2Z65C

Crystal structure of the human tlr4 tv3 hybrid-md-2-eritoran complex
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
140
structure length
140
Chain Sequence
QKQYWVCNSSDASISYTYCDKMQYPISINVNPCIELKGSKGLLHIFYIPRRDLKQLYFNLYITVNTMNLPKRKEVICRGSDDDYSFCRALKGETVNTTISFSFKGIKFSKGKYKCVVEAISGSPEEMLFCLEFVILHQPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Toll-like receptor 4, Variable lymphocyte receptor B
publication title Crystal Structure of the TLR4-MD-2 Complex with Bound Endotoxin Antagonist Eritoran
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 22
structure length 140
sequence length 140
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-07-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.770 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2z65C00
3RG1C 1XWVA 3MTXA 5IJBC 2Z65C 3VQ2C 1AHMA 3M7OA 3MU3A 3VQ1C 2F08A 1A9VA 2Z64C 2E56A 3WEBA 1KTJA 3T6QC 2E59A 1AHKA 5IJCC 5IJDC 3FXIC 2HKAA 3B2DC 4G8AC 1WRFA 1NEPA 3ULAB 3WEAA 5KWYC
chains in the Genus database with same CATH superfamily
4XN8A 3L1OL 4UB0H 3Q05A 2I9LB 4MCMA 4PD4K 3EFOB 3EOAA 5JUEL 3NFNA 2GSGB 5DEFB 1TTBA 5EC1B 1BMGA 3U4BH 5EA0H 3FQ2A 1PG7L 4I3SL 3QI9C 3W2DL 5JOPD 4MD4B 4Q6IB 4Y4FA 4F37K 1P5VA 2XXMB 2KMWA 1WWCA 1YJDL 2AMUA 5D5MA 2ZCKH 3CVHB 2P7TA 4L37A 5HYEA 3U36B 1H6TA 4O00A 2FVNA 3LB6C 2QVFB 4ZUWA 5B4MC 2MKWA 3BH9B 4M4PA 2D3JA 2DLFL 5LLIC 1AS7A 5ECJE 4H26B 3T0DA 1ANUA 3DYMA 1LILA 4I9XA 5HGHB 3O6KH 3B2UC 4MS6A 2FL5A 5MEOA 1JF1A 4PFEA 4DHLA 3D4ZA 5JO5A 1P4LB 5EIQA 2P5ED 5E08L 4E0RB 4KKCC 2JKRM 4IOFD 4KGJA 4QGYA 3RKDC 2ZP0T 3ARBC 2FLBT 1TFHA 4HGWA 3ZL2A 2A83B 2X10A 5IEKA 1U8JB 5K9JH 2HKFL 1F3JA 1FNEB 4BDVB 4LF3A 2OKMA 3QNXB 1K8DA 4EN3A 1A1NA 3UP6A 5CGYC 3SPCA 1HXMA 3HC2A 4PI0A 3RWHA 1FRGL 4FLOA 4APQC 5C0EB 3BAEL 1Q94B 2O6DA 4JFYA 3FQNA 5KN5A 4N8VA 5C2BH 4KJPD 1BD2A 3KMDA 2MCPL 3FSAA 5CCGE 5JORB 3BVVA 4X6DF 4I3RH 3SKNA 4QO1B 2QKIB 5IHZB 5I28A 4QCIA 1DDTA 1TQBC 3HC3H 4P2QE 3DURA 5JPMB 1MCRA 2J72A 4XMKL 3MBXL 3KBEA 2CBPA 3RX9A 3UPRA 4J5VA 5TPWH 1VESA 2EIEA 3GMQB 3MV7E 3GINA 5BXFA 1NEUA 2BERA 4GMTL 3WLBB 3OKMB 1URIA 4RGNC 2BY1A 3COOA 4IBLT 4X4MA 4N0FB 3Q1SL 1ZA6A 2P80D 4PJXA 1I3GH 3H2QA 1M2OA 4UBDD 1D9KC 4ADJA 4HUUB 1KTJA 3ALWA 4RA3A 1UFUA 1JHTB 1ZANH 5ABAA 3FF7A 3C09C 1MY7A 3HI1A 2AXFB 4P04A 3E8UL 4HG4K 1WUNT 2Y0SA 2R15A 4L2YA 2H2PC 1LEKA 3A23A 1DLFL 4FFTA 3RWFB 3FCTA 1ZRUA 2I5YL 3VWJD 3RFZA 5BNXD 2FECI 1O75A 1IC0A 1JDCA 3ZDXF 2XZZA 4POYA 2Z8RA 4IEFA 1A7BA 4MJID 1NUNB 3ZMNA 1NCAH 1OTUC 4DAGL 4JDZA 4L23A 3L6FB 2JNZA 3S9DB 4NO3A 3I9IA 3TESA 3X12A 1XH3A 3KPRB 4YEFA 5E99L 1ORSA 1E3FA 4G6AC 2YJQA 1HYSC 3DWTA 3VFRA 2CRZA 3DJTA 3RL1A 2A3TA 3NJLA 2G30A 4FHJA 5D70H 5J06A 1J1OH 1S7RA 4LCYA 3BEVB 5BO1H 3QUXB 4E68A 4P2OD 1D2PA 2CLVA 5IFAL 2F1AA 5CD5D 1OWWA 1L9TA 2VR8A 5CP3H 5IJCC 4O2EB 2AJ3B 3UAFA 2VW7A 4XN9A 2EVFA 3C5SB 5GS2H 2F54E 4AQ8A 4WHYH 4RMRA 3U4KA 3RU8H 2PETA 1NEPA 3QQ4B 4UQBA 3RY6C 1XBRA 1AI1H 3EO1B 3DV6B 4NBXB 4L3ED 3EKCA 3UAEA 2OMWB 3GB7B 1ZLDA 5H8DA 2IDQA 4IIQC 5KYUA 4J4PC 1OTSD 1FH2A 3GMPA 1AO7E 1TZOA 3K2IA 4CA4A 1FJ1B 5DD1H 2WNWA 2GK0A 4NENA 5F3FA 4EUPB 1QG3A 4CBPA 3VWJA 5I0XA 5F8RC 4R8WL 3PAYA 3FT4B 3R4RA 4A2DA 3TWCH 1DJWA 1NCTA 1NINA 2EDWA 5IY5B 1RURL 3VAEA 2FJFA 3L7FA 1I4FA 3LKPB 4NCC2 3DSNB 3QDJE 4YL4A 4QTHB 2WLMA 2B1AL 3LS4L 5ANMB 2WUCH 2BOBB 4LKXA 5F89B 5JMOC 2NUPA 5F44A 1R0AL 5E6ZA 3VXOA 1ITBB 1VEMA 3VW3H 1X6NA 4X5QA 2EUXA 4Z7QF 1CFVL 4FABH 2W1NA 4ZO6A 4OZIE 3V5HA 3X3FH 4CC4C 1QI3A 3O6MH 4YIQB 1MAJA 1A14H 3ZY7A 2YRLA 4P05A 5IT2H 1JF5A 4P2OA 1F86A 2RH0A 3VYNA 1DANU 4HT1L 3HG3A 2Y7NA 5D1XB 2CJSA 4FJ6A 5CGMA 4G80B 1R4XA 3PWPB 3DETD 2ORBL 1FNGA 2FR4B 4JJOA 3DJRA 4YHIA 2XIIA 1IIIA 4AGOA 3V6ZA 1VCAA 4NM8H 1WFTA 2XVLA 3RPIB 4L3EA 4KZ0A 5IOPA 3LEVH 3PG2A 4RGOL 5EEYA 4G8AC 3EXJA 1BQKA 3KE0A 5D71L 1IC4L 3KL0A 3FFCE 4I85A 4KI5D 1OK0A 1U8PA 1BLNA 3IETB 3IDIA 2O6PA 1E9OB 2K78A 4N6RA 1IAIL 2M2DA 1CXIA 1GZPB 4LRIA 5IQ7H 1RFDL 2GIXA 4Z77B 3TO2A 1HQRA 4N2OA 1R33A 3E2HC 4XCEA 4RFOL 5DJXA 4TVUA 5C0FB 3H1ZA 4PSRA 1ZV2A 2HRPL 5LNEA 3VG9C 4GI8A 1JZFA 1KCVL 1J48A 2XWJA 1UFGA 2EO7A 4FZEL 2H45A 3EOBA 3DHMA 2C9AA 4IMKC 4TQEH 5MERA 4XCNB 2ARJA 2DM2A 5JHLA 3GUFA 3KLHC 2I9LA 1GRWA 5HJDA 3CFCH 3KG5A 5EC1A 4MLIA 1ZTXL 3KPSB 1HAWA 1MW3A 4MD4A 4A7UA 4WFGE 1TU2A 5CFHA 5E9AA 4ZMQA 2ATAA 2WB1A 1BF2A 1K4DB 5DJ8A 2P24B 1MIMH 4ZS6C 1F58H 3D3VB 5B38B 3PWNA 4U05A 2P45B 2WWMC 4HCRA 4QHKI 2RQ8A 4F58L 2BNRB 3BH9A 1G9ML 1PCSA 3T1WA 1YDPB 4H26A 2GAZB 5HGHA 2YGVA 5E7BA 1QSFB 3HN5A 3FHAA 2AI0L 5IQNA 3PWLA 1LE5B 2XQYA 1S8DB 2CDEB 4PLJD 4XPBH 1AH1A 1P4LA 4KXCA 4MYWB 5L7XL 4KFZC 5J6SA 3ZQ9A 4Z7OE 1JRHL 1BZOA 4KBPA 2F5AH 2DJ4A 1U8JA 4HX1B 4QTIL 2EUWA 1QO3A 2RBLA 4BDVA 1NGYA 1FNAA 3DV4A 4JY5H 1MRFL 1KC5H 4ODWB 5F97E 1MFEH 1GVIA 3VTMA 3UBXA 4H0LC 1A0QH 3SPIA 4FGMA 2O6EA 3ZR5A 4DQOH 1MFBL 4FFYL 5JLZB 5C0EA 3MRDB 3WIFA 2COVD 4MCZA 4IDLA 3KPRD 4M7LH 1H8LA 5IG7B 3VI4B 3AXLA 4OLZL 4AT6B 2NY3C 3SDXE 5JORA 1TDQA 1Z5HA 3HRZC 1ZWIB 4Y5XC 1YNLL 1IILE 1NLBL 2MQGA 3NFSH 2NR6C 2DF3A 1USQA 3QUXD 2OMVA 5C09B 1TUPA 2ZNXA 2VDRB 2E27H 1OTTC 4XCFL 4HBCL 4XB8A 5CLTA 4PD4J 1KPUA 4I89A 4X5PA 5ICXB 4BSVB 2FEEI 2C5DC 3O81A 4AQEA 5C6WH 4UV4H 1NFKA 1OB0A 1UEYA 3OKMA 3WLBA 3T0XA 4NJ9L 2QEJA 1COBA 5IBLD 3P0YL 3FUHA 1G43A 3NSYA 3OHXA 5J9PB 1JD7A 4OZGA 3DIVA 3B56A 4PRHE 2Q8BL 3DX6B 4XVJH 3ZIYA 2JKXA 2VDOB 1CL7H 4HUXB 1O7SA 3PABB 2AXFA 1YEIL 5I18H 2BNQB 4MKTA 4QRTB 1EFXA 1JL8A 4R4NC 3CMGA 1Z3GH 4R4BA 3RWFA 1IGML 2Q87A 4WFED 2IDSA 4XO4A 3K46A 3TTYA 1A3RL 1EBAA 3P30L 1RZFH 4GMSL 5E9DE 3DO4A 3P9LB 4M1GH 4CADA 3NA9H 4AIXA 2Y06H 4U6VH 1X5KA 3CPLA 4Z1PA 4E5XB 5I8EB 3WEBA 1IAOB 1LO0H 2DDQH 1C5CH 3V5KA 3CZGA 1GAFH 3BSZH 1T7WA 4KUZL 4MBRA 3UAAA 3VG0H 2IJ0C 4M02A 4E9QA 4F27A 1PJWA 5E5MB 2FUTA 3KPRA 1NGPL 2R0LH 2HUHA 4P5KB 4OV6F 4F80A 4U1MB 1ASPA 4NPYA 2ZNWA 5DFAA 1YEJL 5DEZA 3QUXA 1Y07A 2DQMA 4O02L 1MNNA 4HJGA 2XZCH 2Y6TE 2ZXCA 1VKXA 4KO9A 1RUPL 1KWKA 1G7LA 3BKML 4R7LA 4YBQD 4O2EA 2AJ3A 4X6BB 2OJ1A 4LPCA 1XF2A 3PWPD 1YEEL 3QPXH 1UD3A 2YOAA 4WSKA 3GBLA 1U4EA 4JZJA 3EO1A 1XAKA 1ZIBA 2VXQA 3DV6A 4PJFF 5DYFA 1FL6A 1T5WA 2NXYB 3UZVA 2AJZB 3GRBA 3MLZH 4FFVD 4OCXH 1FWXA 2PW2B 4OUOA 2IADB 2B7DT 3KPQB 4UMGA 4BSWA 2Y7QB 1UT2A 2XV6B 4BZ1H 5JOPE 3O2WL 4HHWA 4N0UB 5KYXB 4PRDA 2X4SB 3G5ZB 1KV3A 3MV8A 5E8OB 4PJ8C 5T8IA 4HG4J 4UTAL 4EUPA 2E47A 2BSRB 2FLRT 5LJYH 2CCWA 4LLWB 1KCUH 3ARPA 5FM5O 4XP1L 1CDBA 4PJXE 3W56A 2NRDA 3L7EB 1EERB 2AQPA 5C0RL 1BG9A 1O9VA 2HAZA 4K4KA 4LVOB 4X7FC 4C56D 4CMMB 5JW5A 3DX8B 3TCTA 3LKPA 5DQJA 1GY1A 1X7TA 1LO4L 2UVEA 4MSWA 3T04D 2BOBA 3TA4D 1KTCA 2L7QA 1PIGA 1N6UA 3IN2A 5HYSG 2P5EE 4MXQD 1S7VA 4Y89A 1QSZA 2ZOKB 3TVMA 1SZNA 2F7RA 5HHXL 3L4YA 2MPVA 5L4IA 4DO5A 1P84J 3CGTA 5F1OB 4Z7IA 1WIPA 5JR1L 1VB9A 2B0SH 2IO5A 3MR9B 4PWHA 1SXBA 1ZTMA 3B9DA 4Y5VB 4AEIH 3SDAA 3IK2A 4POZD 1OHQA 4XO9A 4KUCD 1FSKB 1WGOA 1FF5A 3QZWG 4GAJH 3UROR 3VE0B 5CJ5A 3D3VD 3MOAL 5ENWB 3VVWA 1DVXA 1KIPB 1O9WA 3RG1C 3NGBC 3ZE1B 2BNRD 4P57B 1J5OH 3REWA 2BS8A 2LLLA 2NYZA 4Q4IA 4CU7A 2XYCA 3U0WL 5HGDB 3QQXA 4OM1L 2PP7A 1THCA 3AWFA 3C9NB 1QSFD 2QQLL 2YLHA 1XTLA 3ABLB 2R8SL 3F62A 4PVLA 4WHYG 5GGVL 5LBSA 1H5BB 4NWTL 3V10A 1JNHB 3ARZA 2C26A 3UERA 1WA1X 2GT9B 4Y2OA 2W0PA 4NQXB 5JIKA 4DTGH 1E9OA 3KPPA 5LDSA 1QA9B 4M4RB 2ICWJ 1PG7W 4MQXD 5I5RA 1V7MH 1A7RL 1DR9A 3MXWH 3QJZA 1ADQL 4AYFA 2C3GA 5EULV 3TLRA 4RGMB 4Z77A 3FB6B 4DGIH 5C0FA 2IPUG 1NCWL 4RFEB 2Y69B 4K71C 1MFNA 4C56A 1FPTH 4AV0A 4FHBD 1OAKL 5DMGC 3D48R 1FLTX 3TN0B 3ZJAA 1J9QA 4HDIA 1QBMH 3N44F 1O6SB 1S3KL 4G6JL 4XCNA 6FABL 2DIEA 2VQ4A 4YDKL 3E6HA 4D0BB 4A6YH 3SGKA 4MJIE 2D2OA 5J6GA 3EG9B 1MI5A 4NKIL 4JO2L 3SB3A 1BFVH 1TG8A 5I8CB 4Z3HA 1N5AB 2RAMA 5CM1A 3IJYB 2JK5B 4ZFOA 4UT9H 4S0SD 2L8AA 4HWBL 3JUZA 1RZKL 3O11A 3GEWB 1OF2B 4XP6H 3WCYA 1TZIB 4FCHA 1UM6L 3DXAB 2VZOA 3QQ3B 4RMQA 1FFPA 4ODTH 4LLUB 3LKSB 5GGQH 2O61B 4AGNA 2JTDA 4PEEA 4TTDC 2BSSB 2NZ1A 2BNQD 3WN5C 1TQCB 4JPKH 4MWFB 2CDEA 3DBXA 3QJXA 3KGTA 4PJCE 5HGAB 3INUL 5FM4A 4WSJA 1NCIA 5E8DH 3T2LA 3T3PE 2HTLC 2EILB 4L4JA 5I9QB 1VF5C 2BS9A 5C0CD 1MQKL 3II2A 2BOCB 1F1AA 2WKOF 1N12A 1XXDC 2VQUA 1I31A 2EXTA 3WO3B 5CIPB 2GBTA 4TNVF 4XP9H 2H6OA 3IJ9A 3IMSA 4YWGL 3GZPA 3IJEB 4ODWA 4LVHB 2EP6A 2ZWNA 2X70B 4L1DA 4QHUA 1R3IH 1IKNA 5DK2A 1R6VA 4APXA 2OMZA 4L3EE 4NT6B 2LFEA 1MJ8L 2E76C 5FPIA 2WWOA 5IG7A 4S0TD 4ZT1A 3VMNA 3PRZA 2ERJB 1YN6B 3UJTH 4IDJL 2EDOA 1ZWIA 3GMMA 3ZIMA 5EIIA 3R06B 4DP0X 1U6AH 4JM0A 3VXNB 4BUGA 2VLRB 4R7NA 5DYOB 3QUKB 3DGGB 1MXDA 3PLYA 5IHWA 5EU4A 1IUZA 1G0XA 4XPTL 1RY7B 2GKIA 2WVSA 5TE4L 4HEPA 3DX9A 5GRJL 3ILQD 4E9XA 3TEWA 5ICXA 3TX4A 1WTLA 1H15B 5E1IA 1NC2B 1GXEA 1T3FA 3QEUA 3V6OA 4FQJL 3MJ8B 3VTAA 1AS6A 1ODUA 1L4IA 4AMKL 2EXYC 1G0YR 3ECWA 4J3OD 1KPVB 1EA9C 3FTGA 2NXYD 3RA7H 3VJ6B 1FAKT 1GGBH 2A6JB 4OFVA 1G7PA 1EHXA 3UO1H 3VQMA 2DMGA 4GIPD 2H0FA 2BNQA 4ZX6A 2HFTA 1DVQA 2FATH 4QRTA 4MZRA 3U6XS 5CJQL 2LV4A 4MAUL 3MRJA 3IDMA 5B3JF 2AJSL 5C0CA 1J0HA 4FNQA 4B0MB 1TT6A 1NFDF 3L4ZA 2WBWB 3PREA 1HNFA 4TL5A 2YZ8A 4M5ZH 1JNLH 4XPHL 1AZZC 1T6WA 4Y4HB 2Y36L 1IFHH 3JUYA 2HJFB 3ULVH 2ZUQB 3W39A 3WDHA 2YAQA 2A9CA 4BKSC 1NBVL 1U2YA 3UBFA 1HHKB 5E5MA 1HL5A 2QADD 3RTQA 2FO4B 1U30A 2DIAA 3MZGB 4P5KA 4AXWA 1V5JA 3P3TA 1MCFA 1QBAA 4KI5E 4OFKA 1OCZB 1X5YA 4EXPX 3LIUA 2X4UA 3G6JF 4ZTPH 2CIKA 3R1GH 3AJ7A 2FX8H 2AHIA 1I7UB 2Z4QA 3OLEA 4L5FE 5C6TH 3LZNA 1AIZA 4JE4B 4LOUD 4X6BA 1C7SA 1XCXA 4NWUH 1S7SA 1Z5YD 5IQ9A 2K1MA 2RJMA 4NO2B 4LSVL 1UOVA 2QGEA 4HJ0D 3UGXA 3VFPB 3T71A 4YDLB 1W8EA 4MMZC 4ZMYA 3L2MA 2AK1L 4EOWL 1A7NL 3R7QA 1KG0A 4IKIA 4ATWA 5LGHL 2PWHA 4IU3B 2W0FA 1O7DE 1JPEA 3CDCA 1LD9A 2AJZA 3WDJA 5KBPA 2V5TA 2PW2A 2IADA 3KPQA 2BIHA 1X6LA 2C9VA 1S7XB 2J56A 4HYTB 4U7SA 3S35X 3V0HA 2Y7QA 1XH2A 1WH0A 4R90L 5LNGA 2X4SA 3G5ZA 1T7XA 1U3JA 3HNVH 2ZCHH 4MVBC 4O02B 5FO7B 35C8L 3O0RL 4GIOA 4JCMA 4LLWA 5I6PA 3WIIL 3MRCA 2NDFA 4W6YB 2DQJH 3WNJA 1X5ZA 2NXZC 3HPLA 4I0PD 2B1HL 3FBQA 3T2PA 3WS3A 4G7VL 4S1DD 3RTLA 3PY9A 1XTMA 2ZKXA 4OJAA 3LH2L 1M9SA 1I7RB 5DUPH 4IKNA 3TN0D 3TA3A 5FDYA 4KK5C 3DX7B 1U3HC 4D9QD 2KZ1B 2J2ZB 2X3BA 1F8TL 4HXBH 1ZLVH 4AVJA 5FUCE 4MHHG 3EF4A 1CICB 1MIEH 2ZOKA 4UV7L 2DQEL 2GJJA 3CFBB 5J12B 1HZHH 3ULVC 2BRRH 3MOBH 4JFDA 3FU7B 4QXWA 1UM5L 5BJTB 3F7RA 2DEXX 3NN8B 2ATKB 3D2UD 4CMHC 1MFVA 2OI9B 4ACTA 3D09A 1KYAA 2XWTB 3F04A 2J8UF 3B1TA 5K5YA 1HX0A 4RBPH 2UZPA 1WZMA 2ZPKL 1M7UA 5ENWA 1UWGL 3U2JA 3UYPB 4Z7NB 1UXSB 3N42F 1QPKA 2FK9A 3LXUX 4P57A 3KPRE 3DXAD 2X1QA 3AS1A 2CKBH 4W9EC 1SMOA 2JI2A 3QRBA 4WK4B 4WHTB 5HGDA 3C9NA 4YOKA 3ZT6A 3U6XA 1ZGLM 1TCMA 1BFOB 3X17A 2GFBA 3IXTB 5TF0A 1RZJH 1R47A 2GI7A 3QEHB 3QXWA 4YSDA 4ZBJA 3DUSA 5I6OA 3TONA 3GLZA 1A6VH 1CL7I 3EOTL 4PJBB 1KEMH 1AQKL 1GYWA 3MJ7B 4R97B 1XGQA 2GT9A 5HDLA 1CO1A 3K72B 2BIOA 1HS6A 2X3AA 4WTWA 4FLSA 5FKAB 3A4EA 2ADYA 3QH3A 1SJHB 2GJ6B 1Z9LA 3FB6A 2BIQA 4I0PA 3FCSB 3MRGB 4RFEA 2EH8L 3C2AL 3S5ZA 2MMXA 3PAZA 2VMFA 4GAGL 4KZCA 1HT6A 2V9TA 5CUSH 1I8MB 2KZWA 3ZDZB 3FTWA 2BXYA 2EKSB 2Z1PA 2VLRD 3MNVB 5KVDH 2ZCLL 3K6SA 4P5RA 1AD9B 1F11B 3FQ4A 4WFEE 3RI5F 1MDAA 3IJ8A 5GS1C 3NBNA 4XPFL 3Q48A 4XXDA 3FHQA 3TZVA 1BVNT 5HPMB 3S5LG 4CL7A 1MJUL 2DOCA 5KVEE 5JTWA 3E3QC 5E24E 4FQXC 5EZJB 1DN0B 1MLCA 1S9VB 3D2UA 4XVSL 4ZAKA 1NC2D 3EG9A 1XCTA 3KJ6L 1N5AA 5ANME 4HOZA 5HDQL 4X42A 5D7JC 3IJYA 2JK5A 5EN2B 5BZZA 4WKXA 5CKAA 1NSNH 4KC3B 2JXMA 4ZFGL 3ME0A 1TZIA 5CP7A 2D3VA 3DXAA 3VFSA 1O0VA 3QQ3A 4PTUA 1PF3A 1KIUB 4JRLA 4LLUA 4OFYA 1SYSA 4K7PL 4I18C 4UINL 4GRWB 3EJSA 3NPSC 3I6KA 2AJVH 1S6NA 1B4TA 5LBGA 3RUGB 2WZ5A 2KS0A 3Q44A 3C8DA 4MWFA 4CU8A 4IQHA 3HHSA 1KOAA 3NIDB 4NC0B 4YK4B 5AVZB 1MCLA 4GG8B 1CXHA 3T1FB 4ENED 3S8FB 3IMVA 3FO2B 1SHSA 1G4MA 4XT1C 3T8XB 1JVOA 1RZJC 3PWPE 2WXQA 5HHVL 3CFUA 4LIQL 4Y4HD 4K3EL 3TH3T 1DBKL 2X70A 2H6PB 3JTSA 1I1AA 4FQCL 4S2SB 2CK2A 1HHJB 4ZOBA 4FYTA 4HWUA 1JPFB 4F57H 5DHVA 4NZTL 4FEMA 4TSAH 3FAWA 4NT6A 5IFHL 4KRMB 3QHTC 2VERA 3S98A 1OP3K 5D2LB 1MRDL 2NY6C 1YN6A 1OGSA 4JQIH 2PYEA 3QZLA 4WV1B 4ZTOL 5I66B 3MRPB 4AZ8B 4NN7C 3HBQA 4BE6A 4JG0L 3NFPA 4AK2A 1OP4A 2VLRA 3TF4A 3A24A 3QUKA 4AEHH 4PVBA 3GI8L 1RK0B 3LZRA 5FC9A 4GEJA 1G7HB 3ABZA 5M94B 4NQUA 4C56E 1JPTL 5JYMA 3BLKA 1QTYT 4DP7X 4L0YA 1NC2A 2FJGB 4POUB 5C0NC 4I4WB 2VDKH 3MJ8A 5ES4B 1RZIB 4TRPH 5B1JC 5ITFB 2I32A 3DUUA 2N4IA 1OW0C 3H53A 3L95B 4FFYA 4JGNA 1KPVA 2YK1L 3MRLB 1L0XA 4QXTB 5KVGE 5KJRL 4QXVA 2YC1A 1A8JH 3HLAB 4KH2A 5HI4C 2Q2LA 4MDJB 2P44B 1UA6L 4Z3TA 4Q4EA 2WNXA 3H2PA 2VABB 3DLQR 4J3SA 2VR3A 1JAEA 2HUEA 4CKQA 1KACB 5B1AB 4DVRH 4FULA 2EACA 3V4VL 4GG6B 4NERA 5EC2B 3D3VE 3B3IA 1N0XH 3GHBH 5GS3A 2BNRE 2J4WH 3PFUA 5CNHA 2A74B 4P23C 1OXYA 4BBWA 4YHML 3CZNA 1JVKA 4Z7WB 1UJ3A 4MYPA 3ZKNC 2MEJB 4GB9A 3ILPA 1QSFE 2EXWC 4NN6C 4MJ5B 1QFWL 2VDQL 4L2LA 1I9IH 4PLKD 5TF1L 4PUBL 1HHKA 4O5LH 4GPVA 3B6SB 5B7EA 1UKQA 2IIJA 3F7QA 1FO0H 2WYZA 5E00B 4OD3H 5KYYB 5LCVL 5DLMH 4GSRA 5FA4A 5DJ0A 4YLQT 1BZ7A 1C5BL 2BH0A 2Q7NA 3MBED 2RIKA 4IHBA 5CSZA 3SQBB 5AOZA 3ZYZA 2Y7SA 3LOWA 2CZNA 3BEWA 4FHKA 1I7UA 4PJDF 3F7VA 3WJLC 3T2NH 1ZJAA 3HZVA 3FKUS 2KKQA 2FYYB 1BW8A 2DI9A 5KS9F 1AAJA 3VFPA 4CW1A 4P2YA 1OP9A 3HMWH 3K1DA 3CBJB 3GMRB 3TC9A 1Q0YL 1JXJA 8PAZA 4YHOL 4IU3A 4URTB 4Z3GA 4PGCA 3SCMC 5F6IB 3V9FA 1S7XA 3UGEA 2NNXA 4CGTA 1BXVA 3BAYA 3P3RA 2BC4B 2VXUL 1H3VA 1LE9B 1WBYB 3D39D 1UWYA 1BJ1H 2FJHB 4A7TA 2FIKB 4O02A 5FO7A 1EMTL 4O4YH 4AVKA 3QJFA 1ZGLP 4DERA 4RX4D 1MREH 1D6EB 2GJ6D 2D03L 5CJXC 1G9NL 1A21A 3CDFA 1ACYL 3RL2B 1Z6JT 2I7SA 3HI6L 1SOSA 1G6RH 4M9PA 1QRNA 2W07B 1JZ4A 3O3BB 1X5AA 3ULVF 1RULL 2BNQE 4OCWH 3DX7A 4QRSA 5ACLA 2OQJB 4I1RA 1W8OA 3QEQB 3QXAB 4F7MB 1EFQA 2ITDA 3LNGA 3L2LA 1UVQA 3PFQA 4RNRB 2IWGA 3CFBA 3G6AB 4FFZL 5E2WL 1PG7X 3KAAA 4B3VA 3G5VA 1X9UA 3IU4L 5C0CE 4Y16C 3B2VL 4JKKA 5DHXB 5BJTA 2E7LA 2XY1A 3NN8A 1UKTA 2EIKB 4FA8A 4UTAA 4XMPL 2CH8A 1KTDA 5BUGA 1JZ7A 3MBEA 1DUYB 3OR6A 3LVEA 3BHBA 4M3JA 2FGWL 4NUQA 3UYPA 1T83A 1IT9L 3VM5A 5C0JB 5F0PB 3V2AR 3TBTB 3LHAA 3EUUA 1QLEH 3K6NA 4U1IA 3AREA 2APSA 4LGRB 1UCBH 1AKJB 1BFOA 4DN3H 3CC1A 3APMA 3IXTA 3BFWA 3CLFL 2XA8H 2XPZA 3QEHA 4X50A 4UOQA 4H20L 4CRPA 3EHBB 3FN0H 3IRZA 3IDXH 4P2RB 3K72A 4NNPL 3FBKA 4HH9A 1MWAB 3D39A 4WHCA 4ESKA 5E6IC 1D7BA 5FKAA 4AG4H 2XG4B 4U1LB 1B90A 3ARFB 4RX4A 3UFIA 4PJFA 4U0RC 2DI7A 1A3LH 2X4QB 4FMKA 4M7JH 2IDFA 3MRGA 1CUOA 2Q2EB 3ML8A 3NTCL 3S88L 4UAHA 3MLVH 1HH9A 2OMXB 3PJSB 2KI6A 1G6VK 3ZKXB 1TITA 4OD2A 3MNVA 1EJ8A 1AD9A 1F11A 3ZRSA 2DKSA 4LSSH 5SWQA 4ZODA 4ZQKB 1EAQA 4LCVA 4CUCA 1MCWM 4Y8AA 1C12A 1LHZA 2JWYA 4QRPB 3ZGIA 5EZJA 5HYSA 3HE7A 4B53A 5I75B 1FN4A 4BFOA 3WNKA 1B4LA 4LVNC 2QSTA 4N68A 4I1PA 3FC8A 1ADQA 3LSOB 2ATPB 4QMEA 4PMEA 3AADB 4ONGL 5EN2A 3QXDA 4LU5H 1II4E 1KFGA 1XF5B 1FGVL 3NACH 3VFGL 5IKCA 1BYOA 1CR9H 2LOEA 4FEIA 5EU7C 1YECH 1KIUA 4WW2C 1FH5H 2CBMA 4UZUA 5HVFB 5F9OL 2Y5QA 3ZL1A 5L4JA 1N4XL 1NDTA 5EFIB 1H3PH 2OA9A 1KDIA 3WFBH 3WN6A 5D2NC 4MMYB 1RMFL 4P07A 4JHUA 5DJDB 4DEPB 1B2WH 3ZE1E 5T1LB 5DZAA 4JN1L 1M3IA 2XFXA 2R2BB 1XSOA 3H3BC 5DQ9B 2WUBH 3L9BA 3WE6B 4JO3H 4F7CA 1AVAA 3GF8A 4KV5F 4NUJA 1U8NB 2ZXWB 3DGCR 2XKNB 3IB4A 4ODSH 5I19H 2H6PA 3F7YA 3AU0A 4S2SA 5F9AC 1HHJA 2YQBA 4PWGA 5IIEB 4HWBA 1AC0A 1H8OA 1HOEA 4HHGA 3Q6FB 3CN2A 1MJ7H 3BUIA 5D2LA 5ESVA 2O5ZL 4P49A 1W0VB 5I66A 1FVDA 3VSTA 4AZ8A 4PI2A 4WGKA 3VVVA 3NIGF 5F9JB 1ZIAA 1HTYA 2GUYA 4X8JB 2FQFA 4GW1B 2W95A 2WV3A 3SOTA 1P7QA 2A9DA 3IFPB 3N5AA 4NZUH 1G7HA 1JWMA 4U7KA 2OXHB 1OT2A 2HX7A 2Q76A 3CFKB 3VH8B 4F37F 2EE0A 3IMBA 1DBAL 2OMUB 2FJGA 4AIZB 3Q01A 4F9LA 4I4WA 4K5LA 4JS7A 1RZIA 1NMAH 3A21A 3QUYB 1QEWB 4A39A 4D9QE 4XH2B 3TOPA 1K4CB 5ITFA 4IRJB 5B39G 2FRGP 1FAIL 1EUTA 2CUAA 2UUDK 3MRLA 4JQVC 4M29A 1AIFB 1DTUA 1D5BA 4AV4A 3HLAA 4N8PA 4U1SB 1SOXA 3GK8H 3KDMA 4LSQH 5INDB 4H88H 5AVWB 4G43A 2XNAA 3VU2A 1WHPA 1JTOA 1FIGH 5D4HA 5L0QC 3K2UL 2CPCA 4ZS7H 4KKAC 1MHPL 4L8SB 5EC2A 2NY4C 2DL9A 5I1HL 4OSUH 4OD1L 4UDTB 4XWOD 2A74A 2H3XC 3DXAE 3MYJB 4M56A 4KH9A 1J9CT 2ZIDA 1KBGL 4Z7WA 3WY2A 1OSZB 3W57A 2XWEA 1P4IL 4UTBL 4LARH 5FV1L 4DGVH 3WEXA 4D8OA 4F2MB 3FUMA 5EH1A 5BZDA 3QEQD 1RIUL 5D1QB 4V1DB 1C08A 5IW1B 5HHMB 5HDOA 3PHQB 3QWOA 1UOWA 2ZYHA 3A0OA 2FEDD 1DQMH 1ZTXE 1XIWB 5KYYA 1JYWA 2WO4A 1OAYL 5INCB 3X2QB 1TIUA 4UIKH 1U42A 5E5RB 4HQQL 3H9SB 4NO5A 3SQBA 2ZUYA 2NW3B 4QPEA 2B14A 1JV2B 3MA9L 3OKNA 4ZUTB 3PHSA 4HSQA 3V4VB 2VRAA 1EXUB 1CFNB 2BSTA 3IS0X 4L8DB 2XTJC 4ZFZB 3HR5B 2VR5A 4LXFA 3GJEB 3CVIH 2ENPA 5A2AA 5AVXB 3NP4A 1ZHLB 3JV0A 5GRVK 1MQ8A 2PW1A 3H9HB 5F7YC 3U46A 1LVEA 2FBJL 5BQ7A 1FHGA 4WI8A 3N43B 1FV1A 4KKLC 1Z9SA 3C6EA 3BIAX 1AKJD 3EYUL 2VLRE 3QPKA 4N2NA 3FQXB 3QJUB 2Q8AL 1IKFL 3BD3A 4KNSA 3LN5B 3HUJB 3O9WC 4UZGA 4ZUSA 3D69B 3EHBD 1E2VA 3S3BB 1LDPH 1HJCA 4PAZA 4PBXA 5DO2C 4ZD3H 4P2RD 4K0OA 1LE9A 3SJVB 2WLNA 2K8MA 2CHDA 1X5GA 3JVFC 1OY3B 4OZHB 4MRBA 2IOIA 4S1SL 3PWVB 2OL3L 3LN9A 1E28B 1G9HA 4DZBA 4U1KB 5FWRA 4YHPB 2GSIB 1J0KA 5EUOF 5EU6B 1WICA 2YEQA 3EGXB 3S34H 1FL3B 1IV8A 2F18A 1DDHB 5AWNH 1IEBB 2OQJA 4OJFH 1AGEB 2ZOTA 2BIIA 3OKKA 4K73A 3CXFA 1IBBA 3G5WA 5C0GB 3VO0A 1HKLH 2FDBP 4GFXA 1OB1A 4RNRA 2P47B 2Z31C 4LSPL 4PRAB 4IRSC 4MA7L 5HHNB 3SPJA 1NFDA 4QRPD 4PJHB 1YQVH 5FYLD 1KCRH 1TVBB 4AMXA 4CC1A 1LTXA 4GXVL 1E27A 2JTYA 2FEJA 2WIIB 3BP4A 1B88A 1B4JL 4P4KA 5I5MA 1DUYA 4G9FB 4Y2LA 5AZUA 2I26N 1JZIA 3UMTA 4DEWA 5ID1A 2VSDA 1MHCB 3GSXB 1EHLL 3IJSA 1BQHA 3FRUA 2J57A 2YARA 3GMLA 4MFHA 1ITCA 2CO7A 4KU1A 4O51B 3G6DH 4R26H 2R56L 4ZUUB 3WUZA 2H32H 4KZEH 4XHJC 4ZZKA 2IC2A 3G6JA 1IBHA 2F7OA 2I60H 1AKJA 1CD0A 4BZYA 2VUYA 3MFFB 3AM8C 1TJHL 2YA2A 2C9PA 3C2SA 2YKKA 3HNTH 3L3OB 2IH1B 2VN6A 2WINB 1ZSDB 4WNSA 4CN6A 1IGJA 3WL9A 1PLCA 2DM7A 5T1LD 3T5WA 4QHLB 3GS4A 3DTXA 4W9CC 3AT9A 4ZNCD 2XETA 3PP3K 1NPJA 1ND0A 4JZNB 1NPNA 1NCBH 4LP4A 4U1LA 1MHEB 3TGXA 1CTMA 3FQRB 1IAKB 3QIWC 3PPSA 4HS8H 2PXYD 3BGMA 2GK2A 4H5SB 3KLQA 5FW8A 5IVZB 2J3SA 2VXSL 2H3KA 2F53A 1J86A 3SGEH 2EDQA 3G08A 4ANKA 4ODXB 2OMXA 1RUAL 3UGUA 4ALAH 2GITA 2P8MB 4CBZA 4K3GA 3IKCB 2VGLM 1G4RA 1LMKA 2OPCA 2XC8A 3D30A 5FHAL 5T3XD 3SGJC 3FS9A 4ZQKA 5DT1L 1ZA3A 2H0PA 4ORZC 2G60H 1FFNA 2OK0H 5F7UA 2Q7YA 1I1FB 1L5GB 4C55A 3AAZB 1R5IB 2OZ4L 5DU7A 3DJ9A 4WW2F 4AJ0A 1PEZA 1NAML 3QUYD 4Y1SA 3V8CA 2D7TL 3HNSH 1XF5A 4HKJB 4Y2DA 1LJMA 4LKCB 2JKLA 1WTGT 1MKFA 2JV6A 2YGQA 1U58A 2DQCH 1FZKA 1ETZA 2AQ3A 2VLJD 3RZCB 4ONHA 3RB7A 4NKMA 3MFGB 4HK3N 1L9MA 4TQPA 5TH2B 3P3UA 5I30L 3MA7B 2WXGA 4OJCA 4M6ML 4FKKA 1FYTB 5ESQB 2W94A 4BFGA 4WDIB 4GRLC 4HIHB 4NS0A 5EFIA 1OM9A 2UZYA 1FDLL 2J73A 3DVGB 1DJSA 4OI8A 1CFBA 2I85A 2VIRA 2WLIB 4Z7NE 5T1LA 1XSIA 5T3ZL 5CEYB 4P5TC 2ICWI 5LQBH 1WFOA 1I9EA 2FBOJ 3P54A 5A6LA 3MROB 4RETB 5DQ9A 2Q6WB 4LCCB 2VERN 3QNYB 2AAVA 2XKNA 4AYEC 5F7FA 1GMEA 4QLRA 3Q8EA 5IVOA 5D1QD 2PXYA 4V1DD 5HHMD 5LVEA 1AZRA 5L2JA 1R5VB 5DRXB 3LRSB 4Z7VB 1BAFL 1ED3B 2JJSC 4PJBE 2B1OA 1BLIA 1MHHB 2IH3A 5EO0B 3SPGA 1W0VA 1XIWD 4F3FB 2K3HA 2E7HA 1EZVX 2EYRB 1KJ3L 2JF1A 2Y07H 3KWVA 3D39E 3T0AA 1TTGA 1HOCB 1TJIL 1A6UL 2G4EA 1ZEAL 3H9SD 5TFSH 3HIZA 4W70A 3ZZQA 1RU9L 4BM7A 4PS4H 2ZG3A 3NZHH 1T80A 4N9OB 2GJ6E 4ALAC 2E9JA 4JFPA 3BPOC 4WEBL 5BOJA 2OXHA 3D0LA 3VH8A 1WLHA 4BQ6A 4LDEB 3BPLC 4PG2C 1RPKA 1RK7A 4AIZA 3P9WB 1U91A 4V33A 3VD4A 1IGTA 2P9RA 3QUYA 3ZDZE 3KZ8A 5DMJB 5J13C 4XH2A 5F7AA 4UDUB 4DKFH 1BEYL 2BVOB 3EGSA 5EPMB 1UM4L 3UTQB 1KJMB 3ZHLA 4IM8A 2VLJA 4XC3H 2F7PA 3TT1L 4JFTA 2YOCA 4M7ZB 3QCVL 1CFMA 2DD8L 4M3KB 5F71A 1R3LA 2UWEF 2XQYK 3IN0A 2HN7B 3UJIL 1J9RA 1T22A 3BN3B 4GSUA 3SJVD 4IGBB 3C5JB 4EZMA 4OT1H 3T6QC 3WD5L 1F4XH 2ZKHH 1JOIA 3CU7A 4WIQA 1HINL 1S7QB 2BIMA 3QIBC 4LVEA 4N2CA 1B0GB 2W9EL 1FVEA 1OSZA 1X4ZA 5EU6D 4BH8A 5FLVA 5EOQH 1KTKE 4GRWE 1HIML 1DLHB 4LT7A 4FQ1H 4F2MA 1GGIL 1PBYA 2OTWA 4OF5A 3RUGE 4V1DA 2MOGA 5I8OH 3GKZA 5IW1A 3PHQA 3NIDE 1TJXA 5D1ZC 4YH6A 4KK9D 3HG0A 4J2XA 4YXLH 2NY0C 3QUMH 3TNNB 2BCKB 2XN1A 4UT6L 3RIFK 5INCA 3S3PA 3VXMB 3B2PA 2FO8A 5GGRB 3KLAA 3FT3A 1IC1A 3V4VA 2X9XA 1PZ5B 1EXUA 1EZSA 3DBSA 1RZ7L 1UZ6F 1YMMB 4M43H 3OL2A 3L1GA 4DKEL 5D2LE 3O6FC 1DQKA 5F3HA 1DQJB 3H9HA 2PO6B 2PYFB 4FQIH 4P5MB 4LLQA 2YN5A 4N2MA 1OAUH 2N3JA 1O5PA 3MV01 1OOAA 4D2NA 3H55A 3LN5A 3LS5L 4HKBB 4Z7UF 3TBCA 3HUJA 1Q72H 3D69A 3ARDC 1YNKL 4H8WH 5LCVA 1K6QL 3K4ZA 4NIKB 4KQ4H 3SE9L 5DHYB 4NIYE 1VPOL 3SJVA 4XC1L 4I77H 3HPJB 1E9QB 1XVSA 1IQDB 2CLRB 4KTDL 1P1ZA 1N70A 3P02A 3BAJA 4OZHA 5ALCH 4L4TB 2UXVA 1X9LA 5FYKD 4FADA 4I9WD 1YNTF 2HLAB 3S96B 4UNVA 1HFUA 1E28A 3LZFH 4U1KA 4QRRB 4YHPA 3DO7B 1F6AB 1NOLA 3DDFA 4KHXH 1ZHNB 4L05A 5EHFA 4XPAH 3NRFA 1DDHA 1MWOA 3E9UA 3I9GH 3BIBX 3QARA 5FS5A 5C0GA 3S97C 1DVFB 1KB9K 4LMQE 4KX9A 4X0KB 1I9RH 1N8OE 2NOYA 5F1IB 3N04A 3CN4A 5KUKA 4GG6E 2AQ1A 3FL7A 2WZ6A 4KK6D 3QSKB 4WO4A 4PRAA 5HHNA 3L5HA 4F1SA 4TYUA 4MASA 3IKKA 3UACA 4YHYC 4Z3IA 4Z7WE 5D6CA 1PW3A 2NT1A 2WBXA 2X6VA 2WIIA 3POHA 1ECYA 1F4YL 1WT5A 4FI7A 5JIHA 4O9HL 1FZMA 3GSXA 5H35B 1ZVNA 2Q3ZA 2ZYSA 3RZCD 3KPLB 3CXDL 4RFNC 5E94B 2I69A 4AQ1B 2A6IA 5JHAA 3ARXA 2W65B 4D3CL 4YVNA 4OLVL 5CGTA 4G1EB 1FYTD 1QQDB 1YPZF 3MFFA 1TTUA 2YXFA 3TYGH 3KD4A 2W9DL 4K07A 3K6DA 4PJDA 4FFZA 2WINA 4H2CA 3UTSB 3L4VA 5GGTH 2YLKA 3SKMB 1JFQL 3B7UX 2XJKA 4MMXA 4D0DB 1E4XH 5EOTB 3U0TB 1IGYB 3QG6A 2K7PA 1JIBA 4XP5H 3ZL4L 4OCSL 4HWEH 1MHEA 4H8WC 3ZMRA 3MODH 3FQRA 1IAKA 2WW8A 2GJZA 4Y5YB 2VISA 4JFQB 1F45A 1RPQA 3QFDB 1HSBB 4XO8A 1LNUA 3OF6A 2PF6A 4ZXBB 4ODXA 4FJYA 2VW6A 2GTWB 5EOCJ 2RQEA 2A6DB 2P8MA 3VQLA 1CE1L 3HAEH 3CBKB 3N1PC 4GKSB 4WWOA 3IKCA 1MW0A 4YEEA 4NX0A 4WNQA 4IS6B 4TOYL 4HAFA 4KX7A 2L3BA 3MLTB 3MQIA 3SD2A 2OMNA 5IJKA 2N56A 1E5CA 3Q13A 1I1FA 5E4EC 5IROC 3HC0A 2WBJB 4HVBA 4A7SA 1UWFA 4CVZA 1JI1A 3GZOA 5F7DA 3AUVA 3QIUC 1WFNA 3BWSA 3GO1H 2F5BH 3BWUC 3QEQE 5F96H 4RWYL 2ZUVA 5EN3A 2WCPA 1JNJA 4AM0B 1XHHA 2DQUH 4P8QA 3RZCA 4HISA 2J44A 2VO5A 4I2XB 5TH2A 5AL8A 3CG8A 3MA7A 3BE1L 4MX7B 2MQCA 1FYTA 3O2VL 4OLEA 1KB5H 2X9WA 2QPFA 4IGBD 5DZLA 4PQXA 4JM2C 3QISA 3B2DC 5E03A 2ZKMX 5DR5L 3UEQA 3SOBL 1BP3B 4YSEA 5GZOC 4JG1L 5CEYA 3S6CA 4Q9RH 3RWIB 2QSVA 4PHZA 3Q8CA 3MROA 1BVKB 1SF5A 1V3LA 4LCCA 3QNYA 4WI0B 1FFOB 2KYIA 1LWJA 5FHBL 5I15L 2Q86A 4RZKA 3WAJA 2F19H 1LQSR 1RUQL 4L9LB 4HJJL 2ROYA 2A9NH 1R5VA 1OP3H 2YSSB 2ZOWA 4NQSA 4Z7VA 3FSVA 4QJ4B 5IQLA 1IGIL 2XIBA 3OC8A 4QHMB 4P2RE 2X87A 3MBWA 2EYRA 5IK3A 3WSQH 1YHPA 3HLKA 4UTCA 5FM8A 3RDJA 3VXMD 1OPOA 1KN4H 3T3MB 5L6YH 3BVUA 1QZNA 2F8VA 1MSPA 4KVCH 3N0PB 2AGJL 5I26A 3ROOB 2AVFA 5FAAA 4LEOB 4GSDH 1YMMD 2NY2B 4M6NH 2O5YH 5DJ2B 4F9PA 1XGTB 3TO4B 2PO6D 1KCWA 4FA7B 1BZ8A 4NBZB 4XN1A 5DD5L 4F33A 5IMKB 3VFWB 3HS9A 4NSKA 4UDUA 4OLXH 3PHOB 2E5EA 3OZ9L 4XI5C 1R34A 2ZKYA 3UTPD 1QNZL 4IMLB 3NH7H 1KJMA 4Z7QB 3OHMB 3F83A 3QW9A 5KTEL 1DFBH 1DZ0A 3UZEA 1EDYA 4QRPE 5FYLE 1AR1C 4YZFF 5GSVA 4Q9BA 3TNMA 2HN7A 1OV8A 1AGCB 2BDNL 2CIIB 4PRIB 1PD0A 5DRWA 4CSSA 3NMEA 1VFMA 3QC5X 1HKFA 3VQ1C 4KXAA 3GDBA 2MHAA 1GYCA 4WW1A 4A7GA 2B59A 1ZHBB 4KFMA 2AZAA 2OCCB 2X6UA 3UPAA 3BAWA 1T6BX 1XF3A 4NKDB 1TTAA 5AYQA 3Q8FA 2RTTA 3HG5A 2IAMA 4OF8A 1JNNL 5F0JB 2IGFH 2J1KA 4L9DA 5F72S 1DVFD 4QRQA 1YN7B 3NABH 3FO1A 4KAQH 1KGJA 1A1MB 2X1XR 1AQDA 4KJQD 4JLRB 5DK0B 2BCKA 3BYYA 2JKJA 2LTQB 3MJ9L 1TQVA 4X9GA 5GGUA 2HH0L 3SGEI 3UZQA 3VXUB 5GRXG 3GSWA 3VXMA 4M5YH 4J3TA 4UUJB 5GGRA 2XWBB 1ID5I 2YKLL 1T1ZB 4PJAF 3MLPA 5CEZL 2EUVA 1PZ5A 4AQZA 4N8CH 4YUEL 5HXMA 3EH1A 3PGCB 3E1ZA 2ED7A 2VDLL 4KK8D 2A1WH 4B9CA 2EAEA 3VGAC 3APFA 4MDIA 4HSAC 2YD2A 4Q0XL 5D7SL 4ERSH 5JDSB 4P5MA 5B3NA 4UTBA 1SEBA 5I1CH 1T7ZA 3QI9B 2OS7A 5DFWH 4DGYH 5KYNA 4Q2ZA 2NY7L 4F15C 5C07B 5T3XE 3QGVA 2I9TB 4HKBA 1DBJL 1VSCA 1NBYB 1KYOK 1KNOB 3VXTA 4WI5A 3L5XL 3ASNB 3AWEA 4XZ4A 3UXFA 3TWYA 3UTSD 5KJ4A 4ELMF 2A7BA 5AUMB 5B39A 5JIPA 3KBHE 4EI5C 4JO1H 4KTEL 5DHYA 1CFTB 3OPZH 2QQNL 4NPJA 4Z6AT 3HPJA 1E9QA 4DW2H 3K4DA 1IQDA 1TTRA 2CLRA 2IFGA 3JWDH 4Q56A 4QXUL 1WF5A 1YZZA 4ZK8A 5LGYA 3DK0A 3NDZE 5T33L 1A5FL 4AVIA 2HLAA 5JYLA 4Y88A 1WAPA 4PJ6A 2VLJE 3OAUL 2X89D 1WFMA 4M1CD 3DO7A 1UH2A 4DEUA 4ZXBD 3ARBB 2VDMH 2VH5H 1SN0A 2E56A 3BQUD 4QJ3B 1J1XH 1FQ9C 4HPYL 2ZYRA 1DVFA 4HIJA 2DW5A 2VJ0A 4HJ1A 2HRHA 5F21B 3D9AL 5F1IA 4Q58C 2X4TB 2EDHA 5I1DB 3EDDA 1UC6A 1L6XA 3EJYC 4APQB 2XJLA 3APDA 4UOZA 4TXVB 4YE4H 4K7FB 2WBJD 5EZLA 1Q0XL 2GC7C 4FP8H 1ZSHA 4OVUA 2DAVA 3FF8A 4F2ME 4CC0A 2FD6L 4NZRH 4LBEB 1OAQH 5D1QE 4V1DE 5HHME 3EFFB 3GBNH 1A7QL 1TQBB 1NANH 4K3DL 5DUBB 2WXIA 5AAWC 5T1KB 5AOIA 2OL3A 1HI6B 1SXCA 1VZHA 2NPLX 2ZUUA 2XWXA 3FMGH 3KPLA 1B0WA 2YWYA 3O41B 2C9RA 5IB2A 4NUGH 1IBGH 3HS0A 4AQ1A 3ETBF 1N2RA 1MFDH 2W65A 4G6ML 3DRTB 5TE7L 1YYMH 3VXRB 5AB0A 2ZXBA 1QQDA 4RGNB 3H9SE 5JNYA 4UZSA 5GJSH 5HI5D 1NGQH 1VFAB 2YN3A 2QVKA 3PIQB 3W11C 1SPDA 1O6VA 2R1YB 4UI2A 2NY1C 1RQ5A 1F18A 1ZPUA 1TOXA 5FGCB 1PD6A 4BWTA 1KXVA 3MLRL 1D9KB 4MNGB 4R5TA 3VSUA 5ILTH 2QLVB 4G6KH 4PB9L 3QRGL 4RMTA 4D0DA 1FORL 4GH7B 3ILDA 4FYSA 3C09B 4CVUA 2DLGA 2AK4A 1JG9A 4QOKB 1MN4A 2R2HB 3P73B 1IM3D 3AW5A 1BVZA 1GIGH 2EE9A 2L7UA 5C08A 5DMKB 1MW2A 5DWUL 3EJTA 3NSCA 2WXRA 1PFOA 4Y5YA 2VTFA 1EGJL 1TYJA 4MRCA 3LIZH 4NAQA 3QFDA 3HUJE 2F1EA 1HSBA 3FQUA 2X89A 3JWDC 3LTVA 3L1FA 3OAYK 3IF1B 1J88A 2R7EB 4ZXBA 5D7IF 3UADA 2A6DA 1NLDL 3BQUA 4DP5X 2MPAH 4MS8C 3SJVE 1OF0A 3K0YA 2VR4A 4OZHE 4B27A 1MCOH 2QHRL 2DMHA 1KB9J 3PQYA 1GL4B 1OT4A 1F3RB 3OLIA 3BWUF 5IHBA 4FL4C 5T3ZD 2NY2D 4NZDA 1DQTA 2AF2A 2WBJA 4WF7A 5I0ZA 5EU6E 3TO4D 3U6RB 3NCMA 3DVIA 5DQDH 4JY4B 3IDNB 3WNIA 4AKPA 4ZNEE 3DROB 3HOGA 4JHWL 3GZQA 3BX7C 1TSRA 3HVNA 5FUZH 1TJGH 4X7DC 3RQ3A 4NLHA 1T89C 2CBTA 1CBVL 3PL6C 1A6WL 4YDNA 4Z95L 3FONB 4P99A 1FL5A 2K4WA 3X3GL 4V2CB 4I2XA 4PJHE 1FG2B 2YAOA 4EKXA 4KMTH 1RSFA 4OAWB 1KZYA 4PRID 4XMXA 2BZDA 4PCSA 3SBWC 1NC4B 3Q0HA 3C60A 3CN0A 1P4UA 3GMOB 4NRYA 2YPVH 1OGAB 4QWWD 5TQ0H 2FCBA 4JFXB 1A6ZB 4XWGH 1YEFL 1IGCL 5DJYA 4TQIA 4IIQB 1GYVA 4OM0H 2OZ4A 3ECBA 3WEAA 4N2AA 1BVKA 2HRGA 2IFFL 5AAMA 4WI0A 2ZWKA 1NAMA 3BPCB 3BP6A 4NB7A 1B0IA 4Z9KB 1IM3A 1WZ1L 1WWBX 1A6AA 3IXAA 3O3EB 1WZLA 5DXWA 2EZ0C 2DKUA 4UILL 2FB4L 1IEHA 1RV6X 2YSSA 1P69B 3AITA 4P48A 3LD8C 5EUKA 4NHUB 1CGSH 2CNYA 1J0ZA 3VXUD 5DO8A 3CVCA 1N7ML 5DUMH 3QEGL 3H3KA 4MZ3A 3V0AC 1I8KA 2J25A 4MZ2A 4FXKC 2HKHL 1JSYA 1UGKA 2G5RA 5FYKE 2DM3A 1UWXK 3HAEG 4I9WE 4EKJA 5AB2A 3CLWA 4JFSA 5DJ2A 4K94H 3I74A 1QKZL 2ZOUA 3N41F 4LP8A 3VRIA 2IPKA 1ROCA 3QI9D 1UD8A 4JZOA 1AG0A 3VFWA 1JE6A 4Y19B 2UUDH 1JZJA 5B1BB 1CZ8L 4ZTEA 5C07D 3FZUC 4X5WA 3F12A 3FQWA 3IEAA 2VW4A 4K23L 6PCYA 3RIAK 1X3DA 1RVFH 5KG9B 3LB6D 1ICTA 2B3IA 4OIIH 2ZAHA 4PRIA 4TSCH 5ADPL 3OQ3B 1CF8H 1JK8A 2V3EA 1E8WA 4QNPE 4M7KH 2EYSB 2J1WA 1ZVSB 2HP4A 1ZHBA 3CH1A 3U2SA 1JWUB 1TTFA 4XN5A 2HTKD 2VDPH 3RKDD 4NKDA 2NUTB 2VKXA 3FAXA 5EZIH 3ARBD 1PYWB 1E4XI 4FNSA 4UU9B 1K9TA 4TKWA 3WJMB 1FYTE 1KIRA 4F8PA 2Y9RT 5ID0A 1KN2H 1NCGA 5CGYD 3GBMH 4OQTL 1C8QA 5LWYH 3LRLA 4APQD 3E2HB 5DK0A 5IW3A 3U9PL 1DCEA 3V4UL 2WXNA 4BFBD 3U4AA 2E7BA 1N5YL 1OM3L 2DIJA 1GW0A 2CJTA 2QFRA 3V0WH 1UACL 4DETA 3SYPA 1X4YA 4JR9H 3R7RA 3RKPA 5KSUB 3CFNA 1T1ZA 4M6OL 1BBDL 4LHUB 3UBHA 3T8MA 3N0AA 1CLOH 4KPHL 4LCIH 1SDYA 3VM7A 3VFMB 3KHOA 2HFGL 2XVGA 4JJ5A 1CLVA 4YBHA 5IM7B 2HG5B 3I3DA 5T1KD 1NGXB 2V0AA 4Z7VE 1Q8MA 2E9WA 5D4QA 1C1EL 3IFNH 5HYQA 1FNLA 2DQDL 3NEXA 3WLWC 1BZ9B 1HE7A 3QDGD 3N44B 1QWHA 4JHAL 3TV3L 1OO2A 2YAFA 5A2IH 3VXRD 2WMPB 1EXGA 4RGND 4YHKH 5LAXB 1SYVA 2KQNA 2I9TA 3QO0A 1E6JL 2WKGA 5ACZB 4TVPL 4X4XA 1D9KD 2AQ2A 4UT6A 2BINA 3WFEL 1KJ2L 2XKUA 4CVXB 2O5XL 1CDHA 4JN2A 2RB8A 3A4DA 4TQ8A 3Q6GL 3S36L 4QOKD 43C9B 4Z3JA 1HWGB 3S3SA 2H2PD 1AP2B 4YFEA 2F68X 2ZF8A 5HD8C 4XCYB 5J56B 1LEGB 1DQVA 1GKOA 2E86A 2VDLB 2XQBL 5FKPB 3RWDB 1KLFB 2NX5D 4HCGA 1JK9B 1PEWA 3GYRA 3TYFA 2I24N 4N24A 3IVKA 3ASWA 2EIZB 1UWEL 2LGNA 1BAWA 5LXGH 5IHUL 2QHLA 1MCCA 4HP5A 1AG6A 3OJDB 1OCRB 2JVUA 12E8L 2XV3A 4M61A 1DO6A 3MCKB 3UCRA 5JPNB 1GA2A 5FXCH 1KELH 5EZOH 3NAAL 2YFNA 5G5DA 5FM5M 2R83A 1IM9B 1TZ8A 4GEIA 3CX5K 3V5DB 1GHFH 2LW3A 1J9SA 3VX1A 1Y1UA 3CZLA 1OSEA 2ADGB 3ZZSA 4G6AD 1E40A 1BEXA 2NY3B 2GVYA 1HYSD 5C7XH 3L81A 2YIHA 4LBEA 2JH2A 4Y5XB 4M62H 1HHHB 4MA1C 1IE5A 5BS0B 4GNKB 5ADOL 4I8DA 3PF2A 5T1KA 4Z0BL 1HI6A 3EH2A 3PP4L 4AGMA 3T0EC 1HILB 3EXLA 4XAWL 4A2HA 2XV0A 4OKVB 1KGIA 1LYQA 1XZWA 3QDGA 3DRTA 1T1YA 3VXRA 1PKOA 3VXME 1N64H 3SE4A 5PAZA 1NC4D 4ZO8A 1VFAA 2LLNA 4JGJA 4AKOA 1JGUL 5LGJB 5FFGA 4C54A 3DRQA 3L3DB 4HZ1A 5CZVH 5F8QC 1D9KA 3WFHB 1YMME 3KWWB 1TMCB 3PP3H 2P49B 4F8LA 1MCHA 4M6AA 4OZIF 2APBA 2JKSA 3GJFB 3RBGA 2R2HA 3GPEA 3P73A 2HLEB 1H3UA 1TPXB 3RFZC 1U41A 3CUPA 2XIDA 3UTPE 5GSRA 1IC5H 2CPUA 1BM7A 3IE4A 2NX5A 3I6GB 3UP1A 1EIBA 4FTDA 1EO7A 3SDCA 1LEIA 4DVBB 2QPEB 3MACH 3O45B 2VKWA 2DMBA 1EH9A 4YNYA 2AEQH 5AZEH 1KBVA 1NUDA 3KYMA 1RKRA 1R24B 2W81C 4KJPC 2FX7L 5KZCB 1BQLL 3Q3GB 5K9QI 4Y0GA 2VR9A 2OR7A 4GFTB 5E70A 3H8NA 3NCXA 5EBWB 5G2NA 2HSIA 1A2YB 5DZPA 1X5XA 5ABZA 3FDWA 3MGAA 4JY4A 3PU7A 3JTTB 4FDWA 4P9HL 3LPWA 1E7VA 3V0DA 4KRNA 2G2RA 4Y19D 3UG3A 3O4LB 3QZOA 4X7CC 5FV2A 4ONFL 5I1JH 3AROA 3ULUH 3T6XA 2IBBA 3ZUNC 5MEPB 1EHNA 1KFAL 3L9RA 4FQ2H 3TFKC 3WIHL 5IJBC 5GHWL 2BPBA 3PAVA 4CN4A 4OAWA 4AQ8C 3MLUL 3S48A 1F3DJ 1J7VR 3CN3A 4ZUVB 3FU0A 1HEZB 3P0VL 4P46C 5DJ6B 2G2PA 3STZB 1S5HB 3GIZL 2VE6B 1A6ZA 1S3RA 4X6EB 5B7MA 1KBKA 3F7KA 5E8EB 1XGRB 4TULL 5GS0L 2HVBA 4TQHA 1JZDC 1T03L 4N0CD 3VWJC 4QGTA 2X4NB 3ZHFA 3TT3H 1IIKA 3IBEA 4JAMA 4N85A 4PJ8B 2ZXDA 4N0RA 4LLYB 2H0JA 5A40E 2FYVA 4ZMVA 1BFTA 4YQXH 4YHNB 1F2QA 3EOYG 4S0HA 1N8ZB 5ALBH 3UTSE 1V54B 3SE8H 2FH8A 3AQXA 3KPOA 4FE9A 5JHLH 1Q1JL 2B3RA 1MAKA 5CLZA 2NSMA 4U2ZA 3ZMEA 3MRBA 3UYRL 2WB7A 3LV3A 2H3NA 3LKOB 4YDMA 5C0BB 2G3MA 2CUHA 1JUFA 2DN7A 2CHNA 1T04A 2WD0A 1QX1A 4FQQA 4GQRA 1RH8A 3QC6X 2AJUH 4Z7OF 1KIQB 3TBSB 1HAUA 2OXGB 2PTTB 3AFLA 1JGVL 4HCRH 2IPTL 4UM8A 4PRBA 3QCTL 1OALA 5ITBL 3KXFB 3CK0L 4P2OC 4Y19A 3IDUA 3AMKA 3LKQB 1NANI 3ZDYB 1P5UA 4E9WA 1UB5B 1DEEA 3OC5A 4ZS6D 3T0WA 3L3KB 5KG9A 4LLDA 2AJYL 2WWMD 4BK5C 3NGBB 4FNLL 3ULUC 3CFQA 3HZKB 3WHXB 4K3JL 2EDDA 1BM3L 2ZUXA 4N8UA 1ZT4A 3HN3A 3BUYB 3KEDA 4U7MA 4WUUA 2QSCH 2CR0A 1AYRA 4AGQA 2JB6B 3N42B 4XBMA 2EJ1A 3IM1A 4XP4H 4ZMTA 5GJTH 4PTTB 3QQ9D 4ABQA 1JWUA 2Q0ZX 3ECVA 3EAKA 2ZSVA 2CR3A 4I2XE 2NUTA 1PYWA 1TCRB 3C6LD 3MXVH 3WJMA 4LRIC 1E3ZA 1KTBA 1BYPA 3AG4B 4QY8B 3ES6B 3JV5A 4KHTH 1X5IA 4FXLA 2KBGA 5ESAB 4YAQB 3CU1A 4BFIB 5DK3A 1IM9D 2E6QA 1WE5A 1Q9KB 4MCYB 4UF7C 3ZQXA 4K71B 1OLLA 2GEEA 3Q1EA 2YBRB 2C9XA 1GJIA 2WVUA 2NY3D 3KWXA 5KSUA 4D8PA 4PJIB 1L6PA 5FO8B 4B3EA 3Q5OA 5D5MF 3US1A 3B1UA 4ZFFB 5BS0D 3C08L 1VADB 4NXKA 3VFMA 3CC5A 3AACA 3M1BB 2HG5A 3R8BB 4DK3A 1NGXA 5JMRA 2WVVB 3GXTA 3H7LA 4IJ3C 1OPGH 1OTTD 3QJOA 4PJGB 3N40F 1A4JB 5BQDA 4FC3E 3S5LB 2G5BB 5DS8B 3M45A 4QRUA 4ZPVB 2DQTH 5DTFA 5EBMB 3RVTD 1ERNA 1N6QL 1X4XA 3Q06A 5LAXA 3T3ME 4FNTA 2BVPB 4W68A 1W72L 5D8JL 2Z0UA 1Z32X 3QAQA 5FK9B 9PCYA 2YGOA 1VJSA 3NSDA 4LLMB 5T3ZE 3MJ9A 3DETC 4J2QA 3N06B 3QA3B 4CVXA 1WV7T 5CJOH 4G8GA 2NZ9C 4TSBH 4QHKJ 2ZUWA 5KBDA 43C9A 4E9RA 4N20A 5FO9B 3WN5B 5DRNA 4AH2B 4YHZL 1LEGA 1PLGH 4R4ND 5BO0D 3MUJA 4DOHB 1S7UB 1UD5A 2VDNL 5FKPA 4Z7QE 1N59A 1JK9A 2OLDA 4HWZB 1CURA 3C6LA 2FNWA 4YE0A 2MWCA 3OB0K 4DGUA 1ZT7B 2BP5M 4PRIE 1A7OL 4LQFH 1IEAA 1LO5B 3NSFA 2X0VA 3OJDA 3BP7B 5AYUH 5MHSD 2B39A 4GP4B 4M48H 5DC2A 5JPNA 1W16A 1Y18A 2EYTA 4N8VG 1MFAH 4N90D 4DP1X 3W9EA 5KZCD 1DQDL 4P2CG 3T65B 5DD6A 1RZ8B 4D9LL 4NNXB 5IV2A 3S2AA 3OMNB 4PJ5A 1FNSL 3RWJB 2X6AA 2VUOA 2A38A 4IBUA 2XN0A 4JFZH 3D5OF 2IV8A 4OCYH 1HHHA 3TPUA 3O4LD 2Y6SD 2B08A 4Z5RB 3KYKH 1ULVA 2DQHL 4PJXF 1YYLH 4EDWL 3HG4A 1BIHA 3M7OA 1HILA 1HL9A 1MVYA 1TMQA 1NM4A 1BHGA 1FLRL 2VXQH 4OKVA 3VXUE 5JXAL 5I1EL 4DIXA 3OHXC 2A6KB 2R39A 3RIKA 4X7TA 1Z9MA 1W0YT 4A6YB 3ZW3A 3QHZL 1CN4A 1R46A 1CG9B 2BP0A 2ZSWA 4GSQA 4AYSA 4JHBA 5LGJA 2OZNA 3ZKSD 1JN6B 2VWEE 2X7LB 1OAJA 2XZAL 2JIXB 4EUPH 5A2JH 5GRUH 3WFHA 3KWWA 4NUPA 4WU7A 2XRAL 1PZAA 4KY1H 3GJFA 4JFOB 1Z0MA 2IBGA 1UXWA 3ATBA 2DQGL 5ISZB 2SEBA 1BVLA 5B22A 5AD0A 3FHEA 5C07E 2OTUB 3P4OB 4JFFA 1MVUB 2DWDB 2X4RA 1FYHB 3I6GA 3NJNA 2FX9H 2HFFB 1CLZL 4H7VA 3BSGA 2AW2A 1QFUL 1NIBA 4DVBA 2IWEA 3P9MB 5IF0A 1MFUA 1ETA1 4JRYB 1KXQA 1JGEB 5EBLB 3RVXD 1S5IL 2V2XB 1KCSL 2P28B 3GTNA 3MGOA 3N2JA 1YEHH 5C0BD 4F93B 4PY7B 1S7WB 1ZHKB 5IESL 3BKYH 4PB0H 4PJ7B 5IMOA 4AW4A 1YEKH 1NL0H 1OCCB 2YFOA 5HJGA 3MUY1 4YSSA 1IFRA 5C3IA 3VDAA 1PMYA 3QUXC 2IEPA 3U4EB 2VC2L 25C8L 3DJZA 1MAMH 4R7XA 5HHPB 2YJLA 4FG6C 3RDTC 3O4LA 1EGJA 2MKLC 1V55B 3WXVH 3QG7L 4HJIA 3V0IA 1K8IB 1I9JL 2PNDA 3Q9PA 1G0DA 1MCPL 4FZ8L 4L1SA 1KYDA 1SUJA 5TK4A 4CGUB 3MNWA 5LAPA 3P3SA 5DI8A 3FSZA 3O8XA 5LBSH 2QJDA 2FSEA 4JZJC 1SF3A 1IVLA 1FNFA 1O9ZA 1R1CA 4ZUVA 1NEZB 2YD0A 1NDGB 4U6XB 5DJ6A 3LMJH 3RAJH 3LYRA 1S5HA 3NP3A 3MLWH 1V3JA 3B9KB 3O0LA 1C9SA 4X6EA 1DUZB 4GXFA 1N18A 5AVVB 5E8EA 2ADFH 5KS9B 2R51A 3WKMH 3GT6A 4NZ8A 2APVA 1IL1B 2ZONA 4G5ZH 3QDGE 1VFBB 4P59L 3P1VA 3QT2A 2IWKA 3EYFA 3VXRE 2FBRA 4ZMOA 2CO6A 2X4NA 3LKRA 1ONQB 4RGNE 2HJKB 3GHPA 4KNQA 3H56A 4IK7A 4KQ3H 2TRYA 3RWGA 1MJJB 5TDOB 5FGCE 3THMH 1N8ZA 4MNGE 5T5FL 4HC1L 5I5JA 4Q9QL 1GPOH 1T2QH 2WANA 1B9ZA 1T66D 3QZPA 4MQTB 1A4AA 3UG4A 5GRZA 5KVGH 5KYWA 3IGKA 1KENH 4EVNB 5BRQA 1KEGL 4L1HA 2QR0B 3A6OA 4LRNL 1PX4A 1Q9WB 4QOKE 3K8MA 5IW6B 2XWZA 3HR6A 1U3HB 3LKOA 1HYRC 4PJCF 3B7TA 3TVMC 3HRPA 3T3PF 3X1GA 3MRFB 3UJJL 1OAXL 2NX5E 3TBSA 2PTTA 2ZAGA 1WUZA 1NOFA 2ZUTA 1W9XA 4HLEA 1QYGL 3SDAC 2L7EA 4CMHB 3EYOA 2EH7L 4XNYL 3ULUF 5DJZA 3QXVA 1KGXA 2KERA 4XNXH 1OE3A 2B2XH 3H42H 4U3CA 4NC1C 3PNWA 3LKQA 3TTSA 2BXZA 1ES0A 5IB4B 4GP5B 2IQAB 3OXRB 5EORL 1CK0L 3L1OH 4K2UL 4EI6B 1I1YA 3U83A 5JUEH 1XMEB 3OWEA 5KSAA 4L4VB 1SHXA 2OMTB 2NLJA 3D0AA 1PG7H 4I3SH 4TTDD 3W2DH 3BUYA 2A73B 3TIEB 3WEOA 4L8BA 1WCBA 4E9SA 1YJDH 4BRVA 5A2FA 4PU2A 3V4PL 5L9DL 2HTLD 2ZD0A 1XR9A 1TCRA 4N1EA 2VZSA 2LU3A 3S4SB 2DLFH 2WZAA 4OR1A 3R19A 4QY8A 5CJBA 2H5UA 3K81A 2MOVA 2CKNA 4YAQA 1F42A 3BCDA 4XMZA 4BFIA 2FHCA 2VITB 4TVPD 5A16B 1GC1L 4NO0B 3DNKA 1G7IA 1SJVA 1Q9KA 1MF2L 4MCYA 5E08H 1XSJA 3I02A 2J1XA 3LNDA 4Y8DC 3WY3A 1KF9B 2YBRA 1XSKA 1HESA 2EADA 4PJIA 4PV9B 4IYKA 4PHXA 2FHFA 2GBAA 2XN9B 2VMCA 2XPGB 4MXQC 2HKFH 7PAZA 5FUOL 4HMCA 5AALA 4P2AA 3RY5A 3SGKC 1VADA 2QT6A 2BVQB 1G7QB 3M1BA 3MUZ1 2Q3XA 4G59C 5GS1B 1J0YA 2WVVA 5D7EA 4PJGA 3IAPA 3BT2L 3RY4A 1FRGH 4OZFB 3TURA 2ALWA 2G5BA 3BAEH 4PJ9A 5DS8A 2ICEA 4FQXB 4POZC 4ZPVA 5CFAA 1V3MA 2WLYA 3A22A 2H6UA 4PREB 4JO8A 2MCPH 5GGSB 1WBXB 2FJSA 4LAJH 1IQWL 2WNKA 4OQTA 1MPAL 2H1PL 2EXYD 1YAZA 3EGDA 5D7JB 1CFQB 4FXGA 1BBJB 2JIXD 4GP8B 2OX5A 5I24A 3T4YA 2WTOA 3BP5B 3OXSA 4KVNL 3QA3A 2QV4A 4XMKH 3MBXH 1QRKA 2CHZA 4KI5F 5E2TL 4XNDA 2XQYG 2Z7UA 4I18B 4M8VA 3VFOA 4GMTH 5IGXL 2XTLA 1QFPA 5ISZD 3VMOA 3NPSB 3WN5A 4AH2A 4Y19E 2D8KA 3Q1SH 3KCPA 5ERWB 5IFJA 5ALBL 1S7UA 3EYVA 2CO1A 1INEL 1E6OL 3VDCA 2GEQA 3PGFL 3WIAA 2XXFA 4BXVA 3H2WA 1YJDC 1MCSA 3NK3A 1CQKA 3S3DB 1FP5A 4FNPA 4KRLB 5AW6B 1IKNC 3BP7A 2R2CA 3E8UH 4JRYD 3FUJA 1W72B 1SVCP 1YYCA 4P2QA 3RIFF 1GTFA 3UDWA 1DLFH 3CVHL 1MCQA 3C8KB 3ZRCC 3T65A 1KJ2A 2I5YH 1BX2B 1IC7L 5F9WC 3LQZA 3L4UA 3KNBA 3MV7A 4ELKB 3MLSL 4DJMA 2NTFB 1CB4A 3EYSL 3ESUF 4PBVC 4DAGH 4NN7B 1ZLSL 1RJYB 5CBEB 3FU5A 4OZGF 4Z5RA 1HH6B 4CNIA 2CMRL 2VDNB 4EZKA 1QVOB 3EBHA 4P9ML 4J3OH 5J1AB 3V6OC 4FQHB 5AZ2L 1T5KA 3ZRFC 5FCSH 5CLYA 1P6FA 4ORGA 3KGRA 4YBLC 5E99H 4BCZA 1UENA 1AFVL 1SBSL 3GSRA 1QFWM 1CE6A 1CT8A 2DWYA 1CG9A 3L3GA 4HWNA 3QDHA 2WGNB 5JHDB 3O3AB 3B9KD 2X7LA 3ARVA 1IBFA 4HJEA 2IMMA 4L5FL 5IFAH 3LAFA 2H47C 5DVOA 2DWEA 32C2A 4JFOA 4BKLB 5ISZA 3ML9A 3SO3C 1OGTB 1JZEA 4R96A 3QJVB 3FFDB 1OD9A 4MVBD 4XMWA 3TJEL 4FA6A 3P4OA 4XOBA 2O72A 2WLZA 1MVUA 2DWDA 2IQ9L 3OAYH 4PV1C 5HJBA 4XO3A 4X6CB 3UBXI 2HFFA 2F74B 4S1QL 1G1CA 5E2JA 4E41B 3I84A 1G7JB 3OKEB 4OGYL 3UOAB 4P23B 4BK8A 3MLXL 2DYPB 5DS2A 3U30C 2XKSA 5EBLA 4YSUA 2V2XA 4ISVA 4KK5D 1U3HD 1E9PB 1JHKL 4NN6B 1BJ8A 5E6YA 3RTQC 1R75A 5KSVA 4ODUB 1FIEA 4KNTA 4XOAA 1S7WA 1ZHKA 4R8WH 1PS3A 2V4LA 1GS8A 3O2DL 3P11L 4PJ7A 5GS0D 1D5XB 2FWLB 4XPGL 2LE9A 3OKYA 3JT2A 3F85A 1RURH 3U4EA 3UTTB 2CXKA 5C2UB 3CFMA 4HFWA 3WNOA 3DMMB 4LE8A 1ZVYA 2H41A 1ODAA 1IARB 2B1AH 5T1DL 3ZZ1A 3LS4H 2CDFB 4W4NA 2ED9A 4YXHL 4YSTA 2FE0A 2R4RL 4HLZH 4E9LA 2EDMA 4Y4KA 2BWIA 2QFPA 4J6RL 3VUAA 1R0AH 4N2DA 1EUUA 1MW1A 2KQMA 5JOFB 3T4AA 5TDPB 3A6CL 1CFVH 1AZNA 5KBLA 1NEZA 1TQSA 1NDGA 2YR3A 4U6XA 5EO1B 2G9HB 3I2CL 3IFOA 3CZFB 1WBZB 3B9KA 1SHWA 5BS0E 1I3UA 2J8OA 1N10A 1YMHA 3P2DA 2DH3A 4OJEH 2VDKB 2WXLA 1OK8A 4AYBA 1D6VL 1IB5A 4M1DL 4HT1H 2EDKA 4EUPG 5HGBA 3MKGA 4EZJA 1ACZA 2ZWZA 1ZK9A 3OPUA 4KZDL 1NBZB 4GOSA 4A7VA 1ONQA 1E65A 2HJKA 2ORBH 4FI6A 3VFUB 4Q9CA 4LDOB 4N0YL 1PKQB 2YA1A 1MFCL 3WIHA 5CN3A 4NO0D 3LRHA 1JPSL 1W15A 1P7KB 2GHWB 3SYAA 3TA3C 4RGOH 4AC2A 4EVNA 4UNIA 5D71H 5IEHB 1IC4H 1Q9WA 5DDHB 5K9KB 2E59A 3LKNB 2Y1ZA 2XN9D 4MA8L 1UWXH 3NJHA 1Z5LA 4K9JA 2QADC 1ZE3H 1IAIH 3W9DB 1QBLL 3CVBA 2APWA 5IBUB 1B0RB 1RFDH 3MRFA 1U8OA 5EUOB 1KJVB 1Z2KA 2BVTA 2QLYA 4RFOH 4LESA 1U8MA 1WD9A 4Y16B 2HRPH 4FQXD 4EE2A 1FSKC 2NW2A 2H1XA 5MHSE 4FX5A 1KXQE 4FZEH 1J1PL 4I1NB 4L3CB 2F58L 5D7JD 4KMQA 4N90E 3OXRA 4RCAA 9CGTA 4UQ2B 2CLZB 2AQQA 4G6FD 3PGDB 4K9EC 3RWCB 3WFCL 2KH2B 5KVEL 3ZO0A 1BA9A 3CFIC 4L18A 2HVKB 2OMTA 5AW9B 4ETQB 1ZTXH 5SWZB 2V2TA 4JEGB 3HZYB 3WJJC 2WO2B 3O4LE 1JYXA 5IR1A 2QTEA 3EJZC 4FKHA 4BD4A 3H9ZA 3SY0B 4KKQA 1NJ9A 1KYUA 1J0IA 3FQ1A 4PGBA 2NTSP 2VN5A 5DHVH 4PS7A 4F58H 3UTOA 4H25B 1G9MH 1M71B 3KYAA 5IB1B 2G3XA 5DD0L 3MPCA 4I0PC 5E6IB 1CGTA 4JDVA 4M8QA 5I0DA 5AW8B 2AI0H 2W0LA 1BVNP 1Y1DA 4U0RB 4AL8L 4A04A 4ZW8A 5C86A 3BW9A 3U1SL 1CFSB 3CHXA 4BUHA 2N1KA 5L7XH 1CI5A 2G0KA 2X9ZA 4JB9L 4OLYL 2OSWA 1JRHH 3KLSA 4KOBA 4PRNB 1JGDB 4PV9A 4NFBA 2XN9A 3NQKA 4QTIH 4OBRA 5F7KC 2WIMA 3E38A 1MRFH 4KUCF 1FVCA 1XGUA 3TZVC 3V4PB 1G6RB 1QABA 2EXSA 3C5ZC 4KWUA 4JPIB 2YAHA 4LASL 1MFBH 2V7HB 3CFEA 4FFYH 4OZFA 4ZAKC 3UAJA 1A9BB 1KY7A 1C5DA 2XXGA 1TQWA 1B4RA 4OLZH 3LDBC 3ECUA 3N85L 2OR9L 4J8RA 4LVNB 5B38G 5C0ND 3BGFB 1NDMB 4PJEB 3BH8A 3NEOA 4H0HB 1YNLH 5JHDD 1NLBH 5C0BE 1CFQA 4WEMB 4LCUA 3FCUB 4NLAA 4OF7A 1NCCL 1MCDA 5IP4A 3BP5A 1SM3L 3ROLA 4HIEA 3CN1A 4XCFH 4ZG1A 4HBCH 4WW2B 1ET5A 1TQCC 3EZ8A 3GRWL 1IKOP 1MZZA 4N5UA 5AW1B 4AE0A 5I76B 5GRWA 2ZZUT 4NJ9H 2FZ3B 3P0YH 3H3PL 1N0LA 2CG9X 4W4OA 4BSJA 1T0OA 2C3XA 5AYTA 5D2NB 1EQWA 1HWHB 3ZDYE 2Q8BH 1QLEB 3ZN6A 3TBVB 3V0JA 4HK0B 2W60A 4E41D 3B37A 4XN2A 4P23D 3WNPA 3SDXA 3N1FC 4GUCA 2DYPD 1I1AC 2DS4A 1UUNA 3ZKND 4BYHA 1W72A 1ZXKA 1YEIH 3BMVA 5HYIA 1G9MC 2J7LA 3NIFE 5E4OA 3ET9F 4LSTL 4YDJB 3TCXA 3DARA 1IGMH 3JZ7A 1NZRA 2X0UA 1MCIA 3HE6A 5EF0A 3LN4B 2QDVA 2NTFA 3H4FA 4HS3B 1A3RH 4GMSH 2AEOA 1QW9A 2R23B 3D33A 3P30H 4U1HB 4XZUB 3UTTD 1D5ZB 4BE5A 4HUNB 1RJYA 5CBEA 1QSVA 2BCMA 2Y7MA 3DMMD 4HEPG 3CXHK 2L4OA 5HJ3B 4I87A 3VRJA 1OQOA 4C4BA 4CILA 5B8CC 1E5YA 5J1AA 4KUZH 4OUUB 3M7FB 2KT6A 3CWGA 2NYKA 1RZGB 4NQVB 2A77L 1KLGB 3HC4L 3B5TA 1R3KB 3MV11 3MRMB 1NGPH 1KGYE 4TUJB 2DWTA 1BIIB 1H3TA 3APCA 3D1MC 2BMKA 3WYRA 3MJGX 4HUVB 4PJIE 4LPVA 1JI2A 5IZ7A 1MNUL 3O3AA 2V5MA 1D7DA 1YEJH 3PUCA 1FZOA 5TGBA 2MTAA 1OW0A 4F7EB 5HYJD 4O02H 5HHQB 1EZUA 1YO4A 4LPYA 2ESVD 4PJGE 1U8CA 3IMRA 1RUPH 4WCYL 5E9DA 3VRLF 3BKMH 4KJWD 4BWWA 4N25A 2UZXB 43CAB 1FBIL 4N2GA 5KW9L 1OGTA 1YEEH 5LDUA 5C97A 3MCLL 1F90L 3R4DA 2H7WA 3NJXA 1Z9NA 1UEMA 1OAZL 3LXBA 2NY4B 4AJVA 4X6CA 1X7QB 2J8HA 2VDRL 5AKVA 2UWEB 2K0RA 2DJMA 1F97A 1WITA 3RNKB 1UJ3C 1G7JA 2QPSA 4E41A 4E5XG 4QRAA 2WJ5A 4P23A 4J39A 2OW6A 3HVDA 4ZDHB 3BH4A 3MGTB 4GXUN 3O2WH 4WEUD 2E6JA 3X13A 4UTAH 3REVB 4RAVA 4ODUA 4DOHE 5AOLA 4XP1H 1QUPA 1XR8A 4YR6B 3WBDA 2VDOL 3KW7A 4UAOC 3S3CB 3P4LA 4GKZA 3KR3L 2KC0A 1JGLL 3LNIA 4XBGA 5C0RH 1QR1A 1I1CA 3MX0B 1RHFA 3F6JA 4PW3A 4WGVB 2OV0A 4JPQA 1LP9B 1LO4H 3DMMA 4KKBC 4BFFA 5J89A 4LSRL 4J3OF 1AE6L 2R2EA 4TVPE 5F88A 2EDLA 5E1AB 1NGWA 4ZMAT 1WVZA 1TR7A 1Z9OA 2X0WA 3KVPA 5TDPA 4Z3FA 5HHXH 2Y5TB 3UTZB 4X7SL 4J3OG 4U1JA 2LAGB 5D6DA 5SWZD 5EO1A 3RFRA 2G9HA 4OY9A 1P6AB 2VLKB 5JR1H 3CFDA 4X4YB 4MD5A 5HYJA 2X6CA 5AOMA 5C6PB 1GY2A 2D9QB 2ESVA 3O9WB 4HIXL 3MOAH 1VLXA 5EU3B 2V7NB 2Z92B 3ZTDC 4RSYA 3VXSB 2Z91A 1NBZA 3DJSA 4OQ1A 4X6FA 3VFUA 2BVUA 2I7OA 3GSOB 4RVBA 2YPLB 3SDDB 4Z7UB 2WP3O 3U0WH 4OM1H 1XDTT 3RJQB 2D31A 3L3JA 4EMZA 3VCLA 4UQCA 2QGBA 4N6QA 2QQLH 2P5EA 3CZKA 3RVWC 2R8SH 4QDGA 1K3IA 1SN2A 2BZCA 1PNDA 1EEZB 3FK3A 5GGVH 4NWTH 3QQDB 4XNMB 1E8XA 4AIOA 5AVYB 2D3LA 5DDHA 5E0QA 2BS71 3LKNA 4PLKC 3GWJA 4XAKD 5G4OA 5ISZE 4W9LC 4N2KA 3BFQG 1P2CA 1YNTB 1GS7A 1A7RH 3OMAB 2D73A 3W9DA 1TENA 1RUML 3VGBA 1ADQH 3DK2A 2YEZB 1F2XK 1LO2L 1UYWL 2UZIL 2VAAB 3X11B 3UC2A 2E7LC 2C1PA 2Z31B 5DZOA 3FU8A 4IRSB 2VUKA 1NCWH 2X2IA 3MBEC 3TASA 4QUOA 1L6ZA 3GUTA 3FQYA 4PR5B 5AEAA 5DSCB 1U4FA 4R5VA 4JRYE 1OAKH 4AQAB 1T83C 3DI3B 3BIKB 4B7LA 1S3KH 3KWTA 4G6JH 3CLEL 5T5FA 1R5WB 5I1GL 3E80A 4J7RA 4YDKH 4MKMA 2XWDA 4J1UA 4PJ7E 6FABH 1ZPLA 5DMIL 3AREC 4HLZG 1LXMA 2ZP9A 4ETQA 2JB5L 4N1HB 5L8LB 4MQ7B 5SWZA 5SX4H 4O2CA 2IGTA 5TDNB 5J6HB 2QVIA 4NKIH 2P80A 1CBJA 4JO2H 1QLFA 4DUVA 3EO0B 5C9KA 4G42B 5E5LA 3UL4A 4R97C 3SY0A 1KLUB 4W9HC 4HWBH 3B9VA 1A1OB 1RZKH 5T1MB 3R18A 5GIRB 1BREA 5EO9B 3RWEB 4NZJA 5C0IB 1UM6H 1YPZB 3GIVA 5HY9A 2Y7LA 2R69L 4R83A 3EYQD 3FT1A 5HPOA 3M86A 2UX6A 5DMYA 3QIWB 4CSZA 1G5AA 1ZLUH 4XNUL 1T0NA 2K6ZA 3INUH 3VD1A 1ZVHA 1CXEA 1YC8A 2R0WL 4MJIA 5KS9E 5LXVA 5FGSA 5I6LA 1U8LB 4MLSA 1QR4A 1DVUA 1S9XB 1MQKH 1X5FA 4PRNA 2Y25A 2AQSA 4AY0A 1DE4B