2Z6CA

Crystal structure of lov1 domain of phototropin1 from arabidopsis thaliana
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
121
structure length
121
Chain Sequence
VSEDLKDALSTFQQTFVVSDATKPDYPIMYASAGFFNMTGYTSKEVVGRNCRFLQGSGTDADELAKIRETLAAGNNYCGRILNYKKDGTSFWNLLTIAPIKDESGKVLKFIGMQVEVSKHT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis of the LOV1 dimerization of Arabidopsis phototropins 1 and 2
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Transferase
molecule keywords Phototropin-1
total genus 31
structure length 121
sequence length 121
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2007-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2z6cA00
1S1YA 4GS9B 2PR5A 1D06A 4KQDA 5HWTA 2OWHA 3IS2A 5J3WA 2YKFA 3PYPA 2GJ3A 4H6JA 3A0RA 3NOPC 1KOUA 2Z6DA 1EW0A 4I39A 4JGRA 4EQ1A 1XFNA 4F3LB 1T1CA 2BASA 2D01A 2V1BA 4HP4A 3BY9A 4R38A 3VE4A 4BBTA 1LSWA 3NOTC 3C2WA 5F69A 3NOUC 1S4RA 3GDIA 1LSXA 1XJ2A 3HJIA 4GCZA 4GW9A 4HP9A 5AVEA 4K08A 2PDRA 4JGOA 4EXOA 5HD3A 3SW1A 1BYWA 1S1ZA 3IS2B 4I3JA 4RQ9A 5F6AA 5AVFA 3LI8A 5A8BA 2PYPA 4I3AA 3RH8B 1GSWA 3EEHA 2V0WA 3G6OA 3E4QA 3BY8A 3OLOA 2JN7A 2PHYA 1D7EA 1JNUA 1DP8A 2PD7A 2W0NA 5EFWA 5J7EA 3LIDA 5HDDA 1T1AA 2PD8A 3NHQA 3F1OA 3F1PA 3H9WA 3MJQA 4BBUA 4EESA 3ICYA 4HH2A 4L9EA 5IS1A 3UB7A 1G28A 2ZBBA 2A24B 1GSVA 4NXGA 3F1NB 4EW7A 3UE6A 4WUJA 3LUQA 3NJAA 2H28A 4MN6A 1T18A 3UB6A 2V9AA 2VEAA 4HJ6A 1OTEA 4HQAA 3UMEA 2D02A 4PKYA 2OOLA 5HDSA 3F1PB 2OWJA 4LPZA 3K3CA 2B02A 1ODVA 2KX6A 2QJ5A 2PR6A 1OTBA 3LIBA 2ZOIA 2CMNA 1N9LA 4HJ3A 1MZUA 2WKPA 4HY8A 4R6LA 2V0UA 4H6JB 1OJGA 1TS7A 3MQQA 4HNBA 4JGQA 1OJ5A 3K3DA 4BBVA 3PHYA 4LRZE 1DRMA 3D72A 4KUOA 2HV1A 4B9OA 4EEPA 1DP9A 1S66L 2P7JA 4L9FA 5TBMA 4HHDA 3LYXA 1V9ZA 2VLGA 4EERA 3F1OB 2QJ7A 3LIEA 4E04A 1OT9A 2EA9A 5HZHA 2W27A 1LSVA 1UGUA 1OTAA 3E4PA 3UB8A 2WKQA 5IU1A 3CAXA 5HWWA 1LL8A 2L1MA 1XFQA 1XJ3A 1OTDA 5J4EA 2WKRA 2Z6CA 4GHIA 4R3AA 4XT2B 2L0WA 1OT6A 4WL9A 1V9YA 1OTIA 1S67L 2QKPA 4NXFA 4WN5A 1UWPX 5F5YA 5HDCA 1LT0A 3BWLA 3LICA 2QWSA 4WLAA 2VV7A 4JGPA 2K7SA 2L4RA 3EWKA 3GECA 4I3IA 4HOIA 3F1NA 3H82B 3UMDA 1NWZA 3MXQA 2YKHA 4F3LA 1TS8A 3VOLA 1Y28A 1DP6A 4YWZA 3B33A 3HJKA 3VE3A 4HI4A 4XT2A 1P0ZA 1XJ4A 1T19A 2INWA 2QHKA 4LRYC 5I5LA 5TBMB 1UWNX 4WF0A 5HD5A 4LLOB 3FC7A 1F9IA 1GSXA 2PYRA 1N9NA 3H7WA 4R70A 3H7WB 5DKKA 5G4YA 3H82A 2VV6A 3ZQ5A 4PKYG 5F68A 4EETB 5KIZA 4L9GA 2R78A 3KX0X 4MN5A 3LI9A 2KDKA 4LRXC 4EEUA 2M1CA 2V1AA 5HSQA 2JHEA 1XJ6A 4I5SA 4NXEA 2ZOHA 3CWFA 3ULFA 1WA9A 4HJ4A 3UB9A 3E4OA 3RTYA 1TS6A 1TS0A 2A24A 4I38A 5DJUA 4DJ3A 3MFXA 4GS9A 1F98A 3FG8A 3LIAA 2VV8A 5G4ZA 3T50A 4M4XA 4NXBA 3A0VA 4GHIB 4HH3A 3A0SA 1N9OA 1S4SA 3P7NA 5HWVA 4DJ2A 1X0OA 5DKLA 1T1BA 1VB6A 2J80A 5DJTA 3C8CA 3MQOA 4KUKA 4HIAA 3CLOA 3IBRA 1P97A 3LIFA 2I9VA 3MR0A
chains in the Genus database with same CATH superfamily
1EW0A 4HBUA 3NOTC 2JKGA 5HW3A 4I3AA 3IXBA 1GSWA 3Q7VB 2WADA 5K5BA 4B93A 3H9WA 3MJQA 3ICYA 4HH2A 1G28A 3UB5P 2JKRI 3P09A 1E3UD 2VGKA 4OOLA 2XFSA 3MXRA 3BFDA 3UB6A 1HD8A 3HREA 1PRQA 4EBPA 5HDSA 3S7OA 2ZC6B 5CX7A 1W5DA 3N8RA 4ZJ3A 3UO9A 2VLGA 2JE5A 3DTKA 5M1AA 3IH9A 1LSVA 5IU1A 3CAXA 1MPLA 1PW8A 2XD1A 2Z6CA 1FR6A 1FILA 3O5YA 3GR2A 2W3DA 3F1NA 3VFFA 1FIKA 4GZBA 2P9VA 4YOFA 3UPPA 3H7WB 2EX6A 3H82A 4JXSA 4S2JA 5IT5A 2R78A 3LI9A 2ZQCA 4I5SA 2IA2A 2ZL1A 3ZDJA 4P6BA 5LBRA 3LIAA 4EV4A 2FFFB 3NCKA 1YKDA 5DKLA 3QP6A 4RX3A 2Y2OA 4HIAA 1PNEA 1IYOA 4KZ8A 4E3LA 2BASA 2V1BA 3V50A 4DN0A 5HAIA 3NOUC 3E2KA 4EXOA 5F82A 2XR0A 3E2LA 1DJBA 3UDXA 3G6OA 2CC1A 2HP6A 4G3WA 4GDNA 4QU3A 3LIDA 4S2MA 3F1PA 2XROA 2OAQ1 3BLSA 3M6HA 1ODVA 2KX6A 1U60A 4LV2A 3BQAA 4HY8A 1PWDA 1OJ5A 3K3DA 1YLTA 4OPQA 4OLGA 4KQRA 3IWOA 3MKFA 4R4SA 3M2KA 2IWBA 4FOFA 3E0YA 5CRFA 4GHIA 4WMCA 3V39A 4KG2A 3BQ8A 2K7SA 5AQBA 3OPHA 3GVBA 3OZHA 4BD1A 3VE3A 4X25A 4N92A 4JPMA 1G68A 5FI7A 5HAQA 3ZG7B 1W7FA 2V8CA 4P6ZS 1PI5A 3QP8A 4HJ4A 1K57A 5HFOA 4AFIA 3C30A 3PBTA 3A0SA 3P7NA 4DJ2A 4BQMA 4IVKA 2PBDP 4WZ5A 4QWOA 5J3WA 1ONGA 4ZBEA 4Y0UA 4KQDA 4EQ1A 4BMWA 4Q0JA 3RXWA 2W1TA 4HP9A 4B4XA 1XJ2A 3U2AA 4GCZA 1MC0A 1OPXA 5L09A 2A2LA 5F6AA 3SH9A 5FQIA 1YM1A 4ZRRA 2PAVP 4WEKA 4BBUA 4QHCA 3Q1FA 1GSVA 1LI9A 3F1NB 1PW1A 1NYMA 2V9AA 4DKIA 3IHBA 2VGLS 2MJ6A 4PKYA 5EPHA 2CMNA 2OAP1 2HDUA 2C5WB 4XUZA 1SCWA 2W1RA 4GDBA 3HLDA 2V8FA 4E04A 1J3WA 1UGUA 2A3UA 2P04A 1P9WA 3MSHA 1J9MA 1NRFA 1OTDA 1NJ4A 4NEED 2L0WA 4WL9A 1OTIA 2WZZA 2BTFP 3IF6C 1SHVA 4I3IA 2OV5A 1NXYA 3IBJA 5TJJA 3G4PA 1GCEA 3HJKA 2XA7S 3JPUA 2WAFA 5CGXA 3H7WA 3IT9A 5G4YA 4CLCC 3QHYA 2VV6A 5F68A 3S7QA 4GKUA 1NZOA 4DE2A 1IFQA 2J3TD 4M4XA 3QP4A 2XLNA 1S4SA 1X0OA 4GNUA 1CJFA 4FSFA 5U47A 3QNBA 1CEGA 4C3QA 1S1YA 1MXOA 2Q0OA 1MKIA 4R38A 3ZHHA 1JWPA 5CECA 5FEGA 4FH4A 4G3KA 2PYPA 5FAPA 3VV4A 2QZ6A 1P9RA 3BY8A 2PD7A 2W0NA 5EFWA 5KSCA 1IELA 2W3EA 5IS1A 3UB7A 4ARZA 1N4OA 1W63M 1FR1A 1GHIA 1TF1A 5FDHA 3AGFA 4P6ZM 1S0WA 4KG5A 4GD8A 2JKFA 4DXCA 1OJGA 3B47A 1NLYA 4UA7A 3BECA 1SKFA 5KZHA 3IQAA 3UB8A 1CI9A 1OTAA 3E4PA 3LY4A 4C6YA 5J4EA 2GNXA 3VP4A 3I7JA 4QY5A 3BWLA 3HUNA 4A5RA 1K0KA 4OQIA 4WM9A 4R4RA 1YLJA 2ZC3B 1MY8A 2XEPA 3BFGA 4ZDXA 3VP1A 3UN7A 2V20A 3DW0A 3HLGA 3UB9A 5D3OA 2ZQ8A 4CLCE 2DMWA 3JVVA 3DWZA 4UA9A 5FDSA 3ZG0A 3CI6A 5E2EA 4EWFA 3LIFA 4R3JA 1XKZA 3LICA 1ES4A 4X6TA 1KOUA 2Y8HA 2ZM0A 5L2FA 5GHYA 1KE0A 3BLMA 3DTIA 4GW9A 2BG1A 1XGJA 3MQ0A 1ONHA 3MBZA 2Y55A 1WE4A 2V0WA 5HDDA 1ESUA 1MBLA 3T1XA 2A24B 2J7VA 4KZBA 4JF5A 4Y17A 2Y79A 4QB8A 4WEJA 1T18A 5EOEA 3HVFA 2H10A 3SS4A 3O87A 4CLCA 4C75A 3VP2A 3Q7ZA 3TSGA 1BTLA 3LIBA 3WS5A 2ZQAA 4H6JB 1BT5A 1CF0A 4BD0A 1DRMA 4K91A 1S66L 2P7JA 5GLAA 3B42A 4ID4A 3W4PA 1L2SA 3WRZA 4ZTKA 1LL8A 2L1MA 4B88A 3UE1A 3W8KA 2EWWA 3IHAA 4S2LA 1S67L 1UWPX 4FTXA 3TRCA 3EWKA 4IHQA 1NWZA 3T4LA 3EQUA 2EFUA 3VOYA 3L7HA 2G2UA 4HI4A 3NDEA 3T1QB 5HD5A 5GHXA 1XA1A 4DMZA 1BULA 4RA7A 1VEUA 3TE8A 3ZQ5A 5JYOA 3VMAA 2HDQA 4L9GA 2M7UA 3GTCA 3M6BA 3V67A 3KSIA 2JHEA 4GOGA 4MBFA 5EVIA 4I38A 4ARZB 3K2NA 4N1XA 5DTSA 3T50A 5F1GA 4DDYA 3IF6B 3WS1A 5F1FA 4JLFA 3MQOA 1P97A 3QNCA 4BL2A 2NUPC 2Z6DA 3JVUA 4LV3A 3EEAA 5TR7A 3R7WB 4JGOA 3FPVA 1BYWA 1N9BA 2Y2MA 2UV0E 1XPBA 3BFCA 4IBXA 1BLPA 4QY6A 5CTMA 1W79A 4OQ0A 2WKEA 1KGFA 1G6AA 3NJAA 3GV9A 1ES2A 3N8SA 2QJ5A 1K55A 5BOHA 4R6LA 1VETA 3N4IA 4JGQA 1YT4A 3IX3A 2EXAA 1DP9A 4BLMA 3HUMA 1GA9A 3NDGA 3CUEA 4ETXA 3V3SA 1ESIA 5CXWA 4JGPA 2E8JA 4WBGA 1FSYA 2PBYA 3T4TA 3TW8A 1DY6A 4HESA 2INWA 1MWRA 1GSXA 1N9NA 1ZTUA 2VX8A 5DF7A 3TOIA 5HARA 4QPRA 1ZC2A 3BYDA 3IWQA 1L0FA 2KOIA 3NC8A 1TS6A 1TS0A 5DJUA 2Y59A 3SH8A 3FG8A 3ZG5A 1H8MA 1K55C 4WZ5C 5AQAA 5HWVA 3FKWA 1VB6A 1IYPA 5EUAA 5DJTA 4GB7A 3VFHA 4KUKA 3CLOA 2OWHA 4L0LA 3E98A 1T1CA 3O88A 3JYIA 1Z6FA 3N7WA 4UEYA 3UDFA 1K38A 4K08A 1PWGA 2HJEA 4DDSA 4R0QA 2Y2JA 1JWVA 4I3JA 1XGIA 1RGZA 5DTKA 1ZKJA 3T4JA 2JCHA 1XP4A 1K56D 2VK3A 3VOZA 1ZHHB 1NZUA 4WUJA 3LFVA 3HLBA 2EX8A 3IXGA 2OWJA 4X1LA 2EWVA 1VEUB 1TEMA 5FQMA 2V0UA 4HNBA 1IOUA 1BUEA 4LV0A 3T12B 4DXBA 5TBMA 1OT9A 2VZWA 5HZHA 3T4SA 1C3BA 4PM5A 1OT6A 2Y2LA 2VV7A 3ZG8B 5HX9A 3HBRA 2X01A 1YMSA 2DRWA 4MLLA 3UMDA 3MXQA 4OPZA 5EVLA 2ZD8A 4DE3A 4E3MA 1F9IA 4E3JA 3NBLA 1SDNA 3KYEA 2O0YA 3LEQA 3RJUA 2Y2PA 3FPWA 3KSGA 2EFXA 2A24A 5JYPA 3A3IA 3A0VA 3GSGA 3TG9A 2J3WA 4MN7A 2ZQ7A 2ZL1B 4K0XA 1K57C 4FD8A 3LO7A 4PAUA 1JVJA 2PU4A 4H6JA 4K0WA 3VE4A 3IXDA 4OLDA 4R3BA 5G18A 1K6RA 2PDRA 4LENA 2EX9A 4JF4A 3IXHA 1CQAA 5HL6A 1F2KA 4ME4A 2HPBA 4EBNA 1T1AA 3F1OA 5L8MA 1TDLA 1L0DA 4WZ4A 4R1GA 3AGDA 4KZ6A 2WAEA 3IWIA 2Y2KA 3DBAA 2PR6A 3A3FA 3CPTB 1EWZA 4L9FA 2XFTA 1V9ZA 4S2IA 2Q9NA 2EA9A 4Y13A 1I2WA 2W27A 3BFFA 1XJ3A 5EM1A 4R3AA 4O01A 4XT2B 2XQZA 5F5YA 2K2NA 3BEBA 2EXBA 1E4DA 4Y2FA 2HP9A 4N9LA 2V2FF 4IJGA 2HZ5A 3B33A 5AQ9A 4LRYC 3FKVA 2VGJA 3NULA 2QYBA 4JXVA 1H5XA 5GLCA 5A93A 5FASA 4ZJ2A 4Q0IA 3N8LA 3SS5A 2FZ0A 1RGYA 1ALQA 4U0TA 5G4ZA 4BENA 1JTGA 3MMHA 3ZYTA 2Z2LB 3PBNA 3CHWP 1TVFA 1YAXA 5FAOA 1P0ZA 4CQHA 3IS2A 1LLBA 5MC7A 1K54C 1XFNA 3D3OA 5F69A 1YSPA 4QD4A 2RCXA 3ISGA 4B4ZA 2HGVA 1RCJA 5DFXA 1LI0A 4X68A 2WGVA 2G2WA 1JNUA 3KYQA 4OPYA 4Y0TA 1CI8A 2WUQA 2M7VA 3G34A 4X55A 4HJ6A 3F1PB 1ERQA 3UDIA 3HCYA 1CK3A 1TDGA 1N9LA 4HJ3A 3MQQA 3HL9A 1OMEA 4S2NC 2H0TA 3QP5A 5L10A 2B18A 4N9KA 1XFQA 3T4KA 2QKPA 1YLWA 3WS2A 5IHVA 1KVLA 4HOIA 1NY0A 1MWUA 3G35A 1Y28A 1DP6A 3NIAA 3LR0A 1XJ4A 1PI4A 2ZQ9A 1KGEA 3FC7A 4R70A 1S6RA 3HLFA 4DE1A 4EEUA 2HJ9C 2XH9A 4NXEA 5FA7A 1I5QA 3G2YA 3E4OA 4JXWA 1NLZA 2Y2IA 2GDNA 3MFXA 5FQ9A 4GS9A 2VV8A 4OQGA 5E2FA 5DVAA 1AXBA 4EU0A 1D06A 3PBRA 2Y91A 4PHTA 4S2KA 3T1RA 4JGRA 3CZDA 1XA7A 2Y4AA 4YINA 3BY9A 5DTTA 3C2WA 3GDIA 3HJIA 2VKSA 2ZJ9A 3R7WA 1XXMA 3HLEA 1VETB 5E2HA 3EEHA 1L3LA 4CJNA 3N6IA 4E6XA 3T4QA 3WS4A 1Q2QA 2O9BA 4EW7A 3UE6A 3ZVTA 3UY6A 5EECA 1KGGA 1AWIA 1PIOA 4LPZA 3G2ZA 4S2NA 3IX8A 4Y5FA 1XX2A 3NY4A 3MZDA 3IF5A 3EQVA 1FSWA 3D72A 2HV1A 5CHUA 2X02A 3UE3A 3AGEA 4OOYA 3V5MA 2WKQA 1BZAA 4CLCB 4PMAA 2QWSA 3B3XA 4NKPA 3C38A 1KE4A 3M2JA 1SZVA 1MWSA 5EVEA 4RX2A 3VP0A 2ZQDA 1W8YA 3KX0X 4LRXC 1KE3A 2XK1A 3RTYA 2ZM2A 5FQKA 1YLYA 4Y3IA 1ES3A 3A3EA 2J9OA 2LB9A 2ZM8A 5EVID 4GHIB 1SKOB 3SZTA 3PBSA 3CMZA 2J80A 2WGWA 3C8CA 5EM0A 2Y2NA 1LHYA 3Q82A 2I9VA 2WGIA 3C4OA 4GS9B 4UQIS 5F83A 2YKFA 2GJ3A 5TFQA 2ZC4B 5KMWA 2Y2GA 3BJNA 4JF6A 1F5MA 1LSXA 4MBKA 1H3QA 1EROA 3UPNA 4LGWA 1ACFA 3WS0A 5A8BA 3CG5A 3LI8A 3MXSA 3IX4A 2PHYA 4HEFA 3NHQA 2O99A 4GN2A 4UHUA 1DJCA 2FH5A 2OLUA 3LR4A 1YSQA 3UMEA 2OOLA 3DWKA 3K3CA 4FCFA 1WYBA 4CLCD 5TGFA 2W3GA 4KZ5A 4D60A 3T4OA 1H8YA 4KQQA 3PR6A 2XSSA 5DF9A 3LYXA 4EERA 3VP3A 1FCOA 5GL9A 4E6WA 1QMFA 1Z09A 4NXFA 3FV7A 4PM9A 4GJ4A 2IWDA 3NECA 1PWCA 1SDEA 4M3KA 1T19A 2QHKA 4KQOA 4WF0A 4Q8IA 4LLOB 2PYRA 5DKKA 2JKTI 2H5SA 5KIZA 1K4EA 3S4XA 5HAPA 4MN5A 1NYYA 3GMWA 4X56A 2W3FA 1A0KA 5E43A 2PRFA 1PZOA 5FQQA 3EGDC 1F98A 3OCLA 4LV1A 4EBLA 3LEZA 4U0XA 1YMXA 1K56A 4PM8A 3LR5A 4NETA 5EVIC 2D01A 3FYZA 5DF8A 2ZC5B 3S7PA 2B95A 4UQIM 1E25A 4EUVA 2GX5A 1FCNA 1Q2PA 3PBOA 4Q0HA 2XRNA 1FOFA 4MCWA 2P74A 3BW6A 4G3VA 1BSGA 4OOMA 2QPNA 4YNRA 1O07A 1BLSA 1OTEA 1MZUA 2WKPA 4KENB 2HF6A 4BBVA 5E2GA 5CEDA 3PHYA 4Y15A 4B9OA 1JTDA 3L9KA 4EEPA 3GQZA 1K54A 3GRJA 3C7VA 1E3UA 2XF3A 1CEFA 3T1SA 3GECA 5CGWA 5CHJA 1BLHA 5J8XA 1H8ZA 5HPFA 5M18A 2K31A 2Q9MA 4E3NA 3OPRA 4GLQA 3VOLA 2DCFA 3O3VA 4S2OA 3OPLA 5I5LA 3ITAA 1GA0A 3Q07A 4X69A 1DJAA 3FWLA 1GHPA 1PYYA 3PAEA 3ZVWA 3SH7A 2KDKA 1GHMA 3A3JA 1YQSA 3IH8A 3DTEA 1Y4OA 5A92A 3LCEA 3MF0A 1YPRA 4HH3A 4Z9QA 1N9OA 1TD5A 5CEBA 1T1BA 2ZMVA 5EOOA 4P85A 3MR0A 3C7UA 2J3TC 4BL3A 1MWTA 1LSWA 4JXGA 2LB5A 1WYCA 4II7A 3SW1A 5HD3A 1O7EA 1S1ZA 5C5KA 3RH8B 3ZNTA 3E4QA 2RL3A 1M40A 2WZXA 3BFEA 3BRMA 2NUTC 4OPRA 1ZG6A 3PBQA 4MEZA 4Z1WA 4KZ3A 2ZMAA 2Z2MB 4NG2A 2HDSA 2ZLYA 1KDSA 2GZAA 5FL3A 2ZOIA 3FZCA 1FCMA 2WKIA 4NK3A 2HP5A 2WK0A 1L0GA 2VJWA 3WWXA 2OLVA 4HHDA 2PT7A 3D4FA 2QJ7A 3F1OB 3LIEA 4O8GA 4WMCD 5EVIB 2G7UA 2OSUA 2UWXA 4X53A 5CTNA 1I2SA 1SKOA 4OQHA 4OVDA 2Y2HA 3KSFA 5FATA 4HBTA 1G5UA 4P87A 1TS8A 5HL1A 3CPTA 5TBMB 1UWNX 3EOIA 3HLWA 3S1YA 2JBFA 4KG6A 5L07A 1RP5A 4U3TA 2A49A 4OONA 1HVBA 2W1TB 3OBFA 2V1ZA 4EQIA 1KVMA 2IWCA 1K4FA 3ZNYA 4DJ3A 3PTEA 2QMIA 2X71A 3EGXC 3WRTA 4ESPA 2DNSA 4FUWA 4O0PA 3IBRA 3KYZA 3LR3A 3PYPA 3NOPC 5GLBA 1HTZA 4F3LB 5FEFA 1W63Q 1VM1A 4P0MA 1S4RA 4UA6A 2AVXA 1LL5A 3U4LP 5EV0A 1JWZA 3C5AA 4LFUA 3OLOA 2JN7A 2JC7A 5J7EA 2PD8A 4L9EA 4NXGA 4MMNA 3NI9A 4EUZA 1M6KA 4F94A 1L0EA 4LCMA 4MN6A 5KSHA 3IF6A 4HQAA 3G32A 3UPOA 2C6WB 3OCNA 4Y0OA 3ZCZA 4X1MA 1TS7A 4DE0A 4LRZE 3VSLA 4ETZA 1YLZA 5AQ7A 3BM6A 5A91A 3QP2A 4XXRA 5CERA 1ERMA 5HDCA 1LT0A 4WLAA 2I72A 4OP8A 1STZA 3RFBA 5AJGA 3PAGA 2JKTM 4GD6A 4XT2A 4PM7A 4WELA 5CGSA 2WGWB 2P08A 3VSKA 3PXPA 2ZC7A 2EX2A 1XJ6A 3OPPA 3ULFA 2WKHA 3ITBA 1VHMA 4OKPA 4MDZA 4PPRA 4S2PA 4KZ4A 1NRJA 3TJZC 3MKEA 2WYXA 1K6SA 3MS6A 2XGNA 3ZG9B 5HWTA 1MKMA 2BLSA 1IYQA 3OC2A 4HP4A 4RYEA 3LY3A 4BBTA 2HDRA 4R23A 4KZAA 2VGLM 4O7DA 3W2ZA 3R4KA 4E3OA 3OOVA 5AVFA 4IUKA 4BJPA 3G31A 4E3KA 4FH2A 3S22A 1DP8A 1G6OA 4IVIA 4IUHA 4EESA 4MNRA 2J9PA 2VA0A 3P01A 3LUQA 1PZPA 4N1HA 4XUXA 1HZOA 1YLPA 5A90A 1IKGA 2D02A 5I94A 4IEDA 3HUOA 4KZ7A 4Y7PA 1OTBA 3KSHA 4E3IA 1D1JA 2XD5A 1IEMA 3G30A 4H8RA 2E8IA 3MZFA 4WYYA 5FI6A 3SS3A 4CPKA 4DRTA 5HWWA 4BWIA 2WKRA 1V9YA 4WN5A 2L4RA 2W3HA 4ZJ1A 1H0MA 5FSRA 3MZEA 5FI2A 4YWZA 5HPIA 4UAAA 1EI5A 1QMEA 3KO6A 4OP5A 3W4OA 1IKIA 2XDMA 2Y2QA 1K25A 3CUEC 3CJMA 3ZFZA 2V1AA 2H0YA 1LL9A 3A3DA 1FQGA 4JBFA 2O9CA 2PR5A 2R9XA 3HLCA 1KDWA 2B5RA 3D9YA 3A0RA 4I39A 4YFMA 3Q7VA 5GLDA 3LGOA 2P9VB 5AVEA 3UE0A 3O86A 4RQ9A 3IS2B 1W8QA 5FAQA 5CHMA 1D7EA 5FQJA 4JKTA 1IYSA 2ZBBA 3MFDA 2H28A 1VQQA 2VEAA 2B02A 2JKRM 3DTMA 2XA7M 4KUOA 1ZG4A 4IBRA 3RXXA 3UNWA 2ZMFA 3Q81A 3V3RA 1Y54A 2J8YA 2FFYA 3C4PA 4DF6A 4D2OA 2KLIA 5DFYA 2ACGA 1ES5A 3H82B 3W4QA 2YKHA 4RVAA 4F3LA 4LCLA 1HLUP 4EETB 4PKYG 5M19A 2M1CA 5HSQA 2ZOHA 3CWFA 1WA9A 1PFLA 4QJGA 3DAVA 5EE8A 4MBHA 2R9WA 3CITA 4NXBA 3S7NA 5GHZA 3QP1A 1BLCA 4KZ9A 3P98A 2PU2A 4PM6A 4OH0A 4ZAMA 3SOIA 2O9AA 3ZGAB
chains in the Genus database with same CATH topology
2J3TC 3IS2A 5MC7A 1KOUA 2Y8HA 1EW0A 1XFNA 3D3OA 1LSWA 3NOTC 5F69A 1YSPA 4GW9A 2LB5A 3SW1A 4II7A 3MQ0A 5HD3A 2HGVA 1S1ZA 5C5KA 5DFXA 4I3AA 3RH8B 1GSWA 2V0WA 3E4QA 1JNUA 3KYQA 5HDDA 5K5BA 4B93A 3H9WA 3MJQA 3ICYA 4HH2A 1G28A 2NUTC 2A24B 2M7VA 2JKRI 3PBQA 4Z1WA 4OOLA 2Y79A 4WEJA 1T18A 3UB6A 4HJ6A 5HDSA 4CLCA 3F1PB 3S7OA 2GZAA 5CX7A 3HCYA 5FL3A 3LIBA 2ZOIA 1N9LA 4HJ3A 4H6JB 3MQQA 2VJWA 1DRMA 1S66L 2P7JA 4HHDA 3B42A 2PT7A 2VLGA 3F1OB 2QJ7A 3LIEA 4O8GA 2G7UA 1LSVA 2B18A 5IU1A 3CAXA 1LL8A 2L1MA 1XFQA 2Z6CA 3T4KA 2EWWA 2QKPA 1S67L 1UWPX 3KSFA 3O5YA 3TRCA 3EWKA 2W3DA 4HOIA 3F1NA 4IHQA 1NWZA 3T4LA 3EQUA 1TS8A 1Y28A 1DP6A 4HI4A 3LR0A 1XJ4A 5TBMB 1UWNX 5HD5A 3EOIA 3FC7A 4DMZA 4R70A 4YOFA 3H7WB 3TE8A 3H82A 3ZQ5A 5IT5A 4L9GA 2R78A 2M7UA 3LI9A 4EEUA 3V67A 2HJ9C 3KSIA 2JHEA 2W1TB 4I5SA 4NXEA 2IA2A 3OBFA 3E4OA 1NLZA 4DJ3A 4I38A 4ARZB 3MFXA 4GS9A 3EGXC 3K2NA 3LIAA 5LBRA 2VV8A 3T50A 1YKDA 5DKLA 4O0PA 4EU0A 3MQOA 3IBRA 1P97A 4HIAA 1D06A 3KYZA 3LR3A 3PBRA 4PHTA 3PYPA 4JGRA 3NOPC 2Z6DA 3JVUA 2NUPC 4F3LB 1W63Q 2BASA 3EEAA 2V1BA 3BY9A 4DN0A 3C2WA 3NOUC 1S4RA 3GDIA 3HJIA 4EXOA 2VKSA 3R7WB 3R7WA 4JGOA 3FPVA 1BYWA 3EEHA 3G6OA 3OLOA 2JN7A 4G3WA 5J7EA 3LIDA 2PD8A 3F1PA 3T4QA 4L9EA 2XROA 4NXGA 4MMNA 2O9BA 4EW7A 3UE6A 3NJAA 4MN6A 5KSHA 2OAQ1 4HQAA 4LPZA 2QJ5A 1ODVA 2KX6A 3OCNA 4Y5FA 3BQAA 4R6LA 4HY8A 4JGQA 1TS7A 1OJ5A 3K3DA 3EQVA 4LRZE 3D72A 2HV1A 1DP9A 4ETZA 3UE3A 3CUEA 4ETXA 2WKQA 4FOFA 3E0YA 4GHIA 5HDCA 1LT0A 4CLCB 3BQ8A 2QWSA 4WLAA 4JGPA 2K7SA 1STZA 3RFBA 5AJGA 2JKTM 4NKPA 3C38A 3T4TA 3TW8A 3VE3A 4XT2A 2INWA 4WELA 1GSXA 1N9NA 1ZTUA 2P08A 2VX8A 3PXPA 4QPRA 3KX0X 4P6ZS 4LRXC 1XJ6A 3ULFA 2KOIA 4HJ4A 3RTYA 1TS6A 1TS0A 5DJUA 4AFIA 1VHMA 4Y3IA 3FG8A 4MDZA 1H8MA 2LB9A 3C30A 3PBTA 4GHIB 1NRJA 3TJZC 3A0SA 3P7NA 5HWVA 4DJ2A 3PBSA 1VB6A 2J80A 5DJTA 3C8CA 4KUKA 3CLOA 5J3WA 2I9VA 4GS9B 4UQIS 5HWTA 4KQDA 2OWHA 1MKMA 2YKFA 4L0LA 2GJ3A 3E98A 4EQ1A 4BMWA 1T1CA 3OC2A 4Q0JA 4HP4A 3BJNA 4BBTA 2W1TA 4UEYA 1F5MA 4HP9A 1LSXA 1XJ2A 3U2AA 4GCZA 1H3QA 4K08A 2VGLM 2HJEA 3W2ZA 1MC0A 3R4KA 3OOVA 1OPXA 4I3JA 2A2LA 5F6AA 5AVFA 3LI8A 4IUKA 5A8BA 4BJPA 2PHYA 4ZRRA 1DP8A 1G6OA 4CQHA 4WEKA 3NHQA 3T4JA 4BBUA 4IUHA 4EESA 1GSVA 2O99A 2VA0A 3F1NB 1ZHHB 2FH5A 3P01A 3LR4A 4WUJA 3LUQA 1YSQA 2V9AA 3LFVA 3UMEA 2VGLS 2D02A 2MJ6A 4PKYA 2OOLA 2OWJA 3K3CA 2EWVA 4CLCD 1OTBA 2W3GA 2CMNA 2OAP1 2V0UA 4HNBA 3T4OA 3KSHA 1IOUA 3PR6A 2XSSA 5TBMA 5DF9A 2W1RA 3LYXA 4EERA 4E04A 1OT9A 2VZWA 5HZHA 1UGUA 2P04A 1P9WA 5HWWA 3T4SA 4BWIA 1OTDA 2WKRA 4NEED 2L0WA 1OT6A 4WL9A 1V9YA 1OTIA 4NXFA 4WN5A 2VV7A 2L4RA 4GJ4A 2W3HA 4I3IA 3UMDA 3IBJA 5TJJA 3MXQA 4YWZA 3HJKA 2XA7S 1T19A 2QHKA 4KQOA 5HPIA 4WF0A 4LLOB 1F9IA 2PYRA 5DKKA 3H7WA 5G4YA 4CLCC 2JKTI 2VV6A 3KO6A 5KIZA 5F68A 3CUEC 4MN5A 3S7QA 2V1AA 2W3FA 2O0YA 3FPWA 3KSGA 2A24A 1IFQA 2J3TD 3EGDC 1F98A 3OCLA 4M4XA 3A0VA 1S4SA 1X0OA 2J3WA 4MN7A 4FSFA 4PAUA 1S1YA 2O9CA 2PR5A 4H6JA 3A0RA 4I39A 3LR5A 2D01A 4R38A 3VE4A 3S7PA 5AVEA 2PDRA 4UQIM 4EUVA 4RQ9A 3IS2B 2GX5A 4G3KA 2PYPA 3VV4A 3PBOA 4Q0HA 1P9RA 2XRNA 3BY8A 1D7EA 2PD7A 2W0NA 5EFWA 5HL6A 4ME4A 1T1AA 3F1OA 2W3EA 5L8MA 5IS1A 4MCWA 3UB7A 2ZBBA 4ARZA 3BW6A 1W63M 4G3VA 1TF1A 4OOMA 2H28A 4YNRA 2VEAA 1OTEA 4P6ZM 2B02A 2JKRM 3DBAA 2PR6A 1MZUA 2WKPA 4BBVA 1OJGA 2HF6A 2XA7M 3PHYA 3B47A 4KUOA 4B9OA 4EEPA 4L9FA 1NLYA 1V9ZA 2EA9A 2W27A 3UB8A 3E4PA 1OTAA 2ZMFA 1XJ3A 5J4EA 4R3AA 4O01A 4XT2B 2GNXA 5F5YA 2K2NA 3BWLA 4Y2FA 2KLIA 3GECA 5DFYA 3H82B 5HPFA 2K31A 4IJGA 2YKHA 4GLQA 3VOLA 4F3LA 3B33A 5I5LA 4LRYC 2QYBA 4EETB 4PKYG 2KDKA 2M1CA 5HSQA 2ZOHA 3CWFA 1WA9A 4Q0IA 3UB9A 2FZ0A 3CITA 5G4ZA 4CLCE 3MMHA 3MF0A 4NXBA 2DMWA 3JVVA 3S7NA 3ZYTA 3PBNA 4HH3A 1N9OA 1TD5A 1T1BA 1YAXA 2ZMVA 3CI6A 2O9AA 1P0ZA 3LIFA 3LICA 3MR0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S1Y A;  4GS9 B;  2PR5 A;  1D06 A;  4KQD A;  5HWT A;  2OWH A;  3IS2 A;  5J3W A;  2YKF A;  3PYP A;  2GJ3 A;  4H6J A;  3A0R A;  3NOP C;  1KOU A;  2Z6D A;  1EW0 A;  4I39 A;  4JGR A;  4EQ1 A;  1XFN A;  4F3L B;  1T1C A;  2BAS A;  2D01 A;  2V1B A;  4HP4 A;  3BY9 A;  4R38 A;  3VE4 A;  4BBT A;  1LSW A;  3NOT C;  3C2W A;  5F69 A;  3NOU C;  1S4R A;  3GDI A;  1LSX A;  1XJ2 A;  3HJI A;  4GCZ A;  4GW9 A;  4HP9 A;  5AVE A;  4K08 A;  2PDR A;  4JGO A;  4EXO A;  5HD3 A;  3SW1 A;  1BYW A;  1S1Z A;  3IS2 B;  4I3J A;  4RQ9 A;  5F6A A;  5AVF A;  3LI8 A;  5A8B A;  2PYP A;  4I3A A;  3RH8 B;  1GSW A;  3EEH A;  2V0W A;  3G6O A;  3E4Q A;  3BY8 A;  3OLO A;  2JN7 A;  2PHY A;  1D7E A;  1JNU A;  1DP8 A;  2PD7 A;  2W0N A;  5EFW A;  5J7E A;  3LID A;  5HDD A;  1T1A A;  2PD8 A;  3NHQ A;  3F1O A;  3F1P A;  3H9W A;  3MJQ A;  4BBU A;  4EES A;  3ICY A;  4HH2 A;  4L9E A;  5IS1 A;  3UB7 A;  1G28 A;  2ZBB A;  2A24 B;  1GSV A;  4NXG A;  3F1N B;  4EW7 A;  3UE6 A;  4WUJ A;  3LUQ A;  3NJA A;  2H28 A;  4MN6 A;  1T18 A;  3UB6 A;  2V9A A;  2VEA A;  4HJ6 A;  1OTE A;  4HQA A;  3UME A;  2D02 A;  4PKY A;  2OOL A;  5HDS A;  3F1P B;  2OWJ A;  4LPZ A;  3K3C A;  2B02 A;  1ODV A;  2KX6 A;  2QJ5 A;  2PR6 A;  1OTB A;  3LIB A;  2ZOI A;  2CMN A;  1N9L A;  4HJ3 A;  1MZU A;  2WKP A;  4HY8 A;  4R6L A;  2V0U A;  4H6J B;  1OJG A;  1TS7 A;  3MQQ A;  4HNB A;  4JGQ A;  1OJ5 A;  3K3D A;  4BBV A;  3PHY A;  4LRZ E;  1DRM A;  3D72 A;  4KUO A;  2HV1 A;  4B9O A;  4EEP A;  1DP9 A;  1S66 L;  2P7J A;  4L9F A;  5TBM A;  4HHD A;  3LYX A;  1V9Z A;  2VLG A;  4EER A;  3F1O B;  2QJ7 A;  3LIE A;  4E04 A;  1OT9 A;  2EA9 A;  5HZH A;  2W27 A;  1LSV A;  1UGU A;  1OTA A;  3E4P A;  3UB8 A;  2WKQ A;  5IU1 A;  3CAX A;  5HWW A;  1LL8 A;  2L1M A;  1XFQ A;  1XJ3 A;  1OTD A;  5J4E A;  2WKR A;  2Z6C A;  4GHI A;  4R3A A;  4XT2 B;  2L0W A;  1OT6 A;  4WL9 A;  1V9Y A;  1OTI A;  1S67 L;  2QKP A;  4NXF A;  4WN5 A;  1UWP X;  5F5Y A;  5HDC A;  1LT0 A;  3BWL A;  3LIC A;  2QWS A;  4WLA A;  2VV7 A;  4JGP A;  2K7S A;  2L4R A;  3EWK A;  3GEC A;  4I3I A;  4HOI A;  3F1N A;  3H82 B;  3UMD A;  1NWZ A;  3MXQ A;  2YKH A;  4F3L A;  1TS8 A;  3VOL A;  1Y28 A;  1DP6 A;  4YWZ A;  3B33 A;  3HJK A;  3VE3 A;  4HI4 A;  4XT2 A;  1P0Z A;  1XJ4 A;  1T19 A;  2INW A;  2QHK A;  4LRY C;  5I5L A;  5TBM B;  1UWN X;  4WF0 A;  5HD5 A;  4LLO B;  3FC7 A;  1F9I A;  1GSX A;  2PYR A;  1N9N A;  3H7W A;  4R70 A;  3H7W B;  5DKK A;  5G4Y A;  3H82 A;  2VV6 A;  3ZQ5 A;  4PKY G;  5F68 A;  4EET B;  5KIZ A;  4L9G A;  2R78 A;  3KX0 X;  4MN5 A;  3LI9 A;  2KDK A;  4LRX C;  4EEU A;  2M1C A;  2V1A A;  5HSQ A;  2JHE A;  1XJ6 A;  4I5S A;  4NXE A;  2ZOH A;  3CWF A;  3ULF A;  1WA9 A;  4HJ4 A;  3UB9 A;  3E4O A;  3RTY A;  1TS6 A;  1TS0 A;  2A24 A;  4I38 A;  5DJU A;  4DJ3 A;  3MFX A;  4GS9 A;  1F98 A;  3FG8 A;  3LIA A;  2VV8 A;  5G4Z A;  3T50 A;  4M4X A;  4NXB A;  3A0V A;  4GHI B;  4HH3 A;  3A0S A;  1N9O A;  1S4S A;  3P7N A;  5HWV A;  4DJ2 A;  1X0O A;  5DKL A;  1T1B A;  1VB6 A;  2J80 A;  5DJT A;  3C8C A;  3MQO A;  4KUK A;  4HIA A;  3CLO A;  3IBR A;  1P97 A;  3LIF A;  2I9V A;  3MR0 A; 
#chains in the Genus database with same CATH topology
 1EW0 A;  4HBU A;  3NOT C;  2JKG A;  5HW3 A;  4I3A A;  3IXB A;  1GSW A;  3Q7V B;  2WAD A;  5K5B A;  4B93 A;  3H9W A;  3MJQ A;  3ICY A;  4HH2 A;  1G28 A;  3UB5 P;  2JKR I;  3P09 A;  1E3U D;  2VGK A;  4OOL A;  2XFS A;  3MXR A;  3BFD A;  3UB6 A;  1HD8 A;  3HRE A;  1PRQ A;  4EBP A;  5HDS A;  3S7O A;  2ZC6 B;  5CX7 A;  1W5D A;  3N8R A;  4ZJ3 A;  3UO9 A;  2VLG A;  2JE5 A;  3DTK A;  5M1A A;  3IH9 A;  1LSV A;  5IU1 A;  3CAX A;  1MPL A;  1PW8 A;  2XD1 A;  2Z6C A;  1FR6 A;  1FIL A;  3O5Y A;  3GR2 A;  2W3D A;  3F1N A;  3VFF A;  1FIK A;  4GZB A;  2P9V A;  4YOF A;  3UPP A;  3H7W B;  2EX6 A;  3H82 A;  4JXS A;  4S2J A;  5IT5 A;  2R78 A;  3LI9 A;  2ZQC A;  4I5S A;  2IA2 A;  2ZL1 A;  3ZDJ A;  4P6B A;  5LBR A;  3LIA A;  4EV4 A;  2FFF B;  3NCK A;  1YKD A;  5DKL A;  3QP6 A;  4RX3 A;  2Y2O A;  4HIA A;  1PNE A;  1IYO A;  4KZ8 A;  4E3L A;  2BAS A;  2V1B A;  3V50 A;  4DN0 A;  5HAI A;  3NOU C;  3E2K A;  4EXO A;  5F82 A;  2XR0 A;  3E2L A;  1DJB A;  3UDX A;  3G6O A;  2CC1 A;  2HP6 A;  4G3W A;  4GDN A;  4QU3 A;  3LID A;  4S2M A;  3F1P A;  2XRO A;  2OAQ 1;  3BLS A;  3M6H A;  1ODV A;  2KX6 A;  1U60 A;  4LV2 A;  3BQA A;  4HY8 A;  1PWD A;  1OJ5 A;  3K3D A;  1YLT A;  4OPQ A;  4OLG A;  4KQR A;  3IWO A;  3MKF A;  4R4S A;  3M2K A;  2IWB A;  4FOF A;  3E0Y A;  5CRF A;  4GHI A;  4WMC A;  3V39 A;  4KG2 A;  3BQ8 A;  2K7S A;  5AQB A;  3OPH A;  3GVB A;  3OZH A;  4BD1 A;  3VE3 A;  4X25 A;  4N92 A;  4JPM A;  1G68 A;  5FI7 A;  5HAQ A;  3ZG7 B;  1W7F A;  2V8C A;  4P6Z S;  1PI5 A;  3QP8 A;  4HJ4 A;  1K57 A;  5HFO A;  4AFI A;  3C30 A;  3PBT A;  3A0S A;  3P7N A;  4DJ2 A;  4BQM A;  4IVK A;  2PBD P;  4WZ5 A;  4QWO A;  5J3W A;  1ONG A;  4ZBE A;  4Y0U A;  4KQD A;  4EQ1 A;  4BMW A;  4Q0J A;  3RXW A;  2W1T A;  4HP9 A;  4B4X A;  1XJ2 A;  3U2A A;  4GCZ A;  1MC0 A;  1OPX A;  5L09 A;  2A2L A;  5F6A A;  3SH9 A;  5FQI A;  1YM1 A;  4ZRR A;  2PAV P;  4WEK A;  4BBU A;  4QHC A;  3Q1F A;  1GSV A;  1LI9 A;  3F1N B;  1PW1 A;  1NYM A;  2V9A A;  4DKI A;  3IHB A;  2VGL S;  2MJ6 A;  4PKY A;  5EPH A;  2CMN A;  2OAP 1;  2HDU A;  2C5W B;  4XUZ A;  1SCW A;  2W1R A;  4GDB A;  3HLD A;  2V8F A;  4E04 A;  1J3W A;  1UGU A;  2A3U A;  2P04 A;  1P9W A;  3MSH A;  1J9M A;  1NRF A;  1OTD A;  1NJ4 A;  4NEE D;  2L0W A;  4WL9 A;  1OTI A;  2WZZ A;  2BTF P;  3IF6 C;  1SHV A;  4I3I A;  2OV5 A;  1NXY A;  3IBJ A;  5TJJ A;  3G4P A;  1GCE A;  3HJK A;  2XA7 S;  3JPU A;  2WAF A;  5CGX A;  3H7W A;  3IT9 A;  5G4Y A;  4CLC C;  3QHY A;  2VV6 A;  5F68 A;  3S7Q A;  4GKU A;  1NZO A;  4DE2 A;  1IFQ A;  2J3T D;  4M4X A;  3QP4 A;  2XLN A;  1S4S A;  1X0O A;  4GNU A;  1CJF A;  4FSF A;  5U47 A;  3QNB A;  1CEG A;  4C3Q A;  1S1Y A;  1MXO A;  2Q0O A;  1MKI A;  4R38 A;  3ZHH A;  1JWP A;  5CEC A;  5FEG A;  4FH4 A;  4G3K A;  2PYP A;  5FAP A;  3VV4 A;  2QZ6 A;  1P9R A;  3BY8 A;  2PD7 A;  2W0N A;  5EFW A;  5KSC A;  1IEL A;  2W3E A;  5IS1 A;  3UB7 A;  4ARZ A;  1N4O A;  1W63 M;  1FR1 A;  1GHI A;  1TF1 A;  5FDH A;  3AGF A;  4P6Z M;  1S0W A;  4KG5 A;  4GD8 A;  2JKF A;  4DXC A;  1OJG A;  3B47 A;  1NLY A;  4UA7 A;  3BEC A;  1SKF A;  5KZH A;  3IQA A;  3UB8 A;  1CI9 A;  1OTA A;  3E4P A;  3LY4 A;  4C6Y A;  5J4E A;  2GNX A;  3VP4 A;  3I7J A;  4QY5 A;  3BWL A;  3HUN A;  4A5R A;  1K0K A;  4OQI A;  4WM9 A;  4R4R A;  1YLJ A;  2ZC3 B;  1MY8 A;  2XEP A;  3BFG A;  4ZDX A;  3VP1 A;  3UN7 A;  2V20 A;  3DW0 A;  3HLG A;  3UB9 A;  5D3O A;  2ZQ8 A;  4CLC E;  2DMW A;  3JVV A;  3DWZ A;  4UA9 A;  5FDS A;  3ZG0 A;  3CI6 A;  5E2E A;  4EWF A;  3LIF A;  4R3J A;  1XKZ A;  3LIC A;  1ES4 A;  4X6T A;  1KOU A;  2Y8H A;  2ZM0 A;  5L2F A;  5GHY A;  1KE0 A;  3BLM A;  3DTI A;  4GW9 A;  2BG1 A;  1XGJ A;  3MQ0 A;  1ONH A;  3MBZ A;  2Y55 A;  1WE4 A;  2V0W A;  5HDD A;  1ESU A;  1MBL A;  3T1X A;  2A24 B;  2J7V A;  4KZB A;  4JF5 A;  4Y17 A;  2Y79 A;  4QB8 A;  4WEJ A;  1T18 A;  5EOE A;  3HVF A;  2H10 A;  3SS4 A;  3O87 A;  4CLC A;  4C75 A;  3VP2 A;  3Q7Z A;  3TSG A;  1BTL A;  3LIB A;  3WS5 A;  2ZQA A;  4H6J B;  1BT5 A;  1CF0 A;  4BD0 A;  1DRM A;  4K91 A;  1S66 L;  2P7J A;  5GLA A;  3B42 A;  4ID4 A;  3W4P A;  1L2S A;  3WRZ A;  4ZTK A;  1LL8 A;  2L1M A;  4B88 A;  3UE1 A;  3W8K A;  2EWW A;  3IHA A;  4S2L A;  1S67 L;  1UWP X;  4FTX A;  3TRC A;  3EWK A;  4IHQ A;  1NWZ A;  3T4L A;  3EQU A;  2EFU A;  3VOY A;  3L7H A;  2G2U A;  4HI4 A;  3NDE A;  3T1Q B;  5HD5 A;  5GHX A;  1XA1 A;  4DMZ A;  1BUL A;  4RA7 A;  1VEU A;  3TE8 A;  3ZQ5 A;  5JYO A;  3VMA A;  2HDQ A;  4L9G A;  2M7U A;  3GTC A;  3M6B A;  3V67 A;  3KSI A;  2JHE A;  4GOG A;  4MBF A;  5EVI A;  4I38 A;  4ARZ B;  3K2N A;  4N1X A;  5DTS A;  3T50 A;  5F1G A;  4DDY A;  3IF6 B;  3WS1 A;  5F1F A;  4JLF A;  3MQO A;  1P97 A;  3QNC A;  4BL2 A;  2NUP C;  2Z6D A;  3JVU A;  4LV3 A;  3EEA A;  5TR7 A;  3R7W B;  4JGO A;  3FPV A;  1BYW A;  1N9B A;  2Y2M A;  2UV0 E;  1XPB A;  3BFC A;  4IBX A;  1BLP A;  4QY6 A;  5CTM A;  1W79 A;  4OQ0 A;  2WKE A;  1KGF A;  1G6A A;  3NJA A;  3GV9 A;  1ES2 A;  3N8S A;  2QJ5 A;  1K55 A;  5BOH A;  4R6L A;  1VET A;  3N4I A;  4JGQ A;  1YT4 A;  3IX3 A;  2EXA A;  1DP9 A;  4BLM A;  3HUM A;  1GA9 A;  3NDG A;  3CUE A;  4ETX A;  3V3S A;  1ESI A;  5CXW A;  4JGP A;  2E8J A;  4WBG A;  1FSY A;  2PBY A;  3T4T A;  3TW8 A;  1DY6 A;  4HES A;  2INW A;  1MWR A;  1GSX A;  1N9N A;  1ZTU A;  2VX8 A;  5DF7 A;  3TOI A;  5HAR A;  4QPR A;  1ZC2 A;  3BYD A;  3IWQ A;  1L0F A;  2KOI A;  3NC8 A;  1TS6 A;  1TS0 A;  5DJU A;  2Y59 A;  3SH8 A;  3FG8 A;  3ZG5 A;  1H8M A;  1K55 C;  4WZ5 C;  5AQA A;  5HWV A;  3FKW A;  1VB6 A;  1IYP A;  5EUA A;  5DJT A;  4GB7 A;  3VFH A;  4KUK A;  3CLO A;  2OWH A;  4L0L A;  3E98 A;  1T1C A;  3O88 A;  3JYI A;  1Z6F A;  3N7W A;  4UEY A;  3UDF A;  1K38 A;  4K08 A;  1PWG A;  2HJE A;  4DDS A;  4R0Q A;  2Y2J A;  1JWV A;  4I3J A;  1XGI A;  1RGZ A;  5DTK A;  1ZKJ A;  3T4J A;  2JCH A;  1XP4 A;  1K56 D;  2VK3 A;  3VOZ A;  1ZHH B;  1NZU A;  4WUJ A;  3LFV A;  3HLB A;  2EX8 A;  3IXG A;  2OWJ A;  4X1L A;  2EWV A;  1VEU B;  1TEM A;  5FQM A;  2V0U A;  4HNB A;  1IOU A;  1BUE A;  4LV0 A;  3T12 B;  4DXB A;  5TBM A;  1OT9 A;  2VZW A;  5HZH A;  3T4S A;  1C3B A;  4PM5 A;  1OT6 A;  2Y2L A;  2VV7 A;  3ZG8 B;  5HX9 A;  3HBR A;  2X01 A;  1YMS A;  2DRW A;  4MLL A;  3UMD A;  3MXQ A;  4OPZ A;  5EVL A;  2ZD8 A;  4DE3 A;  4E3M A;  1F9I A;  4E3J A;  3NBL A;  1SDN A;  3KYE A;  2O0Y A;  3LEQ A;  3RJU A;  2Y2P A;  3FPW A;  3KSG A;  2EFX A;  2A24 A;  5JYP A;  3A3I A;  3A0V A;  3GSG A;  3TG9 A;  2J3W A;  4MN7 A;  2ZQ7 A;  2ZL1 B;  4K0X A;  1K57 C;  4FD8 A;  3LO7 A;  4PAU A;  1JVJ A;  2PU4 A;  4H6J A;  4K0W A;  3VE4 A;  3IXD A;  4OLD A;  4R3B A;  5G18 A;  1K6R A;  2PDR A;  4LEN A;  2EX9 A;  4JF4 A;  3IXH A;  1CQA A;  5HL6 A;  1F2K A;  4ME4 A;  2HPB A;  4EBN A;  1T1A A;  3F1O A;  5L8M A;  1TDL A;  1L0D A;  4WZ4 A;  4R1G A;  3AGD A;  4KZ6 A;  2WAE A;  3IWI A;  2Y2K A;  3DBA A;  2PR6 A;  3A3F A;  3CPT B;  1EWZ A;  4L9F A;  2XFT A;  1V9Z A;  4S2I A;  2Q9N A;  2EA9 A;  4Y13 A;  1I2W A;  2W27 A;  3BFF A;  1XJ3 A;  5EM1 A;  4R3A A;  4O01 A;  4XT2 B;  2XQZ A;  5F5Y A;  2K2N A;  3BEB A;  2EXB A;  1E4D A;  4Y2F A;  2HP9 A;  4N9L A;  2V2F F;  4IJG A;  2HZ5 A;  3B33 A;  5AQ9 A;  4LRY C;  3FKV A;  2VGJ A;  3NUL A;  2QYB A;  4JXV A;  1H5X A;  5GLC A;  5A93 A;  5FAS A;  4ZJ2 A;  4Q0I A;  3N8L A;  3SS5 A;  2FZ0 A;  1RGY A;  1ALQ A;  4U0T A;  5G4Z A;  4BEN A;  1JTG A;  3MMH A;  3ZYT A;  2Z2L B;  3PBN A;  3CHW P;  1TVF A;  1YAX A;  5FAO A;  1P0Z A;  4CQH A;  3IS2 A;  1LLB A;  5MC7 A;  1K54 C;  1XFN A;  3D3O A;  5F69 A;  1YSP A;  4QD4 A;  2RCX A;  3ISG A;  4B4Z A;  2HGV A;  1RCJ A;  5DFX A;  1LI0 A;  4X68 A;  2WGV A;  2G2W A;  1JNU A;  3KYQ A;  4OPY A;  4Y0T A;  1CI8 A;  2WUQ A;  2M7V A;  3G34 A;  4X55 A;  4HJ6 A;  3F1P B;  1ERQ A;  3UDI A;  3HCY A;  1CK3 A;  1TDG A;  1N9L A;  4HJ3 A;  3MQQ A;  3HL9 A;  1OME A;  4S2N C;  2H0T A;  3QP5 A;  5L10 A;  2B18 A;  4N9K A;  1XFQ A;  3T4K A;  2QKP A;  1YLW A;  3WS2 A;  5IHV A;  1KVL A;  4HOI A;  1NY0 A;  1MWU A;  3G35 A;  1Y28 A;  1DP6 A;  3NIA A;  3LR0 A;  1XJ4 A;  1PI4 A;  2ZQ9 A;  1KGE A;  3FC7 A;  4R70 A;  1S6R A;  3HLF A;  4DE1 A;  4EEU A;  2HJ9 C;  2XH9 A;  4NXE A;  5FA7 A;  1I5Q A;  3G2Y A;  3E4O A;  4JXW A;  1NLZ A;  2Y2I A;  2GDN A;  3MFX A;  5FQ9 A;  4GS9 A;  2VV8 A;  4OQG A;  5E2F A;  5DVA A;  1AXB A;  4EU0 A;  1D06 A;  3PBR A;  2Y91 A;  4PHT A;  4S2K A;  3T1R A;  4JGR A;  3CZD A;  1XA7 A;  2Y4A A;  4YIN A;  3BY9 A;  5DTT A;  3C2W A;  3GDI A;  3HJI A;  2VKS A;  2ZJ9 A;  3R7W A;  1XXM A;  3HLE A;  1VET B;  5E2H A;  3EEH A;  1L3L A;  4CJN A;  3N6I A;  4E6X A;  3T4Q A;  3WS4 A;  1Q2Q A;  2O9B A;  4EW7 A;  3UE6 A;  3ZVT A;  3UY6 A;  5EEC A;  1KGG A;  1AWI A;  1PIO A;  4LPZ A;  3G2Z A;  4S2N A;  3IX8 A;  4Y5F A;  1XX2 A;  3NY4 A;  3MZD A;  3IF5 A;  3EQV A;  1FSW A;  3D72 A;  2HV1 A;  5CHU A;  2X02 A;  3UE3 A;  3AGE A;  4OOY A;  3V5M A;  2WKQ A;  1BZA A;  4CLC B;  4PMA A;  2QWS A;  3B3X A;  4NKP A;  3C38 A;  1KE4 A;  3M2J A;  1SZV A;  1MWS A;  5EVE A;  4RX2 A;  3VP0 A;  2ZQD A;  1W8Y A;  3KX0 X;  4LRX C;  1KE3 A;  2XK1 A;  3RTY A;  2ZM2 A;  5FQK A;  1YLY A;  4Y3I A;  1ES3 A;  3A3E A;  2J9O A;  2LB9 A;  2ZM8 A;  5EVI D;  4GHI B;  1SKO B;  3SZT A;  3PBS A;  3CMZ A;  2J80 A;  2WGW A;  3C8C A;  5EM0 A;  2Y2N A;  1LHY A;  3Q82 A;  2I9V A;  2WGI A;  3C4O A;  4GS9 B;  4UQI S;  5F83 A;  2YKF A;  2GJ3 A;  5TFQ A;  2ZC4 B;  5KMW A;  2Y2G A;  3BJN A;  4JF6 A;  1F5M A;  1LSX A;  4MBK A;  1H3Q A;  1ERO A;  3UPN A;  4LGW A;  1ACF A;  3WS0 A;  5A8B A;  3CG5 A;  3LI8 A;  3MXS A;  3IX4 A;  2PHY A;  4HEF A;  3NHQ A;  2O99 A;  4GN2 A;  4UHU A;  1DJC A;  2FH5 A;  2OLU A;  3LR4 A;  1YSQ A;  3UME A;  2OOL A;  3DWK A;  3K3C A;  4FCF A;  1WYB A;  4CLC D;  5TGF A;  2W3G A;  4KZ5 A;  4D60 A;  3T4O A;  1H8Y A;  4KQQ A;  3PR6 A;  2XSS A;  5DF9 A;  3LYX A;  4EER A;  3VP3 A;  1FCO A;  5GL9 A;  4E6W A;  1QMF A;  1Z09 A;  4NXF A;  3FV7 A;  4PM9 A;  4GJ4 A;  2IWD A;  3NEC A;  1PWC A;  1SDE A;  4M3K A;  1T19 A;  2QHK A;  4KQO A;  4WF0 A;  4Q8I A;  4LLO B;  2PYR A;  5DKK A;  2JKT I;  2H5S A;  5KIZ A;  1K4E A;  3S4X A;  5HAP A;  4MN5 A;  1NYY A;  3GMW A;  4X56 A;  2W3F A;  1A0K A;  5E43 A;  2PRF A;  1PZO A;  5FQQ A;  3EGD C;  1F98 A;  3OCL A;  4LV1 A;  4EBL A;  3LEZ A;  4U0X A;  1YMX A;  1K56 A;  4PM8 A;  3LR5 A;  4NET A;  5EVI C;  2D01 A;  3FYZ A;  5DF8 A;  2ZC5 B;  3S7P A;  2B95 A;  4UQI M;  1E25 A;  4EUV A;  2GX5 A;  1FCN A;  1Q2P A;  3PBO A;  4Q0H A;  2XRN A;  1FOF A;  4MCW A;  2P74 A;  3BW6 A;  4G3V A;  1BSG A;  4OOM A;  2QPN A;  4YNR A;  1O07 A;  1BLS A;  1OTE A;  1MZU A;  2WKP A;  4KEN B;  2HF6 A;  4BBV A;  5E2G A;  5CED A;  3PHY A;  4Y15 A;  4B9O A;  1JTD A;  3L9K A;  4EEP A;  3GQZ A;  1K54 A;  3GRJ A;  3C7V A;  1E3U A;  2XF3 A;  1CEF A;  3T1S A;  3GEC A;  5CGW A;  5CHJ A;  1BLH A;  5J8X A;  1H8Z A;  5HPF A;  5M18 A;  2K31 A;  2Q9M A;  4E3N A;  3OPR A;  4GLQ A;  3VOL A;  2DCF A;  3O3V A;  4S2O A;  3OPL A;  5I5L A;  3ITA A;  1GA0 A;  3Q07 A;  4X69 A;  1DJA A;  3FWL A;  1GHP A;  1PYY A;  3PAE A;  3ZVW A;  3SH7 A;  2KDK A;  1GHM A;  3A3J A;  1YQS A;  3IH8 A;  3DTE A;  1Y4O A;  5A92 A;  3LCE A;  3MF0 A;  1YPR A;  4HH3 A;  4Z9Q A;  1N9O A;  1TD5 A;  5CEB A;  1T1B A;  2ZMV A;  5EOO A;  4P85 A;  3MR0 A;  3C7U A;  2J3T C;  4BL3 A;  1MWT A;  1LSW A;  4JXG A;  2LB5 A;  1WYC A;  4II7 A;  3SW1 A;  5HD3 A;  1O7E A;  1S1Z A;  5C5K A;  3RH8 B;  3ZNT A;  3E4Q A;  2RL3 A;  1M40 A;  2WZX A;  3BFE A;  3BRM A;  2NUT C;  4OPR A;  1ZG6 A;  3PBQ A;  4MEZ A;  4Z1W A;  4KZ3 A;  2ZMA A;  2Z2M B;  4NG2 A;  2HDS A;  2ZLY A;  1KDS A;  2GZA A;  5FL3 A;  2ZOI A;  3FZC A;  1FCM A;  2WKI A;  4NK3 A;  2HP5 A;  2WK0 A;  1L0G A;  2VJW A;  3WWX A;  2OLV A;  4HHD A;  2PT7 A;  3D4F A;  2QJ7 A;  3F1O B;  3LIE A;  4O8G A;  4WMC D;  5EVI B;  2G7U A;  2OSU A;  2UWX A;  4X53 A;  5CTN A;  1I2S A;  1SKO A;  4OQH A;  4OVD A;  2Y2H A;  3KSF A;  5FAT A;  4HBT A;  1G5U A;  4P87 A;  1TS8 A;  5HL1 A;  3CPT A;  5TBM B;  1UWN X;  3EOI A;  3HLW A;  3S1Y A;  2JBF A;  4KG6 A;  5L07 A;  1RP5 A;  4U3T A;  2A49 A;  4OON A;  1HVB A;  2W1T B;  3OBF A;  2V1Z A;  4EQI A;  1KVM A;  2IWC A;  1K4F A;  3ZNY A;  4DJ3 A;  3PTE A;  2QMI A;  2X71 A;  3EGX C;  3WRT A;  4ESP A;  2DNS A;  4FUW A;  4O0P A;  3IBR A;  3KYZ A;  3LR3 A;  3PYP A;  3NOP C;  5GLB A;  1HTZ A;  4F3L B;  5FEF A;  1W63 Q;  1VM1 A;  4P0M A;  1S4R A;  4UA6 A;  2AVX A;  1LL5 A;  3U4L P;  5EV0 A;  1JWZ A;  3C5A A;  4LFU A;  3OLO A;  2JN7 A;  2JC7 A;  5J7E A;  2PD8 A;  4L9E A;  4NXG A;  4MMN A;  3NI9 A;  4EUZ A;  1M6K A;  4F94 A;  1L0E A;  4LCM A;  4MN6 A;  5KSH A;  3IF6 A;  4HQA A;  3G32 A;  3UPO A;  2C6W B;  3OCN A;  4Y0O A;  3ZCZ A;  4X1M A;  1TS7 A;  4DE0 A;  4LRZ E;  3VSL A;  4ETZ A;  1YLZ A;  5AQ7 A;  3BM6 A;  5A91 A;  3QP2 A;  4XXR A;  5CER A;  1ERM A;  5HDC A;  1LT0 A;  4WLA A;  2I72 A;  4OP8 A;  1STZ A;  3RFB A;  5AJG A;  3PAG A;  2JKT M;  4GD6 A;  4XT2 A;  4PM7 A;  4WEL A;  5CGS A;  2WGW B;  2P08 A;  3VSK A;  3PXP A;  2ZC7 A;  2EX2 A;  1XJ6 A;  3OPP A;  3ULF A;  2WKH A;  3ITB A;  1VHM A;  4OKP A;  4MDZ A;  4PPR A;  4S2P A;  4KZ4 A;  1NRJ A;  3TJZ C;  3MKE A;  2WYX A;  1K6S A;  3MS6 A;  2XGN A;  3ZG9 B;  5HWT A;  1MKM A;  2BLS A;  1IYQ A;  3OC2 A;  4HP4 A;  4RYE A;  3LY3 A;  4BBT A;  2HDR A;  4R23 A;  4KZA A;  2VGL M;  4O7D A;  3W2Z A;  3R4K A;  4E3O A;  3OOV A;  5AVF A;  4IUK A;  4BJP A;  3G31 A;  4E3K A;  4FH2 A;  3S22 A;  1DP8 A;  1G6O A;  4IVI A;  4IUH A;  4EES A;  4MNR A;  2J9P A;  2VA0 A;  3P01 A;  3LUQ A;  1PZP A;  4N1H A;  4XUX A;  1HZO A;  1YLP A;  5A90 A;  1IKG A;  2D02 A;  5I94 A;  4IED A;  3HUO A;  4KZ7 A;  4Y7P A;  1OTB A;  3KSH A;  4E3I A;  1D1J A;  2XD5 A;  1IEM A;  3G30 A;  4H8R A;  2E8I A;  3MZF A;  4WYY A;  5FI6 A;  3SS3 A;  4CPK A;  4DRT A;  5HWW A;  4BWI A;  2WKR A;  1V9Y A;  4WN5 A;  2L4R A;  2W3H A;  4ZJ1 A;  1H0M A;  5FSR A;  3MZE A;  5FI2 A;  4YWZ A;  5HPI A;  4UAA A;  1EI5 A;  1QME A;  3KO6 A;  4OP5 A;  3W4O A;  1IKI A;  2XDM A;  2Y2Q A;  1K25 A;  3CUE C;  3CJM A;  3ZFZ A;  2V1A A;  2H0Y A;  1LL9 A;  3A3D A;  1FQG A;  4JBF A;  2O9C A;  2PR5 A;  2R9X A;  3HLC A;  1KDW A;  2B5R A;  3D9Y A;  3A0R A;  4I39 A;  4YFM A;  3Q7V A;  5GLD A;  3LGO A;  2P9V B;  5AVE A;  3UE0 A;  3O86 A;  4RQ9 A;  3IS2 B;  1W8Q A;  5FAQ A;  5CHM A;  1D7E A;  5FQJ A;  4JKT A;  1IYS A;  2ZBB A;  3MFD A;  2H28 A;  1VQQ A;  2VEA A;  2B02 A;  2JKR M;  3DTM A;  2XA7 M;  4KUO A;  1ZG4 A;  4IBR A;  3RXX A;  3UNW A;  2ZMF A;  3Q81 A;  3V3R A;  1Y54 A;  2J8Y A;  2FFY A;  3C4P A;  4DF6 A;  4D2O A;  2KLI A;  5DFY A;  2ACG A;  1ES5 A;  3H82 B;  3W4Q A;  2YKH A;  4RVA A;  4F3L A;  4LCL A;  1HLU P;  4EET B;  4PKY G;  5M19 A;  2M1C A;  5HSQ A;  2ZOH A;  3CWF A;  1WA9 A;  1PFL A;  4QJG A;  3DAV A;  5EE8 A;  4MBH A;  2R9W A;  3CIT A;  4NXB A;  3S7N A;  5GHZ A;  3QP1 A;  1BLC A;  4KZ9 A;  3P98 A;  2PU2 A;  4PM6 A;  4OH0 A;  4ZAM A;  3SOI A;  2O9A A;  3ZGA B; 
#chains in the Genus database with same CATH homology
 2J3T C;  3IS2 A;  5MC7 A;  1KOU A;  2Y8H A;  1EW0 A;  1XFN A;  3D3O A;  1LSW A;  3NOT C;  5F69 A;  1YSP A;  4GW9 A;  2LB5 A;  3SW1 A;  4II7 A;  3MQ0 A;  5HD3 A;  2HGV A;  1S1Z A;  5C5K A;  5DFX A;  4I3A A;  3RH8 B;  1GSW A;  2V0W A;  3E4Q A;  1JNU A;  3KYQ A;  5HDD A;  5K5B A;  4B93 A;  3H9W A;  3MJQ A;  3ICY A;  4HH2 A;  1G28 A;  2NUT C;  2A24 B;  2M7V A;  2JKR I;  3PBQ A;  4Z1W A;  4OOL A;  2Y79 A;  4WEJ A;  1T18 A;  3UB6 A;  4HJ6 A;  5HDS A;  4CLC A;  3F1P B;  3S7O A;  2GZA A;  5CX7 A;  3HCY A;  5FL3 A;  3LIB A;  2ZOI A;  1N9L A;  4HJ3 A;  4H6J B;  3MQQ A;  2VJW A;  1DRM A;  1S66 L;  2P7J A;  4HHD A;  3B42 A;  2PT7 A;  2VLG A;  3F1O B;  2QJ7 A;  3LIE A;  4O8G A;  2G7U A;  1LSV A;  2B18 A;  5IU1 A;  3CAX A;  1LL8 A;  2L1M A;  1XFQ A;  2Z6C A;  3T4K A;  2EWW A;  2QKP A;  1S67 L;  1UWP X;  3KSF A;  3O5Y A;  3TRC A;  3EWK A;  2W3D A;  4HOI A;  3F1N A;  4IHQ A;  1NWZ A;  3T4L A;  3EQU A;  1TS8 A;  1Y28 A;  1DP6 A;  4HI4 A;  3LR0 A;  1XJ4 A;  5TBM B;  1UWN X;  5HD5 A;  3EOI A;  3FC7 A;  4DMZ A;  4R70 A;  4YOF A;  3H7W B;  3TE8 A;  3H82 A;  3ZQ5 A;  5IT5 A;  4L9G A;  2R78 A;  2M7U A;  3LI9 A;  4EEU A;  3V67 A;  2HJ9 C;  3KSI A;  2JHE A;  2W1T B;  4I5S A;  4NXE A;  2IA2 A;  3OBF A;  3E4O A;  1NLZ A;  4DJ3 A;  4I38 A;  4ARZ B;  3MFX A;  4GS9 A;  3EGX C;  3K2N A;  3LIA A;  5LBR A;  2VV8 A;  3T50 A;  1YKD A;  5DKL A;  4O0P A;  4EU0 A;  3MQO A;  3IBR A;  1P97 A;  4HIA A;  1D06 A;  3KYZ A;  3LR3 A;  3PBR A;  4PHT A;  3PYP A;  4JGR A;  3NOP C;  2Z6D A;  3JVU A;  2NUP C;  4F3L B;  1W63 Q;  2BAS A;  3EEA A;  2V1B A;  3BY9 A;  4DN0 A;  3C2W A;  3NOU C;  1S4R A;  3GDI A;  3HJI A;  4EXO A;  2VKS A;  3R7W B;  3R7W A;  4JGO A;  3FPV A;  1BYW A;  3EEH A;  3G6O A;  3OLO A;  2JN7 A;  4G3W A;  5J7E A;  3LID A;  2PD8 A;  3F1P A;  3T4Q A;  4L9E A;  2XRO A;  4NXG A;  4MMN A;  2O9B A;  4EW7 A;  3UE6 A;  3NJA A;  4MN6 A;  5KSH A;  2OAQ 1;  4HQA A;  4LPZ A;  2QJ5 A;  1ODV A;  2KX6 A;  3OCN A;  4Y5F A;  3BQA A;  4R6L A;  4HY8 A;  4JGQ A;  1TS7 A;  1OJ5 A;  3K3D A;  3EQV A;  4LRZ E;  3D72 A;  2HV1 A;  1DP9 A;  4ETZ A;  3UE3 A;  3CUE A;  4ETX A;  2WKQ A;  4FOF A;  3E0Y A;  4GHI A;  5HDC A;  1LT0 A;  4CLC B;  3BQ8 A;  2QWS A;  4WLA A;  4JGP A;  2K7S A;  1STZ A;  3RFB A;  5AJG A;  2JKT M;  4NKP A;  3C38 A;  3T4T A;  3TW8 A;  3VE3 A;  4XT2 A;  2INW A;  4WEL A;  1GSX A;  1N9N A;  1ZTU A;  2P08 A;  2VX8 A;  3PXP A;  4QPR A;  3KX0 X;  4P6Z S;  4LRX C;  1XJ6 A;  3ULF A;  2KOI A;  4HJ4 A;  3RTY A;  1TS6 A;  1TS0 A;  5DJU A;  4AFI A;  1VHM A;  4Y3I A;  3FG8 A;  4MDZ A;  1H8M A;  2LB9 A;  3C30 A;  3PBT A;  4GHI B;  1NRJ A;  3TJZ C;  3A0S A;  3P7N A;  5HWV A;  4DJ2 A;  3PBS A;  1VB6 A;  2J80 A;  5DJT A;  3C8C A;  4KUK A;  3CLO A;  5J3W A;  2I9V A;  4GS9 B;  4UQI S;  5HWT A;  4KQD A;  2OWH A;  1MKM A;  2YKF A;  4L0L A;  2GJ3 A;  3E98 A;  4EQ1 A;  4BMW A;  1T1C A;  3OC2 A;  4Q0J A;  4HP4 A;  3BJN A;  4BBT A;  2W1T A;  4UEY A;  1F5M A;  4HP9 A;  1LSX A;  1XJ2 A;  3U2A A;  4GCZ A;  1H3Q A;  4K08 A;  2VGL M;  2HJE A;  3W2Z A;  1MC0 A;  3R4K A;  3OOV A;  1OPX A;  4I3J A;  2A2L A;  5F6A A;  5AVF A;  3LI8 A;  4IUK A;  5A8B A;  4BJP A;  2PHY A;  4ZRR A;  1DP8 A;  1G6O A;  4CQH A;  4WEK A;  3NHQ A;  3T4J A;  4BBU A;  4IUH A;  4EES A;  1GSV A;  2O99 A;  2VA0 A;  3F1N B;  1ZHH B;  2FH5 A;  3P01 A;  3LR4 A;  4WUJ A;  3LUQ A;  1YSQ A;  2V9A A;  3LFV A;  3UME A;  2VGL S;  2D02 A;  2MJ6 A;  4PKY A;  2OOL A;  2OWJ A;  3K3C A;  2EWV A;  4CLC D;  1OTB A;  2W3G A;  2CMN A;  2OAP 1;  2V0U A;  4HNB A;  3T4O A;  3KSH A;  1IOU A;  3PR6 A;  2XSS A;  5TBM A;  5DF9 A;  2W1R A;  3LYX A;  4EER A;  4E04 A;  1OT9 A;  2VZW A;  5HZH A;  1UGU A;  2P04 A;  1P9W A;  5HWW A;  3T4S A;  4BWI A;  1OTD A;  2WKR A;  4NEE D;  2L0W A;  1OT6 A;  4WL9 A;  1V9Y A;  1OTI A;  4NXF A;  4WN5 A;  2VV7 A;  2L4R A;  4GJ4 A;  2W3H A;  4I3I A;  3UMD A;  3IBJ A;  5TJJ A;  3MXQ A;  4YWZ A;  3HJK A;  2XA7 S;  1T19 A;  2QHK A;  4KQO A;  5HPI A;  4WF0 A;  4LLO B;  1F9I A;  2PYR A;  5DKK A;  3H7W A;  5G4Y A;  4CLC C;  2JKT I;  2VV6 A;  3KO6 A;  5KIZ A;  5F68 A;  3CUE C;  4MN5 A;  3S7Q A;  2V1A A;  2W3F A;  2O0Y A;  3FPW A;  3KSG A;  2A24 A;  1IFQ A;  2J3T D;  3EGD C;  1F98 A;  3OCL A;  4M4X A;  3A0V A;  1S4S A;  1X0O A;  2J3W A;  4MN7 A;  4FSF A;  4PAU A;  1S1Y A;  2O9C A;  2PR5 A;  4H6J A;  3A0R A;  4I39 A;  3LR5 A;  2D01 A;  4R38 A;  3VE4 A;  3S7P A;  5AVE A;  2PDR A;  4UQI M;  4EUV A;  4RQ9 A;  3IS2 B;  2GX5 A;  4G3K A;  2PYP A;  3VV4 A;  3PBO A;  4Q0H A;  1P9R A;  2XRN A;  3BY8 A;  1D7E A;  2PD7 A;  2W0N A;  5EFW A;  5HL6 A;  4ME4 A;  1T1A A;  3F1O A;  2W3E A;  5L8M A;  5IS1 A;  4MCW A;  3UB7 A;  2ZBB A;  4ARZ A;  3BW6 A;  1W63 M;  4G3V A;  1TF1 A;  4OOM A;  2H28 A;  4YNR A;  2VEA A;  1OTE A;  4P6Z M;  2B02 A;  2JKR M;  3DBA A;  2PR6 A;  1MZU A;  2WKP A;  4BBV A;  1OJG A;  2HF6 A;  2XA7 M;  3PHY A;  3B47 A;  4KUO A;  4B9O A;  4EEP A;  4L9F A;  1NLY A;  1V9Z A;  2EA9 A;  2W27 A;  3UB8 A;  3E4P A;  1OTA A;  2ZMF A;  1XJ3 A;  5J4E A;  4R3A A;  4O01 A;  4XT2 B;  2GNX A;  5F5Y A;  2K2N A;  3BWL A;  4Y2F A;  2KLI A;  3GEC A;  5DFY A;  3H82 B;  5HPF A;  2K31 A;  4IJG A;  2YKH A;  4GLQ A;  3VOL A;  4F3L A;  3B33 A;  5I5L A;  4LRY C;  2QYB A;  4EET B;  4PKY G;  2KDK A;  2M1C A;  5HSQ A;  2ZOH A;  3CWF A;  1WA9 A;  4Q0I A;  3UB9 A;  2FZ0 A;  3CIT A;  5G4Z A;  4CLC E;  3MMH A;  3MF0 A;  4NXB A;  2DMW A;  3JVV A;  3S7N A;  3ZYT A;  3PBN A;  4HH3 A;  1N9O A;  1TD5 A;  1T1B A;  1YAX A;  2ZMV A;  3CI6 A;  2O9A A;  1P0Z A;  3LIF A;  3LIC A;  3MR0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...