWB 2WT7A 3CC2P 4XE5B 1IJDB 4HH2A 1IFIA 3B5NA 3LIDA 2FKWB 3D71A 1ZR2A 1USDA 1PP9D 1Q7YQ 2W83C 2QJPB 3BCCG 1FU1A 4GODA 2E74B 2FYUG 2RMZA 1NU1D 2I8DA 4H44D 2V7QJ 2YMKA 3V4QA 1H8AA 4U3FJ 1FDOA 3MIWA 1WMKA 2KZIA 2FYZA 2BCCE 1SQXK 2QJPC 2O1KA 2E74C 3H32B 4OWFA 5KLVG 3KQGA 3L73D 2ZFCA 3SFDC 3C9IA 4RKUJ 4AUWA 2B9BA 3B71A 1IFNA 3KZIE 3AE2C 2J5UA 3VMXA 1FDIA 3L74G 3O8ZA 4H0LB 1K9MQ 3WU2H 1LWUA 1OW7A 2POHA 1EZVI 2P10A 3G9RA 1ZRTE 3CX5E 2OYOA 3CMEP 4N6JA 4DOJA 2HODB 2WPQA 1FJKA 3CD6P 2OYHA 5GTIE 4H0LC 1SQBG 1BGYD 1OXZA 1NTMD 3PH0A 2KI7B 1A02F 3C8VA 2PFXA 1N7SB 2B87A 1EDIA 5B5EE 1VQKP 2OTJP 1RHZB 1JCCA 1L2PA 1WT6A 2QE7H 3RK3C 2OGUA 2K37A 4I1LA 1LTSC 3EFGA 1P84I 2FY8A 1K73Q 3L75G 1UIIA 3GF7A 1KC8Q 2P58A 1N7SC 2KSJA 1L4AA 1Q90D 1M90Q 4NPEA 1N8RQ 2WPRA 2P1JA 2BEQD 3JC22 2ZYDA 2FBWC 3QWOC 5APQA 3P32A 1ZXGA 4GIFA 3P8CE 2NPSB 1SQQG 1G2CB 3IF4A 4W7YA 2H89C 5APXA 1T6AA 3A0BH 3KXDA 1URQD 2WSSH 1USEA 3TGUJ 2IBZD 3A0HH 2Q1KA 5AW5B 1AJYA 4YXDC 2NPSC 1KB9I 1FE6A 2E43A 3H1KJ 1VF5B 1M1KQ 3HD7B 4NPDA 5BU5A 1X9VA 1JNMA 3I56P 2OTKE 2Y0DA 3KDPB 1SS1A 4R4LA 3F89A 3H1JE 4HB1A 2WWWA 4PD4E 1OVRA 1VF5C 3HD7C 3BRTB 5CCGC 2JEEA 4UB8H 4DZOA 1J1EC 1JTHB 1N2DC 1GW4A 4O9BA 3PTZA 2AXTE 3H6PA 2KZJA 2WSCH 1RE4A 5KAIE 1XTCC 3AE4C 3RGUA 1YJNP 1ZP0C 1GTWA 2E5YA 3KPEA 1OW6A 3ZDMA 4BXLA 2QJYB 1PP9J 3G6EP 3M0DA 2W90A 2YXRB 2PGDA 1ZMEC 1NU1E 2W6AA 1IFJA 1FZCB 3MHVA 5KLIB 1QVFO 4L74A 2KUBA 2Q6QA 2BCCG 1YBKA 2CPBA 1JY3N 2QJYC 1HJ0A 3L73E 3FXDA 1FZCC 4ZNCA 5KLIC 4K3AA 3CCRP 1PGOA 2IYOA 1QL1A 1M57D 3A2AA 1YTZI 4KJMA 1DX7A 4W80A 1SQXD 3GMAA 3NFQA 1IK9A 1FZAA 2WPSA 1QVGO 4RJTA 2C0WA 2QIWA 1KILB 1JUNA 5CMZA 2KNCA 3GHGB 5TISH 2FFDA 1GU5A 1JCDA 1L0NK 1PFIA 3H25A 1NTZJ 3PLNA 4U3FD 4IL6H 1NTME 1BGYJ 1KILC 4LLHA 1HWTC 2YO3A 2GA1A 2WZ7A 3L4FA 3GHGC 5KLVE 5AVVB 3CXHE 3WU2E 5AVUB 3CCMP 4OVNF 4MN4C 2HR3A 1L0LJ 1LTJA 3O6QA 5AVTB 1NTZK 4QMAA 2L91A 2R3SA 2O1JA 2YIUB 1AVYA 5CCHA 2Q9IA 4H0LD 1AA0A 3S4RA 3L70J 2P67A 3D6ZA 4N3YB 1U7JA 1YTZT 1AQTA 3E1RA 3CCVP 2YIUC 2Z4EA 1L0LK 4WY4A 5TJHA 2K88A 1CZQA 3AECC 3FWNA 3RK3D 1PL5A 1M56D 2JP3A 5DJTB 1PPJD 3RBXA 1VQ8P 2IBZE 1S9KE 1N7SD 3EWKA 3OW2O 2IYPA 3A7OA 1KQGB 2OYIB 3CMAP 3MTUE 2M8RA 4I2LC 2OQQA 3GLMA 1Y47A 4WB4A 3MD0A 1JY2O 2OTLP 3SWYA 1YJ9P 2QSIA 2OYIC 1FBMA 3AE5C 1HF9A 3H1JG 3L71J 3LW5J 3MZWB 1ZOYC 4BRYA 3WUUA 2O01N 4IL6X 3B4SA 2GUSA 2XNDH 2ZT9C 5APWA 2C9LY 2PRRA 1RQUA 2DW3A 2M5AB 2KSEA 3HTKB 5CBOA 1LNQA 3VMAA 5B66H 3CWBJ 3HD7D 3Q5RA 1NU1G 3AE9C 3V2RA 5CCGD 5APTA 4UB8E 4YPCA 1S2EA 4ZKUA 5K5GB 1RH5B 4HKZH 1K04A 1OVVA 2E76D 3V2NA 3VN0A 1JY3P 2P2UA 1FDMA 3L73G 4LC1A 1LP1A 4BWNA 1T2KC 2H88C 3PHLA 2YMYA 3HUSA 4OGQB 3VTPC 2JR8A 3T97A 2C0XA 1A02J 2I1JA 2BEZF 2JDIH 1SQXE 1M1JA 1AV1A 3H1LJ 1SQXJ 2WSEJ 5H2FH 1H0TB 4OGQC 4UB6H 1RF1B 5CJ4A 1JB0J 1YIJP 3MP7B 3SSUA 3NMDA 4U7JA 1RF0A 2KS1B 5C39A 1N73B 1EDKA 3CCUP 4U3FE 3OAKA 2VRSA 3ABVC 1NTMG 1RF1C 3H1ID 3L72D 5E79H 2R44A 2R5DA 1L4AD 1N73C 4D6TJ 2IZ0A 5GTHE 1IC2A 1L0ND 1KQSO 1SFCA 4EOTA 4C7NB 2IDBA 5TISE 3C1LA 1VQPP 4PJ0E 1QX8A 1W2BO 1G1IA 1GL2A 1JMMA 2QJKB 1KILD 1KFNA 2N1TA 4R4MA 1S3JA 5KTBA 1NTZD 3RK3B 1W2EA 1JM0A 3IFMA 2GM4A 2ITAA 1QLED 5L8RJ 3CPWO 2QJKC 2IBZG 1ZN5A 4IOIH 1GMJA 3BCCD 3F5HA 2FYUD 4ASVA 1L0LD 2G8YA 1NTKJ 2WSFH 1S5LH 3R2PA 2UWJE 1CW5A 3VP9A 1ZLLA 2PAJA 5AVYB 4GOFA 3L70D 1RE3C 5M1BA 1NJIQ 2ZVOB 4EDFA 2WT7B 1Q81Q 5CJ0A 2RKLA 4W7ZA 2W6JH 3B5NB 5KJ7C 3GG2A 3L74D 1KYOE 1NTKK 3N7NA 2K9YA 2LXCB 1Q2NA 3LW5H 3TGUE 3VOPA 1N7LA 1M8OB 1KMIZ 3B5NC 3G3ZA 3G4SP 4JF7A 3JCUH 3H1KE 3QH9A 1EC5A 4WBAA 1E5WA 1BSHA 1AQ5A 1OWAA 3H1HD 3Q5SA 1P84H 1EZVD 2HPCA 4WWIA 2CK3H 1K8AQ 1J1EB 2ZT9D 2RN0A 2E76B 4GOEA 3L71D 4DCKA 1JMBA 3E7KA 1IFPA 3IN6A 3L75D 2FXMA 5AW1B 3AEEC 1YJWP 2KB7P 1FS0E 1LWUB 5B66E 2JKVA 2H43A 1TU3F 2E76C 3HE5A 2AEFA 2R3CA 1SQXG 1P84D 1LJ2A 2QEXP 2GUVA 1FOSE 1KD1Q 2OYHB 1CI6A 1D7MA 2NZ2A 3FWLA 2YNYA 1LWUC 1SQQD 1PP9E 1JY2N 1KB9H 5AW7B 5AW6B 3SWFA 1S5LX 3CWBD 3NXSA 4JQ0D 3MUDC 5AW4B 2HLOA 2SPZA 3GF3A 2B87B 1T2KD 4K35A 5CHXA 2WSEH 3M91A 2KOGA 3CLQA 4U3FG 2OYHC 1VQ5P 2JWDA 1DEBA 4AQRD 3H1IE 2WMMA 3L72E 1URQA 1EDLA 3CCLP 2J58A 2K9JA 3H1IJ 3L72J 1IO4A 3OA7A 2YXQB 3OJAB 1FZFA 1L4AB 3V5BA 3VMYA 3P8MC 5H2FE 4OGQD 2WTYA 1LT9A 1HVVA 1L0NE 3CX5I 4IFFA 1SP4A 1L0NJ 1KB9D 3TSIA 2OARA 1DH3A 1SQPJ 1X79B 3H1LD 1SQVJ 1L4AC 2W6BA 2KP8A 1PZQA 2L5GB 1KILE 3SWKA 4A7PA 4YTPC 1WRGA 3TNUA 4JBZA 1VPCA 1NTZE 3CCQP 2ZXXA 3V4WA 3W67A 1BGYE 2IZ1A 4KT0J 1T3JA 1SQPK 3WUVA 1SQVK 1BDDA 5AVQB 1GDTA 1ZW0A 3CC7P 1IFDA 3BCCJ 3ITKA 1IFMA 4D6TD 2FYUJ 1L0LE 4ASWA 4Y99B 1NWQA 1E79H 3II6A 4I6MC 2A45I 2G3AA 1FAVA 2XU6A 1X0TA 3CC4P 3U1AA 3L70E 1SVFA 2V4HA 4Y99C 2KK7A 1YI2P 5APSA 4IFDK 2FYUK 4M3LA 4KHXA 1Y8AA 2FYNB 3HE4A 1GZLA 4YXWH 3L74J 1M7LA 5APYA 1MFZA 4DJGA 1VQOP 4PV1B 1GU4A 3CCEP 3TGUG 1S5LE 2K1AA 2WSFJ 1RE4C 2FYNC 3P7KA 1XTGB 1YYCA 2Q5UA 1H0TA 3H1KG 4PV1C 4PD4I 1Y9BA 1HBWA 1NTKD 2KLUA 1SQBJ 1EZVE 3M0DC 1S1CX 3H1HJ 2A45H 1YQ3C 1EXIA 5KJ7D 4ZMDA 2Z5IA 2Y0CA 2AXCA 2ZT9B 3L71E 3A0BE 1NAFA 2XKMA 3H32A 3A0HE 3AE6C 3AEGC 3L75J 3B5ND 3KYQA 5AW9B 3LIEA 2IFMA 1HGZA 3WUTA 3RL0g 1ZR4A 1SQBK 3B8EB 3AEAC 1BE3D 3W68A 1P84E 1NYHA 2KNCB 4CPGA 2FFDB 4OH8B 1DIPA 1S72P 1EQ7A 3I55P 2D2CB 1PP9G 1X8YA 1JY2P 2C9NY 1SQQJ 3CWBE 1DD3A 1FJPA 5AVRB 4GT1A 4Y28J 2FFDC 1NOHA 2HODA 1H88A 1HTLC 5AVZB 1PGPA 2D2CC 3BRVB 2Q3IA 1FZGA 3H1IG 3L72G 1LTGC 3K5BA 1K05A 1LTJB 1N7SA 2B89A 2R5BA 4RO0A 1LTBC 1SQQK 1AVOA 1BCCD 2XNXA 1L0NG 2A06D 1PGQA 2AEMA 1GL2D 1KB9E 4C46A 3TK1A 1LTJC 1LGHB 4HJGH 1OZHA 3H1LE 3RL0B 4WVZA 4WY4B 4RESB 5CCHC 1MKMA 2YKOA 1KN7A 1KQFB 4H13D 1NTZG 1NKNA 3CXHI 3RL0C 2QA4P 2NPSA 2YKPA 4WY4C 1G2CA 1BGYG 2XDJA 1CSBA 4N78D 1Q86Q 2QRXA 4ZKPA 4I7ZB 2QVAA 2ZYAA 3A5TA 1BDCA 2M0BA 2MJZA 2QG4A 3L35A 4D6TE 1Q82Q 2N9YB 1LTTC 1L0LG 1QEXA 2Y0EA 3MGNA 4JPZB 1VQ7P 2ZAEB 3RBZA 3M9BA 4I7ZC 5BU8B 3HD7A 5CCGA 4JYBA 5CBNA 3E1IA 2BCCJ 1SQPD 1LT1A 2M3BA 4BRYB 1SQVD 3L70G 4IL6E 1YITP 2IBZI 1MV8A 2H7HA 4GKGA 1VL2A 3RK3E 2Y9ZA 3AEDC 2IFNA 3CXHH 3UIAA 1JTHA 3AE8C 1PPJE 2ZYGA 3MUDA 3TDKA 3PJSK 2XV5A 4HYTB 3JSVC 5KAFH 1X22A 3AE3C 3SFEC 1NAYA 1W5CE 1T8ZA 1NTKE 3H1HG 1EZVG 3BASA 1LP1B 1FZCA 2JO1A 5KLVD 1R5LA 1T3UA 1NH4A 3HUSB 1KFMA 3CXHD 3L71G 3T97B 4GDOA 3CI9A 1N86A 1H89A 3VYIA 1LTIC 2HG5D 3U59A 1M1JB 3V6IA 4Z1MH 1OVUA 3HUSC 1BE3E 4PV1D 2QM7A 3S1KA 1BE3J 1PIXA 2N9BA 4L76A 1HGVA 3M06A 3USSA 2E42A 2KYVA 2M3EA 1S4XA 4JYCA 5DJUB 1M1JC 3CL3D 2RH0A 3L37A 3CWBG 1KILA 3V2PA 1SQBD 1GK4A 1NO4A 2R32A 1YQ4C 1YHQP 3AEBC 2P7JA 2ZJSE 3GHGA 1S9KD 1RF0C 2J59M 2HYNA 1KQLA 1R8EA 3L36A 2PP6A 4TLFA 3EQ2A 1SFCB 1VQ6P 2KLVA 2B88A 3D6YA 3IR9A 3RK2B 1BCCE 4XFJA 1BCCJ 2A06E 2ZXEB 3PP5A 1VDFA 2WPVB 1GL2B 1NKZB 3U1CA 1GW3A 1SFCC 1DD4A 3H1JJ 3H1LG 5AW8B 3RK2C 2N1TB 1OX3A 5APUA 3PRJA 1GK6A 2D2CD 5APVA 1VQMP 2O01J 5AW3B 1GL2C 5AW2B 3A3YB 1JOCA 1FZEA 4NPFX 5AVWB 5AVSB 1MUUA 3FX0A 4H13B 3G71P 2QM8A 2N1TC
chains in the Genus database with same CATH topology
1GZLA 2YMYA 1GD2E 1WT6A 3HUSA 5APYA 1M7LA 3VTPC 3RK3C 3T97A 4N78E 1MFZA 1GU4A 4I1LA 2C0XA 1A02J 1LTSC 3EFGA 2I1JA 3BVHA 5BVZA 1G1JA 1N7SC 5AVXB 2KSJA 1L4AA 1M1JA 1RE4C 3P7KA 1XTGB 1YYCA 2Q5UA 2OYIA 5CCHD 2WPRA 1RF1B 5CJ4A 2P1JA 1HBWA 3NMDA 3M0DC 1RF0A 1NHLA 2A45H 3RL0D 5APQA 1N73B 1HUCA 2JJLA 3P32A 5KJ7D 2Z5IA 4GIFA 4WY4D 3P8CE 3M9HA 2NPSB 3OAKA 1ZV8A 4XA4A 2VRSA 1G2CB 2LKMA 4W7YA 1RF1C 5APXA 1NAFA 1NU1K 1URQD 2XKMA 3H32A 1JCCA 2R5DA 3B5ND 3KYQA 2YO2A 5AW5B 5AW9B 3LIEA 1L4AD 1N73C 2IFMA 1HGZA 1ZR4A 1SQBK 2NPSC 3B8EB 1QL2A 2E43A 1IC2A 2IX7C 1SFCA 3I5CA 4EOTA 4C7NB 3HD7B 4AYCA 4EIJA 2HPCB 2FFDB 5BU5A 1X9VA 2CPSA 4OH8B 1JNMA 3HTKA 3KDPB 1EQ7A 1G1IA 5AW0B 1X8YA 2I1KA 1GL2A 1JMMA 1JY2P 2C9NY 1KILD 1KFNA 2WWWA 3HD7C 3BRTB 1FJPA 5AVRB 4B86A 5CCGC 4GT1A 1J2JB 2N1TA 2JEEA 2W27A 2FFDC 4DZOA 1NOHA 2HODA 5KTBA 1H88A 1HTLC 5AVZB 3RK3B 1W2EA 3IFMA 1J1EC 1JTHB 3BRVB 2GM4A 2Q3IA 1FZGA 1LTGC 1N2DC 1FOSF 1GW4A 4O9BA 1LTJB 1N7SA 3HE5B 3HRNA 3V2QA 2XZRA 1MZ9A 1ZN5A 3H6PA 2WSCH 1RE4A 1XTCC 2R5BA 2BASA 1LTBC 1SQQK 2XNXA 1NTMK 1Z56A 1CI6B 1GTWA 3KPEA 1GL2D 1RY3A 4C46A 3M0DA 3TK1A 3VMZA 2WSFH 1LTJC 4IFMA 2A45G 5KLVK 1LGHB 2W6AA 3R2PA 1IFJA 1CW5A 3RL0B 3VP9A 1ZLLA 2PAJA 5AVYB 1FZCB 4WY4B 1RE3C 4RESB 2HFED 5CCHC 1HJBA 1RF1A 2WT7B 2YKOA 1LTAC 5CJ0A 3VP8A 3TYYA 1URQB 2CPBA 1JY3N 4W7ZA 1N73A 3B5NB 2YKQA 1NKNA 3RL0C 1KZUB 5KJ7C 2NPSA 1FZCC 2YKPA 4WY4C 1G2CA 1NTKK 2XDJA 3N7NA 1CSBA 1LT9B 1QL1A 1FZBA 4N78D 4ZKPA 3N4XA 3LW5H 3A2AA 3BATA 3VOPA 1URQC 3M0AA 3A5TA 1YTZI 3HE4A 1N7LA 2MJZA 1DX7A 3L35A 3NTNA 2WITA 4W80A 3B5NC 3G3ZA 3NFQA 1LTTC 1IK9A 1FZAA 4JF7A 4LGDE 2WPSA 3M9QA 3MGNA 1JO5A 1LT9C 4WBAA 2C0WA 3M9BA 3WMM0 1E5WA 5BU8B 1KILB 4C7NA 1AQ5A 3HD7A 1OWAA 5CCGA 1JUNA 4JYBA 3E1IA 5CMZA 2HPCA 2M3BA 3GHGB 2FFDA 1GU5A 3TNUB 1JCDA 4C7RA 1L0NK 1PFIA 2NPSD 1J1EB 1JY3O 3P8CD 1MV8A 1KILC 4LLHA 1HWTC 1J1DB 2YO3A 2WZ7A 3L4FA 2FXMA 3GHGC 2H7HA 4GKGA 5AW1B 5AVVB 2IFNA 2KB7P 2H8PD 3UIAA 1JTHA 5AVUB 1LWUB 2O01H 2H43A 1AFOA 3MUDA 1LTJA 1SFCD 3HE5A 5AVTB 2R3CA 1NTZK 1J1DC 3RK2D 2XV5A 2O1JA 2Z5HA 4HYTB 2GUVA 1FOSE 1RE3A 5CCHA 2Q9IA 2IPPA 2OYHB 1CI6A 2YNYA 1LWUC 1JY2N 2P67A 1T8ZA 4N3YB 1HH0A 5AW7B 5AW6B 3SWFA 2Q7CA 3NXSA 1YTZT 5AW4B 2HLOA 3BASA 1T2KD 5KJ7A 2Z4EA 5CHXA 1L0LK 1FZCA 2N1TD 2WSEH 3M91A 4WY4A 2KOGA 3CLQA 3HE4B 1CZQA 1T3UA 1SLQA 3RK3D 1NH4A 3HUSB 1KFMA 2OYHC 2WT7A 1DEBA 3CI9A 4AQRD 4XE5B 1URQA 1IJDB 4HH2A 2J58A 1N86A 1IFIA 1S9KE 1N7SD 1H89A 3OA7A 1IO4A 3B5NA 3OJAB 3VYIA 1FZFA 1LTIC 3LIDA 1L4AB 2HG5D 3U59A 3V5BA 3A7OA 3VMYA 1M1JB 2FKWB 3P8MC 2WTYA 1ZR2A 1LT9A 2OYIB 1HVVA 3HUSC 3MTUE 2M8RA 4I2LC 4IFFA 1SP4A 2QM7A 2N9BA 1HGVA 3TSIA 4WB4A 1FU1A 3MD0A 3M06A 2OARA 1DH3A 2E42A 1X79B 2KYVA 4JYCA 1L4AC 1JY2O 1M1JC 3SWYA 3CL3D 2W6BA 3L37A 3V4QA 2KP8A 1H8AA 2OYIC 1FBMA 2L5GB 3MIWA 1KILA 3V2PA 2FYZA 1SQXK 1GK4A 1NO4A 2R32A 2O1KA 2P7JA 3GHGA 1WRGA 3H32B 1RF0C 3TNUA 1S9KD 2J59M 2HYNA 1VPCA 3KQGA 1KQLA 2ZFCA 3L36A 3C9IA 2PP6A 3V4WA 4AUWA 3EQ2A 2GUSA 1IFNA 1T3JA 5APWA 1SQPK 2C9LY 1SQVK 1SFCB 5AVQB 1GDTA 3VMXA 2KLVA 3IR9A 3RK2B 1IFDA 1IFMA 3HTKB 3O8ZA 2ZXEB 3PP5A 1LWUA 4Y99B 1NWQA 1VDFA 1GL2B 3II6A 2POHA 1NKZB 3U1CA 1GW3A 4I6MC 2A45I 1SFCC 3HD7D 1FAVA 2XU6A 5AW8B 3V2RA 5CCGD 3RK2C 5APTA 3U1AA 2N1TB 4N6JA 4ZKUA 5APUA 4DOJA 2HODB 2WPQA 1FJKA 1GK6A 2OYHA 1SVFA 5APVA 4Y99C 1OXZA 5AW3B 1GL2C 5AW2B 3V2NA 3VN0A 3A3YB 1JY3P 2P2UA 5APSA 1A02F 4IFDK 2FYUK 1JOCA 1FZEA 1N7SB 1FDMA 4M3LA 4KHXA 4LC1A 5AVWB 5AVSB 1MUUA 1T2KC 2QM8A 2N1TC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B86 A;  1GZL A;  4GT1 A;  1J2J B;  4C7N A;  1GD2 E;  1OWA A;  4I2L C;  5APY A;  3VTP C;  1SP4 A;  2QM7 A;  1JUN A;  2W27 A;  4JYB A;  3T97 A;  4DZO A;  1MFZ A;  2N9B A;  5CMZ A;  1H88 A;  1GU4 A;  1GU5 A;  5AVZ B;  3TNU B;  3MD0 A;  1A02 J;  3M06 A;  1DH3 A;  2E42 A;  2Q3I A;  4JYC A;  1FOS F;  5AVX B;  3HE5 B;  2XZR A;  3L37 A;  3V4Q A;  2KP8 A;  1MV8 A;  1H8A A;  3P7K A;  1YYC A;  2R5B A;  2BAS A;  2Q5U A;  1HWT C;  2YO3 A;  2WPR A;  1GK4 A;  2R32 A;  2H7H A;  4GKG A;  5AW1 B;  2P7J A;  5AVV B;  1CI6 B;  1GTW A;  1HBW A;  1S9K D;  3TNU A;  3NMD A;  3UIA A;  4C46 A;  3KQG A;  5AVR B;  5AVU B;  1KQL A;  2ZFC A;  3M0D A;  3L36 A;  5APQ A;  3TK1 A;  3VMZ A;  3V4W A;  4AUW A;  1HUC A;  2JJL A;  3P32 A;  2Z5I A;  2W6A A;  3HE5 A;  3M9H A;  3OAK A;  5APW A;  2VRS A;  5AVT B;  2R3C A;  2C9L Y;  1G2C B;  5AVY B;  2XV5 A;  2Z5H A;  5AVQ B;  4HYT B;  3VMX A;  4RES B;  5APX A;  3IR9 A;  1NAF A;  1HJB A;  1FOS E;  2IPP A;  2WT7 B;  1CI6 A;  3TYY A;  2YNY A;  2R5D A;  3O8Z A;  2P67 A;  2YO2 A;  2ZXE B;  5AW5 B;  3LIE A;  5AW9 B;  5AW7 B;  5AW6 B;  3SWF A;  1NWQ A;  2Q7C A;  3NXS A;  5AW4 B;  3B8E B;  4I6M C;  2E43 A;  1T2K D;  1FAV A;  3M91 A;  2XU6 A;  3I5C A;  5AW8 B;  4EOT A;  1CSB A;  5APT A;  3HE4 B;  1CZQ A;  4C7N B;  1SLQ A;  4AYC A;  5APU A;  3A2A A;  2WPQ A;  2WT7 A;  1GK6 A;  3M0A A;  3A5T A;  4AQR D;  1JNM A;  3HTK A;  4XE5 B;  5APV A;  3KDP B;  3L35 A;  3NTN A;  1OXZ A;  5AW3 B;  5AW2 B;  1S9K E;  1IO4 A;  1H89 A;  5AW0 B;  3NFQ A;  3VN0 A;  3A3Y B;  3VYI A;  1X8Y A;  2P2U A;  5APS A;  1A02 F;  2C9N Y;  3LID A;  2WPS A;  4M3L A;  3A7O A;  4KHX A;  3V5B A;  3VMY A;  4LC1 A;  5AVW B;  5AVS B;  3P8M C;  2WWW A;  1MUU A;  3MGN A;  1T2K C;  2QM8 A;  2WTY A;  3M9B A;  3HE4 A; 
#chains in the Genus database with same CATH topology
 1GD2 E;  2E75 D;  2NRG A;  3Q2Y A;  4N78 E;  1IZN B;  2LXB A;  3BVH A;  5BVZ A;  1G1J A;  2FXP A;  4D6T G;  5AVX B;  1NVO A;  4H13 C;  1NU1 J;  4H44 B;  4UB6 E;  5CCH D;  2OYI A;  4L73 A;  1VQ4 P;  1SQP E;  1NHL A;  1SQV E;  3RL0 D;  2V7Q H;  1HUC A;  2JJL A;  4H44 C;  3L73 J;  4WY4 D;  3M9H A;  1ZV8 A;  2FXO A;  4XA4 A;  2AEJ A;  1UIX A;  1PV3 A;  1VQN P;  2LKM A;  1NU1 K;  5E79 E;  1OFC X;  2YO2 A;  2K3R A;  1R5S A;  3KHU A;  1QL2 A;  5GTH H;  3KZI H;  1PPJ G;  2IX7 C;  3I5C A;  1VQ9 P;  3Q5P A;  4AYC A;  3BCC E;  2E74 D;  4EIJ A;  2FYU E;  2HPC B;  2M5A A;  3FXE A;  2CPS A;  3HTK A;  4PJ0 H;  1OMI A;  4TT3 H;  5AW0 B;  2I1K A;  1NTK G;  3FGA D;  1OIP A;  3AE1 C;  2KXP B;  3EFF K;  1NTM J;  3CX5 H;  2BCC D;  4B86 A;  1J2J B;  1KYO I;  2W27 A;  3R4Y A;  5KLV J;  5GTI H;  3GW6 A;  2ZVN B;  1JEK A;  1FOS F;  3CCJ P;  2JWA A;  3HRN A;  3HE5 B;  3V2Q A;  2XZR A;  1MZ9 A;  5B5E H;  2BAS A;  5KAF E;  3L74 E;  1VQL P;  1NTM K;  1Z56 A;  1BE3 G;  1CI6 B;  1RY3 A;  3VMZ A;  1ZRT D;  4IFM A;  2A45 G;  5KLV K;  1OW8 A;  3CX5 D;  2KIK A;  2HFE D;  1HJB A;  1RF1 A;  1KOR A;  1IK7 A;  1SQB E;  1LTA C;  3VP8 A;  3H1H E;  3TYY A;  1EXJ A;  1URQ B;  2K9J B;  2KS1 A;  1QGK B;  1N73 A;  2YKQ A;  1KZU B;  1KYO H;  1LT9 B;  1FZB A;  3IAO A;  3N4X A;  3BAT A;  1URQ C;  3L75 E;  3M0A A;  1BCC G;  3NTN A;  2WIT A;  2Q3E A;  1FC2 C;  4EI2 A;  3AE7 C;  2A06 G;  1U7M A;  3JCU E;  4LGD E;  3M9Q A;  1JO5 A;  1LT9 C;  5KKZ B;  2WQY C;  3WMM 0;  4C7N A;  2MKV A;  3TNU B;  3Q1M A;  3Q3D A;  4C7R A;  3CCS P;  2NPS D;  2W8Z A;  1JY3 O;  1SQQ E;  3P8C D;  1KYO D;  3D70 A;  5KKZ C;  2LR2 A;  4EYY Q;  4PD4 H;  1J1D B;  3TGU D;  4DT0 A;  1KV4 A;  3S9O A;  1MFT A;  1NGM B;  4L75 A;  2E5T A;  2WVR A;  2E75 B;  2H8P D;  2O01 H;  3H1K D;  1AFO A;  1EDJ A;  1SFC D;  1VF5 D;  1J1D C;  2AXT H;  3RK2 D;  3O6Q B;  2Z5H A;  5KAI H;  1KTM A;  1PGJ A;  1RE3 A;  3AEF C;  2IPP A;  2E75 C;  1HH0 A;  2Y9Y A;  2O3J A;  1DEE G;  1SQP G;  1RQV A;  3H1J D;  2Q7C A;  1SQV G;  4PD4 D;  5KJ7 A;  2WSC J;  2N1T D;  1U57 A;  3HE4 B;  3TF5 A;  1SLQ A;  1BSN A;  5EFW B;  2WT7 A;  3CC2 P;  4XE5 B;  1IJD B;  4HH2 A;  1IFI A;  3B5N A;  3LID A;  2FKW B;  3D71 A;  1ZR2 A;  1USD A;  1PP9 D;  1Q7Y Q;  2W83 C;  2QJP B;  3BCC G;  1FU1 A;  4GOD A;  2E74 B;  2FYU G;  2RMZ A;  1NU1 D;  2I8D A;  4H44 D;  2V7Q J;  2YMK A;  3V4Q A;  1H8A A;  4U3F J;  1FDO A;  3MIW A;  1WMK A;  2KZI A;  2FYZ A;  2BCC E;  1SQX K;  2QJP C;  2O1K A;  2E74 C;  3H32 B;  4OWF A;  5KLV G;  3KQG A;  3L73 D;  2ZFC A;  3SFD C;  3C9I A;  4RKU J;  4AUW A;  2B9B A;  3B71 A;  1IFN A;  3KZI E;  3AE2 C;  2J5U A;  3VMX A;  1FDI A;  3L74 G;  3O8Z A;  4H0L B;  1K9M Q;  3WU2 H;  1LWU A;  1OW7 A;  2POH A;  1EZV I;  2P10 A;  3G9R A;  1ZRT E;  3CX5 E;  2OYO A;  3CME P;  4N6J A;  4DOJ A;  2HOD B;  2WPQ A;  1FJK A;  3CD6 P;  2OYH A;  5GTI E;  4H0L C;  1SQB G;  1BGY D;  1OXZ A;  1NTM D;  3PH0 A;  2KI7 B;  1A02 F;  3C8V A;  2PFX A;  1N7S B;  2B87 A;  1EDI A;  5B5E E;  1VQK P;  2OTJ P;  1RHZ B;  1JCC A;  1L2P A;  1WT6 A;  2QE7 H;  3RK3 C;  2OGU A;  2K37 A;  4I1L A;  1LTS C;  3EFG A;  1P84 I;  2FY8 A;  1K73 Q;  3L75 G;  1UII A;  3GF7 A;  1KC8 Q;  2P58 A;  1N7S C;  2KSJ A;  1L4A A;  1Q90 D;  1M90 Q;  4NPE A;  1N8R Q;  2WPR A;  2P1J A;  2BEQ D;  3JC2 2;  2ZYD A;  2FBW C;  3QWO C;  5APQ A;  3P32 A;  1ZXG A;  4GIF A;  3P8C E;  2NPS B;  1SQQ G;  1G2C B;  3IF4 A;  4W7Y A;  2H89 C;  5APX A;  1T6A A;  3A0B H;  3KXD A;  1URQ D;  2WSS H;  1USE A;  3TGU J;  2IBZ D;  3A0H H;  2Q1K A;  5AW5 B;  1AJY A;  4YXD C;  2NPS C;  1KB9 I;  1FE6 A;  2E43 A;  3H1K J;  1VF5 B;  1M1K Q;  3HD7 B;  4NPD A;  5BU5 A;  1X9V A;  1JNM A;  3I56 P;  2OTK E;  2Y0D A;  3KDP B;  1SS1 A;  4R4L A;  3F89 A;  3H1J E;  4HB1 A;  2WWW A;  4PD4 E;  1OVR A;  1VF5 C;  3HD7 C;  3BRT B;  5CCG C;  2JEE A;  4UB8 H;  4DZO A;  1J1E C;  1JTH B;  1N2D C;  1GW4 A;  4O9B A;  3PTZ A;  2AXT E;  3H6P A;  2KZJ A;  2WSC H;  1RE4 A;  5KAI E;  1XTC C;  3AE4 C;  3RGU A;  1YJN P;  1ZP0 C;  1GTW A;  2E5Y A;  3KPE A;  1OW6 A;  3ZDM A;  4BXL A;  2QJY B;  1PP9 J;  3G6E P;  3M0D A;  2W90 A;  2YXR B;  2PGD A;  1ZME C;  1NU1 E;  2W6A A;  1IFJ A;  1FZC B;  3MHV A;  5KLI B;  1QVF O;  4L74 A;  2KUB A;  2Q6Q A;  2BCC G;  1YBK A;  2CPB A;  1JY3 N;  2QJY C;  1HJ0 A;  3L73 E;  3FXD A;  1FZC C;  4ZNC A;  5KLI C;  4K3A A;  3CCR P;  1PGO A;  2IYO A;  1QL1 A;  1M57 D;  3A2A A;  1YTZ I;  4KJM A;  1DX7 A;  4W80 A;  1SQX D;  3GMA A;  3NFQ A;  1IK9 A;  1FZA A;  2WPS A;  1QVG O;  4RJT A;  2C0W A;  2QIW A;  1KIL B;  1JUN A;  5CMZ A;  2KNC A;  3GHG B;  5TIS H;  2FFD A;  1GU5 A;  1JCD A;  1L0N K;  1PFI A;  3H25 A;  1NTZ J;  3PLN A;  4U3F D;  4IL6 H;  1NTM E;  1BGY J;  1KIL C;  4LLH A;  1HWT C;  2YO3 A;  2GA1 A;  2WZ7 A;  3L4F A;  3GHG C;  5KLV E;  5AVV B;  3CXH E;  3WU2 E;  5AVU B;  3CCM P;  4OVN F;  4MN4 C;  2HR3 A;  1L0L J;  1LTJ A;  3O6Q A;  5AVT B;  1NTZ K;  4QMA A;  2L91 A;  2R3S A;  2O1J A;  2YIU B;  1AVY A;  5CCH A;  2Q9I A;  4H0L D;  1AA0 A;  3S4R A;  3L70 J;  2P67 A;  3D6Z A;  4N3Y B;  1U7J A;  1YTZ T;  1AQT A;  3E1R A;  3CCV P;  2YIU C;  2Z4E A;  1L0L K;  4WY4 A;  5TJH A;  2K88 A;  1CZQ A;  3AEC C;  3FWN A;  3RK3 D;  1PL5 A;  1M56 D;  2JP3 A;  5DJT B;  1PPJ D;  3RBX A;  1VQ8 P;  2IBZ E;  1S9K E;  1N7S D;  3EWK A;  3OW2 O;  2IYP A;  3A7O A;  1KQG B;  2OYI B;  3CMA P;  3MTU E;  2M8R A;  4I2L C;  2OQQ A;  3GLM A;  1Y47 A;  4WB4 A;  3MD0 A;  1JY2 O;  2OTL P;  3SWY A;  1YJ9 P;  2QSI A;  2OYI C;  1FBM A;  3AE5 C;  1HF9 A;  3H1J G;  3L71 J;  3LW5 J;  3MZW B;  1ZOY C;  4BRY A;  3WUU A;  2O01 N;  4IL6 X;  3B4S A;  2GUS A;  2XND H;  2ZT9 C;  5APW A;  2C9L Y;  2PRR A;  1RQU A;  2DW3 A;  2M5A B;  2KSE A;  3HTK B;  5CBO A;  1LNQ A;  3VMA A;  5B66 H;  3CWB J;  3HD7 D;  3Q5R A;  1NU1 G;  3AE9 C;  3V2R A;  5CCG D;  5APT A;  4UB8 E;  4YPC A;  1S2E A;  4ZKU A;  5K5G B;  1RH5 B;  4HKZ H;  1K04 A;  1OVV A;  2E76 D;  3V2N A;  3VN0 A;  1JY3 P;  2P2U A;  1FDM A;  3L73 G;  4LC1 A;  1LP1 A;  4BWN A;  1T2K C;  2H88 C;  3PHL A;  2YMY A;  3HUS A;  4OGQ B;  3VTP C;  2JR8 A;  3T97 A;  2C0X A;  1A02 J;  2I1J A;  2BEZ F;  2JDI H;  1SQX E;  1M1J A;  1AV1 A;  3H1L J;  1SQX J;  2WSE J;  5H2F H;  1H0T B;  4OGQ C;  4UB6 H;  1RF1 B;  5CJ4 A;  1JB0 J;  1YIJ P;  3MP7 B;  3SSU A;  3NMD A;  4U7J A;  1RF0 A;  2KS1 B;  5C39 A;  1N73 B;  1EDK A;  3CCU P;  4U3F E;  3OAK A;  2VRS A;  3ABV C;  1NTM G;  1RF1 C;  3H1I D;  3L72 D;  5E79 H;  2R44 A;  2R5D A;  1L4A D;  1N73 C;  4D6T J;  2IZ0 A;  5GTH E;  1IC2 A;  1L0N D;  1KQS O;  1SFC A;  4EOT A;  4C7N B;  2IDB A;  5TIS E;  3C1L A;  1VQP P;  4PJ0 E;  1QX8 A;  1W2B O;  1G1I A;  1GL2 A;  1JMM A;  2QJK B;  1KIL D;  1KFN A;  2N1T A;  4R4M A;  1S3J A;  5KTB A;  1NTZ D;  3RK3 B;  1W2E A;  1JM0 A;  3IFM A;  2GM4 A;  2ITA A;  1QLE D;  5L8R J;  3CPW O;  2QJK C;  2IBZ G;  1ZN5 A;  4IOI H;  1GMJ A;  3BCC D;  3F5H A;  2FYU D;  4ASV A;  1L0L D;  2G8Y A;  1NTK J;  2WSF H;  1S5L H;  3R2P A;  2UWJ E;  1CW5 A;  3VP9 A;  1ZLL A;  2PAJ A;  5AVY B;  4GOF A;  3L70 D;  1RE3 C;  5M1B A;  1NJI Q;  2ZVO B;  4EDF A;  2WT7 B;  1Q81 Q;  5CJ0 A;  2RKL A;  4W7Z A;  2W6J H;  3B5N B;  5KJ7 C;  3GG2 A;  3L74 D;  1KYO E;  1NTK K;  3N7N A;  2K9Y A;  2LXC B;  1Q2N A;  3LW5 H;  3TGU E;  3VOP A;  1N7L A;  1M8O B;  1KMI Z;  3B5N C;  3G3Z A;  3G4S P;  4JF7 A;  3JCU H;  3H1K E;  3QH9 A;  1EC5 A;  4WBA A;  1E5W A;  1BSH A;  1AQ5 A;  1OWA A;  3H1H D;  3Q5S A;  1P84 H;  1EZV D;  2HPC A;  4WWI A;  2CK3 H;  1K8A Q;  1J1E B;  2ZT9 D;  2RN0 A;  2E76 B;  4GOE A;  3L71 D;  4DCK A;  1JMB A;  3E7K A;  1IFP A;  3IN6 A;  3L75 D;  2FXM A;  5AW1 B;  3AEE C;  1YJW P;  2KB7 P;  1FS0 E;  1LWU B;  5B66 E;  2JKV A;  2H43 A;  1TU3 F;  2E76 C;  3HE5 A;  2AEF A;  2R3C A;  1SQX G;  1P84 D;  1LJ2 A;  2QEX P;  2GUV A;  1FOS E;  1KD1 Q;  2OYH B;  1CI6 A;  1D7M A;  2NZ2 A;  3FWL A;  2YNY A;  1LWU C;  1SQQ D;  1PP9 E;  1JY2 N;  1KB9 H;  5AW7 B;  5AW6 B;  3SWF A;  1S5L X;  3CWB D;  3NXS A;  4JQ0 D;  3MUD C;  5AW4 B;  2HLO A;  2SPZ A;  3GF3 A;  2B87 B;  1T2K D;  4K35 A;  5CHX A;  2WSE H;  3M91 A;  2KOG A;  3CLQ A;  4U3F G;  2OYH C;  1VQ5 P;  2JWD A;  1DEB A;  4AQR D;  3H1I E;  2WMM A;  3L72 E;  1URQ A;  1EDL A;  3CCL P;  2J58 A;  2K9J A;  3H1I J;  3L72 J;  1IO4 A;  3OA7 A;  2YXQ B;  3OJA B;  1FZF A;  1L4A B;  3V5B A;  3VMY A;  3P8M C;  5H2F E;  4OGQ D;  2WTY A;  1LT9 A;  1HVV A;  1L0N E;  3CX5 I;  4IFF A;  1SP4 A;  1L0N J;  1KB9 D;  3TSI A;  2OAR A;  1DH3 A;  1SQP J;  1X79 B;  3H1L D;  1SQV J;  1L4A C;  2W6B A;  2KP8 A;  1PZQ A;  2L5G B;  1KIL E;  3SWK A;  4A7P A;  4YTP C;  1WRG A;  3TNU A;  4JBZ A;  1VPC A;  1NTZ E;  3CCQ P;  2ZXX A;  3V4W A;  3W67 A;  1BGY E;  2IZ1 A;  4KT0 J;  1T3J A;  1SQP K;  3WUV A;  1SQV K;  1BDD A;  5AVQ B;  1GDT A;  1ZW0 A;  3CC7 P;  1IFD A;  3BCC J;  3ITK A;  1IFM A;  4D6T D;  2FYU J;  1L0L E;  4ASW A;  4Y99 B;  1NWQ A;  1E79 H;  3II6 A;  4I6M C;  2A45 I;  2G3A A;  1FAV A;  2XU6 A;  1X0T A;  3CC4 P;  3U1A A;  3L70 E;  1SVF A;  2V4H A;  4Y99 C;  2KK7 A;  1YI2 P;  5APS A;  4IFD K;  2FYU K;  4M3L A;  4KHX A;  1Y8A A;  2FYN B;  3HE4 A;  1GZL A;  4YXW H;  3L74 J;  1M7L A;  5APY A;  1MFZ A;  4DJG A;  1VQO P;  4PV1 B;  1GU4 A;  3CCE P;  3TGU G;  1S5L E;  2K1A A;  2WSF J;  1RE4 C;  2FYN C;  3P7K A;  1XTG B;  1YYC A;  2Q5U A;  1H0T A;  3H1K G;  4PV1 C;  4PD4 I;  1Y9B A;  1HBW A;  1NTK D;  2KLU A;  1SQB J;  1EZV E;  3M0D C;  1S1C X;  3H1H J;  2A45 H;  1YQ3 C;  1EXI A;  5KJ7 D;  4ZMD A;  2Z5I A;  2Y0C A;  2AXC A;  2ZT9 B;  3L71 E;  3A0B E;  1NAF A;  2XKM A;  3H32 A;  3A0H E;  3AE6 C;  3AEG C;  3L75 J;  3B5N D;  3KYQ A;  5AW9 B;  3LIE A;  2IFM A;  1HGZ A;  3WUT A;  3RL0 g;  1ZR4 A;  1SQB K;  3B8E B;  3AEA C;  1BE3 D;  3W68 A;  1P84 E;  1NYH A;  2KNC B;  4CPG A;  2FFD B;  4OH8 B;  1DIP A;  1S72 P;  1EQ7 A;  3I55 P;  2D2C B;  1PP9 G;  1X8Y A;  1JY2 P;  2C9N Y;  1SQQ J;  3CWB E;  1DD3 A;  1FJP A;  5AVR B;  4GT1 A;  4Y28 J;  2FFD C;  1NOH A;  2HOD A;  1H88 A;  1HTL C;  5AVZ B;  1PGP A;  2D2C C;  3BRV B;  2Q3I A;  1FZG A;  3H1I G;  3L72 G;  1LTG C;  3K5B A;  1K05 A;  1LTJ B;  1N7S A;  2B89 A;  2R5B A;  4RO0 A;  1LTB C;  1SQQ K;  1AVO A;  1BCC D;  2XNX A;  1L0N G;  2A06 D;  1PGQ A;  2AEM A;  1GL2 D;  1KB9 E;  4C46 A;  3TK1 A;  1LTJ C;  1LGH B;  4HJG H;  1OZH A;  3H1L E;  3RL0 B;  4WVZ A;  4WY4 B;  4RES B;  5CCH C;  1MKM A;  2YKO A;  1KN7 A;  1KQF B;  4H13 D;  1NTZ G;  1NKN A;  3CXH I;  3RL0 C;  2QA4 P;  2NPS A;  2YKP A;  4WY4 C;  1G2C A;  1BGY G;  2XDJ A;  1CSB A;  4N78 D;  1Q86 Q;  2QRX A;  4ZKP A;  4I7Z B;  2QVA A;  2ZYA A;  3A5T A;  1BDC A;  2M0B A;  2MJZ A;  2QG4 A;  3L35 A;  4D6T E;  1Q82 Q;  2N9Y B;  1LTT C;  1L0L G;  1QEX A;  2Y0E A;  3MGN A;  4JPZ B;  1VQ7 P;  2ZAE B;  3RBZ A;  3M9B A;  4I7Z C;  5BU8 B;  3HD7 A;  5CCG A;  4JYB A;  5CBN A;  3E1I A;  2BCC J;  1SQP D;  1LT1 A;  2M3B A;  4BRY B;  1SQV D;  3L70 G;  4IL6 E;  1YIT P;  2IBZ I;  1MV8 A;  2H7H A;  4GKG A;  1VL2 A;  3RK3 E;  2Y9Z A;  3AED C;  2IFN A;  3CXH H;  3UIA A;  1JTH A;  3AE8 C;  1PPJ E;  2ZYG A;  3MUD A;  3TDK A;  3PJS K;  2XV5 A;  4HYT B;  3JSV C;  5KAF H;  1X22 A;  3AE3 C;  3SFE C;  1NAY A;  1W5C E;  1T8Z A;  1NTK E;  3H1H G;  1EZV G;  3BAS A;  1LP1 B;  1FZC A;  2JO1 A;  5KLV D;  1R5L A;  1T3U A;  1NH4 A;  3HUS B;  1KFM A;  3CXH D;  3L71 G;  3T97 B;  4GDO A;  3CI9 A;  1N86 A;  1H89 A;  3VYI A;  1LTI C;  2HG5 D;  3U59 A;  1M1J B;  3V6I A;  4Z1M H;  1OVU A;  3HUS C;  1BE3 E;  4PV1 D;  2QM7 A;  3S1K A;  1BE3 J;  1PIX A;  2N9B A;  4L76 A;  1HGV A;  3M06 A;  3USS A;  2E42 A;  2KYV A;  2M3E A;  1S4X A;  4JYC A;  5DJU B;  1M1J C;  3CL3 D;  2RH0 A;  3L37 A;  3CWB G;  1KIL A;  3V2P A;  1SQB D;  1GK4 A;  1NO4 A;  2R32 A;  1YQ4 C;  1YHQ P;  3AEB C;  2P7J A;  2ZJS E;  3GHG A;  1S9K D;  1RF0 C;  2J59 M;  2HYN A;  1KQL A;  1R8E A;  3L36 A;  2PP6 A;  4TLF A;  3EQ2 A;  1SFC B;  1VQ6 P;  2KLV A;  2B88 A;  3D6Y A;  3IR9 A;  3RK2 B;  1BCC E;  4XFJ A;  1BCC J;  2A06 E;  2ZXE B;  3PP5 A;  1VDF A;  2WPV B;  1GL2 B;  1NKZ B;  3U1C A;  1GW3 A;  1SFC C;  1DD4 A;  3H1J J;  3H1L G;  5AW8 B;  3RK2 C;  2N1T B;  1OX3 A;  5APU A;  3PRJ A;  1GK6 A;  2D2C D;  5APV A;  1VQM P;  2O01 J;  5AW3 B;  1GL2 C;  5AW2 B;  3A3Y B;  1JOC A;  1FZE A;  4NPF X;  5AVW B;  5AVS B;  1MUU A;  3FX0 A;  4H13 B;  3G71 P;  2QM8 A;  2N1T C; 
#chains in the Genus database with same CATH homology
 1GZL A;  2YMY A;  1GD2 E;  1WT6 A;  3HUS A;  5APY A;  1M7L A;  3VTP C;  3RK3 C;  3T97 A;  4N78 E;  1MFZ A;  1GU4 A;  4I1L A;  2C0X A;  1A02 J;  1LTS C;  3EFG A;  2I1J A;  3BVH A;  5BVZ A;  1G1J A;  1N7S C;  5AVX B;  2KSJ A;  1L4A A;  1M1J A;  1RE4 C;  3P7K A;  1XTG B;  1YYC A;  2Q5U A;  2OYI A;  5CCH D;  2WPR A;  1RF1 B;  5CJ4 A;  2P1J A;  1HBW A;  3NMD A;  3M0D C;  1RF0 A;  1NHL A;  2A45 H;  3RL0 D;  5APQ A;  1N73 B;  1HUC A;  2JJL A;  3P32 A;  5KJ7 D;  2Z5I A;  4GIF A;  4WY4 D;  3P8C E;  3M9H A;  2NPS B;  3OAK A;  1ZV8 A;  4XA4 A;  2VRS A;  1G2C B;  2LKM A;  4W7Y A;  1RF1 C;  5APX A;  1NAF A;  1NU1 K;  1URQ D;  2XKM A;  3H32 A;  1JCC A;  2R5D A;  3B5N D;  3KYQ A;  2YO2 A;  5AW5 B;  5AW9 B;  3LIE A;  1L4A D;  1N73 C;  2IFM A;  1HGZ A;  1ZR4 A;  1SQB K;  2NPS C;  3B8E B;  1QL2 A;  2E43 A;  1IC2 A;  2IX7 C;  1SFC A;  3I5C A;  4EOT A;  4C7N B;  3HD7 B;  4AYC A;  4EIJ A;  2HPC B;  2FFD B;  5BU5 A;  1X9V A;  2CPS A;  4OH8 B;  1JNM A;  3HTK A;  3KDP B;  1EQ7 A;  1G1I A;  5AW0 B;  1X8Y A;  2I1K A;  1GL2 A;  1JMM A;  1JY2 P;  2C9N Y;  1KIL D;  1KFN A;  2WWW A;  3HD7 C;  3BRT B;  1FJP A;  5AVR B;  4B86 A;  5CCG C;  4GT1 A;  1J2J B;  2N1T A;  2JEE A;  2W27 A;  2FFD C;  4DZO A;  1NOH A;  2HOD A;  5KTB A;  1H88 A;  1HTL C;  5AVZ B;  3RK3 B;  1W2E A;  3IFM A;  1J1E C;  1JTH B;  3BRV B;  2GM4 A;  2Q3I A;  1FZG A;  1LTG C;  1N2D C;  1FOS F;  1GW4 A;  4O9B A;  1LTJ B;  1N7S A;  3HE5 B;  3HRN A;  3V2Q A;  2XZR A;  1MZ9 A;  1ZN5 A;  3H6P A;  2WSC H;  1RE4 A;  1XTC C;  2R5B A;  2BAS A;  1LTB C;  1SQQ K;  2XNX A;  1NTM K;  1Z56 A;  1CI6 B;  1GTW A;  3KPE A;  1GL2 D;  1RY3 A;  4C46 A;  3M0D A;  3TK1 A;  3VMZ A;  2WSF H;  1LTJ C;  4IFM A;  2A45 G;  5KLV K;  1LGH B;  2W6A A;  3R2P A;  1IFJ A;  1CW5 A;  3RL0 B;  3VP9 A;  1ZLL A;  2PAJ A;  5AVY B;  1FZC B;  4WY4 B;  1RE3 C;  4RES B;  2HFE D;  5CCH C;  1HJB A;  1RF1 A;  2WT7 B;  2YKO A;  1LTA C;  5CJ0 A;  3VP8 A;  3TYY A;  1URQ B;  2CPB A;  1JY3 N;  4W7Z A;  1N73 A;  3B5N B;  2YKQ A;  1NKN A;  3RL0 C;  1KZU B;  5KJ7 C;  2NPS A;  1FZC C;  2YKP A;  4WY4 C;  1G2C A;  1NTK K;  2XDJ A;  3N7N A;  1CSB A;  1LT9 B;  1QL1 A;  1FZB A;  4N78 D;  4ZKP A;  3N4X A;  3LW5 H;  3A2A A;  3BAT A;  3VOP A;  1URQ C;  3M0A A;  3A5T A;  1YTZ I;  3HE4 A;  1N7L A;  2MJZ A;  1DX7 A;  3L35 A;  3NTN A;  2WIT A;  4W80 A;  3B5N C;  3G3Z A;  3NFQ A;  1LTT C;  1IK9 A;  1FZA A;  4JF7 A;  4LGD E;  2WPS A;  3M9Q A;  3MGN A;  1JO5 A;  1LT9 C;  4WBA A;  2C0W A;  3M9B A;  3WMM 0;  1E5W A;  5BU8 B;  1KIL B;  4C7N A;  1AQ5 A;  3HD7 A;  1OWA A;  5CCG A;  1JUN A;  4JYB A;  3E1I A;  5CMZ A;  2HPC A;  2M3B A;  3GHG B;  2FFD A;  1GU5 A;  3TNU B;  1JCD A;  4C7R A;  1L0N K;  1PFI A;  2NPS D;  1J1E B;  1JY3 O;  3P8C D;  1MV8 A;  1KIL C;  4LLH A;  1HWT C;  1J1D B;  2YO3 A;  2WZ7 A;  3L4F A;  2FXM A;  3GHG C;  2H7H A;  4GKG A;  5AW1 B;  5AVV B;  2IFN A;  2KB7 P;  2H8P D;  3UIA A;  1JTH A;  5AVU B;  1LWU B;  2O01 H;  2H43 A;  1AFO A;  3MUD A;  1LTJ A;  1SFC D;  3HE5 A;  5AVT B;  2R3C A;  1NTZ K;  1J1D C;  3RK2 D;  2XV5 A;  2O1J A;  2Z5H A;  4HYT B;  2GUV A;  1FOS E;  1RE3 A;  5CCH A;  2Q9I A;  2IPP A;  2OYH B;  1CI6 A;  2YNY A;  1LWU C;  1JY2 N;  2P67 A;  1T8Z A;  4N3Y B;  1HH0 A;  5AW7 B;  5AW6 B;  3SWF A;  2Q7C A;  3NXS A;  1YTZ T;  5AW4 B;  2HLO A;  3BAS A;  1T2K D;  5KJ7 A;  2Z4E A;  5CHX A;  1L0L K;  1FZC A;  2N1T D;  2WSE H;  3M91 A;  4WY4 A;  2KOG A;  3CLQ A;  3HE4 B;  1CZQ A;  1T3U A;  1SLQ A;  3RK3 D;  1NH4 A;  3HUS B;  1KFM A;  2OYH C;  2WT7 A;  1DEB A;  3CI9 A;  4AQR D;  4XE5 B;  1URQ A;  1IJD B;  4HH2 A;  2J58 A;  1N86 A;  1IFI A;  1S9K E;  1N7S D;  1H89 A;  3OA7 A;  1IO4 A;  3B5N A;  3OJA B;  3VYI A;  1FZF A;  1LTI C;  3LID A;  1L4A B;  2HG5 D;  3U59 A;  3V5B A;  3A7O A;  3VMY A;  1M1J B;  2FKW B;  3P8M C;  2WTY A;  1ZR2 A;  1LT9 A;  2OYI B;  1HVV A;  3HUS C;  3MTU E;  2M8R A;  4I2L C;  4IFF A;  1SP4 A;  2QM7 A;  2N9B A;  1HGV A;  3TSI A;  4WB4 A;  1FU1 A;  3MD0 A;  3M06 A;  2OAR A;  1DH3 A;  2E42 A;  1X79 B;  2KYV A;  4JYC A;  1L4A C;  1JY2 O;  1M1J C;  3SWY A;  3CL3 D;  2W6B A;  3L37 A;  3V4Q A;  2KP8 A;  1H8A A;  2OYI C;  1FBM A;  2L5G B;  3MIW A;  1KIL A;  3V2P A;  2FYZ A;  1SQX K;  1GK4 A;  1NO4 A;  2R32 A;  2O1K A;  2P7J A;  3GHG A;  1WRG A;  3H32 B;  1RF0 C;  3TNU A;  1S9K D;  2J59 M;  2HYN A;  1VPC A;  3KQG A;  1KQL A;  2ZFC A;  3L36 A;  3C9I A;  2PP6 A;  3V4W A;  4AUW A;  3EQ2 A;  2GUS A;  1IFN A;  1T3J A;  5APW A;  1SQP K;  2C9L Y;  1SQV K;  1SFC B;  5AVQ B;  1GDT A;  3VMX A;  2KLV A;  3IR9 A;  3RK2 B;  1IFD A;  1IFM A;  3HTK B;  3O8Z A;  2ZXE B;  3PP5 A;  1LWU A;  4Y99 B;  1NWQ A;  1VDF A;  1GL2 B;  3II6 A;  2POH A;  1NKZ B;  3U1C A;  1GW3 A;  4I6M C;  2A45 I;  1SFC C;  3HD7 D;  1FAV A;  2XU6 A;  5AW8 B;  3V2R A;  5CCG D;  3RK2 C;  5APT A;  3U1A A;  2N1T B;  4N6J A;  4ZKU A;  5APU A;  4DOJ A;  2HOD B;  2WPQ A;  1FJK A;  1GK6 A;  2OYH A;  1SVF A;  5APV A;  4Y99 C;  1OXZ A;  5AW3 B;  1GL2 C;  5AW2 B;  3V2N A;  3VN0 A;  3A3Y B;  1JY3 P;  2P2U A;  5APS A;  1A02 F;  4IFD K;  2FYU K;  1JOC A;  1FZE A;  1N7S B;  1FDM A;  4M3L A;  4KHX A;  4LC1 A;  5AVW B;  5AVS B;  1MUU A;  1T2K C;  2QM8 A;  2N1T C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...