2Z65C

Crystal structure of the human tlr4 tv3 hybrid-md-2-eritoran complex
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
140
structure length
140
Chain Sequence
QKQYWVCNSSDASISYTYCDKMQYPISINVNPCIELKGSKGLLHIFYIPRRDLKQLYFNLYITVNTMNLPKRKEVICRGSDDDYSFCRALKGETVNTTISFSFKGIKFSKGKYKCVVEAISGSPEEMLFCLEFVILHQPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the TLR4-MD-2 Complex with Bound Endotoxin Antagonist Eritoran
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Toll-like receptor 4, Variable lymphocyte receptor B
total genus 22
structure length 140
sequence length 140
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-07-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.770 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2z65C00
2F08A 1A9VA 5IJDC 1XWVA 2HKAA 3MU3A 1AHKA 3T6QC 1AHMA 1NEPA 2E59A 2E56A 2Z64C 3VQ2C 3B2DC 2Z65C 3WEAA 3RG1C 5IJCC 3M7OA 3MTXA 3FXIC 3ULAB 3VQ1C 1KTJA 4G8AC 5KWYC 5IJBC 3WEBA 1WRFA
chains in the Genus database with same CATH superfamily
1OGPA 3BWZA 1EXGA 4Z78A 5FO7A 7TAAA 2AXHA 4LVNB 2BSSA 4GRWH 1CIDA 2R29H 2EUVA 3DBSA 1DSFH 1WUNT 2DYSB 1CFQA 4RX4D 4AM0A 4JFFB 4N2KA 1T1WA 3I3DA 4L3ED 2KERA 2FWUA 2MIZA 4YHOL 3U7WH 4ONFL 4CVUA 4FABH 4F15B 2ICWI 5IFJA 2Y7LA 2GPZA 4WO4D 1L6XA 1QYGH 1KPRB 1J5DA 2JKNA 4F57L 3V7MA 1IGFH 4HXAH 3CVDA 1ZANL 1G9EA 4OZFA 5IOPA 5H35A 3K71B 2XWEA 4B9KC 1SBSL 3SKMB 1KB5H 2MTAA 3N9GH 4XXDB 1XGRB 2P3YA 4C57C 3US1A 4QT5B 4YSSA 1AZRA 2NXYD 1HIML 1MI5E 1BW8A 4MA3B 3FQUB 4L4VA 5EZOH 2JKRM 4QHLA 1AG0A 1PG7L 1SDDA 3OAYK 2FHCA 3O3AA 4OZGE 5C0AB 3DOSB 5FYKE 2QEJA 2Y9RT 4JFEA 3V6OA 3A3YB 1OD9A 1T03L 4NQQA 1FAKT 1LILA 5F1NB 4WUKL 4Y7OC 4D3CH 1NCHA 4EZLA 5DT1H 5BO1L 2HTKD 5JORB 4NSKA 1IBGH 1IT9H 5H37G 1E9OA 1OP5H 3RDTB 5TTRA 3BP5B 4MJ4A 3S9DB 3QQDB 2O5ZH 2XTLA 4PJCE 1EHLL 4K3GA 2CMRH 5DK0B 1DVSA 1U91A 1WFMA 2BNQE 1WTLA 4O5LH 1JAEA 2X2JA 3QRBA 5D2NC 5DZ9A 1ADQH 2X05A 3ZHNA 4FHKA 5DT1L 3VMNA 1OVZA 3MQIA 3IWUA 1KCUH 2GQHA 4FXGC 3MXWH 3L16A 1Z1WA 3BUYB 3L3OA 2H32H 3K74B 2OS7A 4XMXA 1SFHA 3T6XA 2YARA 4OF0A 4WWKB 1KN4H 1UT1A 2KZ1B 3PL6D 3T04D 2E5EA 1MZZA 3NIGB 1OE2A 2QVIA 4PV8A 4WDIB 5EU3A 4EIUA 1XAUA 3B2DC 1D5MB 4POUB 3F00A 4UQ2A 1MJUL 3STLB 3WN5C 4XOCA 5D2LB 3MOBL 1N7ML 2WZ6A 2HTLC 1WFUA 3NIFE 3MRHB 1X4ZA 4RRPG 4UQBA 4AGLA 5EULV 1FG2B 3KJ4C 3VD0A 4XPGL 4H8HA 2QGDA 1FAIL 3CIAA 3DXAB 1P7QD 2YUZA 5A43C 3NEOA 2J2ZA 4LEBA 3W3BA 4F57H 2JIXB 1AFVH 2HWZH 3A6CH 4Q6KA 4G6JH 3F85A 2I26N 2QSCH 2XN9B 2PPAA 5H37H 3S48A 2DWXA 3ZN6A 1M7XA 5IMOA 2Z91B 3ECWA 1G1CA 3AG1B 1M1XA 2JI2A 1OGAB 5E9DB 4BDVB 2EIJB 5T3ZD 3ZDXB 5CCJA 1FORH 4JLRA 2DYPB 3WXWH 2VUYA 3KNBA 2DICA 3JTTA 3KBPA 2ZXQA 4MMXC 5C0GA 2DPKA 2G5UA 5T3XD 3FONA 1JS4A 3TNMB 3ULVD 3PDOB 1FL5A 4TXVB 3GK8H 2GTQA 4L1LA 3GSQA 3PQYD 5D7IB 1W72H 4ZJ9A 1X9QA 2CO1A 3QEQD 4CAGA 4Q9RL 1V7MH 3S88H 1D7CA 2YXWA 5EO0A 5HPMB 3KMDA 3S37L 5J11C 1WHPA 4YHNA 2F53E 3SDAC 5C7XH 2JQAA 5ITBH 1VDGA 3IFNH 4E0RA 2IDFA 5A3IC 5J13C 5IB5B 3NJMA 3B3IB 5IVZA 2HFFA 4KI5C 4H8WH 2FEEL 2ENSA 4OZFB 5IOPB 2F53B 2IANB 4XNZB 4PWEA 4H2CA 1UD3A 2YLKA 2CK0L 3G6DH 25C8H 1TZIA 4W68A 3TH4T 3N85L 4ZUWA 5HYSB 2BIHA 4PJHB 2Y5TB 1QFWH 2PYFB 3M1BA 4LSUH 4XMKH 4FLSA 4CA4A 4QGYA 2VXUL 4XO5A 3O4LA 2BVUA 4WI5A 4FZEH 4JB9L 5C0ND 3RL1B 4QIRA 3BW9A 1SRDA 2IPUG 2I07B 4X7DC 1AHWC 4U4BA 3I9GL 3CFUA 2NQ3A 4AXWB 1HH9A 1G9ML 4PD4J 2DM4A 3KPNB 1ASPA 4NDMB 3WSQL 1YPZA 3QCUH 3IDIA 5GGSB 4GT7A 2O6DA 3RAJH 1K85A 4G1MA 4H1LB 3IFLH 1YCSA 3W39B 5ICYB 1PY0A 2ESVD 2J4WH 3OAUL 2YKKA 2JB6B 4PUBL 3FOMB 1W0VA 3ZL1A 4EUPB 4A66A 1UTDA 1IFHH 1I9EA 1HILB 1I9IH 4KZEH 3O81A 4G6KL 5LWYL 1BXXA 1S7UA 5T33H 1SXZA 5KYNA 4TPRL 5FDWB 1JXGA 1UM5H 2ZWNA 1PZ2A 4MNHB 5H35B 1FL3A 1MCDA 4Y2OB 4P23A 4BFRA 3BQUA 3RPIB 3CC5A 5CZVH 3KL0A 4EDXA 1TVBA 3HC4L 1Q0YH 3P9MB 5HHXH 4Q4EA 3FRPG 1ZLDA 1BECA 4X4KA 1GSMA 4UZGA 3CZFB 1JK9A 1KPUA 2UY7B 3D85B 1M9SA 2P8LB 5GJTL 3QJHA 4K3JH 1A14L 1BF2A 3FBKA 3NIFF 5DMKA 3H53A 4RWYL 5JHDE 4I18C 1QSZA 4KK6C 4DP8X 2EUXA 35C8H 4PJ9A 3JZ7A 4ZK8A 3SYOA 3FBQA 1JFQL 3ZHKA 3RP1A 3E1F1 1G87A 1PL3A 1VAHA 3HZ3A 4IMLB 3SBWC 1HEJC 3FCBA 2HXAA 1RJLB 1EAJA 3MV7B 3WUZA 5KS9E 2D3NA 4EOWH 1I4FB 4Z7IA 3GUFA 3CSYB 5CWSB 3V6FA 1WC7A 3QXDA 1FO0L 4K0OA 4S1SH 2AJZA 4W9EC 2WXKA 1OHQA 4L4JA 3BMWA 4BSJA 1UA3A 3F58H 3K4ZA 5DK2A 4Z77A 2A3TA 3ULSA 5IMMA 2P80A 2D0FA 3MNZA 2VLKB 2BNRE 5IMKA 1U8KA 1SN2A 3FB5B 5SWQA 3ZE0F 1JWMA 4J3UA 1QFWL 4LSUL 5JOPD 4BJLA 3EOBA 2J57A 1KULA 2JXMA 2CLVA 4X4YB 3H3PL 1K4CA 5CEZE 3QHFL 1ID2A 1LP9F 1FIGH 4V2CB 4XZUB 5FFOA 2YWZA 4PJ8B 5D1XC 1BX2A 1U8QA 3JTTB 4KPHH 2EDXA 4GUQA 3QUXB 4N0UE 1ZLSL 5EU4B 4KNUA 4OZGB 5C0AE 5ICUA 5F6HI 1UB6A 2PKDA 4ZMPA 4YSAA 2JCWA 4XAKD 3ZTNL 1T1ZA 4FFTA 4KKNA 4YLQT 3KLHD 2DKMA 1UFGA 3IE4A 5CSGA 2KLRA 1OGTB 5TDOA 2D31B 4G9FD 3UZEC 3N5AA 3AADB 3MLPA 2L8AA 2KLSA 3G08A 2NQCA 4JK0D 2WZ5A 1WIOA 1FNLA 4QOKE 1H5BC 4RESB 4BZ2H 3WY3A 3QCTL 1F4XL 1RMFL 5IB4B 3RZWA 1RHHA 2DTML 5LBSA 4KKRA 4UT9L 1JZFA 4Y4HC 4CSTA 2DQDL 2OULB 3K6SA 1B4LA 1JNLL 3X14B 2WQVA 2E7LA 3D3VB 2QV2A 2XCMC 3MLYH 2WBJC 2ZXWB 3LRKA 4B5ZA 2R2HA 5BVJB 5F96H 5EOQH 2AVFA 2BVOB 1DSYA 4PGBA 2F19H 4Y4KB 4WJ5B 2X4TB 4R96B 3QFJE 1CIUA 3UTPE 5TGBB 2CR6A 3QR0A 2ZYIA 2X9ZA 4BEIA 3DO4A 4UNUA 1M57B 3TBWB 3H2PA 3SDCA 2TSBA 5E4EC 5E4OA 4NHUA 4FJYA 3V6ZA 2A9AA 2ICWA 4TQ8A 3HCVA 5HDBF 5HJBA 4N90E 4LAQH 4LKXA 2MNUA 2VW6A 1T7VA 2ZX5A 4S1RH 3HR5A 4U1MB 3UERA 1JNNH 4B9JA 5KVEH 4AUJA 5JDSB 5D7JA 1FF5A 1WISA 3ALPA 2WBJA 5AYQA 2JH2A 2WIMA 2K8MA 3KE0A 3MOBH 4RGNB 3WFCL 4YFLI 3OAZH 3Q2VA 4Y4HA 1E28B 1QLEL 2C3VA 2XC8A 5F21B 3CFJB 5K39B 5FO8B 5AW8B 3KBEA 5B38B 4KKLD 1KCVL 1CFVH 3VFPB 4DTGL 2XT1B 2OXHB 4M5YH 5KVFL 1LDSA 5MEQB 4LCIL 5E7FA 4F92B 4WF7A 3MUHL 4OGAD 3DUSB 4ZMTA 2YHGA 5JHAA 1AY1H 2VXVL 3RL1A 4YSUA 2XFXB 2Q87A 2X4UA 2G2RB 2GKIA 3KHQA 3L3IB 4FF9A 4JAMB 4W9CC 3WFDL 3QO1A 5I8CB 3GXTA 3DOIA 3QQ4B 2ZXDA 5EO1B 3NDZE 3HE7D 5T1KB 1NZRA 5A2CA 5HDOA 3HS0B 2XWZA 1FL6A 2J8UA 3FSZA 1SVCP 2IGLA 4UV7L 5EC2B 5I71B 4Z95H 1CE1H 1MFBH 2VAAA 2XWBB 4L1SA 4OIBA 4N8PA 3RGVA 5FUCC 5D1XA 5BQ7A 3CHPA 5C07E 1U93A 5DVNA 3TO4A 2SODB 3SDXF 1AJ7L 4OGYL 3WEMA 1I7TB 2H3NB 5DMYA 4CKQA 1T3FB 1BHGA 2YFOA 1CPUA 3IKCA 3NDYE 1EHAA 2IF7A 3KEDA 3BHBB 4XGZB 3F58L 5FKAB 5B7EA 5JLZA 1YSOA 1FZJB 2A77L 2OJ1A 5KJ4A 3H0TB 4LBAA 2LU5A 4MAZA 1R3LB 3L5XH 3VFWB 1PLGL 5IB2A 4ZXBA 1RFDL 2R1WB 4HMCA 3K72B 4ZTOH 3HMWL 1ZLWH 4NQEB 4JW3A 3HFMH 4KRPC 2GK0A 2HMIC 2E9JA 1A1NB 3MFFB 4AWJC 3W0WD 5GS1B 1A7OL 2EIZB 1B0WA 1UD4A 4XB3A 1Z9LA 4MJIB 3HMXL 5E8NA 3AZUA 4FA8A 2CGRL 3ZIMA 5ADPH 2BP8A 5JPMB 3Q8BA 4Y16C 2K78A 1KGJA 3HBQA 4ELMA 4P9HL 2DB8A 4BH8B 2YQBA 3DX9B 4CW1A 3L1EA 5D1QD 4YH6A 5F3HA 1JNNL 5CZVL 4ZTPH 5E1GA 1AIFA 2PTTA 3FSOA 2FX9H 5HHNA 1OAXL 4Y4HD 4AX3A 1V7NH 2HN7B 4J3OG 5TQ0H 1PQZB 2C3WA 4GAJH 4LPWA 15C8L 4ZXBC 3ATAA 4OI8A 1XCXA 4P2OB 1MJJA 3P02A 2NSQA 3HI6L 3VFVB 2WUBL 1K4CB 3UZVA 3ZGHA 1SYSB 3DIVA 3F65A 5AL8A 4XO9A 2X0UA 2JWYA 4K2UL 1K3IA 2V5YA 4LDOB 4K94L 4K8RC 4R7VA 3D48R 1MW0A 3VH8G 1RUML 5JHDD 4BZ1L 4P57A 3L4TA 1ZGLA 1I9RH 2NNXA 2ODHA 1JV5A 4HHWA 5F9WC 5EBGA 4MJJA 5E8DH 3IDGB 3RGVC 4Z7WE 3AU1A 1F3RB 1ZE3H 4IU3B 5CP3A 1UYWH 3QG7L 2AK4E 2D31A 5AFAA 4L2YA 4QXUH 1RL1A 4FNTA 1AZUA 2D8KA 2R0KH 4QHNB 5A16B 1GTFA 1NANI 4EVNA 1KXTA 5K5YA 3NH7L 3QJHB 5IW1A 5CLWA 2DQTH 4YSCA 1DN0A 4DQOL 3PHAA 1JPFA 1FWXA 1YY9C 2IIJA 2P1YA 2Z65C 3DX8B 4R4FL 3X3FH 4ANVA 4FQXB 1FA4A 1JL8A 3ZSSA 1KGCD 5FO9B 1AO7E 1RZ8A 2YD2A 3L1OH 4DVBA 3H9SA 4WTWA 1MQKL 4PW9A 3EGXB 1T4WA 5B39A 1GSKA 5HYIA 1NGWB 2P5EB 4ODTL 4PP1C 3ML8A 5JO5B 3QE5A 4NC2B 1BFSA 5LXGH 5CINL 4Q9RH 2UXFA 2IH8A 4NB7A 5IQ9A 1LXMA 2BSBA 4LIQH 5FYLH 1RZJH 2CIIA 3JXAA 2YPLE 5I6XB 3L3IA 4JAMA 2V2TB 3N42B 1J0YA 4YXKH 4V1DA 1ZHLA 4MSWA 1A7BA 1ZLVH 4L8CB 2QTEA 5D4HA 3NGBB 3FU3A 4JGMA 5ANME 3MGTB 2NT1A 2EYRB 2VN7A 3MUJA 2HX8A 1EEUA 2EVJA 3RA7H 4LNRB 1M7IA 5D7SH 3HPJA 2D7TH 3AITA 1E2ZA 2I5YH 3S2AA 1WAAA 2VLJE 5EOCJ 5L0QB 4TNWK 3HB3D 2HAZA 1BZ8A 3GEFA 4TUJB 1I7TA 5E1IA 2YEQA 3O4LB 3DKHA 1XL6A 1GTNA 4LGPB 4GQZA 1QNIA 3PGFL 2A38A 4RA3A 3FQNA 2IALB 4LPTA 3REVB 2DJUA 4W6YB 4MA7H 2WLLA 3AB0B 3MRFB 2JCCA 4Y5XA 5D7LA 2FE0A 1YJDC 2R1XB 1MG2C 1U3HB 4PRPE 1H6FA 1KG0A 1I8KB 3KGUA 4AVJA 5EO1A 3D6GA 2UXVA 1AE6L 4ZMVA 1CD0A 2BSCA 2X4PB 1TZGL 3JYBA 4PJBF 2D03L 3L4VA 1CVSC 2KT6A 3EJYC 2H47C 3ISRA 3E3QE 5INCA 3HMXH 5EO0B 4WFHE 5D93C 4L3FA 3PHOA 3UAEA 4FMFA 1RJZB 1S3KL 1A7RL 4DZBB 2V7HB 4A7VA 4YSTA 4U1SB 1HCVA 1E0OB 1EJ6A 1TQSA 3UFIA 5KOMC 3K7UA 3ISYA 4FQXC 1EXHA 1EV2E 1OP3H 1SLUA 1SLXA 3WKYA 2KZWA 3UAAA 1YMMD 2YBRA 2LVCA 3LZFL 4LCWE 5DHMC 1RJYA 1HYSC 1BVOA 3JSSA 4L2LA 1YEEH 1EDQA 3MUY1 3LKPB 5TDOB 2OTUB 5DTFB 4AQ8A 2YAQA 1J0JA 1KGYE 1YECL 5GRUL 4DOHE 3TVMA 3QRGL 1AGBB 2RTTA 4X6FA 2CIKA 4G6AD 4J3WA 4S1QH 1T1ZB 2J8HA 3HBGA 4GBXC 1E9PA 2WCSA 2MNJB 1L5GB 2BY3A 1U8PA 5D7EA 5TK4A 1CFBA 4YXLH 1J5IA 4I1PA 1L0QA 1T0PB 2AEQH 5DQ9B 2BHUA 2DV6A 3QHZH 1AGFA 3WL9B 3OKEB 1AXSA 3UBXG 4KUZH 1IL1B 4LCUA 1GJUA 1PIFA 2DQGH 1S9YB 5SWZA 2BVOA 1Q94A 3IMRA 1LK2B 1DDHA 2X2HA 4ELMB 1B3IA 1AY1L 5FHBL 4QUOA 1NCGA 1TJHL 5KZCD 1V7ML 5KS9F 2CO6A 2YD7A 1U3YA 2ZG1A 4PCKA 1NMAH 3S36L 2YMXH 5FFLA 4KJYA 4NN5B 1TYJA 2DI7A 2K6YA 5IESH 5DK3A 4AV5A 3DC0A 3KCWA 3WDJA 3SCMC 5CM1A 2A0LD 1NFDF 1HEZA 3L3KB 5FFGA 4QY8B 1A3RL 1BYOA 3LKSB 4G80B 4YL9A 3EJUA 3FO0L 3NZHH 3LEVL 4PJ5D 3CFKA 4UBDD 5DUMH 3ZKSD 2VXSH 2XSKA 3ILPB 4KV5F 3WXWL 4O02B 3ULVE 5M94B 1G9NC 4ADIA 5ID0B 1TTBA 3EH4B 2B5IC 1HZLA 4PJ9B 1AQDA 1J9SA 3IRPX 4HD5A 4WQOA 4Y8AA 2Y3NA 1ZVHA 3BZEB 1CTMA 1YMME 2XQYA 3K2UL 1CF1A 4KDTA 4NO5B 1AD9B 2QMKA 3MCKB 4RFNB 3SE3A 1V3MA 1VHPA 2VDNB 1A3RH 1V5JA 1AIZA 4DEUA 2BXYA 1XH3B 2RACA 3H1ZA 3RVTC 4EPSA 1DUYA 3PP3H 3NJNA 4FS0A 3CDGA 4NPJA 1VKXB 5DK2B 4L48A 1YMMA 1V27A 1CU4H 3QWQB 1WBYA 3KPMB 1HZHH 4XCCL 4YE0A 1U8KB 3IJ7A 5EIIB 3L9RB 3IETB 3DBXB 4YPJA 5T1KA 5BOPA 1DVFD 1R3JA 1CLYH 2N7SA 3Q5OA 4PJDA 4QHLB 3A5VA 2MCAA 4YHZL 5FYJU 1TLKA 2X4UB 1TOXA 4LESA 4ONGL 1WBZB 2G4GA 1RUQL 4PGDA 1AGDA 4XODA 2Y36L 3TIEA 1Q90A 3VVWA 7FABL 3CXFA 1Z9NA 4L8DA 5AOKA 2ADYA 2HFGL 4FTVA 1NBZA 5J12C 3LNHA 3IDMA 4Y19D 1FGNL 1ZS2A 2HT3C 4H8PA 2CRZA 1KBGH 4XCFH 3EYVA 1SJHA 4XMPH 5CMAA 3QJVB 1XGYL 1SHMA 3OKDA 2C9QA 1JHKL 3ZE1B 2C9VA 1P9MA 2KUTA 1A3ZA 5IR1B 5DC0A 1ADQL 3TN0C 5DK0A 1Q0XH 2F54D 1XX9C 3BGAA 5I1AB 4N1HB 1ML0A 5JQHC 1ZA6A 4KZDL 2HVKB 3G5WA 5KYYA 1DVUA 1E4JA 4HXBH 4YC2C 5E5MB 4LLQB 1NCBH 2O5ZL 2A1WL 3MI6A 5D5ME 5SWZE 2Z31A 4H1LG 3PUUA 2F2HA 5FPIA 1IT9L 3TTYA 3EJYD 2ROXA 43C9B 4JHWH 4FCAA 3K0WA 3MUZ1 5EWIL 3H3PH 1M4KA 5F9JB 2UVEA 2YXVA 5DSCB 5I0WA 2E46A 2JMRA 1PBYA 4XWOD 3PXJA 4KXCA 2YOAA 4WO4C 3QIUD 3DROA 3KYNB 1E4KC 3NRFA 4FTDA 2ARJB 5ILTL 1CWVA 4ALAH 4G6AC 1Q8MA 4LP5A 1UKSA 5KYUA 3QR1A 2ADIB 4WIQA 3BLBA 3U82B 4IS6A 5F89B 3TO2B 3LS4H 3VFGL 5E00A 2ZCLL 2VN6A 4P49A 2GIXA 2Q76A 5GHWL 1RQ5A 1C08B 1N4XL 4NN7C 5ESAB 4DK6A 2XKSA 3ETSA 5TF0A 1BXAA 3KPRE 3LPGA 3MREA 4P48A 1FHNA 2Q8BH 1RZGA 1T0NA 3IJHB 4QRPA 3VXTA 4QEGA 5KVMC 3VAEA 3OMNB 1J7VR 1OAJA 4HS6B 2E8ZA 5GZOD 1IGCL 1HXMB 4FG4A 2XBDA 2DKUA 1Z7JA 3ULUH 4K3JL 3CZKA 2AJ3B 4G7VH 4AQOA 5EZJB 1CGSL 1HTYA 3CVHH 4BCZA 4RZKA 1D9KB 5DEFB 4Q0XH 3PY9A 4YDNA 4OCXH 1F4YL 3PNWA 3IBOA 4UNTA 4HJ0D 4LSQL 4ZMNA 2I9TB 3P54A 1EGJH 4WK2B 4XWGL 4A7UA 3K6DA 5HHOD 5AD0B 5F1IB 2ZCLH 4L1HA 1RUKH 4P57B 1R3KB 1VERA 5HVFB 5TFSH 5IWLA 3B2MA 5I0VA 3EYOA 1IE4A 1Z9OA 2XDHA 2Y24A 1PEWA 5DC9B 1H19A 2A6IB 1UUNA 2AK1H 4FE9A 1N68A 4K4KA 3T77A 1FO0B 2NYZA 3LN4A 4DKAA 5CU5A 3U36B 4A6YH 1PTZA 3MRRB 2CRYA 4NWUL 2LW3A 4YIQB 4YEFA 1AXSB 4I8DA 1WZ1L 2QHRL 3EGDA 4GFTB 4UT6A 1HHHB 3EBIA 4FEIA 1P0SE 6CGTA 4I0PD 1P5VA 1KCRH 1JUFA 2NNAA 1MHPH 2J6EH 4XVSL 2XY1A 3QDHA 1HSBB 4AZ8A 4XX1G 5HI5C 2K4WA 4JHUA 3ZDWA 5IIEB 4DKEH 1NBQA 3JWDC 4I77L 2R1XA 4OZ4B 3J27A 4F9LC 2ZSVB 3CDGB 5KBPA 2LHAA 2ICWJ 3CU1A 3QIWA 2KHAA 2CNYA 3L7FA 4XVOA 1E5UI 4ZFOL 5IKCA 2YA2A 3BP5A 1T04B 3L3KA 3P4NB 3QDMA 2JQMA 3AQZA 4JHBA 3GHPA 4PLJC 5BRZE 3GKZA 3MRMB 3QULB 2WXJA 2NX5B 1LQSR 4AENB 4FRWA 5F8QC 3DX6B 2OV0A 1J9QA 4XXCA 1SVBA 4FCHA 1RIVL 4GAFB 1PYWB 5LB1A 4A39A 4WHYH 1G7JB 1L9MA 3RJOA 4UI2A 1YNTA 4RRPM 4O02A 4WI0A 3U9UA 4ENEC 5KYXB 1M7IB 5AG8A 1OK0A 4JFYA 5E8EB 5D1ZC 3BZFA 4XPAH 1MW3A 1E4XL 2E9BA 2NNRA 4HIJA 3GJFB 2FT6A 2JK5B 4LU5H 1W0VB 5I18H 2VDLB 4MA3A 2NPLX 4PBDA 4AW4A 1A4KB 2C9XA 3O6FA 3MTXA 2K6WA 1OE3A 2P4AB 3F7VB 4NFBA 3U4KA 4KX9A 3UBFA 1MW2A 2B4CL 4KK8C 1AOZA 4XMVA 4R2GD 1BZDA 4DKFH 1V7NL 4I4WA 2H2SC 1ZT1B 4JQIH 4PS7A 2AANA 2YGOA 4LLAA 1F4YH 4HKZB 2WWMC 2FHBA 3ESUF 3V0VB 5F88A 1IM9D 3VQMA 5I1DB 4WEEA 4G6FB 2X4RB 4Y8DC 2CRMA 2EE3A 5I8OL 4FQ2L 4KO7A 1USZA 1AFVL 2HWZL 4XPBH 3HNVL 1JVOA 3MV8B 4AM0B 3PWNA 5J12B 3M7FB 1UURA 5E7BA 5I6PA 2O6EA 4WW2C 2VKWA 2AQ1A 5AAWA 3SDAB 4L4VB 5F0PB 2UWEE 4MXVE 5TPWH 3UGEA 1X5ZA 3HFML 1HOCB 4QHMA 4GXVL 1JG9A 3AREB 3BPOC 2OTWB 3I2CH 1E5YA 2VWEC 5C0IB 4TULH 1IAIM 1XMWA 4LEXH 5EOTA 3I75A 3FOLA 1RZIB 1CLCA 4DQAA 1JRHI 4EIZC 1LO4H 2OMUA 2HYMA 1QSFE 1OCWL 1QBML 1RI8A 2A83B 4QGTA 5EN2B 3HE6C 1MHHB 4LBEA 2WLLB 4XOEA 3ZDYE 3ZOAA 4QTIL 4BSVA 1BWMA 3ATFA 4OBSA 3AACA 3GRGA 3EYQD 4E36A 2WLKA 1T2QH 1FZKA 3NSXA 1T21A 4BKSC 5IMLA 3MYJB 4KAQL 1I75A 4PJIE 2OR8A 1LGVA 1G7IA 4LLYA 5EIVA 1AJ7H 4DETA 2ZP9A 3LDBC 3UJIH 2DKSA 3GC3A 2DLIA 2J1KA 4HUCA 5EU5A 4UTAH 2E7CA 2J3SA 1VJSA 1B2YA 4JCLA 3ASNB 1OOWA 1R3KA 3EH2A 4XMLL 4KKBC 4O5LL 2FEDC 4PJIA 5CP7A 3Q5TA 3V0IA 2GIMA 1H6UA 5KG9A 1Z32X 1F6AB 4C54A 1T6VN 5AZEH 5JPNC 3KR3L 1QSFA 3O2WL 5DMGC 4HOWA 5EBMA 1MFAH 3RWEB 5IWLC 4P3CH 2QGEA 3RQ3A 1MCSA 1XGYH 3NSCA 1T4KA 4ODXB 3THMH 1BD2D 5J7CC 1ET5A 3LKSA 4WEBL 2F54B 3FQYA 4NFCA 5DDHA 3RHWF 4GIAA 3UYPB 2F7OA 2JB5L 4DUVA 1J1OL 5KSAB 4A6YB 4Q4IA 5J6SA 4DVRH 1FG2A 3BP7B 4P5KB 4PSRA 3PWPA 3MRQB 1HL4A 1XCTA 3ARFA 1MRFL 2G2NA 4UIMA 2ZUTA 4NOFA 5DFTA 5LGHH 1UQSB 1WBXB 1WICA 3BLKA 3DWTA 2YZ8A 3LAFA 1Q4NX 1R3IL 3QUGA 4JCMA 1XF2A 4OZIB 1R5IB 4KXZH 4UQ2B 5L4JA 3OPZH 3SPIA 2E47A 4E42A 5IFHH 1IGYA 4JY4B 3CFDB 3UTSD 3F3HA 4R3SB 5C0CE 1RLWA 4IRZH 3BQVA 3WGUB 2Z9TA 3QEGH 3WS6A 3UO1L 5E08L 3BDBA 2Z92B 5CKAA 5I8OH 3ETBF 3KGTA 5H2BA 1RXLA 4OIFA 4YHOH 5CCKH 1U8CB 4W4NA 1FFRA 1HSAB 5JQ6H 4Z7VA 2GFBB 3SDXA 2E74C 1GZHA 2XV3A 3ARGA 2WXOA 3ES6B 4PS4L 2VUKA 2EDDA 1PAMA 1KY6A 1KYDA 3B9KA 3WIHH 1E5AA 3TCLB 4Y5YA 3EYFB 3VE0B 4JFZH 3ZL2A 3BPLC 4GUOA 3LIUA 4KH9A 1ITBB 5GPRA 4B9IA 1N10A 4NZ8A 4YGAB 1KXVC 3TYFB 4DKTA 1BOGB 2D2OA 4PLJD 1BLNA 2OMZB 3VFPA 2DH3A 4OFDA 3ZBMA 4JDZA 4S0HA 2ICES 5D93B 4D7PA 4KRNA 1KJ3L 4C56E 1T1YA 5C08A 1AZNA 5C0JA 1UCBL 3SEPA 3GM0A 4YN3A 2XWJB 4KK8D 1DANT 2C8NA 3D18B 4JEGB 4OJFH 3SJVA 2XFGB 2XPYA 5IB3B 4QD2E 2DMHA 4H8UA 2ZKHH 2AF2A 3P4OA 2R69H 2V8MA 1J8HD 3DIFA 1BJ1J 1GL4B 3AJ7A 3BP4B 3NG5A 4OLEA 4U6XA 4UDTB 4WEUD 3W2DH 2ZUXA 1MVUA 4ZMXA 3MUGA 1AC0A 1ADQA 3HMXA 2DI9A 1M9WA 2VNCA 3TZVA 2F7RA 2X6BA 1WT5C 4IKKA 4HSCX 2DJ4A 3EJRA 2ILLA 5DEGB 1MCCA 4IEFA 1SF3A 3KW8A 2ZOOA 4HAFA 4Y9BA 3NCFB 2XRAL 4QRUA 2WZAA 1ACXA 5AVTB 2FO4B 3T8XB 3CHXA 1P1ZB 1GOHA 4XN1A 1UZ8A 2O5NA 5FGRA 3FH7A 3KPPB 4D94A 1YHPA 5CIPB 1XH1A 1OAUH 4Y2DC 5GRVL 5IB4A 3C5SA 4BFEA 1HS6A 4CMHC 5DC4B 3H9SD 4DAGH 3QHTC 1E4HA 4ODUB 2MPVA 2ZJSL 5A3ID 4KOCA 2R15A 4NJ9L 3QI9D 4HMEA 4GKSB 1JOIA 3DYOA 3GIVB 3JTBA 1A7PL 1R24B 4OD2A 2HPTA 4UOW0 4FP8H 4Q7DA 3NQIA 1VFBA 3B5HA 5JOFA 3O0LA 3RGVB 2VLRB 5DJ2B 3L95A 3ARGD 4PRBA 2VXQL 5I1HL 1TTGA 3CQQA 4YDMA 1OD7A 1HHGB 3J07A 1FNHA 3OV6A 2FX9L 3GSUB 5I1CH 3D52A 2X1PA 1DJZA 2QHLA 4K71B 3WENA 3E9UA 2WWKT 5I76A 1BQUA 5ICZA 3GI8H 1QI4A 3TU6A 3VFTB 5I24A 4JG1L 4W6WB 1KJ2H 2WNXA 4XVTH 1MCNA 2G3NA 5DJZB 5A2AA 3T4YB 4PP2A 1KWKA 3COOA 5I9QB 1IZJA 3SQRA 1WSST 3M6DA 4M62L 4YSOA 4A38A 3RL2B 4QHUA 4DZBA 1YLBB 3RB7A 1HDMB 2H3XC 4GY4A 2MSPA 3NFNA 4EZKA 1X6LA 4EUPH 1AKJA 2R0WH 4XNYH 2W9EH 2ZP0T 3UTTE 2EIZA 2WPGA 1E8YA 1L9PA 2ITDB 2V7NB 2I5YL 3B5GA 3L3DA 2DQHL 4G6MH 1XDTT 2LR4A 4JANA 3RWGB 5BJTA 5E2TH 3UEQA 2ENPA 5I6NA 4OV5B 4HFWA 4ZPVA 4BGDA 5LBSL 2R8SL 3MODH 1X7QB 2CDGA 4L9LB 3V6FB 4GI6A 3L13A 3LNIA 3GZOA 2PYEB 3CFCH 3D33A 4CVZB 2R23B 3N44F 2BVPB 4KK9D 3VRLE 4BFBD 4U33A 3DECA 3ZRSA 3D69A 4NHUB 3CV5A 1GYWA 3IAQA 3N41F 3VXNA 2DJSA 3MRKA 4J3OF 1AP2A 3GXPA 1PQZA 4FX5A 4GKNA 3UAJC 4JRWA 2XG4B 4WUUB 1UB6B 3V55A 4J12A 4G5ZL 4XVUC 4BSWB 5TE4H 4M1DH 1NWPA 1HINL 1IAMA 5T1DH 2VQTA 1W2KT 3O3EB 4UV7H 4HKXA 3V0FA 3MOAL 4AYSA 3HRZB 4R4FH 2FUQA 4XZUA 4B50A 3LKQB 3TCTA 1P4IH 3CVIH 2ZD0A 4XO4A 4BFJA 2VM4A 4UOW1 5GXBB 5LGKA 2QKIB 4KFMA 4NAMA 4BM7A 1VSCA 1CLZL 1L9OA 3LZRA 3GBNH 4XE0A 5LGJA 1ZK9A 2VDNL 3MSPA 4J1UA 5FA3B 1S7QA 1EPFA 3QO0A 4DO6A 1KBGL 3FSAA 4R97B 4XCFL 1U4FA 3NP3A 5HDLA 1CDJA 1S9XA 3C9NB 2XWTA 2BSRB 3QUXD 4HSQA 4Y5XC 3A67H 4FMVA 4IIZA 2OXHA 4ZXBB 2GK0B 2UY6B 1NAMA 3OKKA 1IAKB 1KELH 3NCEB 1R33A 4OF8A 3UAJA 3UJJH 4Q9BA 5E2VH 5GGUB 3LNFA 4ZMOA 2GC7C 2DBJA 1JF5A 4X7FC 2EAEA 3VXUB 2C9SA 3FTUA 5ABAA 2BNUB 2MPAH 2X4RA 3ZYIA 4JL2A 4Z7UE 4AENA 4ZW3A 4A2MA 3TBTA 5K9QG 1U93B 2EDLA 3U7AA 3DMMC 1XZ0B 4XTRD 3MO1A 3APNA 2Q2LA 4Y4FA 3WTSA 4AE1A 2Q0ZX 4FQPA 4U4IA 4XNUL 5BV7H 1DQLL 3H3KA 4Q6YA 1S7VA 3MGAA 5I8KL 1AHMA 1WV7T 1OB1A 1ZK5A 1PD0A 3FH8A 2IAMA 2WWKO 3Q2CA 4PJEA 3TBWA 2Y3AA 5FR3A 1NC2D 2X70A 4P05A 3LNDA 4GQPH 4YHPB 3FOLB 5DJDA 3VFSA 1VGEL 4HA1A 1TU2A 5ICXA 1KBKA 4FMKA 4U6XB 5F2FA 4EBQL 3OMAB 4FNPA 1IAII 3C60C 5IJBC 3GMLB 1A21A 1QLFB 2DQDH 4DFHA 3WJJA 1I7RA 2WB1A 4M43L 1S46A 3VD4A 4LNRA 5ALBH 3HS8A 4DVRL 5LHDA 4ORZC 3W57A 1M05B 2B0SL 5IHHA 1C8QA 1ETJA 3AUVA 1HHJB 5E0FA 2ESVA 3BVTA 2Y2YA 1M6OB 4RGNC 3W11D 5EU6D 3U79A 3T8XA 2R1YA 1JZHA 3DJZA 4GW1A 1IARB 1F18A 4QHKI 3L1GA 3IDGA 4QRUB 5TF1L 1B0GA 4KHTL 1GC1C 2I60L 3EZJB 5L6YL 3KPOA 4ANWA 4WKZA 3SY0B 2A0LC 5T5NG 2EH7H 5EBMB 3T0ED 2CWRA 1LO0L 2B9AA 3NPSB 3VXPB 3MVSA 3FK3A 1TF4A 5ACMA 4PYHA 1HDMA 2XQ0A 3BH9A 5LQBL 3ZUNC 3SDCB 1W72B 1PZ3A 3R0NA 2CXKA 4Y7MA 3VFVA 4XE5B 3WJLA 1JPFB 5EORL 4AV0A 3RRQA 4P2OA 2GTWB 2JCCF 2Y1ZA 3G3LA 2YC1A 2G3XA 5EN3A 1KY7A 4PJFB 1IM9B 5BVPH 4QMEA 3PHQA 4WU7B 4X6DF 5EB9A 4QRQA 4U1IB 3ARTA 3KS0J 2BNQA 5GSRB 1SDAB 4AMWA 2VDMB 2OR9L 5FK9A 4LLYB 3WNNA 2I60H 2KPNA 1A6ZA 4HK3N 1ITCA 4C4KO 1H5BB 3VI4A 2JJUA 2WZPA 4PJDF 2P80D 4LSVH 4LOEA 1YNKL 3EO1B 1CFVL 1THAA 4B7LA 3OC5A 4DTGH 1NLBH 2P5WB 1NGXA 3WDHA 1U9KA 4A7QA 3MLRL 4IRSB 2B77A 2CIKB 3KYMA 3D06A 2COVD 1A5FL 4L29B 3HB3C 3B9DA 3IU3A 5AW4B 3NFNB 3BIKA 1BEXA 2X89D 3LRHA 1NOAA 4GINA 2QBWA 3CLWA 4K9EL 1NSNH 5EDSA 3APFA 4AC4A 5E95B 3QG6B 3EFDH 3BIAX 2R39A 1GA2A 5BUGA 1K4DB 3QFJD 3WKMH 5LN8A 5T33L 3VJ6B 5F1NA 1ZLVK 2MKLC 4X98B 3GNML 3GZQA 4WV1C 1A6TB 5MEND 1BD2A 1XGUA 4J23A 2ICEB 2CO2A 4M61A 4RISL 2RCSH 4HK3J 4BA0A 4AJWA 4G9FE 2ZNWA 4JUSA 2V5SA 5INCB 2QZ5A 4TQPA 4OLVH 1DQML 3GIVA 5I8EA 1XCQA 4BGLA 1CF8L 4JQVA 4UM9B 2X6MA 1MHEA 1N59A 1NOLA 3WS3B 3ZZ1A 1AGDB 2YD0A 4IDLA 4HUWA 3ARBA 4H5SB 2H8PB 2XTJE 5L4IA 1QVOA 4JJHA 4XC1H 2GJ6E 3BGFB 1HOEA 4OB5H 1F4XH 1RMFH 3QFGA 5C3TA 4AGPA 4KQ4H 1KIRA 1LD9A 4YSDA 2QDWA 4UZSA 4BIKA 4NJAL 2VMJA 3VWJC 4TSAH 1RJCA 4W9FC 1HHKB 3ZZSA 3L3JA 4GKZB 3UTZA 4D9LL 4OZHF 3HAEA 3R1GL 5F0JB 1J1XH 2DWEA 2H0EA 4FDWA 3GSRB 3BSHA 1LO3L 4UT6L 1FBIH 3L2MA 4FI6A 4Z78B 3S35H 3VA2C 1TYEB 3ETTA 2VUOA 1KWGA 3C87A 2CR3A 1G43A 3BVNA 2EICA 2A9DA 4P5MA 4AM0Q 2EIEA 2P46B 1ET7A 4MAUH 1WD9A 4IHBA 3DETC 3ELAT 4NWUH 3DIFB 4G42B 1EAPB 5HP5A 2F6AA 3MROA 4N2HA 5DCCA 1JV2B 4URTB 4K8RH 2R8SH 1J11A 4TV3A 4JVWA 1S7SB 4GRMB 5DFVD 1SM3H 3QB7C 5J4MA 4U1LB 3T0WA 5C0BB 1S6NA 2E75C 1MCPH 4MXWH 1UACH 4G7RB 4M93C 3CLFL 3LS5L 2R0WL 1DQKA 2I7OA 3ARGC 1D5MA 2JFCA 2EXYD 1TIUA 3FCGA 1L9QA 1KPVA 4HALA 1MSPA 3WFBH 1BQRA 3NT0A 5CJOH 1JYWA 4GG6E 3GMOA 5SWSE 2NY3B 2FJFA 4JFDB 3LQAL 4P46A 5CD3A 2DTSA 2XWCA 15C8H 1RCYA 5DJYA 4DP5X 3TL5A 2NR6C 4FFYH 1L7IH 2B8OT 2WMPB 4MMXB 4NENA 4K7PX 1GJWA 1MCKA 3SOTA 3KLAA 3ZMNA 1U8OB 2Y0SA 1ZTXH 4HLZH 5D8JL 4LSTL 3UC0H 2F1AA 1TQTA 2NXYB 4JQXA 4RDBA 3I6KB 1U92A 1R3IH 4OZIF 4BELD 5LDSA 1MUJB 4HFUL 2N7AA 2VLRE 5DEZA 3SE8H 4N8CL 4GS7C 2EXWD 4XI5C 5CFHA 3K8KA 2W38A 5BRZB 4E9WA 4HUXA 5I1KH 2WSKA 5JORA 1DVXA 5E00B 2ZUVA 2J55A 5T3ZH 2MCPL 4ONHA 3RZCA 3TBSB 4FHJA 4QXTA 1KPRA 2AV7A 5HSFA 2SEBA 2N1KA 3NFSH 3TO4D 4Z18A 3ZKMC 4JRFA 1OCCB 1NC4D 1O7DE 3HMWH 4ERSH 4IYKA 5EWIH 4AYFA 4AQ1A 4H40A 1D6EB 4L9LC 1YC8A 3AT9A 4G43A 1GGUA 3WIHA 1AQDB 5D1XE 1G7HB 1XGRA 1E9PB 4KNQA 2L4OA 1PY9A 3GXNA 1IQWH 2E86A 3FC8A 5D7HA 4ABQA 2B7DT 4FL4C 1EHLH 4BH7A 3M8OL 2R29A 4MLIA 5F3BA 3DDFA 1NPUA 3IPBA 4E68A 1RJYB 3TTSA 3HRZC 2WW8A 2J2ZB 3K6IA 4EN3D 5KBMA 2JKTM 3O41A 4NSKB 5E6RB 4FJ6A 4WSGA 1WAAE 2VLJA 4WUKH 2HVKA 4Z1PA 4K8RD 1PFOA 1I31A 1SEQL 3FQRB 3OTTA 4HYTB 2EEAA 3CZFA 4ZUSB 4UOZA 4PFEA 2APWA 2AKRA 1QO3A 2AZUA 1FLTX 1NGZB 2EH7L 5DGRA 4YZFE 1UB5B 1FUNA 2R59A 3HE6A 1KCWA 3I84A 1DBBL 4LHJB 4F8NA 1Y1DA 2H26B 5EA0L 4AUYA 1QKZH 4OLXH 2NY4D 2QPSA 1ZS8A 3PPEA 3D4ZA 3KYNA 4IS6B 2WXQA 2XI9A 4XCCH 4N2DA 1W72L 3P0VL 5KYUB 3CSYA 3T0EB 2BPBA 2O5XL 5IEKA 1M71B 3QWNA 3A6BH 4TQEL 2GBAA 5AAMA 1ZOXA 4M6OH 4MS8D 3G6JB 2IAMB 3IU4H 1NFIA 3QUMA 2IGTA 4PR5A 4X0NA 2IWKA 5FGBC 3CFTA 3PDDA 5DJDB 5I8EB 2Q8AH 4MXVF 4LHUD 4D2NA 4ACPA 4NYLB 1BIIB 4PS4H 4ODHH 2V9UA 4OW6A 4P07A 3W5NA 4J4PA 3S36X 2NX5A 5L2JB 3LEYL 4JG0H 4G71B 5CCKL 1KYOJ 1V3LA 1PPIA 3H7LA 4D8PB 1ZLUK 4B3VA 4DW2L 3K80A 4PJ5B 3MLUH 1DCEA 4M1CC 3BPCB 5AOMA 2CLZB 4FXKB 1WBZA 2L7JA 2HSIA 4MS6A 4GG8A 4ZUUB 2YBGA 3K5RA 5EU7E 1GAFH 4P3DA 5CAYB 3MJ8B 5HGDB 1G4RA 3IGAA 1FH5L 2IDQA 4XCEA 2G9KA 3X1FA 4DWHA 3FRPA 3QFDB 5FM8A 3ZYZA 1FV1A 4KKBD 1MJUH 1HHHA 3GTVA 4P5MB 2W07B 4XXCC 3X1NA 3DBXA 2W1NA 1I3GH 2NW2B 4R90L 5FEBA 4JRYA 1T89A 1ASOA 4FFWC 3RY5A 1R75A 3FUFA 4NKDA 5HVHC 2AEQL 2LU3A 5IP4A 4AKQA 3FU6A 4HF5H 4UT9A 4M5ZH 3SKUD 5FUCE 1NCWL 3EYQC 5EZIH 2EO7A 3U46A 3GRWA 1KIPA 3H4HA 4NQDB 2GTWA 1INQA 3KR3H 2BMKB 1YYLL 2DQJH 4N2OA 1RIUL 4ESKA 4P2AA 3AAZA 5IEHA 2Z64C 2YPKB 2J5WA 1KB9K 5J56B 1G5GA 4X5WB 2Z4TA 4KKLC 2NCMA 1CFNA 5DYFA 4CADB 4HQQL 3HVDA 2PO6D 4PLKC 4E41D 4PY8I 1A8ZA 1KJVA 4DGWC 4PRIB 1BJ1H 1GMIA 3MNVB 3DO3A 2CK2A 3BT0A 2CUMA 3MNDA 4IMKC 3TFBA 1NPJA 4AQ1B 4GKLA 5BZWB 4JFDE 4XP6H 3TZVD 3TEWA 4W93A 3MFGB 4F5CE 5KSBF 3VW3H 2Z1KA 1S3KH 2ADJB 2EE6A 2K9UA 1ZWIA 3MMEA 2E8YA 5ESAA 1QWUA 3EGDB 5DRXA 5IW6B 1K72A 5T5FH 3WEXB 1WFJA 5K1VA 1GJIA 3O3DB 5AVQB 2PWDA 2WQUA 1A6VL 2Y69B 4GXVH 4LQFH 5E5RB 2OP4L 1HAWA 2F18A 1O9VA 3VJ6A 2ADIA 3ARSA 1RSFA 5G5DA 4XBEL 1V3KA 1U92B 3VNYA 1CFSA 2OSYA 5IK3B 3LRSA 1JZ2A 2CD0A 3D3VD 1RVFL 4DP6X 2FZ3A 4E2OA 4EJ1C 1MJ7L 4APQD 3EGSB 1TU2B 1BVLA 1TMCB 1OPOA 1A14H 1JZIA 1N19A 2E27L 4Y4KD 1TQVA 2E4FA 3QI9A 2EDQA 2IO5A 5JNYB 1N2RB 1OARH 3HC4H 2VAAB 2XWBA 4XBEH 2XZCH 1MPAH 1HQRA 2GB2A 2GCYB 1FL6B 2J8UB 1F58L 2OP4H 4GMSL 3BRDA 3M1CA 3MA7A 2CHXA 4TOYH 5C0NC 5E1QA 2I7SA 4N3TA 1SXSA 3CBJB 4WTXA 4XBGB 3HR6A 2AC0A 4F7PB 1TFPA 4I5BA 1JPEA 3DK0A 3UBXB 5D2LF 4ATWA 3BDYH 1A7PH 5D2NA 4YXKL 3DGGB 1E67A 2CCWA 3LDBB 5A2KH 4F80A 4NRZB 4CC1A 1U3NA 3S3CB 5FYLL 5EZLA 2HFTA 3M7OA 3S97C 3L81A 5DS8B 1L3WA 2EDJA 3W82A 4QR7A 2WXNA 5DD5H 2WLHA 5CBEB 5KSAC 1FNEB 3IE9A 1H6EA 2WXGA 3KW7A 1TKWB 1Y0LA 3ARYA 1LE5A 1PX4A 3N04A 1DANU 2R51A 1AZVA 1CT8A 1U8HA 2PPFA 2HJFB 1J86A 5GIRB 1LEGA 2MRYA 2YC1B 3IF1B 1XSKA 4XVJH 2K4AA 4RIRB 4YXHL 3QFJA 4M29A 2EDMA 3GEWB 2FBJH 1IM3A 3RI5K 4PGCA 2XLLA 1IBFA 4JZNA 1GHFH 4W9ZA 5GGSY 5HHQB 5KSUB 2AI0H 1ZXKA 2R56L 4MB1A 3O9WC 4MNGE 1HFUA 5DI8A 3LN5B 4AMKL 4R90H 2XKNA 8FABA 1J05B 3QG7H 5JA9A 3CH1B 1CS6A 5CIPA 4EKXA 1IV8A 3FAXA 3DX7B 1EAOA 2VR5A 4FFVC 4HKJB 5FHAH 1CLYL 2C7UA 3QXVA 5IVOA 3RTQB 3I6GA 1X44A 3VU2A 4N5ED 3MJ9L 2IWGA 2MQ0A 1SYVA 2LE9A 3TA3B 1HL5A 1FRGL 2XY2A 5D7JB 1QFPA 5KSVB 2BSED 1EFXD 2X2UA 4U31A 1G6RB 2C5DC 5KWYC 2VN5A 2CHWA 5FB8A 4JN2B 5BMFL 1N64L 5JIPA 4QRTA 3KWUA 2BC4B 3APMA 3EFDL 1F58H 4WW2F 4HU8A 3MRNB 3ROLB 3ET9F 3C09C 2NY3C 5TGBA 1AC6A 4WI2A 3K5SA 4Q0XL 5JIQA 3HG1B 3EIFA 4PGBB 2HZHA 3DUSA 2MJWA 4HJIA 3T6ZA 4FAAB 4JRXA 3R8BB 2C3HA 2VLKE 2WP3T 2DBLH 4GP4B 2ZX6A 1IGCH 5E08H 4R8WL 3BPOB 2G9HA 4LSSH 1HXKA 2IJ0C 3O45B 3PJLA 2V3EA 5AUMB 1XHHA 5FUOL 4YDVA 1N6UA 5F72S 4RFOL 4A6YA 1I8LA 4DZ8B 1BLNB 4MJ5B 1T7ZA 4EXPX 2XV2A 4X9HA 1UCTA 4B9FA 2F54A 3HG1E 1EZLA 2VW4A 3UPRA 4MQ7A 5IBTH 5KS9B 4KVNH 2IAMD 1JPSH 3MRGB 4JFSA 1J0ZA 4NUQA 5H94B 2F61A 4ISVA 3TCXA 4A7TA 1X5MA 5JHDB 4LSRH 3QDJA 5DRWA 2PW1B 1XGTB 1MFNA 2EZ0D 1YEDB 1NCTA 3JUZA 5K59E 2YPLD 4S2SB 5HHOE 4D0DB 3QQ9C 1H6TA 2IBGA 4GPVA 5FF6A 4XNBA 5I1AA 3N40P 1CGXA 1QFOA 3CNKA 3BD4A 5I26A 4HUVA 3QDGD 1CE1L 2YEVB 3WJMB 3JVGA 1QW9A 2BRRL 2VITA 4X2UA 5T1MA 4EF3A 2EILB 4KK5C 4MDIA 5FGSA 4HXBL 1PSKH 3BWAA 3TURA 5DUJA 3F6LA 2WOYA 4PJ7B 2MEJB 2DZEA 3WHE1 5KEZA 4HJEA 3QUZC 5J8OA 5GGVL 1CYWA 4PJ8C 5D1XB 5DUPL 4ZYKB 3RGBA 4O02H 3REVA 3PJSB 3FUNA 5SWSD 3HC2A 4S0SD 1ZLEA 4M6NL 1OALA 4QRPD 4ZW7A 4QXWA 4RLDA 3DTXB 2W81C 5JUEH 3KEHA 4NZUL 2WQRA 3AREA 1M56B 3B7TA 4QTIH 4E9YA 2CA3A 4UUJB 4IBQA 1LO4L 5JZ7C 4N24A 3VXUE 4XPFL 4Z7WF 3LQZB 4Q14A 3VM5A 5C0JB 3PAYA 4ABVA 1WLHA 1MJJB 2VWEE 3DX1A 1MRCL 4HUKB 2COQA 4JPVL 4M56A 2PP9A 3DGCR 1EJOH 3I9PA 4TNWF 4OM0H 1Q9LB 1G0XA 5AVVB 3U1PA 2GJZB 3P3UA 2D3VA 5FKPB 4F58L 2OSWA 4LLVB 3OZLA 1I8UA 1X5YA 3LHPL 3E6HB 3BQUD 4KU1A 4KJPC 5F7KC 5GS3A 4DKDC 4IEFB 4WVRA 3CVBA 1MH5B 5B1CA 3UGUA 3TNNB 3T6VA 2HRLA 4U7KA 3FF7A 5DHVB 5E2WH 5ETUB 1MJ8L 4IRSC 4OZHB 1B3JA 3H9ZA 5F96L 3BPNB 3SGEH 1AXIB 1ET8A 3SGKA 4LRNH 2Z1PA 5GIRA 1SYVB 3TA3A 3QDJD 2RQEA 3QZOA 5D1ZI 1WFOA 3QAZB 4HUNB 1DBKH 3ZE0B 2ENYA 3QUZD 2X88A 3KH4A 3OJMB 4K3DL 1DDTA 1FRGH 1FSKC 3LSOA 1VEMA 3ZIYA 4HH8A 5CJQL 3S96B 1RZJL 3QDME 4LU5L 5DLLA 3MJ9H 5DURD 2FEJA 5IFJB 2X7LA 1V54B 5JIIA 32C2A 3H2QA 4UB0L 1GS6X 1EDHA 2Z8WC 4JO3L 4NNPH 1OGAE 5J9PB 1KN2H 4P9ML 4LFHG 5DI8B 3RY6C 4XMZA 1JTOA 1V55B 2BCKB 4WWKD 4HZ1A 5F1OB 4JN1H 4A1RA 3OL2A 3UTTB 3CN4A 2XV6B 3MNVA 3ARBD 2R56H 4NN7B 5H2BB 1HINH 2OCJA 4HJUA 2P7TB 4P9HC 4QF1B 5FYKL 1KJVB 2DH2A 4PB0L 2DQTL 1OT4A 3LKQA 4L3AA 4RDQG 1XF4A 2DWTA 5DC2A 3U1QA 1ORQA 1MREH 3TJEH 2XA8H 3QSKB 2ED6A 1BP3B 3EUUA 3R19A 1YEIL 4F2MB 8PAZA 2FJSA 1F11B 1SMOA 2CUHA 3KWVA 4LCWB 4XN5A 3ZO0A 4OB5L 3ROLA 5CBEA 1YN7A 4IKIA 3DGDA 4M9OA 5IW6A 4F7MB 3U0WL 1BXVA 5FYJD 2NZ9D 4KZ0A 3RWCA 5FECA 3U2SB 4ERSL 3SKOA 1H8SA 3BN3B 1UOKA 4QRRE 1X7QA 3CSBA 4PWJA 1TETL 3PLYA 4KXDA 3TH3T 2A9MH 5ABDE 3VMOA 3U0PB 1JZ3A 4XNXH 3ZDZF 1S9VB 5I30H 4IRZA 3PV7A 3L5WA 1HCYA 5DJ8B 2B59A 3HI6H 5TDPB 1G94A 4BV1A 2NDFA 4PRIA 5C0FB 4M1GH 4UIKL 1M1XB 3O45A 2GCYA 2DM3A 2C9AA 2JJTA 1BM7A 3EBHA 3DHUA 4JFPA 4JQXC 2NLJB 4JDTH 5DJZA 1N2RA 3VYOA 5CJXA 5FV2A 3TYGH 4WTQA 2QQKH 1ZTXL 2WIIA 2HG0A 3DMMB 3INUL 2YJQA 3WIFB 1G7QB 3QPXH 2VRKA 2I32A 5KVGL 1DLHA 4U6HA 1N12A 2GYSA 4UV4H 3LD8B 1IEAB 3MRIA 1QHQA 1VEPA 1VEOA 2KYIA 3L2LA 1RVFH 2PW1A 2WHVA 5JW3H 3LYRA 5K9OB 3B1TA 3MRHA 1FJ1A 4B3EA 2Q6WA 4MVBC 4YR6B 1TETH 1S7UB 1X9RA 1N6QH 2YMOA 1W0WB 3SGDH 5IQNA 5GGRY 3OKOB 4MMZC 3RA7L 2OW6A 5D5MA 1DCLA 5DJ0A 1U6AH 3OJDA 4OCYH 4UILL 3QIBC 5F9DC 4ACTA 3DROB 4R7LA 3IS1X 3X3GH 1ZPLA 2H4EA 4IBTA 1DVFB 2AEPH 2BFGA 1QHPA 3GSXA 4MD0A 4OF7A 4PJFE 4WWKC 1KJ2B 4UU9A 4C56B 5BOJA 4FNUA 1BAGA 1UG9A 2NY7H 1G0DA 1E40A 4MXQC 4S11A 4Y1AA 1RP8A 2DWEB 2HPOA 5FYJL 5KJRL 5A2JH 1JF1A 2GHZA 1J48A 1TTCA 3V4LA 1J05A 3PFQA 2YD6A 1TNNA 3BAKA 2IADB 2G0LA 3MBEC 4OV6F 4CRPA 5HD8C 3C5ZA 3S35L 3SCMB 1XO8A 3JWDH 3P9WB 1H8NA 4HIPA 4L5FH 4R7NB 1HNFA 3QPQC 3T3MF 5C7XL 3WFDH 1UZ6E 4KFZC 4NM8L 1DL7L 3MGOA 1RV6X 3ZPDA 5E4IA 4BFOA 5HBBA 1DVYA 3BCDA 4PJAF 2DI8A 5DQJB 4ELKB 3HLKA 4PU2A 2B3RA 4H25A 1BM3H 4GB9A 4WY7H 5DZJA 2H8PA 3W39A 5CSZB 5KBDA 2YAHA 1SDDB 1X5GA 1U8HB 5A40E 2I24N 2CUAA 3FOMA 3ZYJA 4GP8B 2VC2H 5AAPA 2HJLA 3TVMD 3WNJA 4Z7WB 3QEQB 8CGTA 1X9LA 2QKIC 3O3BB 4YPGB 3HUJB 5H4YA 4BRJA 1OW0C 2IPTL 3ARBC 4IMLA 3TA4D 5MI0C 1V3JA 4OZIE 1YYMH 3JV6B 3SB3A 5C6PB 1Z66A 4M6MH 1WBYB 3KPMA 2HKHL 3NAAL 2ITFA 4AQEB 1BF5A 1RUMH 1VFOA 4F9PC 1FO0A 2DDQH 2R4SL 4CSZA 3M07A 4LAJH 4PJHA 1KPUB 2UY7A 4X9GA 2NTFA 5E4AA 4R7DB 3UO8B 4H20L 3FTVA 4YVNA 4LAQL 1IIIA 2YUVA 5BV7L 3FB8A 4X7TA 1T22A 3CX5J 4HPHA 3ESNA 3V0WH 1YNLL 3AB0C 2YGQA 5IIEA 5IJCC 4X6DA 4PJXE 1D9KA 1HSBA 5IQOA 2HX7A 4EUPA 3VGBA 3VU1A 4YHNB 3FQUA 5T5FA 4YDZA 3RVTD 3LY6A 4K5MA 5K1JA 1CFTB 4YUEH 2VC2B 5GZND 4AW7A 4XPFH 2V37A 4FG6D 5F9AC 1XCQB 1IGTA 2BVQB 3Q8EA 4EE2A 3U9PH 5I15H 4M6OL 4GXUN 4Y2DB 1U3HC 2YRZA 1PYWA 5LNGA 1II4E 1H5BA 1G5AA 1XIWB 1TJHH 2EDEA 2AXFB 5HYSA 1MWAH 1NFDA 4MKTA 3N55A 1DL7H 4O02L 3SO3B 4B5EA 5J1TC 4QTHB 2X6AA 2OLDA 1P4IL 1FYTD 2QPDB 3SGJC 1W72A 3VD1A 1EWHA 4W9HC 1U8OA 5BVPL 4KXAA 2CJ3A 2FJHA 2YRPA 2LAGB 2Z7YA 3HPLB 4HD9A 1ZLSH 2YIHA 2OYLA 4JJOA 4I3RL 4KJWD 5T1KD 1QD0A 3ZO9A 1JK8A 1QW8A 1KIUB 3X2QB 1CG9A 3HLAA 4TNFA 2ZSVA 2OJEA 4JRXD 3V5HB 1VACA 3L5WB 3BWUC 4RX4A 2KQMA 5ENWA 4KRLB 1A47A 3U0PA 5HVGB 4ANXA 4ZFFB 2VGLM 5C2UB 5AKTA 5L7XL 3O2VH 2GSGA 4POZD 3D0LB 1KTJA 2NZ1A 2BP3A 2PCPA 4PEEA 2CM5A 4X6CA 1I1FB 1RERA 1IB5A 4LFHD 3B6SA 1MFDL 4F8OA 5DJCB 3ULUD 4MNHA 4P2RA 3EOBB 3FU7B 2HT2D 4UNIA 1I7RB 3TBVB 5GS0H 1VESA 2V17H 5DO2C 1EEYA 4XP1H 3FFCB 3OG6B 4N5UA 2MCMA 3O4OB 2QQLL 3UAJD 5DQDL 5IUCA 1SZNA 1GC1H 1UVQA 1EAQA 3SDAA 1KCSH 3VG0L 1H3WM 2A4CA 1PZSA 4RGNE 1D9KD 1JGVL 3VSVA 5AD0A 4I18A 1AANA 1JI1A 5FW8A 2D03H 1Z5HA 1KFAL 4OJAA 4UINH 1ANUA 4TMPA 3U2JA 1F13A 4JKMA 4QJ3B 5DVPA 3B5TA 4O2FB 1F3DH 4MAYC 3S7GA 3VXRE 3JWOH 5FUZH 3VXTB 3UP6A 1RIHL 4DP2X 4HS6A 4JRXE 4TPRH 5I1HH 4XNUH 4Y4FC 3K2IA 4EI6B 1T5WB 2A6DA 3MBEB 3RDTD 4G9FB 3FCUB 3LQAH 4FOMA 3MCLL 2YN5A 4WHTB 4L18A 3CZNA 3LXCA 4FL4B 3QIWB 5EU7C 4YHIA 4F91B 4M7JL 1IEBA 3DVGA 4QXGH 5DZPA 2C26A 1KFGA 5J89A 4KNSA 4GRLB 2DDQL 4IKLA 1S7RB 1EAPA 1Q72H 5E2VL 4Y89A 1O75A 3T0VA 4L4VD 1AHWA 1BMZA 3LZLA 5BO0D 1XGZA 5CEXA 3ARZA 2RBLA 4K8RL 2VB5A 4ZRGA 1E7VA 3GMNB 4PG9A 5DWPA 3T8MA 1H9DA 4OLZH 3MRRA 3UBGA 4NO0B 2Q20A 1RZKL 2P24A 1JPTH 3G6DL 5CINH 1TZAA 3GGWB 3RFRA 1JGDB 1JGLH 2OAAA 1M42A 2BWDA 1BQHG 2FBJL 3HS9A 2AK4A 3RIFK 4ZUVB 1MI5B 5E23A 1MQKH 2IVFC 2IDCA 1TQBB 2WVVB 4HKBA 4OCWL 5JW5A 4NBXB 4PI2A 3ARPA 1WF5A 3BUPA 3HN3A 2VLJB 4WI3A 3VRLF 4FQCL 1A3QA 1TTRA 1UT9A 4IW4C 4YDIL 4PLNC 4HEMA 5T1DL 1XD1A 3RYMA 5D72H 2C1OB 3CQFA 4A7GA 1VA9A 3RVVC 2W80C 1QI3A 5HGAB 2BW5A 4G5ZH 2MHAB 3VRIA 1B88A 2AJXL 4Q89A 3QHFH 4ZX5A 2P47B 5C0CD 2MMXA 5CBAA 4N3UA 1FVEA 2QPEB 1JPTL 1YN6A 4L23A 1F00I 4LNVA 4Z9KB 4A04A 3FT3A 3WTUA 2PR4H 4UM9A 4CU6A 2AEPL 4QTHA 4R26L 4M93B 1S9VA 1W9XA 4PGZA 2TSAA 4H5SA 1YY9D 4A2DA 3ME0B 4JFFE 1ZHKA 1I9JL 5EBLB 1BD2E 4ZZFA 2FLBT 4Y4KC 1NGWA 1QG3A 4EQ3A 4KGJA 4UCFA 1RZ8B 1E8ZA 4KTEL 3B2VH 1EGJL 4OCSH 3MV7E 3CN2A 5HJGA 1BBDL 1QHOA 1CL7H 1IEAA 3MRIB 5KYWA 1PX3A 1JFQH 2BIOA 1U8IB 3HTLX 1RPKA 1KNOA 3ZTCC 4E9LA 3RIAF 2E27H 2HB0A 4Z76B 1G7PA 3UIZA 2Y25A 2EDFA 1MJ7H 3B8SA 3OM3B 4UTCA 3SPGA 5IV2B 1W8EA 1X7TA 5MEOA 5B3NA 2OMWA 3VDCA 1KACB 2AS5M 3MX0A 2V9RA 4N9GA 4ZPTA 5DR5L 2QPFA 5D4QA 2OQJB 3WLWC 4MJIA 1UUSA 3PAUA 2YQ2A 4K9EH 4RMBA 3ZGIA 1DBJL 4NQCB 1PNCA 5DJYB 3O3UN 1S7WA 1JV5B 1IGIL 2R0ZL 5L9DL 3KYKL 3KPSD 2WQXA 3OKOA 2VXQH 4UAOB 5CSBA 4HAKA 3NCMA 2Q3AA 5ACZB 3BI9X 1JD7A 2LLLA 3BKJL 3DRTA 2XPZA 3P9LA 4JO1H 4PUBH 4RZCA 5C0RH 1PG7W 4PJXF 4Q2ZB 1USQA 4P2QA 2VQ4A 2AK4D 4FFZA 1TNMA 1E9QB 1NWOA 5C0BA 4KJQC 5AW0B 2F0CA 1IGJA 1XEDA 5EEZA 1WEJL 3CHQA 4IBSA 2NTSP 4XGZA 1B6UA 2VZOA 1Z0MA 3N43B 5BS0B 2B2XL 3D07A 5LGYA 3QARA 5GGRA 4BKTC 1C5DB 5GS2D 3ZDYF 3BFOA 3IGLA 5TDNA 4JFTA 5HGBB 4IOFD 2K3HA 2D3LA 5B39B 4WV1B 3FU9A 3KM2A 5L7XH 1ERNA 4PGCB 5AZ2H 3S3BB 4XMLH 5M7QA 4CDGC 25C8L 4P46B 5T3XH 1L9RA 1M7DB 4FQQB 2JI3A 2QSVA 4HF5L 3L4ZA 4CN1A 1JIBA 5HHVL 5MENA 3N0PB 1AXTL 2O93L 3ZJAA 4TYUA 3PV6A 1EO7A 1NCIA 3N1GC 4O4YL 1Q9WB 5GSVB 4AQEA 5EUKA 4HKJA 4GG6B 3S37H 1HIMH 5A16A 4JG9A 1OSPL 1PS3A 3I3EA 4DP4X 3NOIA 1GVIA 2IAAC 4Z5RA 2O72A 1F90L 4OF6A 3SY6A 3ABZA 1DR9A 2JKIS 2X4PA 2F74B 4HIXH 4YFDB 2UWEB 3BKCH 1BOGA 2KKQA 4HPYL 4JZOB 3O6LH 4M9PA 4P8QA 4UT7H 2IOMA 5BJTB 4LCYA 3WTTA 1IBDA 5JO5A 1KXVA 2Q9OA 5ALBL 4HBCH 3PXLA 2H6PA 4PJHF 3WKNA 4WI6A 3IMWA 4DGIL 4OGAC 2J1XA 2NMSA 5KVGE 1JGEA 4J39A 4BK5A 2JCCB 3N40F 1JPST 2APSA 3C5ZD 1F2QA 6TAAA 2CCLA 1Q94B 1U3JA 3WV0A 3BISA 1O7VA 4HWEH 4HH9A 3P4OB 4U05A 5DLMH 1NA8A 3FCSA 3GDBA 2XG4A 4KVPA 4WUUA 1N64H 4P5TD 1CK0H 3UP1A 4C58B 2XN9E 4CKVX 4G9DB 1VFAB 2HUEA 4R3SA 4RMWA 1FLRL 3WEOA 4PJ6A 4F7KA 4ZQKB 1UZ6F 3BD3A 5IESL 3STZA 4A63A 4F8PA 4HWBL 4KDVA 2RFXA 4QKXB 3EJZC 3MLYL 5GS0C 1RK0B 5E6ZA 3GUTB 4OLXL 1SN0A 1KCKA 5KW9H 1FVDB 3QXTA 3ASOB 1WZKA 3MBED 2BSRA 3ZKXC 5B8CC 3D2UA 3PGCB 2HP4A 4JZJB 2PP8A 4PRNA 4WK4B 3MHZA 5AW2B 3ZU8A 1AACA 1IBYA 4HWNA 3OHXA 2Q3XA 4I0PA 4L05A 4P99A 4XNQA 5DD6A 4IBUA 4ZD3L 4K5LA 2CE6A 1YDPB 1TUPA 1IC4L 1MFEH 3RTQC 2ATAA 4OLWH 1X5AA 4JG5A 2ZUUA 4CADA 1RU9L 1SEBB 2XZZA 5FCSH 2V3DA 3ZTNH 4EDWL 3OR7A 3LPWA 4AI7A 5CU9A 1WFIA 2D73A 3B83A 4JDEA 2NY4C 4MD5A 3VGFA 3PJNA 3QIWD 4MCZB 1TDQA 3V4VA 1JZ4A 1L6PA 3ZE2F 1BZQK 3VCLB 2FIRT 4IMKA 4GKNB 4QHPA 1MHPL 3O9WB 2X1QA 5FOJA 3C09B 1M3IA 3P0YL 4X6EB 5JOFB 1E5ZA 3DIDA 3G6AA 5JIMA 1DN2A 1DEEB 1S7VB 5HGHB 4LB8A 4HC1A 3C60D 2VMDA 1ILSA 4ZFQA 4OAWB 4HIIB 3RZCD 3V2AR 2IPKB 3FTYA 2BHFA 4XP9H 2HLAA 4P4KB 2G4EA 5HD8D 1GZPA 3II3A 4NUGL 1KXQE 3EJJX 4G8EA 5IB1A 2VDRH 3AWEA 5BRQA 5C0EA 1R5VA 1I1YA 2PO6B 3P4MA 3DARA 3RTQA 4KVNL 4JPIB 4JDVA 5GGVY 4UYPA 4DN4L 1AE6H 5SV4A 3EUDA 4Z3IA 5I66A 3QW9A 2AGJL 1DJGA 4N6RA 3KPPA 3EDFA 5K93A 3RL2A 4LSQH 4RFNC 3OHXC 5TPWL 1E8XA 5JW5B 2VABB 2NUTB 4YE4H 3T2QA 4BUGA 5DR5H 3CBKB 1DQDL 3IJSB 5D70L 1IGFL 2AAAA 4GH7B 3HC0A 2H3KA 3BSGA 1QMUA 1ORSB 2BC4A 2PNDA 3L4UA 2J25A 2DQEH 3IJYB 3U7WL 4CVXB 4OGXH 2BNRB 5AALA 3ML9A 2OMXB 2O1AA 3QWRD 4J3XA 1EJ8A 2CHZA 1JXKA 5I16A 4OCSL 1RUAL 2VZUA 1U8NA 1WAPA 3GMRA 4KK6D 3WTYA 3AS3A 5FA4B 5AVWB 4OF5A 3VFGH 2NZIA 2P26A 3D0VB 2FLMA 4G8FB 2VDRL 1OTSD 3CPLA 3PAZA 2ETWA 2XWRA 4MAYB 4NDMA 3O6FC 4W6XB 2J21A 3DV4B 3OKNA 4JO5A 2R7EA 1FZMA 2OX5A 2W94A 3CDFA 3WHE0 4DAGL 1JYVA 2RAMA 1QBAA 2X3BA 4H0HB 2WXRA 1N18A 3IXTB 1KCBA 3DSNA 3I9AA 5DS2A 5I19H 1MCEA 1R34A 4FZ8L 3ECQA 4ABWA 3NIDF 2K3TA 2ID5A 3BAJA 3FFCD 4HQQH 4ZFZA 1IM3B 1S9XB 4XP4H 2F53A 2OTPA 5HDRA 1XTLA 2QGCA 4P23B 5ANMA 3X3FL 1KGWA 4XXWC 4QAMB 1MREL 2VLMD 2FUTA 4V1DE 2J43A 3RGVD 3VXMB 1GHFL 1NCNA 2XG5A 4PJGE 2CJUH 5JNYA 4GO9A 1JZJA 2WN2A 5F1SA 2OMVA 5IT2H 3VX1A 4HHAA 2B1AL 4NN5C 4EO5A 3VD2A 3MLVL 4XMPL 1MFCH 3MV9E 4W81A 5IHWA 3O3EA 4QOKA 5F7HA 1DBMH 1QSFD 1XB3A 1TEFA 2FAUA 3GXDA 1T80A 3FSVA 1CFMA 2FVNA 1P5VB 2JNZA 1NICA 3OKMB 2VDKB 3H9SE 3MAWA 3GIZH 1IIKA 3O6KH 5E8DL 4X5LA 5B1JA 3WTXA 4FXGB 1S9WA 5DVLA 1PG7X 5I19L 2UWEF 4ZAKB 1JGUH 4L1TA 2DL2A 4IIQC 3FT1A 1G6RA 1CD1A 4LHQB 3C9NA 5F1IA 2AJZB 4Z77B 3ZHFA 3QZWG 3RFZA 2B59B 5F7YC 4YDKL 5HGGS 3UMTA 1S7QB 4RISH 3LQMA 1NDMB 1RP9A 4KY2A 2C34A 1BVZA 4KOBA 3OGCA 2V2XB 4I9WD 4AQ1C 1AMXA 1GCYA 5L88H 5IV2A 1JDDA 2BVYA 4UMSA 4RH4A 3MKGA 4OQTL 4W9GC 3X12B 3NQKA 5F7UA 2UZYA 1QTYT 4WTZG 4BA8A 4N2FA 1BYPA 4R4ND 3QUXA 1R46A 2XZCL 2Z91A 3EJTA 1MCFA 1WWAX 3RKDC 5DMKB 1MVYA 2BOCA 3GMMA 4BFIA 2NUPB 1A9BA 1BVNP 3OX8B 4XAWH 2Q2EB 5LCVH 5IVXA 4MA1B 3A23A 1I85A 4HBCL 5CLTA 3FN0L 1S5HA 1FFPB 1JTPA 4I4WB 4NO2A 2QQLH 5IFHL 5CEXB 1CLOH 4NCC1 3UADA 1JWMB 2V17L 1CR9H 4QWWD 4DGUA 2TAAA 5C0GB 2CDFB 5JHDA 2P48B 5TDNB 3ULSB 2W59A 3KWTA 5IMMB 2K0RA 3DX2A 4AC2A 5D6CB 4Z0XB 1C7SA 4ELME 3MLXL 2ZPKH 5E9DE 3KJ6L 4DJMA 1UA6L 3FN9A 3IK2A 3QEHA 4ZPTB 4ZAKC 5J0BA 3VW3L 2VDQH 1Z9PA 3NCJH 5KYXA 3T0EC 3THML 4R5VA 2XVBA 3ZKQD 1J8HA 1J5HA 2XJLA 2P8LA 4K3HA 4BRVA 3C6LD 2HUHA 4OZGA 3MLSH 1DQJA 3OMIB 2H41A 3QDJE 1XGPB 4AUUA 1H0DA 3ZE2B 4AVKA 4I3RH 3WKQA 1ZRUA 4HT1L 3PYCA 5GJSH 3ZRCC 2YMTA 3V4PL 5LKNA 5IFAH 4IRJD 5F71A 3P3YA 3VI3F 4AQZA 1EERB 3TN0A 2ZX9A 3GSNA 1IKFH 1ZT1A 4LBEB 1XB8A 2P8MB 2FL5A 3PRZA 1I8MA 3ME0A 1JHKH 3ZQXA 1QFWM 1FZKB 2IH3B 2MNWA 2QQNH 3GSOB 3KLSA 5J5EA 4F37F 4FXKC 3SQBA 2HVJB 5F7BA 4L8DB 1Y07A 3MXVL 1JUFB 2NNAB 3WELA 3IJ9A 3POCA 3ZMEA 2B0SH 1PG7H 4WJ5A 1ESOA 1LO5B 4ZUTB 5C6TH 5K69A 5FO8A 3V5KB 1JPSL 4NN6C 1C12A 1N3NB 4FNRA 4YHKL 5E24E 3QULA 1VGEH 3X11B 1F8TH 1AD9A 5LXVA 3D85D 4K3EL 4EEEA 4E9QA 1U8NB 4Z8FH 2PXYD 1MXDA 4MA7L 4AEHH 3QUYD 3FN0H 3CC5B 1U58B 3LPPA 3V4PB 4WGKA 5ISZA 4HZLA 2W92A 1TJXA 1G7LB 1YQVH 2A9NL 4ZS6C 4FABL 5DMJB 1KTDB 5TE7H 5L4MA 5KANI 1CICB 1UM6L 1N0XH 2ZSWA 5JHLL 5EV7A 2JI1A 5IGXL 5LBGA 1SPDA 1CGUA 4YNYA 1GGTA 2XTSA 3PE9A 1PCXA 3BUIA 4LSPH 5E56A 3TIEB 3IFPA 5I6MA 3ULUF 4KI5F 3OBAA 3L17A 4MCYB 4CN6A 1JI2A 1FG9C 3LKRA 5L2KE 4HU2A 5DO8A 4RFEB 1YEGH 2JIXD 3DOHA 5FX3A 4HUMB 3AY2A 2X1OA 1KDIA 1U95B 2CKBH 3C2SA 4NO3A 1FJ1B 3L7EA 4MMZB 4XMTA 3REWB 2DEYX 1C08A 3ABLB 2Z31C 2XUWA 2BX5A 2EEBA 2Z4QB 4NQTA 5EUOE 4F27A 4DP0X 3KLKA 3SDDB 5BRZA 2X87A 4HCRH 1SLWA 2OR7A 2H6OA 4Y5YB 3VE0A 3LNGA 1I1RA 1Z9MA 3M1OA 5EPMA 5IBLD 5JPNB 3RWJA 4CN4A 4XN7A 3L3HA 4ZOAA 1ZSDA 4J3SA 4NKQB 2F5BL 4X6EA 4Y16B 2QQQA 3SPCA 3SPHA 4LMQE 4UT6H 1OB0A 4OCWH 3QJOA 2EC9T 3QHZL 3BOVA 3EJPA 4HWBA 5D1QE 1G4MA 5D96B 1CCZA 1Z9SB 5IY5B 4U0RC 4NUPA 4DCQA 3D05A 2VR8A 4BUQA 4AH2A 2NY7L 2HRHA 3V9CA 4BYHA 2N0MA 4UTBH 1MIML 3SKJL 1ES0B 3CFBA 4YXHH 1UD5A 5CGYC 2EECA 3EHBD 2BY0A 1E5CA 1OWRM 1MY7A 1A1MB 4X5QA 5JXAH 4JMNA 3C2AL 2PR9A 2GTZA 4XVSH 2B2XH 3FZUD 3NJFA 4ZSOA 1XIWA 1G7IB 3FCTB 3RVXD 4NC1E 1CXFA 5CJ8A 3MLTB 4PRAA 4TVUA 3VD7A 5IMKB 1U21A 4ZUSA 4N0RA 1DQMH 2GJ6D 3KXFB 4PJBE 3CVHB 4MNQB 5E2UH 5T1JA 3T1FB 3MJ8A 1XAKA 5HGDA 1CDYA 1J8KA 4NP4H 1FFOB 4M62H 2FLRT 2VMEA 3LJ3A 4Y19E 3SGJA 2X6CA 1UXWA 3BDYL 1ICTA 1MUJA 1JWSA 2XXMB 2GHWB 2BDNH 3OJ2C 1G9MC 3FHEA 3OXRB 2CBOA 4U3HA 2CBQA 5CXPA 5IROA 1ZA3B 1A9VA 3VWKC 2J12B 5IHZB 4GIOA 2BH0A 5CNHA 3CU7A 3FUHA 3U1SL 3INUH 3OF6A 3SCMA 3JWOL 5HXMA 5JIKA 2EVGA 1RD6A 4LSTH 1X5IA 5BW7A 3CC1A 2AXGB 4Y2NA 3SYCA 1T5WA 2A6DB 5AW1B 5DU7A 4B95C 3QJSB 5DZNA 1TR7A 2O4EA 2VAJA 1NC2A 2WQWA 1FYHB 1XB6A 1CI3M 1TPXB 2WCPA 3FT4A 2AQRA 4N22A 1W6LA 3NSYA 3V5KA 2P9RA 4Y5VA 3TZVB 1LEKA 3PQYE 5I0YA 1NUNB 4YPGA 2I69A 5MP6H 3RAJL 4D8OA 4HJSA 4EUPG 1D3CA 2ZUQB 5GHWH 1DVFA 1YRKA 5AEAA 1JPGB 2RD0A 3IGAB 1DP0A 4L4TB 5CJBA 3PL6A 1QR1A 1I9JH 3QAZC 4YR6A 4L37B 4NQXB 3BSZH 5D55A 3EO9L 4GUPB 4LF3B 1IKOP 2ED7A 3S0PA 1X4XA 1CMOA 3BPNC 2ZCKL 3OMZA 3E8UL 4WW1B 3WFEL 2VSDA 5SWSA 1OSEA 2SEBB 1NGZA 5HI5D 1H3PL 2FL5B 1I8MB 4DPRA 5KTEL 2C4FT 4GEIA 4L4VE 3VGDA 3WNLA 3TPUB 4NPYB 3U48A 3DX6A 3OAYH 4FQXA 4H8WL 3OKEA 1XXDC 1WIPA 3BWUF 4DK5A 4OJYA 1NUDA 1LO3H 2WIIB 2Z31D 1UZGA 3IFNL 2ZYSA 1U8MA 2WYZA 5L6YH 4FKEA 2GBVA 1PCSA 3PABB 1TYRA 3UEZA 5TF1H 4CBZA 4D9LH 3HVNA 4PJGB 3P3RA 3O6FB 3N91A 5GRJL 5AWNH 3P30H 4OCMC 3DI2B 1UCBH 1AYOA 4P06A 3AU1B 3GI9L 4MJ6B 2DQUH 3IRCA 4NZDA 3HG5A 5HDBE 3HRPA 5H4ZA 4U1GB 5DQJA 3NIDE 1JRHH 3NFPB 4M7KL 5I74C 3RTLA 4WO0A 2E4TA 2DQIH 4LHUG 5FW6A 1T0MA 3QDMD 4MAYD 4OGZA 4HMDA 1TQWA 1AKJB 1WZMA 4JM2D 1MHCA 2CO7B 3QUYC 2VIRA 5DRNA 4XNMA 4OLVL 3BE1H 2DW5A 3C8DA 3ABGA 1XBDA 1OKEA 3D2TA 3HE6D 4F7CB 4V2BA 3HB3B 3HW7A 4FQ1H 4MB5A 2OL3H 4WFFD 2NUPA 2ZUSA 3HLAB 1ROCA 3WHXA 3OC8A 4GAAA 2H1XA 2G60L 1UXLA 5F3HB 3LEYH 4JG0L 3ETBJ 3ELQA 3ZR6A 3QNZA 4F58H 4ATTA 1YEFH 2APBA 3OPZL 3BVWA 4ZO7A 2W0PA 4JPWL 4YSRA 4OCRH 4UQ3B 4Y16A 4X5WA 3S3SA 1ZKAA 3T1FA 1E65A 3WKPA 1K9TA 2O6CA 5HHME 3OLDA 1GRWA 4PRPB 3V4UH 4NQEA 3LZNA 1X4YA 2D3JA 3Q9PA 3V0EA 4R0LC 3H6AA 2VN3A 4OQTA 3FO9A 4FYQA 3BKCL 2F7PA 4QRAA 4FA7B 3QEQA 1TTAA 1IGTB 1OHZA 1UWXH 2BCMA 2BVQA 3E9TA 3D51A 3IDXH 3N1QC 1FYTE 4JFUA 5HI3C 1K8IA 1MFUA 5C09A 4DO4A 4KXZI 3CMGA 4NT6B 5KVEE 4TUOA 4ODVH 2DL9A 5EA0H 3MJ6A 3P2TA 1GGIL 2J88L 2VO5A 3QNYB 2BZCA 4I2XA 5JYLA 2HFEB 2O5YL 1CGWA 4HCIA 4LQ1A 2P8MA 2D7MA 4LLUB 1HAUA 1UWYA 1XWVA 3FT2B 4M3KB 4OCNC 3RWIB 1MRDH 5KAQG 5D7LB 5BOZG 1I7UB 2ZICA 1Y18B 1LEKB 2QFPA 4ZOEA 3BKMH 3FB8B 3ZR5A 1PLBA 2EYSB 4JZJC 4NBZB 1NL0L 4WHTA 4E5XB 4MBOA 5T3XL 5DVOA 2PN5A 3VXSA 4TVPE 4BFGA 3RNKA 2DD8H 3H3BC 4IHOA 5HHMB 3ILQD 2AMGA 2A74C 3C8KB 3NSDA 5C71A 4RETB 1MAKA 1TT6A 3L3GB 5GZNC 1L3NA 4LVHC 3KJ6H 5A1AA 2NOYA 1UGNA 2EXTA 3TO2A 3TT3L 4C4BA 1UFUA 4JFQA 3LXAA 5LNEA 1WO2A 2C1PA 4HUUB 4NQVA 2NY2C 4HIEB 1FO0H 4G1EA 1FZOB 4D9RD 2OYMA 4NS0A 2Y1VA 1SBSH 3EJCA 2ZXGA 1IKNC 4L8CA 1BIHA 3OXSA 4MXQD 3GMPB 4GG6F 1VFUA 3L9BA 2MCPH 1ZTMA 4JO1L 3K71A 3NRPA 1AI1H 2J7LA 4J1UB 4Z7OB 5LJYH 2MOQA 2G30A 4Z3GA 3CZGA 4ONOA 4FQ2H 4N8CH 3II1A 1KTDA 4Y2LA 1G1YA 4FNLL 1BQLH 3B2PA 5I82A 5C7ZA 4JPWH 2EIKB 4EI6A 2FWOB 2DMGA 2AQPA 3T6QC 4LLWB 4HW6A 3BZEA 2IALA 2WGNB 4S1RL 3VGAC 5HDBB 5CZKA 3NJIA 4WFGE 2YN3A 3PWPD 1HI6B 4B97A 2ATKA 3QR2A 2IBZX 1F6FB 1E50A 4HWZB 3RX7A 2P45B 5GRWA 3UTOA 2IOIA 4PI0A 1IFHL 1YEHH 2PYEA 1AP2B 2C9RA 3I02B 4FKHA 1A2YA 4IRSA 4YX2H 5GZNA 1KGUA 4OZFH 2LU7A 4GSRA 3ZE1E 3B9EA 3HC3L 3KDMA 4XPAL 3CFEB 2HKFH 1ZSDB 3ECBA 4KO9A 1JWSB 2E7LC 2NY6C 3AXLA 3ZHLA 3C6EA 3FFOA 3TEUA 4JFXA 3QJZA 2N59A 3E8VA 2OYKA 1ND0A 2J8OA 4PGEA 2VDLH 3L5IA 1BVKA 2CDEA 1F02I 2YAOA 5FA3A 3FMGH 1MCWW 4G83A 4TNVK 5E9DD 2AQNA 4UAHA 4Z7UA 4IOIB 3Q05A 1XGUB 2B1AH 2GUYA 2D0GA 2YA1A 4NO5A 5D7KE 3VFNB 1R5WA 3SE4A 1WITA 2CJUL 2Y6SD 3IN0A 3I3BA 5DFVC 3KJ4B 5E99H 4F33B 1F4WL 2N56A 4ZT1A 2QADC 4TSBL 1HWGB 1X5JA 4ZO6A 3CSGA 1EEZA 1I8KA 3KVDD 4KQ3L 1AGBA 2ISDA 2VZVA 2OI9C 2V8LA 4QRTB 4OKVB 3HFFA 2X3CA 4OM1L 3SKNB 4D0DA 4NKIH 4X4YA 3PQYB 3QQ3B 3RY6A 2CPCA 5TE4L 1LP9B 5F44A 2WSPA 3TNNA 2UXTA 3P73B 2W9DL 3SY0A 1JNHB 5JW4Q 5HJ3B 4HFWB 5JPNA 2BHYA 3LZOA 3NCYS 3NJJA 4OVUA 4PVBA</