2Z63A

Crystal structure of the tv8 hybrid of human tlr4 and hagfish vlrb.61
Total Genus 189
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
189
sequence length
570
structure length
570
Chain Sequence
EPCVEVVPNITYQCMELNFYKIPDNLPFSTKNLDLSFNPLRHLGSYSFFSFPELQVLDLSRCEIQTIEDGAYQSLSHLSTLILTGNPIQSLALGAFSGLSSLQKLVAVETNLASLENFPIGHLKTLKELNVAHNLIQSFKLPEYFSNLTNLEHLDLSSNKIQSIYCTDLRVLHQMPLLNLSLDLSLNPMNFIQPGAFKEIRLHKLTLRNNFDSLNVMKTCIQGLAGLEVHRLVLGEFRNEGNLEKFDKSALEGLCNLTIEEFRLAYLDYYLDDIIDLFNCLTNVSSFSLVSVTIERVKDFSYNFGWQHLELVNCKFGQFPTLKLKSLKRLTFTSNKGGNAFSEVDLPSLEFLDLSRNGLSFKGCCSQSDFGTTSLKYLDLSFNGVITMSSNFLGLEQLEHLDFQHSNLKQMSEFSVFLSLRNLIYLDISHTHTRVAFNGIFNGLSSLEVLKMAGNSFQENFLPDIFTELRNLTFLDLSQCQLEQLSPTAFNSLSSLQVLNMASNQLKSVPDGIFDRLTSLQKIWLHTNPWDCSCPRIDYLSRWLNKNSQKEQGSAKCSGSGKPVRSIICP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Toll-like receptor 4, Variable lymphocyte receptor B
publication title Crystal Structure of the TLR4-MD-2 Complex with Bound Endotoxin Antagonist Eritoran
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 189
structure length 570
sequence length 570
ec nomenclature
pdb deposition date 2007-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13516 LRR_6 Leucine Rich repeat
A PF13855 LRR_8 Leucine rich repeat
A PF13855 LRR_8 Leucine rich repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 2z63A00
4R6FA 5IJDA 3RFJA 4MN8B 1K5GC 3M18A 2V9SA 2ID5A 1M10B 4PKIG 2IFGA 4AW4A 4RWTC 2CA6A 3C6NB 2Z66A 3SB4A 2A0ZA 1H6TA 3ZYNA 1QYYA 4R0AA 3G3BA 4R58A 4KT1A 3RFEA 4I6JB 2Z7XA 1P8TA 3P72A 3WPGA 3E4GA 3RGXA 5GS0A 3UL8A 4G8AA 4V2DA 4CNCA 3OJAA 1FO1A 4R6JA 4L3FA 4HQ1A 4Z94G 1YRGA 1P9AG 4IM6A 1G9UA 4ECOA 1A9NA 2OMWA 4LXRA 1M9LA 5AZ5A 4R5CA 3W3NA 1DFJI 3W3JA 3WPHA 4PQ8A 4CC4C 4LI2A 3C6OB 2FT3A 4LSAA 4P8SA 4NKGA 4XSQA 1DS9A 4BV4R 3VQ2A 4FHOA 5GQRK 3OGLB 1JL5A 5GS2B 4Z8GA 5LFNA 4J4LA 4LSCA 3RIZA 2JE0A 4CNMA 2RA8A 5GMHA 4XOSA 4FCGA 3ULAA 1XWDC 5B4PA 3VQ1A 2R9UA 4FMZA 4Z61C 2P1PB 4QC0A 2V70A 5AWAA 1WWLA 3WPIA 2Z64A 2Z63A 3E6JA 4FD0A 2O6RA 1GWBA 2BNHA 3GOZA 5HZLB 1P8VA 4P91A 3REZA 1U0ND 3G04C 3CIGA 5AWBA 5GMFA 4R6GA 1XCDA 4Z79A 4KXFB 3M19A 2BEXA 4R08A 4NKHA 2V9TB 4ARNA 3CVRA 1IO0A 2OMYA 5A5CA 5GMGA 4OQTA 1K5DC 4WYKA 4C2BB 1ZIWA 4L3AA 2WFHA 4LI1A 1OTMA 5B0NA 3OGKB 2OMVA 1FT8A 2P1OB 5AWDA 4R5DA 4CC4A 4U7LA 2Z81A 1D0BA 1LTXA 3TSRE 4J0MA 3FXIA 5IJCA 2XOTA 4LSXA 1O6VA 4B8CD 2Z62A 3BZ5A 2JQDA 4CP6A 3ZYJA 1W8AA 1M0ZA 5CMPA 4LXSA 2OMZA 3G39A 4GLPA 4BSUA 3DZEA 5IYXC 1KOHA 3WPBA 4LSXC 4K17A 4PERA 2UZYA 3UN9A 4QBZA 1XKUA 4RCWA 2Z7XB 4CILA 4V2EA 1OGQA 3ULVA 4BSRA 4Q62A 3C6PB 4Q3IA 3W3LA 1O6TA 3OJAB 3W3GA 2XWTC 3ULUA 1OTOA 3ZYIA 1OZNA 2OMXA 2O6SA 4AY9X 5FTTB 2P1NB 3UL9A 3JB9j 5B0TA 1FQVA 3G3AA 3ZYOA 4R09A 2WQXA 3A79B 1XEUA 4U08A 2Y5QA 1DCEA 4U06A 3O6NA 3WPFA 5IJBA 4U09A 2ASTB 4TZHA 3O53A 2Q4GW 4FDWA 2OMTA 1OOKG 4BSSA 3RGZA 2WQVA 4YEBB 3W3KA 5AWCA 4QXEA 1SQ0B 4ECNA 4V2CA 5D3IA 3E3ZA 2P1MB 3CIYA 1OTNA 4KNGA 4ARRA 2JE1A 3UL7A 4Z64C 4RCAB 4M7EA 2ELLA 3WN4A 4UFRA 1FS2A 4EZGA 1A4YA 4PEQB 2WQWA 3G06A 1Z7XW 3E2JA 4Q3GA 3PMHG 4FS7A 3WPEA 3WPCA 3W3MA 4M7EC 3KJ4A 2P1QB 2O6QA 4R6AA 4R07A 2OMUA 2Z82A 1M9SA 3RJ0A 2WQUA 3RW7A 2ASSB 3OGMB 5HDHA 3RFSA 2Z65A 4H09A 4WP6A 4MQWX 1PGVA 4GT6A 1KOOA 3RW6A 1H6UA 1O6SA 1XECA 4C2AB 4Y61B 4PSJA 3WPDA 4XGOA 2UZXA 2RR6A 5CMNA
chains in the Genus database with same CATH superfamily
4R6FA 5IJDA 3RFJA 4MN8B 1K5GC 3M18A 2V9SA 2ID5A 1M10B 4PKIG 2IFGA 4AW4A 4RWTC 2CA6A 3C6NB 2Z66A 3SB4A 2A0ZA 1H6TA 3ZYNA 1QYYA 4R0AA 3G3BA 4R58A 4KT1A 3RFEA 4I6JB 2Z7XA 1P8TA 3P72A 3WPGA 3E4GA 3RGXA 5GS0A 3UL8A 4G8AA 4V2DA 4CNCA 3OJAA 1FO1A 4R6JA 4L3FA 4HQ1A 4Z94G 1YRGA 1P9AG 4IM6A 1G9UA 4ECOA 1A9NA 2OMWA 4LXRA 1M9LA 5AZ5A 4R5CA 3W3NA 1DFJI 3W3JA 3WPHA 4PQ8A 4CC4C 4LI2A 3C6OB 2FT3A 4LSAA 4P8SA 4NKGA 4XSQA 1DS9A 4BV4R 3VQ2A 4FHOA 5GQRK 3OGLB 1JL5A 5GS2B 4Z8GA 5LFNA 4J4LA 4LSCA 3RIZA 2JE0A 4CNMA 2RA8A 5GMHA 4XOSA 4FCGA 3ULAA 1XWDC 5B4PA 3VQ1A 2R9UA 4FMZA 4Z61C 2P1PB 4QC0A 2V70A 5AWAA 1WWLA 3WPIA 2Z64A 2Z63A 3E6JA 4FD0A 2O6RA 1GWBA 2BNHA 3GOZA 5HZLB 1P8VA 4P91A 3REZA 1U0ND 3G04C 3CIGA 5AWBA 5GMFA 4R6GA 1XCDA 4Z79A 4KXFB 3M19A 2BEXA 4R08A 4NKHA 2V9TB 4ARNA 3CVRA 1IO0A 2OMYA 5A5CA 5GMGA 4OQTA 1K5DC 4WYKA 4C2BB 1ZIWA 4L3AA 2WFHA 4LI1A 1OTMA 5B0NA 3OGKB 2OMVA 1FT8A 2P1OB 5AWDA 4R5DA 4CC4A 4U7LA 2Z81A 1D0BA 1LTXA 3TSRE 4J0MA 3FXIA 5IJCA 2XOTA 4LSXA 1O6VA 4B8CD 2Z62A 3BZ5A 2JQDA 4CP6A 3ZYJA 1W8AA 1M0ZA 5CMPA 4LXSA 2OMZA 3G39A 4GLPA 4BSUA 3DZEA 5IYXC 1KOHA 3WPBA 4LSXC 4K17A 4PERA 2UZYA 3UN9A 4QBZA 1XKUA 4RCWA 2Z7XB 4CILA 4V2EA 1OGQA 3ULVA 4BSRA 4Q62A 3C6PB 4NZRM 4Q3IA 3W3LA 1O6TA 3OJAB 3W3GA 2XWTC 3ULUA 1OTOA 4NZTM 3ZYIA 1OZNA 2OMXA 2O6SA 4AY9X 5FTTB 2P1NB 3UL9A 3JB9j 5B0TA 1FQVA 3G3AA 3ZYOA 4R09A 2WQXA 3A79B 1XEUA 4U08A 2Y5QA 1DCEA 4U06A 3O6NA 3WPFA 5IJBA 4U09A 2ASTB 4TZHA 3O53A 2Q4GW 4FDWA 2OMTA 1OOKG 4BSSA 3RGZA 2WQVA 4YEBB 3W3KA 5AWCA 4QXEA 1SQ0B 4ECNA 4V2CA 5D3IA 3E3ZA 2P1MB 3CIYA 1OTNA 4KNGA 4ARRA 2JE1A 3UL7A 4Z64C 4RCAB 4M7EA 2ELLA 3WN4A 4UFRA 1FS2A 4EZGA 1A4YA 4PEQB 2WQWA 3G06A 1Z7XW 3E2JA 4Q3GA 3PMHG 4FS7A 3WPEA 3WPCA 3W3MA 4M7EC 3KJ4A 2P1QB 2O6QA 4R6AA 4R07A 2OMUA 2Z82A 1M9SA 3RJ0A 2WQUA 3RW7A 2ASSB 3OGMB 5HDHA 3RFSA 2Z65A 4H09A 4WP6A 4MQWX 1PGVA 4GT6A 1KOOA 3RW6A 1H6UA 1O6SA 1XECA 4C2AB 4Y61B 4PSJA 3WPDA 4XGOA 2UZXA 2RR6A 5CMNA
chains in the Genus database with same CATH topology
4R6FA 5IJDA 3RFJA 4MN8B 1K5GC 3M18A 2V9SA 2ID5A 1M10B 4PKIG 2IFGA 4AW4A 4RWTC 2CA6A 3C6NB 2Z66A 3SB4A 2A0ZA 1H6TA 3ZYNA 1QYYA 4R0AA 3G3BA 4R58A 4KT1A 3RFEA 4I6JB 2Z7XA 1P8TA 3P72A 3WPGA 3E4GA 3RGXA 5GS0A 3UL8A 4G8AA 4V2DA 4CNCA 3OJAA 1FO1A 4R6JA 4L3FA 4HQ1A 4Z94G 1YRGA 1P9AG 4IM6A 1G9UA 4ECOA 1A9NA 2OMWA 4LXRA 1M9LA 5AZ5A 4R5CA 3W3NA 1DFJI 3W3JA 3WPHA 4PQ8A 4CC4C 4LI2A 3C6OB 2FT3A 4LSAA 4P8SA 4NKGA 4XSQA 1DS9A 4BV4R 3VQ2A 4FHOA 5GQRK 3OGLB 1JL5A 5GS2B 4Z8GA 5LFNA 4J4LA 4LSCA 3RIZA 2JE0A 4CNMA 2RA8A 5GMHA 4XOSA 4FCGA 3ULAA 1XWDC 5B4PA 3VQ1A 2R9UA 4FMZA 4Z61C 2P1PB 4QC0A 2V70A 5AWAA 1WWLA 3WPIA 2Z64A 2Z63A 3E6JA 4FD0A 2O6RA 1GWBA 2BNHA 3GOZA 5HZLB 1P8VA 4P91A 3REZA 1U0ND 3G04C 3CIGA 5AWBA 5GMFA 4R6GA 1XCDA 4Z79A 4KXFB 3M19A 2BEXA 4R08A 4NKHA 2V9TB 4ARNA 3CVRA 1IO0A 2OMYA 5A5CA 5GMGA 4OQTA 1K5DC 4WYKA 4C2BB 1ZIWA 4L3AA 2WFHA 4LI1A 1OTMA 5B0NA 3OGKB 2OMVA 1FT8A 2P1OB 5AWDA 4R5DA 4CC4A 4U7LA 2Z81A 1D0BA 1LTXA 3TSRE 4J0MA 3FXIA 5IJCA 2XOTA 4LSXA 1O6VA 4B8CD 2Z62A 3BZ5A 2JQDA 4CP6A 3ZYJA 1W8AA 1M0ZA 5CMPA 4LXSA 2OMZA 3G39A 4GLPA 4BSUA 3DZEA 5IYXC 1KOHA 3WPBA 4LSXC 4K17A 4PERA 2UZYA 3UN9A 4QBZA 1XKUA 4RCWA 2Z7XB 4CILA 4V2EA 1OGQA 3ULVA 4BSRA 4Q62A 3C6PB 4Q3IA 3W3LA 1O6TA 3OJAB 3W3GA 2XWTC 3ULUA 1OTOA 3ZYIA 1OZNA 2OMXA 2O6SA 4AY9X 5FTTB 2P1NB 3UL9A 3JB9j 5B0TA 1FQVA 3G3AA 3ZYOA 4R09A 2WQXA 3A79B 1XEUA 4U08A 2Y5QA 1DCEA 4U06A 3O6NA 3WPFA 5IJBA 4U09A 2ASTB 4TZHA 3O53A 2Q4GW 4FDWA 2OMTA 1OOKG 4BSSA 3RGZA 2WQVA 4YEBB 3W3KA 5AWCA 4QXEA 1SQ0B 4ECNA 4V2CA 5D3IA 3E3ZA 2P1MB 3CIYA 1OTNA 4KNGA 4ARRA 2JE1A 3UL7A 4Z64C 4RCAB 4M7EA 2ELLA 3WN4A 4UFRA 1FS2A 4EZGA 1A4YA 4PEQB 2WQWA 3G06A 1Z7XW 3E2JA 4Q3GA 3PMHG 4FS7A 3WPEA 3WPCA 3W3MA 4M7EC 3KJ4A 2P1QB 2O6QA 4R6AA 4R07A 2OMUA 2Z82A 1M9SA 3RJ0A 2WQUA 3RW7A 2ASSB 3OGMB 5HDHA 3RFSA 2Z65A 4H09A 4WP6A 4MQWX 1PGVA 4GT6A 1KOOA 3RW6A 1H6UA 1O6SA 1XECA 4C2AB 4Y61B 4PSJA 3WPDA 4XGOA 2UZXA 2RR6A 5CMNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R6F A;  5IJD A;  3RFJ A;  4MN8 B;  1K5G C;  3M18 A;  2V9S A;  2ID5 A;  1M10 B;  4PKI G;  2IFG A;  4AW4 A;  4RWT C;  2CA6 A;  3C6N B;  2Z66 A;  3SB4 A;  2A0Z A;  1H6T A;  3ZYN A;  1QYY A;  4R0A A;  3G3B A;  4R58 A;  4KT1 A;  3RFE A;  4I6J B;  2Z7X A;  1P8T A;  3P72 A;  3WPG A;  3E4G A;  3RGX A;  5GS0 A;  3UL8 A;  4G8A A;  4V2D A;  4CNC A;  3OJA A;  1FO1 A;  4R6J A;  4L3F A;  4HQ1 A;  4Z94 G;  1YRG A;  1P9A G;  4IM6 A;  1G9U A;  4ECO A;  1A9N A;  2OMW A;  4LXR A;  1M9L A;  5AZ5 A;  4R5C A;  3W3N A;  1DFJ I;  3W3J A;  3WPH A;  4PQ8 A;  4CC4 C;  4LI2 A;  3C6O B;  2FT3 A;  4LSA A;  4P8S A;  4NKG A;  4XSQ A;  1DS9 A;  4BV4 R;  3VQ2 A;  4FHO A;  5GQR K;  3OGL B;  1JL5 A;  5GS2 B;  4Z8G A;  5LFN A;  4J4L A;  4LSC A;  3RIZ A;  2JE0 A;  4CNM A;  2RA8 A;  5GMH A;  4XOS A;  4FCG A;  3ULA A;  1XWD C;  5B4P A;  3VQ1 A;  2R9U A;  4FMZ A;  4Z61 C;  2P1P B;  4QC0 A;  2V70 A;  5AWA A;  1WWL A;  3WPI A;  2Z64 A;  2Z63 A;  3E6J A;  4FD0 A;  2O6R A;  1GWB A;  2BNH A;  3GOZ A;  5HZL B;  1P8V A;  4P91 A;  3REZ A;  1U0N D;  3G04 C;  3CIG A;  5AWB A;  5GMF A;  4R6G A;  1XCD A;  4Z79 A;  4KXF B;  3M19 A;  2BEX A;  4R08 A;  4NKH A;  2V9T B;  4ARN A;  3CVR A;  1IO0 A;  2OMY A;  5A5C A;  5GMG A;  4OQT A;  1K5D C;  4WYK A;  4C2B B;  1ZIW A;  4L3A A;  2WFH A;  4LI1 A;  1OTM A;  5B0N A;  3OGK B;  2OMV A;  1FT8 A;  2P1O B;  5AWD A;  4R5D A;  4CC4 A;  4U7L A;  2Z81 A;  1D0B A;  1LTX A;  3TSR E;  4J0M A;  3FXI A;  5IJC A;  2XOT A;  4LSX A;  1O6V A;  4B8C D;  2Z62 A;  3BZ5 A;  2JQD A;  4CP6 A;  3ZYJ A;  1W8A A;  1M0Z A;  5CMP A;  4LXS A;  2OMZ A;  3G39 A;  4GLP A;  4BSU A;  3DZE A;  5IYX C;  1KOH A;  3WPB A;  4LSX C;  4K17 A;  4PER A;  2UZY A;  3UN9 A;  4QBZ A;  1XKU A;  4RCW A;  2Z7X B;  4CIL A;  4V2E A;  1OGQ A;  3ULV A;  4BSR A;  4Q62 A;  3C6P B;  4Q3I A;  3W3L A;  1O6T A;  3OJA B;  3W3G A;  2XWT C;  3ULU A;  1OTO A;  3ZYI A;  1OZN A;  2OMX A;  2O6S A;  4AY9 X;  5FTT B;  2P1N B;  3UL9 A;  3JB9 j;  5B0T A;  1FQV A;  3G3A A;  3ZYO A;  4R09 A;  2WQX A;  3A79 B;  1XEU A;  4U08 A;  2Y5Q A;  1DCE A;  4U06 A;  3O6N A;  3WPF A;  5IJB A;  4U09 A;  2AST B;  4TZH A;  3O53 A;  2Q4G W;  4FDW A;  2OMT A;  1OOK G;  4BSS A;  3RGZ A;  2WQV A;  4YEB B;  3W3K A;  5AWC A;  4QXE A;  1SQ0 B;  4ECN A;  4V2C A;  5D3I A;  3E3Z A;  2P1M B;  3CIY A;  1OTN A;  4KNG A;  4ARR A;  2JE1 A;  3UL7 A;  4Z64 C;  4RCA B;  4M7E A;  2ELL A;  3WN4 A;  4UFR A;  1FS2 A;  4EZG A;  1A4Y A;  4PEQ B;  2WQW A;  3G06 A;  1Z7X W;  3E2J A;  4Q3G A;  3PMH G;  4FS7 A;  3WPE A;  3WPC A;  3W3M A;  4M7E C;  3KJ4 A;  2P1Q B;  2O6Q A;  4R6A A;  4R07 A;  2OMU A;  2Z82 A;  1M9S A;  3RJ0 A;  2WQU A;  3RW7 A;  2ASS B;  3OGM B;  5HDH A;  3RFS A;  2Z65 A;  4H09 A;  4WP6 A;  4MQW X;  1PGV A;  4GT6 A;  1KOO A;  3RW6 A;  1H6U A;  1O6S A;  1XEC A;  4C2A B;  4Y61 B;  4PSJ A;  3WPD A;  4XGO A;  2UZX A;  2RR6 A;  5CMN A; 
#chains in the Genus database with same CATH topology
 4R6F A;  5IJD A;  3RFJ A;  4MN8 B;  1K5G C;  3M18 A;  2V9S A;  2ID5 A;  1M10 B;  4PKI G;  2IFG A;  4AW4 A;  4RWT C;  2CA6 A;  3C6N B;  2Z66 A;  3SB4 A;  2A0Z A;  1H6T A;  3ZYN A;  1QYY A;  4R0A A;  3G3B A;  4R58 A;  4KT1 A;  3RFE A;  4I6J B;  2Z7X A;  1P8T A;  3P72 A;  3WPG A;  3E4G A;  3RGX A;  5GS0 A;  3UL8 A;  4G8A A;  4V2D A;  4CNC A;  3OJA A;  1FO1 A;  4R6J A;  4L3F A;  4HQ1 A;  4Z94 G;  1YRG A;  1P9A G;  4IM6 A;  1G9U A;  4ECO A;  1A9N A;  2OMW A;  4LXR A;  1M9L A;  5AZ5 A;  4R5C A;  3W3N A;  1DFJ I;  3W3J A;  3WPH A;  4PQ8 A;  4CC4 C;  4LI2 A;  3C6O B;  2FT3 A;  4LSA A;  4P8S A;  4NKG A;  4XSQ A;  1DS9 A;  4BV4 R;  3VQ2 A;  4FHO A;  5GQR K;  3OGL B;  1JL5 A;  5GS2 B;  4Z8G A;  5LFN A;  4J4L A;  4LSC A;  3RIZ A;  2JE0 A;  4CNM A;  2RA8 A;  5GMH A;  4XOS A;  4FCG A;  3ULA A;  1XWD C;  5B4P A;  3VQ1 A;  2R9U A;  4FMZ A;  4Z61 C;  2P1P B;  4QC0 A;  2V70 A;  5AWA A;  1WWL A;  3WPI A;  2Z64 A;  2Z63 A;  3E6J A;  4FD0 A;  2O6R A;  1GWB A;  2BNH A;  3GOZ A;  5HZL B;  1P8V A;  4P91 A;  3REZ A;  1U0N D;  3G04 C;  3CIG A;  5AWB A;  5GMF A;  4R6G A;  1XCD A;  4Z79 A;  4KXF B;  3M19 A;  2BEX A;  4R08 A;  4NKH A;  2V9T B;  4ARN A;  3CVR A;  1IO0 A;  2OMY A;  5A5C A;  5GMG A;  4OQT A;  1K5D C;  4WYK A;  4C2B B;  1ZIW A;  4L3A A;  2WFH A;  4LI1 A;  1OTM A;  5B0N A;  3OGK B;  2OMV A;  1FT8 A;  2P1O B;  5AWD A;  4R5D A;  4CC4 A;  4U7L A;  2Z81 A;  1D0B A;  1LTX A;  3TSR E;  4J0M A;  3FXI A;  5IJC A;  2XOT A;  4LSX A;  1O6V A;  4B8C D;  2Z62 A;  3BZ5 A;  2JQD A;  4CP6 A;  3ZYJ A;  1W8A A;  1M0Z A;  5CMP A;  4LXS A;  2OMZ A;  3G39 A;  4GLP A;  4BSU A;  3DZE A;  5IYX C;  1KOH A;  3WPB A;  4LSX C;  4K17 A;  4PER A;  2UZY A;  3UN9 A;  4QBZ A;  1XKU A;  4RCW A;  2Z7X B;  4CIL A;  4V2E A;  1OGQ A;  3ULV A;  4BSR A;  4Q62 A;  3C6P B;  4NZR M;  4Q3I A;  3W3L A;  1O6T A;  3OJA B;  3W3G A;  2XWT C;  3ULU A;  1OTO A;  4NZT M;  3ZYI A;  1OZN A;  2OMX A;  2O6S A;  4AY9 X;  5FTT B;  2P1N B;  3UL9 A;  3JB9 j;  5B0T A;  1FQV A;  3G3A A;  3ZYO A;  4R09 A;  2WQX A;  3A79 B;  1XEU A;  4U08 A;  2Y5Q A;  1DCE A;  4U06 A;  3O6N A;  3WPF A;  5IJB A;  4U09 A;  2AST B;  4TZH A;  3O53 A;  2Q4G W;  4FDW A;  2OMT A;  1OOK G;  4BSS A;  3RGZ A;  2WQV A;  4YEB B;  3W3K A;  5AWC A;  4QXE A;  1SQ0 B;  4ECN A;  4V2C A;  5D3I A;  3E3Z A;  2P1M B;  3CIY A;  1OTN A;  4KNG A;  4ARR A;  2JE1 A;  3UL7 A;  4Z64 C;  4RCA B;  4M7E A;  2ELL A;  3WN4 A;  4UFR A;  1FS2 A;  4EZG A;  1A4Y A;  4PEQ B;  2WQW A;  3G06 A;  1Z7X W;  3E2J A;  4Q3G A;  3PMH G;  4FS7 A;  3WPE A;  3WPC A;  3W3M A;  4M7E C;  3KJ4 A;  2P1Q B;  2O6Q A;  4R6A A;  4R07 A;  2OMU A;  2Z82 A;  1M9S A;  3RJ0 A;  2WQU A;  3RW7 A;  2ASS B;  3OGM B;  5HDH A;  3RFS A;  2Z65 A;  4H09 A;  4WP6 A;  4MQW X;  1PGV A;  4GT6 A;  1KOO A;  3RW6 A;  1H6U A;  1O6S A;  1XEC A;  4C2A B;  4Y61 B;  4PSJ A;  3WPD A;  4XGO A;  2UZX A;  2RR6 A;  5CMN A; 
#chains in the Genus database with same CATH homology
 4R6F A;  5IJD A;  3RFJ A;  4MN8 B;  1K5G C;  3M18 A;  2V9S A;  2ID5 A;  1M10 B;  4PKI G;  2IFG A;  4AW4 A;  4RWT C;  2CA6 A;  3C6N B;  2Z66 A;  3SB4 A;  2A0Z A;  1H6T A;  3ZYN A;  1QYY A;  4R0A A;  3G3B A;  4R58 A;  4KT1 A;  3RFE A;  4I6J B;  2Z7X A;  1P8T A;  3P72 A;  3WPG A;  3E4G A;  3RGX A;  5GS0 A;  3UL8 A;  4G8A A;  4V2D A;  4CNC A;  3OJA A;  1FO1 A;  4R6J A;  4L3F A;  4HQ1 A;  4Z94 G;  1YRG A;  1P9A G;  4IM6 A;  1G9U A;  4ECO A;  1A9N A;  2OMW A;  4LXR A;  1M9L A;  5AZ5 A;  4R5C A;  3W3N A;  1DFJ I;  3W3J A;  3WPH A;  4PQ8 A;  4CC4 C;  4LI2 A;  3C6O B;  2FT3 A;  4LSA A;  4P8S A;  4NKG A;  4XSQ A;  1DS9 A;  4BV4 R;  3VQ2 A;  4FHO A;  5GQR K;  3OGL B;  1JL5 A;  5GS2 B;  4Z8G A;  5LFN A;  4J4L A;  4LSC A;  3RIZ A;  2JE0 A;  4CNM A;  2RA8 A;  5GMH A;  4XOS A;  4FCG A;  3ULA A;  1XWD C;  5B4P A;  3VQ1 A;  2R9U A;  4FMZ A;  4Z61 C;  2P1P B;  4QC0 A;  2V70 A;  5AWA A;  1WWL A;  3WPI A;  2Z64 A;  2Z63 A;  3E6J A;  4FD0 A;  2O6R A;  1GWB A;  2BNH A;  3GOZ A;  5HZL B;  1P8V A;  4P91 A;  3REZ A;  1U0N D;  3G04 C;  3CIG A;  5AWB A;  5GMF A;  4R6G A;  1XCD A;  4Z79 A;  4KXF B;  3M19 A;  2BEX A;  4R08 A;  4NKH A;  2V9T B;  4ARN A;  3CVR A;  1IO0 A;  2OMY A;  5A5C A;  5GMG A;  4OQT A;  1K5D C;  4WYK A;  4C2B B;  1ZIW A;  4L3A A;  2WFH A;  4LI1 A;  1OTM A;  5B0N A;  3OGK B;  2OMV A;  1FT8 A;  2P1O B;  5AWD A;  4R5D A;  4CC4 A;  4U7L A;  2Z81 A;  1D0B A;  1LTX A;  3TSR E;  4J0M A;  3FXI A;  5IJC A;  2XOT A;  4LSX A;  1O6V A;  4B8C D;  2Z62 A;  3BZ5 A;  2JQD A;  4CP6 A;  3ZYJ A;  1W8A A;  1M0Z A;  5CMP A;  4LXS A;  2OMZ A;  3G39 A;  4GLP A;  4BSU A;  3DZE A;  5IYX C;  1KOH A;  3WPB A;  4LSX C;  4K17 A;  4PER A;  2UZY A;  3UN9 A;  4QBZ A;  1XKU A;  4RCW A;  2Z7X B;  4CIL A;  4V2E A;  1OGQ A;  3ULV A;  4BSR A;  4Q62 A;  3C6P B;  4Q3I A;  3W3L A;  1O6T A;  3OJA B;  3W3G A;  2XWT C;  3ULU A;  1OTO A;  3ZYI A;  1OZN A;  2OMX A;  2O6S A;  4AY9 X;  5FTT B;  2P1N B;  3UL9 A;  3JB9 j;  5B0T A;  1FQV A;  3G3A A;  3ZYO A;  4R09 A;  2WQX A;  3A79 B;  1XEU A;  4U08 A;  2Y5Q A;  1DCE A;  4U06 A;  3O6N A;  3WPF A;  5IJB A;  4U09 A;  2AST B;  4TZH A;  3O53 A;  2Q4G W;  4FDW A;  2OMT A;  1OOK G;  4BSS A;  3RGZ A;  2WQV A;  4YEB B;  3W3K A;  5AWC A;  4QXE A;  1SQ0 B;  4ECN A;  4V2C A;  5D3I A;  3E3Z A;  2P1M B;  3CIY A;  1OTN A;  4KNG A;  4ARR A;  2JE1 A;  3UL7 A;  4Z64 C;  4RCA B;  4M7E A;  2ELL A;  3WN4 A;  4UFR A;  1FS2 A;  4EZG A;  1A4Y A;  4PEQ B;  2WQW A;  3G06 A;  1Z7X W;  3E2J A;  4Q3G A;  3PMH G;  4FS7 A;  3WPE A;  3WPC A;  3W3M A;  4M7E C;  3KJ4 A;  2P1Q B;  2O6Q A;  4R6A A;  4R07 A;  2OMU A;  2Z82 A;  1M9S A;  3RJ0 A;  2WQU A;  3RW7 A;  2ASS B;  3OGM B;  5HDH A;  3RFS A;  2Z65 A;  4H09 A;  4WP6 A;  4MQW X;  1PGV A;  4GT6 A;  1KOO A;  3RW6 A;  1H6U A;  1O6S A;  1XEC A;  4C2A B;  4Y61 B;  4PSJ A;  3WPD A;  4XGO A;  2UZX A;  2RR6 A;  5CMN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...