2Z6CA

Crystal structure of lov1 domain of phototropin1 from arabidopsis thaliana
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
121
structure length
121
Chain Sequence
VSEDLKDALSTFQQTFVVSDATKPDYPIMYASAGFFNMTGYTSKEVVGRNCRFLQGSGTDADELAKIRETLAAGNNYCGRILNYKKDGTSFWNLLTIAPIKDESGKVLKFIGMQVEVSKHT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Phototropin-1
publication title Structural basis of the LOV1 dimerization of Arabidopsis phototropins 1 and 2
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Transferase
total genus 31
structure length 121
sequence length 121
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2007-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2z6cA00
3T50A 1TS8A 3F1OA 4PKYG 3H9WA 3E4PA 2B02A 4K08A 1T1CA 4LPZA 4HHDA 2YKFA 1XJ3A 4LRXC 4B9OA 4KUKA 4JGRA 2QWSA 5HD3A 1OTDA 2OWJA 3NHQA 5DJTA 2D02A 1OT9A 3F1OB 3K3DA 3PYPA 2QKPA 4MN5A 3F1NA 4I39A 2PD8A 4I3AA 4M4XA 2V0UA 3UB7A 2BASA 1LL8A 1OTIA 1LSVA 4DJ3A 1S67L 5HDSA 2Z6CA 4LRYC 3C2WA 1NWZA 5F69A 5J7EA 4NXEA 1V9ZA 4HJ3A 4E04A 3F1NB 3LI8A 4WN5A 3A0SA 3LIDA 4EETB 2V0WA 1BYWA 4WF0A 3H82A 2Z6DA 1XFNA 1Y28A 3BY9A 4I3IA 4EW7A 2VV6A 4R3AA 3VE3A 4BBVA 3B33A 2GJ3A 1LSWA 4HY8A 3KX0X 1T1AA 4EXOA 1GSXA 3ULFA 1T1BA 2YKHA 4MN6A 3H82B 2W27A 2ZOIA 1KOUA 3HJIA 1WA9A 2VV7A 1F98A 1OTBA 4JGPA 3OLOA 2VV8A 5G4YA 1T18A 3RTYA 3UB9A 3BWLA 4BBTA 4H6JA 4HP4A 5HDCA 1N9NA 4LRZE 3MQOA 4WLAA 1S66L 4R6LA 3UB6A 2WKQA 5KIZA 1XJ6A 3CLOA 1D7EA 4GCZA 5HWTA 4WUJA 2I9VA 3LYXA 3G6OA 2JN7A 1OTAA 2M1CA 2EA9A 1GSVA 4JGOA 1S1YA 4XT2A 1S4SA 4H6JB 3MR0A 1OJGA 1S1ZA 4YWZA 1S4RA 4NXBA 1UWNX 1XFQA 4R70A 4HJ6A 1XJ4A 4NXGA 1DRMA 2W0NA 2KX6A 3GDIA 1UGUA 2WKPA 3LIAA 2K7SA 1JNUA 3IBRA 3SW1A 2ZBBA 4XT2B 1GSWA 5HDDA 5HWVA 5HSQA 3NOPC 5HWWA 2CMNA 3LICA 3H7WA 3F1PA 3IS2B 1P0ZA 4L9FA 2WKRA 2J80A 2V9AA 5I5LA 4WL9A 4EERA 3NOUC 5AVEA 4EEPA 3LIFA 1T19A 4EQ1A 1OT6A 3UMEA 1UWPX 3H7WB 5HD5A 3F1PB 3EEHA 2V1BA 1DP6A 3CWFA 4F3LA 1N9LA 3FC7A 3UB8A 1DP9A 3A0VA 4KUOA 1N9OA 5J3WA 1V9YA 2PR5A 4I3JA 5AVFA 1EW0A 2OOLA 2ZOHA 4EEUA 5A8BA 2PYPA 3LIBA 2KDKA 3GECA 4EESA 1P97A 4F3LB 4HOIA 2L0WA 5F6AA 1OTEA 5DKLA 2HV1A 3PHYA 5DKKA 2PDRA 4I5SA 4KQDA 3VOLA 5TBMA 1G28A 3LIEA 1DP8A 2P7JA 1ODVA 3A0RA 3LUQA 3NOTC 1XJ2A 4L9EA 4R38A 4HIAA 1OJ5A 5G4ZA 3E4OA 3NJAA 5IU1A 5F68A 2QJ7A 1F9IA 3MJQA 3IS2A 4PKYA 3ICYA 5TBMB 2L4RA 4HH3A 1D06A 4L9GA 5EFWA 2INWA 4HI4A 2A24A 4BBUA 1LT0A 3EWKA 4GHIA 4HQAA 4GS9A 2D01A 2V1AA 3MQQA 4HP9A 2QHKA 3UMDA 3ZQ5A 3CAXA 3MXQA 1X0OA 4HJ4A 4DJ2A 2A24B 3LI9A 5F5YA 4HH2A 3P7NA 2PHYA 3FG8A 4GHIB 4GS9B 2OWHA 3E4QA 2PYRA 2VLGA 5HZHA 1TS0A 5DJUA 3HJKA 5J4EA 3MFXA 1TS7A 2PD7A 4NXFA 3D72A 1LSXA 4HNBA 2QJ5A 2H28A 2R78A 2PR6A 4RQ9A 3C8CA 2VEAA 1TS6A 3RH8B 3VE4A 4GW9A 1VB6A 4LLOB 2L1MA 4I38A 1MZUA 5IS1A 3UE6A 3K3CA 3BY8A 4JGQA 2JHEA
chains in the Genus database with same CATH superfamily
1K57C 3NCKA 4OPRA 1KVMA 2J9PA 1XJ3A 3V3SA 2K31A 1IKGA 1YKDA 2W3EA 4B9OA 4Y7PA 4OQHA 5FDHA 4LFUA 1K0KA 4FTXA 5L07A 2XH9A 2K2NA 1JWZA 5HD3A 3QP8A 2D02A 5E2GA 3HLWA 4JXWA 2ZQAA 1MWUA 3F1NA 1AWIA 4M4XA 2V0UA 3IWOA 4K0WA 1NYYA 5A91A 3VOZA 2Y2QA 3IX3A 3NDEA 4LRYC 3I7JA 3C2WA 5GHZA 3UPOA 5BOHA 4E3KA 1XGJA 3LI8A 3CI6A 3PBNA 4PM9A 3B3XA 4MEZA 5L09A 1H0MA 5F1GA 1FSWA 1I2WA 1BSGA 3DTMA 2G7UA 4DE3A 1G5UA 1Y28A 2VK3A 3PBOA 2QYBA 3BY9A 4I3IA 3IHAA 5CGSA 1HD8A 2W3HA 3BFCA 4R3AA 1FIKA 3VE3A 3R7WA 2WKIA 1ESIA 1PZOA 4CPKA 4HY8A 4HBUA 3KX0X 5EPHA 2ZC7A 1JWPA 1S0WA 4WELA 1JVJA 4KZ7A 3S7PA 3B47A 2ZOIA 2VV7A 4WMCD 2Y2NA 4JPMA 3UB5P 4KENB 4GDBA 1CEFA 2VV8A 2Y55A 5G4YA 1T18A 3UY6A 1MWRA 4N92A 3UB9A 4BBTA 1ACFA 4LRZE 1FOFA 3WWXA 3UB6A 1CI8A 2WKQA 3C4OA 4BQMA 3UDFA 3IF6B 3HBRA 1XJ6A 1D7EA 1BULA 3LYXA 1OTAA 5EECA 2ZC3B 4II7A 1NYMA 4DXBA 5M19A 1SDNA 1YQSA 4XT2A 1S4SA 4H6JB 5FAPA 2OV5A 3LEZA 4X56A 5KZHA 1L0EA 3LY4A 2W1RA 2A2LA 3W4QA 4NXBA 5DFYA 4S2NA 2PBDP 3BECA 2ZM8A 4R0QA 5GLBA 3GSGA 5LBRA 4WBGA 2WKPA 5HPIA 4PM8A 2HGVA 2JKRM 2O9AA 1GSWA 4KG2A 5HDDA 5HFOA 1YSPA 1G68A 1XKZA 4X1LA 2CMNA 1ZG4A 1K56D 1WYBA 3JVUA 1BUEA 2Y2KA 2B95A 1P0ZA 2DNSA 2J80A 2H0TA 2V9AA 5I5LA 2ZL1B 4PM5A 4WL9A 3PBRA 5L10A 3PR6A 4QWOA 5EV0A 1CQAA 2J3TD 3DTEA 3FKVA 5AVEA 4EEPA 5M1AA 3W4OA 1FQGA 3LIFA 1JTGA 1XX2A 4DXCA 1KVLA 3QNCA 3H7WB 2WADA 5KMWA 3EEHA 3NY4A 2V1BA 1DP6A 3CWFA 5FI6A 5FSRA 3IWQA 1BLSA 4LV2A 4EV4A 1L3LA 1W8QA 2XDMA 3VP3A 2WKHA 4BJPA 3DAVA 1EW0A 2W1TB 4E6WA 4YOFA 2BG1A 2ZLYA 4E3JA 3Q7VA 4EUVA 4EESA 4DMZA 4S2NC 5F6AA 1VHMA 3U4LP 2WZZA 3CG5A 1BZAA 1FSYA 1K6SA 4O0PA 1IYSA 3T1SA 1L0DA 2XA7M 3A3DA 4HBTA 2W3DA 4KQDA 3VOLA 1IYQA 4WMCA 4E3MA 4EBPA 2P7JA 4MBKA 1SKOB 1ODVA 3BJNA 1QMEA 2Y2LA 3LUQA 1ES4A 2XD5A 4L9EA 4OVDA 4X68A 2HPBA 1PWGA 4OH0A 4N9LA 3NJAA 2UWXA 5IU1A 3D9YA 4LV3A 3EGDC 5F68A 5A93A 5TBMB 3CJMA 1PRQA 1W79A 1D06A 1F5MA 5CHMA 3PBQA 3OPRA 3S7OA 2HF6A 1IELA 4HI4A 4OOYA 4MBHA 3VP2A 2WK0A 4OKPA 1STZA 3Q07A 2O0YA 2Q9MA 3N6IA 1G6AA 3SZTA 4S2LA 4D2OA 3PTEA 1J9MA 4C3QA 3LR4A 5TGFA 3UMDA 3B42A 5G18A 3MXQA 4HJ4A 3KSGA 4E3LA 2Y4AA 4QPRA 4X69A 2PHYA 4B88A 2LB9A 1YT4A 4FUWA 4R1GA 4MMNA 4DF6A 3SOIA 3MZFA 3UN7A 1YSQA 2MJ6A 5EM1A 1KE0A 1Q2QA 1IEMA 5F83A 2Q0OA 5E2HA 2VLGA 1N9BA 5AQBA 4QD4A 3IF5A 4Y2FA 2PD7A 4PAUA 1YM1A 3D72A 5HARA 2R78A 4OP8A 4P0MA 4KQOA 2E8IA 2VEAA 2Q9NA 3RH8B 1RCJA 3G30A 4I38A 2WGWB 3BM6A 5IHVA 3SS4A 1GA0A 5IS1A 3SH7A 5AQ7A 2DMWA 3BY8A 4JGQA 1PI4A 4EBLA 1ES2A 1NZUA 3H9WA 2B02A 4LPZA 4Q0HA 1A0KA 3G32A 3N8RA 2HJ9C 3KSHA 4KUKA 4D60A 1NJ4A 4PM6A 3HLEA 1MWSA 2OWJA 5DJTA 2VKSA 3MF0A 1TVFA 5FATA 3A3FA 2ZJ9A 5HW3A 2XA7S 2HP6A 4G3KA 4ETXA 1F2KA 3FPVA 5CX7A 3U2AA 4GD8A 1NLYA 1LSVA 3E0YA 2KLIA 1S67L 4JXVA 3UE3A 1KGFA 1NWZA 4IJGA 2WGIA 3G2YA 4NXEA 3JVVA 1ES3A 3T12B 4LENA 4HJ3A 4E04A 4WN5A 2EX8A 3A0SA 3PBSA 3LIDA 3T4QA 1LI9A 2ZMAA 3TE8A 3MXRA 4QHCA 3A3JA 2BLSA 2Z6DA 5FQMA 1XFNA 3FPWA 4ARZB 4EW7A 2P9VB 2HDRA 2VJWA 3B33A 4A5RA 4CLCD 1M6KA 5FDSA 1LSWA 3ZGAB 1FR1A 4EXOA 2O9BA 3ULFA 2WUQA 1T1BA 1VETB 2YKHA 3IT9A 4GB7A 3O88A 3H82B 3QP4A 5DVAA 2FH5A 2XFSA 3DTIA 3ZG9B 2DRWA 5FASA 3HJIA 3IF6A 2DCFA 4GOGA 4RVAA 3SH9A 3RXWA 1OTBA 1HTZA 3IWIA 3MZEA 2IWDA 3PAGA 3RTYA 3OPHA 2Y2GA 4EQIA 4H6JA 1TD5A 3MQOA 4KG6A 5FQQA 2OLUA 4WLAA 1S66L 4X6TA 5GL9A 4LV0A 5KIZA 2JC7A 5L2FA 3HLGA 3CLOA 5HWTA 2PU4A 2I9VA 1GCEA 2I72A 3G6OA 3IX4A 5FA7A 3Q7ZA 3HLFA 1YLPA 4R4SA 3ZG5A 3GMWA 3HLDA 3VP0A 2IA2A 4ETZA 1S1ZA 3T4LA 1UWNX 1XFQA 3FYZA 4HJ6A 1DRMA 1C3BA 5HAPA 4NEED 2KX6A 4OQIA 2ACGA 3KSFA 3T1QB 2JKRI 1L2SA 2K7SA 1JNUA 3RXXA 1YMSA 4WEJA 1E25A 2P04A 5HWVA 2UV0E 3FZCA 1G6OA 5FI7A 5FEFA 1ZG6A 3KYZA 5DF7A 1TEMA 3LCEA 4MLLA 5TFQA 1MKIA 4PHTA 4FD8A 3LR3A 3H7WA 5EE8A 4ZRRA 5IT5A 4ESPA 3IS2B 2WKRA 4E3OA 3IF6C 5FQKA 2VA0A 4ZAMA 1I2SA 1SZVA 4X53A 5GLDA 4E3IA 5U47A 5FAQA 1JWVA 2O9CA 3IBJA 4DDSA 1H8YA 3G4PA 2ZQ7A 3L9KA 4Y5FA 1N9LA 3HUMA 1CEGA 3W4PA 3UB8A 3MBZA 4KUOA 1LL9A 2NUTC 5J3WA 4PPRA 3W8KA 2NUPC 3ZYTA 3LR0A 3LY3A 1BTLA 2IWCA 1L0GA 1JTDA 2ZOHA 4Y3IA 4EEUA 2C6WB 4BD0A 1CJFA 1EI5A 3O5YA 3GECA 3NBLA 1SKOA 3IXDA 4RA7A 4FCFA 4HOIA 4NG2A 3UE0A 4G3VA 2HV1A 3PHYA 4UHUA 2V1ZA 4DRTA 4CLCA 4IEDA 2W3FA 1W8YA 5DKKA 5M18A 4FOFA 3HCYA 4KZ4A 3V5MA 4DN0A 1PI5A 3MQ0A 4I5SA 3UDXA 2XRNA 1FILA 5TBMA 2WZXA 1K4EA 2VGJA 3VV4A 2ZC5B 1O7EA 1IOUA 3EQUA 4S2MA 3E4OA 1PWDA 4GNUA 1PZPA 1CK3A 3ITAA 5TJJA 2QJ7A 3MJQA 1ZC2A 1NRFA 3G35A 3ICYA 2W3GA 3VMAA 4LCLA 4OPZA 5EFWA 1PWCA 2B5RA 5K5BA 4MNRA 3V39A 3L7HA 3EWKA 4GLQA 4FSFA 2ZM0A 4GZBA 4JLFA 1LLBA 3HVFA 1QMFA 4B4XA 3VSLA 4HP9A 2V2FF 1ZHHB 3VP4A 4EWFA 4U3TA 1H3QA 4KZ6A 1KDWA 3LI9A 3WS0A 1EWZA 3UPNA 1NLZA 3P7NA 3FG8A 1RGZA 4CLCC 2JE5A 1GHMA 2GNXA 2GZAA 2EXAA 4FH2A 2OWHA 3CHWP 2EX6A 3E4QA 2V8CA 4UA9A 2WGWA 4UA7A 1ZKJA 5HZHA 4IBRA 4YNRA 3VOYA 1TS0A 4GD6A 3HJKA 2KOIA 4PMAA 3MFXA 2FFYA 3C4PA 4NXFA 2QJ5A 1N4OA 2PR6A 5AQ9A 5KSCA 3BQ8A 1W7FA 1MZUA 4XUXA 1M40A 5E2FA 5F1FA 2JHEA 1TS8A 3V67A 4H8RA 2EWWA 3WRZA 2FFFB 4K08A 1T1CA 4HHDA 4MCWA 2YKFA 3M6HA 3ZVWA 2XROA 2ZQCA 4LRXC 4F94A 4CJNA 3AGDA 1H8MA 4JGRA 2QWSA 1SDEA 2M7VA 3Q1FA 4LGWA 4S2OA 4DE2A 1OT9A 3F1OB 4OOMA 2X02A 3DW0A 3PYPA 2QKPA 2R9XA 4MN5A 4I39A 2PD8A 4I3AA 1KGGA 3UB7A 4MBFA 1LL8A 5HX9A 4KZ9A 3Q82A 5HDSA 4QU3A 1VEUB 1ESUA 4EUZA 3DBAA 3A3EA 3P09A 4QB8A 2HP5A 1HVBA 3QP5A 1IYOA 5HAQA 1LHYA 2P9VA 2XR0A 1YLYA 4PM7A 5J7EA 4BL3A 3IH9A 4X25A 5C5KA 3IXGA 1Z6FA 3C5AA 4OQGA 4NETA 3S1YA 4ME4A 1BYWA 1PNEA 1VETA 4N1HA 4WF0A 3H82A 2EX2A 2EFXA 4L0LA 3ZCZA 3QHYA 2Y2PA 2ZC6B 1K4FA 3S4XA 4BBVA 2GJ3A 3O3VA 5CERA 3ZG8B 2WGVA 3O87A 1T1AA 5EVIB 3FWLA 1GSXA 4FH4A 4KZ8A 3BFDA 4S2IA 1MWTA 2W27A 1KOUA 4JXGA 5FQJA 3G31A 1I5QA 5L8MA 2PT7A 3M6BA 1DJAA 2XQZA 1FCOA 4JF6A 5CTNA 3BWLA 3R4KA 4OOLA 1K6RA 4QY5A 4HP4A 5HDCA 5EVEA 5FAOA 4UQIS 1J3WA 3NIAA 3T4KA 4R6LA 3VP1A 3BFFA 2ZMVA 3GVBA 3ZFZA 2JKFA 4GCZA 4RX3A 1Y4OA 2J9OA 3N8LA 3D3OA 5JYOA 2JN7A 1NZOA 4JBFA 3VFFA 2M7UA 4OQ0A 2EA9A 4JGOA 3OCLA 3Q7VB 3P01A 4O01A 3ITBA 5HL1A 3MR0A 3V3RA 1Y54A 3MXSA 4JKTA 4R70A 4YINA 4ID4A 1K54A 1PIOA 1XJ4A 3RJUA 4NXGA 1OMEA 1K38A 2W0NA 1RP5A 3CPTB 4K0XA 3GDIA 4U0TA 3LIAA 2WAEA 3CMZA 4B93A 4B4ZA 4DDYA 2JKTM 3SW1A 2ZBBA 2IWBA 4JXSA 1XXMA 4E3NA 4R23A 5HSQA 2Y91A 2HP9A 3WS4A 4Z1WA 1E4DA 3BLSA 3GTCA 1KDSA 4IUHA 1LI0A 1WE4A 1D1JA 3DWZA 3N4IA 4X1MA 1P9RA 1BT5A 2ZQ8A 2H0YA 1YAXA 4U0XA 2EFUA 4KZBA 1ALQA 1W63Q 5DFXA 3IXHA 4IVKA 3BFEA 3QNBA 2EXBA 4KZAA 4Q0IA 1FR6A 1T19A 4EQ1A 3E2KA 4E6XA 3UMEA 4OPYA 3MS6A 4MN7A 1KGEA 4WZ4A 3F1PB 4IUKA 3QP1A 3T4JA 1BLCA 3VFHA 1XA7A 5JYPA 1DY6A 4WM9A 3MKFA 1V9YA 4Y17A 2HDSA 5AVFA 2VGLM 1ZTUA 2V20A 3QP2A 3AGFA 1P97A 1TDLA 4F3LB 1XA1A 2L0WA 3T4TA 3O86A 1K54C 1OPXA 5DKLA 2OAQ1 5FEGA 2G2UA 3ZVTA 2OSUA 1WYCA 4XUZA 3GQZA 2PDRA 2V8FA 1ONGA 4Y0UA 1G28A 1DP8A 4Y0OA 1IKIA 5CHJA 3UO9A 2AVXA 5GHYA 2XK1A 1XJ2A 3RFBA 1E3UA 3MSHA 2E8JA 4G3WA 5G4ZA 3MKEA 2P08A 1F9IA 4WYYA 3EGXC 4UA6A 3ZG7B 2J3WA 2L4RA 5EVID 2ZL1A 4N1XA 3M2JA 2FZ0A 1KE3A 5I94A 4L9GA 2XFTA 3G2ZA 3T1XA 5AQAA 1ONHA 3KO6A 4BBUA 1SKFA 2WAFA 1LT0A 1ES5A 1CI9A 3MFDA 4HQAA 2D01A 5GLAA 3BRMA 5HAIA 2V1AA 3MQQA 2P74A 3T4OA 1XPBA 5CRFA 3ZQ5A 3CAXA 3LGOA 1X0OA 3PXPA 4DJ2A 2A24B 3N8SA 4KG5A 4OONA 2W1TA 2LB5A 4HH2A 3BFGA 4GHIB 4GS9B 5E2EA 3QP6A 3WS2A 2H5SA 5EM0A 2PYRA 3ZNTA 4Q0JA 5J4EA 4ZBEA 1FCNA 2X01A 4Q8IA 2H28A 3DTKA 4N9KA 4LCMA 2C5WB 1H5XA 4CLCE 3C8CA 2VZWA 2OAP1 1NRJA 3NECA 4UAAA 3NULA 4P6BA 3WS1A 5DTSA 4NKPA 3FV7A 4LLOB 2L1MA 3ISGA 3P98A 2PAVP 3BEBA 3K3CA 2PU2A 3OC2A 3BLMA 1ERMA 3S7NA 3T50A 3WS5A 1PW1A 3F1OA 2HDUA 4PKYG 3Q81A 3E4PA 2R9WA 4M3KA 1Q2PA 2VGLS 1O07A 4KQRA 4P6ZM 5CXWA 5D3OA 4IBXA 3UPPA 3UNWA 4IVIA 3VSKA 1VEUA 2Y59A 5EVLA 3N7WA 2OLVA 1OTDA 3GR2A 3BYDA 3NHQA 5FQ9A 3K3DA 1EROA 3CUEA 1MXOA 5CECA 2XGNA 4K91A 4UEYA 2BASA 5A90A 4RX2A 4C75A 1OTIA 1W63M 4DJ3A 4HEFA 2G2WA 4S2KA 2Z6CA 3V50A 1VM1A 3WRTA 5F69A 1IFQA 1V9ZA 1L0FA 2PBYA 2QZ6A 3F1NB 3TG9A 5DF8A 4EETB 4GN2A 4JF5A 5EVIA 2V0WA 1PW8A 2GX5A 3LFVA 4WZ5A 1MY8A 3M2KA 4R3JA 3SS5A 3GV9A 5CGWA 2VV6A 2XD1A 3EOIA 1KE4A 4NK3A 1NXYA 4LV1A 3KSIA 4QJGA 4UQIM 2B18A 5TR7A 2ZC4B 4Y13A 3BW6A 5DTTA 3UE1A 4MN6A 2RL3A 3IX8A 1WA9A 5CEBA 1F98A 4ZJ3A 2ZQDA 1MPLA 4JGPA 3R7WB 3OLOA 4OLGA 4S2JA 1K55A 3CZDA 3CUEC 1CF0A 3OZHA 4ZJ1A 4Y0TA 3E98A 1N9NA 3IXBA 4DE0A 2Z2LB 3JYIA 1P9WA 5A92A 1YLTA 1XGIA 3CPTA 3ZNYA 4WUJA 2Y2OA 3TW8A 2XLNA 2M1CA 1GSVA 2ZQ9A 1S1YA 2A49A 3HUOA 5HL6A 2BTFP 4R3BA 3IH8A 1OJGA 3S22A 4YWZA 1S4RA 4CLCB 5EVIC 4DE1A 1DJCA 1IYPA 1UGUA 5EOOA 2JKTI 4EU0A 3K2NA 4WZ5C 5CTMA 1TDGA 5CGXA 3D4FA 1SHVA 4GJ4A 3UDIA 3IBRA 2GDNA 4XT2B 4P6ZS 2JCHA 2WKEA 3BQAA 3TOIA 2J7VA 2Y2MA 4ARZA 2H10A 1ERQA 4OLDA 3NOPC 3A3IA 5HWWA 2XSSA 1DJBA 3AGEA 2HJEA 2X71A 3LICA 1BLPA 1TF1A 2XEPA 4KZ5A 3F1PA 1YLWA 4L9FA 5CHUA 4DKIA 2JBFA 5EOEA 4OP5A 5FL3A 2A3UA 4EERA 1MC0A 3PAEA 3NOUC 5CEDA 3S7QA 5DTKA 3KYEA 2WYXA 4C6YA 1K55C 4IHQA 1OT6A 3DWKA 4JF4A 4O7DA 4P87A 4P85A 4Z9QA 1UWPX 2EWVA 5E43A 5HD5A 1BLHA 4F3LA 1YLZA 3OBFA 3FC7A 1DP9A 3A0VA 4MDZA 1N9OA 3C30A 1K56A 1PYYA 3OPLA 1W5DA 2PR5A 4I3JA 5GLCA 4BL2A 1GA9A 2PRFA 2OOLA 5A8BA 3G34A 4EBNA 2HDQA 1E3UD 2PYPA 1FCMA 3LIBA 3TJZC 2KDKA 2VGKA 5KSHA 1GHPA 3C7VA 4XXRA 3JPUA 3LR5A 5AJGA 1OTEA 5J8XA 5F82A 3ZHHA 3LO7A 1YLJA 1HZOA 1YPRA 4BD1A 1LL5A 2Y2IA 3E2LA 2ZD8A 4GKUA 3T4SA 3ZDJA 3LIEA 4BMWA 1VQQA 3A0RA 3NOTC 4YFMA 5FQIA 4AFIA 4R4RA 4R38A 4HIAA 3SH8A 1OJ5A 1HLUP 1U60A 5FI2A 4WEKA 3TSGA 2EX9A 4KZ3A 3MMHA 3IS2A 4ZDXA 1GHIA 4PKYA 3OOVA 1RGYA 3NC8A 3OPPA 1H8ZA 4QY6A 3OCNA 4KQQA 4HH3A 1K57A 3CITA 2J8YA 1AXBA 3ZG0A 2INWA 3W2ZA 3PBTA 1NY0A 2A24A 3T1RA 4Y15A 3GRJA 2RCXA 4GDNA 5EUAA 1MKMA 3NI9A 2CC1A 4GHIA 4GS9A 5HPFA 4RYEA 4ZTKA 1Z09A 1SCWA 3IHBA 3HLBA 2VX8A 3HREA 2QHKA 4CQHA 4ZJ2A 2J3TC 5F5YA 3SS3A 3TRCA 3HUNA 4OPQA 3C7UA 1MBLA 2XF3A 1S6RA 4O8GA 4BWIA 2Y2JA 4S2PA 5DJUA 2Z2MB 2Y8HA 3MZDA 1TS7A 1K25A 1XP4A 2O99A 1LSXA 2HZ5A 4HNBA 3C38A 4BLMA 2Y79A 3NDGA 4RQ9A 1PFLA 3EQVA 1TS6A 3EEAA 3VE4A 2QMIA 4GW9A 1VB6A 3HLCA 1YMXA 5GHXA 4X55A 3HL9A 2QPNA 2Y2HA 2ZM2A 2ZMFA 3LEQA 5DF9A 3UE6A 2JKGA 5MC7A 3IQAA 4HESA 4BENA 3FKWA 3KYQA
chains in the Genus database with same CATH topology
3T50A 1TS8A 3V67A 3F1OA 4PKYG 3H9WA 2EWWA 3E4PA 2B02A 4K08A 1T1CA 4LPZA 4HHDA 2VGLS 4MCWA 2YKFA 4Q0HA 1XJ3A 2XROA 2K31A 4LRXC 4P6ZM 4B9OA 1YKDA 2W3EA 2HJ9C 3KSHA 4KUKA 1H8MA 4JGRA 2QWSA 2K2NA 2M7VA 5HD3A 1OTDA 2OWJA 3NHQA 5DJTA 2D02A 2VKSA 1OT9A 3F1OB 3K3DA 3MF0A 3CUEA 4OOMA 2XA7S 3PYPA 2QKPA 4G3KA 4ETXA 4MN5A 3F1NA 3FPVA 4I39A 2PD8A 4I3AA 4M4XA 2V0UA 4UEYA 5CX7A 3UB7A 3U2AA 2BASA 1LL8A 1NLYA 1OTIA 1LSVA 1W63M 4DJ3A 3E0YA 2KLIA 1S67L 5HDSA 2Z6CA 3DBAA 3UE3A 4LRYC 3C2WA 1NWZA 4IJGA 5F69A 5J7EA 4NXEA 3JVVA 1IFQA 1V9ZA 4HJ3A 5C5KA 4E04A 3F1NB 3LI8A 4WN5A 3A0SA 3PBSA 3LIDA 3T4QA 4EETB 3CI6A 3PBNA 3TE8A 4ME4A 2V0WA 1BYWA 4WF0A 3H82A 2GX5A 3LFVA 4L0LA 2Z6DA 2G7UA 1XFNA 1Y28A 3PBOA 2QYBA 3BY9A 3FPWA 4I3IA 4ARZB 4EW7A 2VV6A 2W3HA 4R3AA 3EOIA 3VE3A 2VJWA 4BBVA 3R7WA 3B33A 3KSIA 4CLCD 4UQIM 2B18A 2GJ3A 1LSWA 4HY8A 3KX0X 1T1AA 4EXOA 3BW6A 1GSXA 4WELA 2O9BA 3ULFA 1T1BA 3S7PA 2YKHA 4MN6A 3H82B 2FH5A 2W27A 3B47A 2ZOIA 1KOUA 3HJIA 1WA9A 2VV7A 1F98A 5L8MA 2PT7A 1OTBA 4JGPA 3R7WB 3OLOA 2VV8A 5G4YA 1T18A 3RTYA 3UB9A 3BWLA 3R4KA 3CUEC 4OOLA 4BBTA 3E98A 4H6JA 1TD5A 1N9NA 4HP4A 4LRZE 5HDCA 3MQOA 4WLAA 4UQIS 1S66L 3T4KA 4R6LA 3UB6A 2WKQA 5KIZA 1P9WA 2ZMVA 1XJ6A 3CLOA 1D7EA 4GCZA 5HWTA 3D3OA 4WUJA 2I9VA 3LYXA 3G6OA 2JN7A 1OTAA 3TW8A 2M7UA 4II7A 2M1CA 2EA9A 1GSVA 4JGOA 3OCLA 1S1YA 4XT2A 3P01A 4O01A 1S4SA 4H6JB 5HL6A 3MR0A 1OJGA 2IA2A 2W1RA 2A2LA 1S1ZA 4YWZA 3T4LA 4ETZA 1S4RA 4NXBA 4CLCB 1UWNX 5DFYA 1XFQA 4R70A 4HJ6A 1XJ4A 4NXGA 1DRMA 4NEED 2W0NA 2KX6A 3GDIA 1UGUA 5LBRA 2JKTI 3KSFA 2WKPA 5HPIA 2JKRI 4EU0A 3K2NA 2HGVA 3LIAA 2K7SA 1JNUA 4GJ4A 4B93A 4WEJA 3IBRA 2JKTM 2P04A 2ZBBA 3SW1A 2JKRM 4P6ZS 4XT2B 2O9AA 1GSWA 5HDDA 3BQAA 5HWVA 4ARZA 1G6OA 5HSQA 1YSPA 3NOPC 5HWWA 4Z1WA 2XSSA 3KYZA 2CMNA 2HJEA 3LICA 1TF1A 4PHTA 4IUHA 3LR3A 3JVUA 3H7WA 4ZRRA 1P9RA 3F1PA 5IT5A 3IS2B 1P0ZA 4L9FA 2WKRA 1YAXA 2J80A 5FL3A 2V9AA 5I5LA 4WL9A 3PBRA 3PR6A 1W63Q 5DFXA 1MC0A 2VA0A 4EERA 2J3TD 3NOUC 5AVEA 3S7QA 4EEPA 4Q0IA 3LIFA 1T19A 4EQ1A 4IHQA 1OT6A 3UMEA 2O9CA 3IBJA 1UWPX 2JHEA 2EWVA 3H7WB 4MN7A 3F1PB 5HD5A 4IUKA 3EEHA 2V1BA 1DP6A 3CWFA 4Y5FA 3T4JA 4F3LA 1N9LA 3OBFA 3FC7A 3UB8A 1DP9A 3A0VA 4MDZA 4KUOA 1N9OA 2NUTC 5J3WA 3C30A 1V9YA 2NUPC 3ZYTA 3LR0A 4BJPA 2PR5A 4I3JA 5AVFA 1EW0A 2OOLA 2ZOHA 4Y3IA 4EEUA 5A8BA 2W1TB 2VGLM 2PYPA 1ZTUA 3LIBA 3TJZC 4YOFA 2KDKA 3O5YA 3GECA 4EUVA 5KSHA 4EESA 1P97A 4DMZA 3LR5A 4F3LB 4HOIA 2L0WA 3T4TA 5AJGA 5F6AA 1OTEA 4G3VA 1VHMA 5DKLA 1OPXA 2HV1A 3PHYA 4CLCA 2W3FA 2OAQ1 4O0PA 5DKKA 4FOFA 3HCYA 2XA7M 4DN0A 2PDRA 2W3DA 3MQ0A 4I5SA 2XRNA 4KQDA 3T4SA 3VOLA 5TBMA 1G28A 3LIEA 1DP8A 4BMWA 2P7JA 1ODVA 3BJNA 3A0RA 3VV4A 3LUQA 3NOTC 1XJ2A 4AFIA 3RFBA 4L9EA 4R38A 4HIAA 4G3WA 1IOUA 1OJ5A 3EQUA 5G4ZA 4WEKA 3E4OA 3NJAA 2P08A 5IU1A 5TJJA 3MMHA 3EGDC 5F68A 2QJ7A 1F9IA 3EGXC 3IS2A 3MJQA 4PKYA 3OOVA 2J3WA 3ICYA 2W3GA 5TBMB 2L4RA 3OCNA 2FZ0A 4HH3A 3CITA 1D06A 1F5MA 4L9GA 5EFWA 3PBQA 2INWA 3S7OA 3W2ZA 2HF6A 5K5BA 3PBTA 4HI4A 2A24A 3KO6A 4BBUA 1LT0A 1STZA 3EWKA 2O0YA 4GLQA 4FSFA 1MKMA 4GHIA 4HQAA 4GS9A 2D01A 5HPFA 2V1AA 3MQQA 4HP9A 1ZHHB 2VX8A 3T4OA 3LR4A 2QHKA 4CQHA 3UMDA 1H3QA 3B42A 3ZQ5A 3CAXA 3MXQA 1X0OA 4HJ4A 3PXPA 3KSGA 4DJ2A 2A24B 2W1TA 2J3TC 3LI9A 5F5YA 2LB5A 4HH2A 3TRCA 4QPRA 1NLZA 3P7NA 2PHYA 2LB9A 3FG8A 4GHIB 4MMNA 4CLCC 4GS9B 4O8GA 1YSQA 4BWIA 2GNXA 2GZAA 2MJ6A 2OWHA 3E4QA 2PYRA 2VLGA 5HZHA 4YNRA 4Q0JA 1TS0A 5DJUA 3HJKA 2KOIA 5J4EA 3MFXA 2Y8HA 4Y2FA 1TS7A 2PD7A 4NXFA 2O99A 4PAUA 3D72A 1LSXA 4HNBA 2QJ5A 2H28A 3C38A 2R78A 4KQOA 2PR6A 2Y79A 4CLCE 4RQ9A 3C8CA 2VZWA 2OAP1 3EQVA 2VEAA 1NRJA 1TS6A 3EEAA 3RH8B 3VE4A 4GW9A 4NKPA 1VB6A 4LLOB 2L1MA 3BQ8A 4I38A 1MZUA 2ZMFA 5DF9A 5IS1A 3UE6A 2DMWA 3K3CA 5MC7A 3BY8A 3OC2A 4JGQA 3S7NA 3KYQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T50 A;  1TS8 A;  3F1O A;  4PKY G;  3H9W A;  3E4P A;  2B02 A;  4K08 A;  1T1C A;  4LPZ A;  4HHD A;  2YKF A;  1XJ3 A;  4LRX C;  4B9O A;  4KUK A;  4JGR A;  2QWS A;  5HD3 A;  1OTD A;  2OWJ A;  3NHQ A;  5DJT A;  2D02 A;  1OT9 A;  3F1O B;  3K3D A;  3PYP A;  2QKP A;  4MN5 A;  3F1N A;  4I39 A;  2PD8 A;  4I3A A;  4M4X A;  2V0U A;  3UB7 A;  2BAS A;  1LL8 A;  1OTI A;  1LSV A;  4DJ3 A;  1S67 L;  5HDS A;  2Z6C A;  4LRY C;  3C2W A;  1NWZ A;  5F69 A;  5J7E A;  4NXE A;  1V9Z A;  4HJ3 A;  4E04 A;  3F1N B;  3LI8 A;  4WN5 A;  3A0S A;  3LID A;  4EET B;  2V0W A;  1BYW A;  4WF0 A;  3H82 A;  2Z6D A;  1XFN A;  1Y28 A;  3BY9 A;  4I3I A;  4EW7 A;  2VV6 A;  4R3A A;  3VE3 A;  4BBV A;  3B33 A;  2GJ3 A;  1LSW A;  4HY8 A;  3KX0 X;  1T1A A;  4EXO A;  1GSX A;  3ULF A;  1T1B A;  2YKH A;  4MN6 A;  3H82 B;  2W27 A;  2ZOI A;  1KOU A;  3HJI A;  1WA9 A;  2VV7 A;  1F98 A;  1OTB A;  4JGP A;  3OLO A;  2VV8 A;  5G4Y A;  1T18 A;  3RTY A;  3UB9 A;  3BWL A;  4BBT A;  4H6J A;  4HP4 A;  5HDC A;  1N9N A;  4LRZ E;  3MQO A;  4WLA A;  1S66 L;  4R6L A;  3UB6 A;  2WKQ A;  5KIZ A;  1XJ6 A;  3CLO A;  1D7E A;  4GCZ A;  5HWT A;  4WUJ A;  2I9V A;  3LYX A;  3G6O A;  2JN7 A;  1OTA A;  2M1C A;  2EA9 A;  1GSV A;  4JGO A;  1S1Y A;  4XT2 A;  1S4S A;  4H6J B;  3MR0 A;  1OJG A;  1S1Z A;  4YWZ A;  1S4R A;  4NXB A;  1UWN X;  1XFQ A;  4R70 A;  4HJ6 A;  1XJ4 A;  4NXG A;  1DRM A;  2W0N A;  2KX6 A;  3GDI A;  1UGU A;  2WKP A;  3LIA A;  2K7S A;  1JNU A;  3IBR A;  3SW1 A;  2ZBB A;  4XT2 B;  1GSW A;  5HDD A;  5HWV A;  5HSQ A;  3NOP C;  5HWW A;  2CMN A;  3LIC A;  3H7W A;  3F1P A;  3IS2 B;  1P0Z A;  4L9F A;  2WKR A;  2J80 A;  2V9A A;  5I5L A;  4WL9 A;  4EER A;  3NOU C;  5AVE A;  4EEP A;  3LIF A;  1T19 A;  4EQ1 A;  1OT6 A;  3UME A;  1UWP X;  3H7W B;  5HD5 A;  3F1P B;  3EEH A;  2V1B A;  1DP6 A;  3CWF A;  4F3L A;  1N9L A;  3FC7 A;  3UB8 A;  1DP9 A;  3A0V A;  4KUO A;  1N9O A;  5J3W A;  1V9Y A;  2PR5 A;  4I3J A;  5AVF A;  1EW0 A;  2OOL A;  2ZOH A;  4EEU A;  5A8B A;  2PYP A;  3LIB A;  2KDK A;  3GEC A;  4EES A;  1P97 A;  4F3L B;  4HOI A;  2L0W A;  5F6A A;  1OTE A;  5DKL A;  2HV1 A;  3PHY A;  5DKK A;  2PDR A;  4I5S A;  4KQD A;  3VOL A;  5TBM A;  1G28 A;  3LIE A;  1DP8 A;  2P7J A;  1ODV A;  3A0R A;  3LUQ A;  3NOT C;  1XJ2 A;  4L9E A;  4R38 A;  4HIA A;  1OJ5 A;  5G4Z A;  3E4O A;  3NJA A;  5IU1 A;  5F68 A;  2QJ7 A;  1F9I A;  3MJQ A;  3IS2 A;  4PKY A;  3ICY A;  5TBM B;  2L4R A;  4HH3 A;  1D06 A;  4L9G A;  5EFW A;  2INW A;  4HI4 A;  2A24 A;  4BBU A;  1LT0 A;  3EWK A;  4GHI A;  4HQA A;  4GS9 A;  2D01 A;  2V1A A;  3MQQ A;  4HP9 A;  2QHK A;  3UMD A;  3ZQ5 A;  3CAX A;  3MXQ A;  1X0O A;  4HJ4 A;  4DJ2 A;  2A24 B;  3LI9 A;  5F5Y A;  4HH2 A;  3P7N A;  2PHY A;  3FG8 A;  4GHI B;  4GS9 B;  2OWH A;  3E4Q A;  2PYR A;  2VLG A;  5HZH A;  1TS0 A;  5DJU A;  3HJK A;  5J4E A;  3MFX A;  1TS7 A;  2PD7 A;  4NXF A;  3D72 A;  1LSX A;  4HNB A;  2QJ5 A;  2H28 A;  2R78 A;  2PR6 A;  4RQ9 A;  3C8C A;  2VEA A;  1TS6 A;  3RH8 B;  3VE4 A;  4GW9 A;  1VB6 A;  4LLO B;  2L1M A;  4I38 A;  1MZU A;  5IS1 A;  3UE6 A;  3K3C A;  3BY8 A;  4JGQ A;  2JHE A; 
#chains in the Genus database with same CATH topology
 1K57 C;  3NCK A;  4OPR A;  1KVM A;  2J9P A;  1XJ3 A;  3V3S A;  2K31 A;  1IKG A;  1YKD A;  2W3E A;  4B9O A;  4Y7P A;  4OQH A;  5FDH A;  4LFU A;  1K0K A;  4FTX A;  5L07 A;  2XH9 A;  2K2N A;  1JWZ A;  5HD3 A;  3QP8 A;  2D02 A;  5E2G A;  3HLW A;  4JXW A;  2ZQA A;  1MWU A;  3F1N A;  1AWI A;  4M4X A;  2V0U A;  3IWO A;  4K0W A;  1NYY A;  5A91 A;  3VOZ A;  2Y2Q A;  3IX3 A;  3NDE A;  4LRY C;  3I7J A;  3C2W A;  5GHZ A;  3UPO A;  5BOH A;  4E3K A;  1XGJ A;  3LI8 A;  3CI6 A;  3PBN A;  4PM9 A;  3B3X A;  4MEZ A;  5L09 A;  1H0M A;  5F1G A;  1FSW A;  1I2W A;  1BSG A;  3DTM A;  2G7U A;  4DE3 A;  1G5U A;  1Y28 A;  2VK3 A;  3PBO A;  2QYB A;  3BY9 A;  4I3I A;  3IHA A;  5CGS A;  1HD8 A;  2W3H A;  3BFC A;  4R3A A;  1FIK A;  3VE3 A;  3R7W A;  2WKI A;  1ESI A;  1PZO A;  4CPK A;  4HY8 A;  4HBU A;  3KX0 X;  5EPH A;  2ZC7 A;  1JWP A;  1S0W A;  4WEL A;  1JVJ A;  4KZ7 A;  3S7P A;  3B47 A;  2ZOI A;  2VV7 A;  4WMC D;  2Y2N A;  4JPM A;  3UB5 P;  4KEN B;  4GDB A;  1CEF A;  2VV8 A;  2Y55 A;  5G4Y A;  1T18 A;  3UY6 A;  1MWR A;  4N92 A;  3UB9 A;  4BBT A;  1ACF A;  4LRZ E;  1FOF A;  3WWX A;  3UB6 A;  1CI8 A;  2WKQ A;  3C4O A;  4BQM A;  3UDF A;  3IF6 B;  3HBR A;  1XJ6 A;  1D7E A;  1BUL A;  3LYX A;  1OTA A;  5EEC A;  2ZC3 B;  4II7 A;  1NYM A;  4DXB A;  5M19 A;  1SDN A;  1YQS A;  4XT2 A;  1S4S A;  4H6J B;  5FAP A;  2OV5 A;  3LEZ A;  4X56 A;  5KZH A;  1L0E A;  3LY4 A;  2W1R A;  2A2L A;  3W4Q A;  4NXB A;  5DFY A;  4S2N A;  2PBD P;  3BEC A;  2ZM8 A;  4R0Q A;  5GLB A;  3GSG A;  5LBR A;  4WBG A;  2WKP A;  5HPI A;  4PM8 A;  2HGV A;  2JKR M;  2O9A A;  1GSW A;  4KG2 A;  5HDD A;  5HFO A;  1YSP A;  1G68 A;  1XKZ A;  4X1L A;  2CMN A;  1ZG4 A;  1K56 D;  1WYB A;  3JVU A;  1BUE A;  2Y2K A;  2B95 A;  1P0Z A;  2DNS A;  2J80 A;  2H0T A;  2V9A A;  5I5L A;  2ZL1 B;  4PM5 A;  4WL9 A;  3PBR A;  5L10 A;  3PR6 A;  4QWO A;  5EV0 A;  1CQA A;  2J3T D;  3DTE A;  3FKV A;  5AVE A;  4EEP A;  5M1A A;  3W4O A;  1FQG A;  3LIF A;  1JTG A;  1XX2 A;  4DXC A;  1KVL A;  3QNC A;  3H7W B;  2WAD A;  5KMW A;  3EEH A;  3NY4 A;  2V1B A;  1DP6 A;  3CWF A;  5FI6 A;  5FSR A;  3IWQ A;  1BLS A;  4LV2 A;  4EV4 A;  1L3L A;  1W8Q A;  2XDM A;  3VP3 A;  2WKH A;  4BJP A;  3DAV A;  1EW0 A;  2W1T B;  4E6W A;  4YOF A;  2BG1 A;  2ZLY A;  4E3J A;  3Q7V A;  4EUV A;  4EES A;  4DMZ A;  4S2N C;  5F6A A;  1VHM A;  3U4L P;  2WZZ A;  3CG5 A;  1BZA A;  1FSY A;  1K6S A;  4O0P A;  1IYS A;  3T1S A;  1L0D A;  2XA7 M;  3A3D A;  4HBT A;  2W3D A;  4KQD A;  3VOL A;  1IYQ A;  4WMC A;  4E3M A;  4EBP A;  2P7J A;  4MBK A;  1SKO B;  1ODV A;  3BJN A;  1QME A;  2Y2L A;  3LUQ A;  1ES4 A;  2XD5 A;  4L9E A;  4OVD A;  4X68 A;  2HPB A;  1PWG A;  4OH0 A;  4N9L A;  3NJA A;  2UWX A;  5IU1 A;  3D9Y A;  4LV3 A;  3EGD C;  5F68 A;  5A93 A;  5TBM B;  3CJM A;  1PRQ A;  1W79 A;  1D06 A;  1F5M A;  5CHM A;  3PBQ A;  3OPR A;  3S7O A;  2HF6 A;  1IEL A;  4HI4 A;  4OOY A;  4MBH A;  3VP2 A;  2WK0 A;  4OKP A;  1STZ A;  3Q07 A;  2O0Y A;  2Q9M A;  3N6I A;  1G6A A;  3SZT A;  4S2L A;  4D2O A;  3PTE A;  1J9M A;  4C3Q A;  3LR4 A;  5TGF A;  3UMD A;  3B42 A;  5G18 A;  3MXQ A;  4HJ4 A;  3KSG A;  4E3L A;  2Y4A A;  4QPR A;  4X69 A;  2PHY A;  4B88 A;  2LB9 A;  1YT4 A;  4FUW A;  4R1G A;  4MMN A;  4DF6 A;  3SOI A;  3MZF A;  3UN7 A;  1YSQ A;  2MJ6 A;  5EM1 A;  1KE0 A;  1Q2Q A;  1IEM A;  5F83 A;  2Q0O A;  5E2H A;  2VLG A;  1N9B A;  5AQB A;  4QD4 A;  3IF5 A;  4Y2F A;  2PD7 A;  4PAU A;  1YM1 A;  3D72 A;  5HAR A;  2R78 A;  4OP8 A;  4P0M A;  4KQO A;  2E8I A;  2VEA A;  2Q9N A;  3RH8 B;  1RCJ A;  3G30 A;  4I38 A;  2WGW B;  3BM6 A;  5IHV A;  3SS4 A;  1GA0 A;  5IS1 A;  3SH7 A;  5AQ7 A;  2DMW A;  3BY8 A;  4JGQ A;  1PI4 A;  4EBL A;  1ES2 A;  1NZU A;  3H9W A;  2B02 A;  4LPZ A;  4Q0H A;  1A0K A;  3G32 A;  3N8R A;  2HJ9 C;  3KSH A;  4KUK A;  4D60 A;  1NJ4 A;  4PM6 A;  3HLE A;  1MWS A;  2OWJ A;  5DJT A;  2VKS A;  3MF0 A;  1TVF A;  5FAT A;  3A3F A;  2ZJ9 A;  5HW3 A;  2XA7 S;  2HP6 A;  4G3K A;  4ETX A;  1F2K A;  3FPV A;  5CX7 A;  3U2A A;  4GD8 A;  1NLY A;  1LSV A;  3E0Y A;  2KLI A;  1S67 L;  4JXV A;  3UE3 A;  1KGF A;  1NWZ A;  4IJG A;  2WGI A;  3G2Y A;  4NXE A;  3JVV A;  1ES3 A;  3T12 B;  4LEN A;  4HJ3 A;  4E04 A;  4WN5 A;  2EX8 A;  3A0S A;  3PBS A;  3LID A;  3T4Q A;  1LI9 A;  2ZMA A;  3TE8 A;  3MXR A;  4QHC A;  3A3J A;  2BLS A;  2Z6D A;  5FQM A;  1XFN A;  3FPW A;  4ARZ B;  4EW7 A;  2P9V B;  2HDR A;  2VJW A;  3B33 A;  4A5R A;  4CLC D;  1M6K A;  5FDS A;  1LSW A;  3ZGA B;  1FR1 A;  4EXO A;  2O9B A;  3ULF A;  2WUQ A;  1T1B A;  1VET B;  2YKH A;  3IT9 A;  4GB7 A;  3O88 A;  3H82 B;  3QP4 A;  5DVA A;  2FH5 A;  2XFS A;  3DTI A;  3ZG9 B;  2DRW A;  5FAS A;  3HJI A;  3IF6 A;  2DCF A;  4GOG A;  4RVA A;  3SH9 A;  3RXW A;  1OTB A;  1HTZ A;  3IWI A;  3MZE A;  2IWD A;  3PAG A;  3RTY A;  3OPH A;  2Y2G A;  4EQI A;  4H6J A;  1TD5 A;  3MQO A;  4KG6 A;  5FQQ A;  2OLU A;  4WLA A;  1S66 L;  4X6T A;  5GL9 A;  4LV0 A;  5KIZ A;  2JC7 A;  5L2F A;  3HLG A;  3CLO A;  5HWT A;  2PU4 A;  2I9V A;  1GCE A;  2I72 A;  3G6O A;  3IX4 A;  5FA7 A;  3Q7Z A;  3HLF A;  1YLP A;  4R4S A;  3ZG5 A;  3GMW A;  3HLD A;  3VP0 A;  2IA2 A;  4ETZ A;  1S1Z A;  3T4L A;  1UWN X;  1XFQ A;  3FYZ A;  4HJ6 A;  1DRM A;  1C3B A;  5HAP A;  4NEE D;  2KX6 A;  4OQI A;  2ACG A;  3KSF A;  3T1Q B;  2JKR I;  1L2S A;  2K7S A;  1JNU A;  3RXX A;  1YMS A;  4WEJ A;  1E25 A;  2P04 A;  5HWV A;  2UV0 E;  3FZC A;  1G6O A;  5FI7 A;  5FEF A;  1ZG6 A;  3KYZ A;  5DF7 A;  1TEM A;  3LCE A;  4MLL A;  5TFQ A;  1MKI A;  4PHT A;  4FD8 A;  3LR3 A;  3H7W A;  5EE8 A;  4ZRR A;  5IT5 A;  4ESP A;  3IS2 B;  2WKR A;  4E3O A;  3IF6 C;  5FQK A;  2VA0 A;  4ZAM A;  1I2S A;  1SZV A;  4X53 A;  5GLD A;  4E3I A;  5U47 A;  5FAQ A;  1JWV A;  2O9C A;  3IBJ A;  4DDS A;  1H8Y A;  3G4P A;  2ZQ7 A;  3L9K A;  4Y5F A;  1N9L A;  3HUM A;  1CEG A;  3W4P A;  3UB8 A;  3MBZ A;  4KUO A;  1LL9 A;  2NUT C;  5J3W A;  4PPR A;  3W8K A;  2NUP C;  3ZYT A;  3LR0 A;  3LY3 A;  1BTL A;  2IWC A;  1L0G A;  1JTD A;  2ZOH A;  4Y3I A;  4EEU A;  2C6W B;  4BD0 A;  1CJF A;  1EI5 A;  3O5Y A;  3GEC A;  3NBL A;  1SKO A;  3IXD A;  4RA7 A;  4FCF A;  4HOI A;  4NG2 A;  3UE0 A;  4G3V A;  2HV1 A;  3PHY A;  4UHU A;  2V1Z A;  4DRT A;  4CLC A;  4IED A;  2W3F A;  1W8Y A;  5DKK A;  5M18 A;  4FOF A;  3HCY A;  4KZ4 A;  3V5M A;  4DN0 A;  1PI5 A;  3MQ0 A;  4I5S A;  3UDX A;  2XRN A;  1FIL A;  5TBM A;  2WZX A;  1K4E A;  2VGJ A;  3VV4 A;  2ZC5 B;  1O7E A;  1IOU A;  3EQU A;  4S2M A;  3E4O A;  1PWD A;  4GNU A;  1PZP A;  1CK3 A;  3ITA A;  5TJJ A;  2QJ7 A;  3MJQ A;  1ZC2 A;  1NRF A;  3G35 A;  3ICY A;  2W3G A;  3VMA A;  4LCL A;  4OPZ A;  5EFW A;  1PWC A;  2B5R A;  5K5B A;  4MNR A;  3V39 A;  3L7H A;  3EWK A;  4GLQ A;  4FSF A;  2ZM0 A;  4GZB A;  4JLF A;  1LLB A;  3HVF A;  1QMF A;  4B4X A;  3VSL A;  4HP9 A;  2V2F F;  1ZHH B;  3VP4 A;  4EWF A;  4U3T A;  1H3Q A;  4KZ6 A;  1KDW A;  3LI9 A;  3WS0 A;  1EWZ A;  3UPN A;  1NLZ A;  3P7N A;  3FG8 A;  1RGZ A;  4CLC C;  2JE5 A;  1GHM A;  2GNX A;  2GZA A;  2EXA A;  4FH2 A;  2OWH A;  3CHW P;  2EX6 A;  3E4Q A;  2V8C A;  4UA9 A;  2WGW A;  4UA7 A;  1ZKJ A;  5HZH A;  4IBR A;  4YNR A;  3VOY A;  1TS0 A;  4GD6 A;  3HJK A;  2KOI A;  4PMA A;  3MFX A;  2FFY A;  3C4P A;  4NXF A;  2QJ5 A;  1N4O A;  2PR6 A;  5AQ9 A;  5KSC A;  3BQ8 A;  1W7F A;  1MZU A;  4XUX A;  1M40 A;  5E2F A;  5F1F A;  2JHE A;  1TS8 A;  3V67 A;  4H8R A;  2EWW A;  3WRZ A;  2FFF B;  4K08 A;  1T1C A;  4HHD A;  4MCW A;  2YKF A;  3M6H A;  3ZVW A;  2XRO A;  2ZQC A;  4LRX C;  4F94 A;  4CJN A;  3AGD A;  1H8M A;  4JGR A;  2QWS A;  1SDE A;  2M7V A;  3Q1F A;  4LGW A;  4S2O A;  4DE2 A;  1OT9 A;  3F1O B;  4OOM A;  2X02 A;  3DW0 A;  3PYP A;  2QKP A;  2R9X A;  4MN5 A;  4I39 A;  2PD8 A;  4I3A A;  1KGG A;  3UB7 A;  4MBF A;  1LL8 A;  5HX9 A;  4KZ9 A;  3Q82 A;  5HDS A;  4QU3 A;  1VEU B;  1ESU A;  4EUZ A;  3DBA A;  3A3E A;  3P09 A;  4QB8 A;  2HP5 A;  1HVB A;  3QP5 A;  1IYO A;  5HAQ A;  1LHY A;  2P9V A;  2XR0 A;  1YLY A;  4PM7 A;  5J7E A;  4BL3 A;  3IH9 A;  4X25 A;  5C5K A;  3IXG A;  1Z6F A;  3C5A A;  4OQG A;  4NET A;  3S1Y A;  4ME4 A;  1BYW A;  1PNE A;  1VET A;  4N1H A;  4WF0 A;  3H82 A;  2EX2 A;  2EFX A;  4L0L A;  3ZCZ A;  3QHY A;  2Y2P A;  2ZC6 B;  1K4F A;  3S4X A;  4BBV A;  2GJ3 A;  3O3V A;  5CER A;  3ZG8 B;  2WGV A;  3O87 A;  1T1A A;  5EVI B;  3FWL A;  1GSX A;  4FH4 A;  4KZ8 A;  3BFD A;  4S2I A;  1MWT A;  2W27 A;  1KOU A;  4JXG A;  5FQJ A;  3G31 A;  1I5Q A;  5L8M A;  2PT7 A;  3M6B A;  1DJA A;  2XQZ A;  1FCO A;  4JF6 A;  5CTN A;  3BWL A;  3R4K A;  4OOL A;  1K6R A;  4QY5 A;  4HP4 A;  5HDC A;  5EVE A;  5FAO A;  4UQI S;  1J3W A;  3NIA A;  3T4K A;  4R6L A;  3VP1 A;  3BFF A;  2ZMV A;  3GVB A;  3ZFZ A;  2JKF A;  4GCZ A;  4RX3 A;  1Y4O A;  2J9O A;  3N8L A;  3D3O A;  5JYO A;  2JN7 A;  1NZO A;  4JBF A;  3VFF A;  2M7U A;  4OQ0 A;  2EA9 A;  4JGO A;  3OCL A;  3Q7V B;  3P01 A;  4O01 A;  3ITB A;  5HL1 A;  3MR0 A;  3V3R A;  1Y54 A;  3MXS A;  4JKT A;  4R70 A;  4YIN A;  4ID4 A;  1K54 A;  1PIO A;  1XJ4 A;  3RJU A;  4NXG A;  1OME A;  1K38 A;  2W0N A;  1RP5 A;  3CPT B;  4K0X A;  3GDI A;  4U0T A;  3LIA A;  2WAE A;  3CMZ A;  4B93 A;  4B4Z A;  4DDY A;  2JKT M;  3SW1 A;  2ZBB A;  2IWB A;  4JXS A;  1XXM A;  4E3N A;  4R23 A;  5HSQ A;  2Y91 A;  2HP9 A;  3WS4 A;  4Z1W A;  1E4D A;  3BLS A;  3GTC A;  1KDS A;  4IUH A;  1LI0 A;  1WE4 A;  1D1J A;  3DWZ A;  3N4I A;  4X1M A;  1P9R A;  1BT5 A;  2ZQ8 A;  2H0Y A;  1YAX A;  4U0X A;  2EFU A;  4KZB A;  1ALQ A;  1W63 Q;  5DFX A;  3IXH A;  4IVK A;  3BFE A;  3QNB A;  2EXB A;  4KZA A;  4Q0I A;  1FR6 A;  1T19 A;  4EQ1 A;  3E2K A;  4E6X A;  3UME A;  4OPY A;  3MS6 A;  4MN7 A;  1KGE A;  4WZ4 A;  3F1P B;  4IUK A;  3QP1 A;  3T4J A;  1BLC A;  3VFH A;  1XA7 A;  5JYP A;  1DY6 A;  4WM9 A;  3MKF A;  1V9Y A;  4Y17 A;  2HDS A;  5AVF A;  2VGL M;  1ZTU A;  2V20 A;  3QP2 A;  3AGF A;  1P97 A;  1TDL A;  4F3L B;  1XA1 A;  2L0W A;  3T4T A;  3O86 A;  1K54 C;  1OPX A;  5DKL A;  2OAQ 1;  5FEG A;  2G2U A;  3ZVT A;  2OSU A;  1WYC A;  4XUZ A;  3GQZ A;  2PDR A;  2V8F A;  1ONG A;  4Y0U A;  1G28 A;  1DP8 A;  4Y0O A;  1IKI A;  5CHJ A;  3UO9 A;  2AVX A;  5GHY A;  2XK1 A;  1XJ2 A;  3RFB A;  1E3U A;  3MSH A;  2E8J A;  4G3W A;  5G4Z A;  3MKE A;  2P08 A;  1F9I A;  4WYY A;  3EGX C;  4UA6 A;  3ZG7 B;  2J3W A;  2L4R A;  5EVI D;  2ZL1 A;  4N1X A;  3M2J A;  2FZ0 A;  1KE3 A;  5I94 A;  4L9G A;  2XFT A;  3G2Z A;  3T1X A;  5AQA A;  1ONH A;  3KO6 A;  4BBU A;  1SKF A;  2WAF A;  1LT0 A;  1ES5 A;  1CI9 A;  3MFD A;  4HQA A;  2D01 A;  5GLA A;  3BRM A;  5HAI A;  2V1A A;  3MQQ A;  2P74 A;  3T4O A;  1XPB A;  5CRF A;  3ZQ5 A;  3CAX A;  3LGO A;  1X0O A;  3PXP A;  4DJ2 A;  2A24 B;  3N8S A;  4KG5 A;  4OON A;  2W1T A;  2LB5 A;  4HH2 A;  3BFG A;  4GHI B;  4GS9 B;  5E2E A;  3QP6 A;  3WS2 A;  2H5S A;  5EM0 A;  2PYR A;  3ZNT A;  4Q0J A;  5J4E A;  4ZBE A;  1FCN A;  2X01 A;  4Q8I A;  2H28 A;  3DTK A;  4N9K A;  4LCM A;  2C5W B;  1H5X A;  4CLC E;  3C8C A;  2VZW A;  2OAP 1;  1NRJ A;  3NEC A;  4UAA A;  3NUL A;  4P6B A;  3WS1 A;  5DTS A;  4NKP A;  3FV7 A;  4LLO B;  2L1M A;  3ISG A;  3P98 A;  2PAV P;  3BEB A;  3K3C A;  2PU2 A;  3OC2 A;  3BLM A;  1ERM A;  3S7N A;  3T50 A;  3WS5 A;  1PW1 A;  3F1O A;  2HDU A;  4PKY G;  3Q81 A;  3E4P A;  2R9W A;  4M3K A;  1Q2P A;  2VGL S;  1O07 A;  4KQR A;  4P6Z M;  5CXW A;  5D3O A;  4IBX A;  3UPP A;  3UNW A;  4IVI A;  3VSK A;  1VEU A;  2Y59 A;  5EVL A;  3N7W A;  2OLV A;  1OTD A;  3GR2 A;  3BYD A;  3NHQ A;  5FQ9 A;  3K3D A;  1ERO A;  3CUE A;  1MXO A;  5CEC A;  2XGN A;  4K91 A;  4UEY A;  2BAS A;  5A90 A;  4RX2 A;  4C75 A;  1OTI A;  1W63 M;  4DJ3 A;  4HEF A;  2G2W A;  4S2K A;  2Z6C A;  3V50 A;  1VM1 A;  3WRT A;  5F69 A;  1IFQ A;  1V9Z A;  1L0F A;  2PBY A;  2QZ6 A;  3F1N B;  3TG9 A;  5DF8 A;  4EET B;  4GN2 A;  4JF5 A;  5EVI A;  2V0W A;  1PW8 A;  2GX5 A;  3LFV A;  4WZ5 A;  1MY8 A;  3M2K A;  4R3J A;  3SS5 A;  3GV9 A;  5CGW A;  2VV6 A;  2XD1 A;  3EOI A;  1KE4 A;  4NK3 A;  1NXY A;  4LV1 A;  3KSI A;  4QJG A;  4UQI M;  2B18 A;  5TR7 A;  2ZC4 B;  4Y13 A;  3BW6 A;  5DTT A;  3UE1 A;  4MN6 A;  2RL3 A;  3IX8 A;  1WA9 A;  5CEB A;  1F98 A;  4ZJ3 A;  2ZQD A;  1MPL A;  4JGP A;  3R7W B;  3OLO A;  4OLG A;  4S2J A;  1K55 A;  3CZD A;  3CUE C;  1CF0 A;  3OZH A;  4ZJ1 A;  4Y0T A;  3E98 A;  1N9N A;  3IXB A;  4DE0 A;  2Z2L B;  3JYI A;  1P9W A;  5A92 A;  1YLT A;  1XGI A;  3CPT A;  3ZNY A;  4WUJ A;  2Y2O A;  3TW8 A;  2XLN A;  2M1C A;  1GSV A;  2ZQ9 A;  1S1Y A;  2A49 A;  3HUO A;  5HL6 A;  2BTF P;  4R3B A;  3IH8 A;  1OJG A;  3S22 A;  4YWZ A;  1S4R A;  4CLC B;  5EVI C;  4DE1 A;  1DJC A;  1IYP A;  1UGU A;  5EOO A;  2JKT I;  4EU0 A;  3K2N A;  4WZ5 C;  5CTM A;  1TDG A;  5CGX A;  3D4F A;  1SHV A;  4GJ4 A;  3UDI A;  3IBR A;  2GDN A;  4XT2 B;  4P6Z S;  2JCH A;  2WKE A;  3BQA A;  3TOI A;  2J7V A;  2Y2M A;  4ARZ A;  2H10 A;  1ERQ A;  4OLD A;  3NOP C;  3A3I A;  5HWW A;  2XSS A;  1DJB A;  3AGE A;  2HJE A;  2X71 A;  3LIC A;  1BLP A;  1TF1 A;  2XEP A;  4KZ5 A;  3F1P A;  1YLW A;  4L9F A;  5CHU A;  4DKI A;  2JBF A;  5EOE A;  4OP5 A;  5FL3 A;  2A3U A;  4EER A;  1MC0 A;  3PAE A;  3NOU C;  5CED A;  3S7Q A;  5DTK A;  3KYE A;  2WYX A;  4C6Y A;  1K55 C;  4IHQ A;  1OT6 A;  3DWK A;  4JF4 A;  4O7D A;  4P87 A;  4P85 A;  4Z9Q A;  1UWP X;  2EWV A;  5E43 A;  5HD5 A;  1BLH A;  4F3L A;  1YLZ A;  3OBF A;  3FC7 A;  1DP9 A;  3A0V A;  4MDZ A;  1N9O A;  3C30 A;  1K56 A;  1PYY A;  3OPL A;  1W5D A;  2PR5 A;  4I3J A;  5GLC A;  4BL2 A;  1GA9 A;  2PRF A;  2OOL A;  5A8B A;  3G34 A;  4EBN A;  2HDQ A;  1E3U D;  2PYP A;  1FCM A;  3LIB A;  3TJZ C;  2KDK A;  2VGK A;  5KSH A;  1GHP A;  3C7V A;  4XXR A;  3JPU A;  3LR5 A;  5AJG A;  1OTE A;  5J8X A;  5F82 A;  3ZHH A;  3LO7 A;  1YLJ A;  1HZO A;  1YPR A;  4BD1 A;  1LL5 A;  2Y2I A;  3E2L A;  2ZD8 A;  4GKU A;  3T4S A;  3ZDJ A;  3LIE A;  4BMW A;  1VQQ A;  3A0R A;  3NOT C;  4YFM A;  5FQI A;  4AFI A;  4R4R A;  4R38 A;  4HIA A;  3SH8 A;  1OJ5 A;  1HLU P;  1U60 A;  5FI2 A;  4WEK A;  3TSG A;  2EX9 A;  4KZ3 A;  3MMH A;  3IS2 A;  4ZDX A;  1GHI A;  4PKY A;  3OOV A;  1RGY A;  3NC8 A;  3OPP A;  1H8Z A;  4QY6 A;  3OCN A;  4KQQ A;  4HH3 A;  1K57 A;  3CIT A;  2J8Y A;  1AXB A;  3ZG0 A;  2INW A;  3W2Z A;  3PBT A;  1NY0 A;  2A24 A;  3T1R A;  4Y15 A;  3GRJ A;  2RCX A;  4GDN A;  5EUA A;  1MKM A;  3NI9 A;  2CC1 A;  4GHI A;  4GS9 A;  5HPF A;  4RYE A;  4ZTK A;  1Z09 A;  1SCW A;  3IHB A;  3HLB A;  2VX8 A;  3HRE A;  2QHK A;  4CQH A;  4ZJ2 A;  2J3T C;  5F5Y A;  3SS3 A;  3TRC A;  3HUN A;  4OPQ A;  3C7U A;  1MBL A;  2XF3 A;  1S6R A;  4O8G A;  4BWI A;  2Y2J A;  4S2P A;  5DJU A;  2Z2M B;  2Y8H A;  3MZD A;  1TS7 A;  1K25 A;  1XP4 A;  2O99 A;  1LSX A;  2HZ5 A;  4HNB A;  3C38 A;  4BLM A;  2Y79 A;  3NDG A;  4RQ9 A;  1PFL A;  3EQV A;  1TS6 A;  3EEA A;  3VE4 A;  2QMI A;  4GW9 A;  1VB6 A;  3HLC A;  1YMX A;  5GHX A;  4X55 A;  3HL9 A;  2QPN A;  2Y2H A;  2ZM2 A;  2ZMF A;  3LEQ A;  5DF9 A;  3UE6 A;  2JKG A;  5MC7 A;  3IQA A;  4HES A;  4BEN A;  3FKW A;  3KYQ A; 
#chains in the Genus database with same CATH homology
 3T50 A;  1TS8 A;  3V67 A;  3F1O A;  4PKY G;  3H9W A;  2EWW A;  3E4P A;  2B02 A;  4K08 A;  1T1C A;  4LPZ A;  4HHD A;  2VGL S;  4MCW A;  2YKF A;  4Q0H A;  1XJ3 A;  2XRO A;  2K31 A;  4LRX C;  4P6Z M;  4B9O A;  1YKD A;  2W3E A;  2HJ9 C;  3KSH A;  4KUK A;  1H8M A;  4JGR A;  2QWS A;  2K2N A;  2M7V A;  5HD3 A;  1OTD A;  2OWJ A;  3NHQ A;  5DJT A;  2D02 A;  2VKS A;  1OT9 A;  3F1O B;  3K3D A;  3MF0 A;  3CUE A;  4OOM A;  2XA7 S;  3PYP A;  2QKP A;  4G3K A;  4ETX A;  4MN5 A;  3F1N A;  3FPV A;  4I39 A;  2PD8 A;  4I3A A;  4M4X A;  2V0U A;  4UEY A;  5CX7 A;  3UB7 A;  3U2A A;  2BAS A;  1LL8 A;  1NLY A;  1OTI A;  1LSV A;  1W63 M;  4DJ3 A;  3E0Y A;  2KLI A;  1S67 L;  5HDS A;  2Z6C A;  3DBA A;  3UE3 A;  4LRY C;  3C2W A;  1NWZ A;  4IJG A;  5F69 A;  5J7E A;  4NXE A;  3JVV A;  1IFQ A;  1V9Z A;  4HJ3 A;  5C5K A;  4E04 A;  3F1N B;  3LI8 A;  4WN5 A;  3A0S A;  3PBS A;  3LID A;  3T4Q A;  4EET B;  3CI6 A;  3PBN A;  3TE8 A;  4ME4 A;  2V0W A;  1BYW A;  4WF0 A;  3H82 A;  2GX5 A;  3LFV A;  4L0L A;  2Z6D A;  2G7U A;  1XFN A;  1Y28 A;  3PBO A;  2QYB A;  3BY9 A;  3FPW A;  4I3I A;  4ARZ B;  4EW7 A;  2VV6 A;  2W3H A;  4R3A A;  3EOI A;  3VE3 A;  2VJW A;  4BBV A;  3R7W A;  3B33 A;  3KSI A;  4CLC D;  4UQI M;  2B18 A;  2GJ3 A;  1LSW A;  4HY8 A;  3KX0 X;  1T1A A;  4EXO A;  3BW6 A;  1GSX A;  4WEL A;  2O9B A;  3ULF A;  1T1B A;  3S7P A;  2YKH A;  4MN6 A;  3H82 B;  2FH5 A;  2W27 A;  3B47 A;  2ZOI A;  1KOU A;  3HJI A;  1WA9 A;  2VV7 A;  1F98 A;  5L8M A;  2PT7 A;  1OTB A;  4JGP A;  3R7W B;  3OLO A;  2VV8 A;  5G4Y A;  1T18 A;  3RTY A;  3UB9 A;  3BWL A;  3R4K A;  3CUE C;  4OOL A;  4BBT A;  3E98 A;  4H6J A;  1TD5 A;  1N9N A;  4HP4 A;  4LRZ E;  5HDC A;  3MQO A;  4WLA A;  4UQI S;  1S66 L;  3T4K A;  4R6L A;  3UB6 A;  2WKQ A;  5KIZ A;  1P9W A;  2ZMV A;  1XJ6 A;  3CLO A;  1D7E A;  4GCZ A;  5HWT A;  3D3O A;  4WUJ A;  2I9V A;  3LYX A;  3G6O A;  2JN7 A;  1OTA A;  3TW8 A;  2M7U A;  4II7 A;  2M1C A;  2EA9 A;  1GSV A;  4JGO A;  3OCL A;  1S1Y A;  4XT2 A;  3P01 A;  4O01 A;  1S4S A;  4H6J B;  5HL6 A;  3MR0 A;  1OJG A;  2IA2 A;  2W1R A;  2A2L A;  1S1Z A;  4YWZ A;  3T4L A;  4ETZ A;  1S4R A;  4NXB A;  4CLC B;  1UWN X;  5DFY A;  1XFQ A;  4R70 A;  4HJ6 A;  1XJ4 A;  4NXG A;  1DRM A;  4NEE D;  2W0N A;  2KX6 A;  3GDI A;  1UGU A;  5LBR A;  2JKT I;  3KSF A;  2WKP A;  5HPI A;  2JKR I;  4EU0 A;  3K2N A;  2HGV A;  3LIA A;  2K7S A;  1JNU A;  4GJ4 A;  4B93 A;  4WEJ A;  3IBR A;  2JKT M;  2P04 A;  2ZBB A;  3SW1 A;  2JKR M;  4P6Z S;  4XT2 B;  2O9A A;  1GSW A;  5HDD A;  3BQA A;  5HWV A;  4ARZ A;  1G6O A;  5HSQ A;  1YSP A;  3NOP C;  5HWW A;  4Z1W A;  2XSS A;  3KYZ A;  2CMN A;  2HJE A;  3LIC A;  1TF1 A;  4PHT A;  4IUH A;  3LR3 A;  3JVU A;  3H7W A;  4ZRR A;  1P9R A;  3F1P A;  5IT5 A;  3IS2 B;  1P0Z A;  4L9F A;  2WKR A;  1YAX A;  2J80 A;  5FL3 A;  2V9A A;  5I5L A;  4WL9 A;  3PBR A;  3PR6 A;  1W63 Q;  5DFX A;  1MC0 A;  2VA0 A;  4EER A;  2J3T D;  3NOU C;  5AVE A;  3S7Q A;  4EEP A;  4Q0I A;  3LIF A;  1T19 A;  4EQ1 A;  4IHQ A;  1OT6 A;  3UME A;  2O9C A;  3IBJ A;  1UWP X;  2JHE A;  2EWV A;  3H7W B;  4MN7 A;  3F1P B;  5HD5 A;  4IUK A;  3EEH A;  2V1B A;  1DP6 A;  3CWF A;  4Y5F A;  3T4J A;  4F3L A;  1N9L A;  3OBF A;  3FC7 A;  3UB8 A;  1DP9 A;  3A0V A;  4MDZ A;  4KUO A;  1N9O A;  2NUT C;  5J3W A;  3C30 A;  1V9Y A;  2NUP C;  3ZYT A;  3LR0 A;  4BJP A;  2PR5 A;  4I3J A;  5AVF A;  1EW0 A;  2OOL A;  2ZOH A;  4Y3I A;  4EEU A;  5A8B A;  2W1T B;  2VGL M;  2PYP A;  1ZTU A;  3LIB A;  3TJZ C;  4YOF A;  2KDK A;  3O5Y A;  3GEC A;  4EUV A;  5KSH A;  4EES A;  1P97 A;  4DMZ A;  3LR5 A;  4F3L B;  4HOI A;  2L0W A;  3T4T A;  5AJG A;  5F6A A;  1OTE A;  4G3V A;  1VHM A;  5DKL A;  1OPX A;  2HV1 A;  3PHY A;  4CLC A;  2W3F A;  2OAQ 1;  4O0P A;  5DKK A;  4FOF A;  3HCY A;  2XA7 M;  4DN0 A;  2PDR A;  2W3D A;  3MQ0 A;  4I5S A;  2XRN A;  4KQD A;  3T4S A;  3VOL A;  5TBM A;  1G28 A;  3LIE A;  1DP8 A;  4BMW A;  2P7J A;  1ODV A;  3BJN A;  3A0R A;  3VV4 A;  3LUQ A;  3NOT C;  1XJ2 A;  4AFI A;  3RFB A;  4L9E A;  4R38 A;  4HIA A;  4G3W A;  1IOU A;  1OJ5 A;  3EQU A;  5G4Z A;  4WEK A;  3E4O A;  3NJA A;  2P08 A;  5IU1 A;  5TJJ A;  3MMH A;  3EGD C;  5F68 A;  2QJ7 A;  1F9I A;  3EGX C;  3IS2 A;  3MJQ A;  4PKY A;  3OOV A;  2J3W A;  3ICY A;  2W3G A;  5TBM B;  2L4R A;  3OCN A;  2FZ0 A;  4HH3 A;  3CIT A;  1D06 A;  1F5M A;  4L9G A;  5EFW A;  3PBQ A;  2INW A;  3S7O A;  3W2Z A;  2HF6 A;  5K5B A;  3PBT A;  4HI4 A;  2A24 A;  3KO6 A;  4BBU A;  1LT0 A;  1STZ A;  3EWK A;  2O0Y A;  4GLQ A;  4FSF A;  1MKM A;  4GHI A;  4HQA A;  4GS9 A;  2D01 A;  5HPF A;  2V1A A;  3MQQ A;  4HP9 A;  1ZHH B;  2VX8 A;  3T4O A;  3LR4 A;  2QHK A;  4CQH A;  3UMD A;  1H3Q A;  3B42 A;  3ZQ5 A;  3CAX A;  3MXQ A;  1X0O A;  4HJ4 A;  3PXP A;  3KSG A;  4DJ2 A;  2A24 B;  2W1T A;  2J3T C;  3LI9 A;  5F5Y A;  2LB5 A;  4HH2 A;  3TRC A;  4QPR A;  1NLZ A;  3P7N A;  2PHY A;  2LB9 A;  3FG8 A;  4GHI B;  4MMN A;  4CLC C;  4GS9 B;  4O8G A;  1YSQ A;  4BWI A;  2GNX A;  2GZA A;  2MJ6 A;  2OWH A;  3E4Q A;  2PYR A;  2VLG A;  5HZH A;  4YNR A;  4Q0J A;  1TS0 A;  5DJU A;  3HJK A;  2KOI A;  5J4E A;  3MFX A;  2Y8H A;  4Y2F A;  1TS7 A;  2PD7 A;  4NXF A;  2O99 A;  4PAU A;  3D72 A;  1LSX A;  4HNB A;  2QJ5 A;  2H28 A;  3C38 A;  2R78 A;  4KQO A;  2PR6 A;  2Y79 A;  4CLC E;  4RQ9 A;  3C8C A;  2VZW A;  2OAP 1;  3EQV A;  2VEA A;  1NRJ A;  1TS6 A;  3EEA A;  3RH8 B;  3VE4 A;  4GW9 A;  4NKP A;  1VB6 A;  4LLO B;  2L1M A;  3BQ8 A;  4I38 A;  1MZU A;  2ZMF A;  5DF9 A;  5IS1 A;  3UE6 A;  2DMW A;  3K3C A;  5MC7 A;  3BY8 A;  3OC2 A;  4JGQ A;  3S7N A;  3KYQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...