2Z6KC

Crystal structure of full-length human rpa14/32 heterodimer
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
117
structure length
117
Chain Sequence
VDMMDLPRSRINAGMLAQFIDKPVCFVGRLEKIHPTGKMFILSDGEGKNGTIELMEPLDEEISGIVEVVGRVTAKATILCTSYVQFKEDSHPFDLGLYNEAVKIIHDFPQFYPLGIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Full-length Human RPA14/32 Complex Gives Insights into the Mechanism of DNA Binding and Complex Formation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Replication
molecule keywords Replication protein A 32 kDa subunit
total genus 22
structure length 117
sequence length 117
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF08661 Rep_fac-A_3 Replication factor A protein 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2z6kC00
2MO1A 1XNRL 1SMXA 1VQLA 2IX1A 1VQGA 2VQEQ 1Q46A 1UE7A 3I56A 1GKHA 2CWPA 3CW2C 3E9IA 3RLNA 1C7YA 1IBLQ 2UUBL 3S2HH 5C4XH 4DV5Q 1FGUA 2UUCL 4DV4Q 2HIVA 3S1NH 1E24A 2B63H 2F4VQ 3I4NG 4DUZQ 3NENA 1J5EL 5FLMH 3KLWA 1QVGA 1X54A 3AYHB 5IYCG 5BR8L 3PUZA 2JA6G 2K5NA 5J3BA 4DK6C 4LNQA 2JA5H 2Q2HA 2Q2IA 4HIMA 1HNWL 4A3KH 2R92H 2XTIA 1IXRA 1UE5A 2NZHA 4FDBA 4POFA 3CC7A 2B3GA 2UXDL 4Y7NH 3RLOA 1FL0A 3CCUA 2IHFA 4B3TQ 5M3MH 3K81C 4HJ7A 2NZOA 4L5TA 5LMUQ 4DR1Q 3HKSA 2NVQH 3PO3H 3EN2A 2UXCL 1DGSA 3FKIH 4R4IA 3I7FA 1N34L 3GTGH 1Y1VG 2VNUD 3W1BA 4DR3L 4JI0L 1IBML 2D0PA 1MJEA 1U0LA 1YIJA 5GAHC 2OCEA 1GO3E 3PCOB 3L2PA 1PYSB 1VQCA 1K73C 1K0RA 2EIFA 3ER0A 4X62Q 2WFWA 5JEAG 2WB1E 3G4SA 4DV3Q 3KFUA 3PO2G 3RZDH 1XNRQ 3OW2A 5ELNA 2N8NA 3RLFA 2HQLA 2I5LX 1VCIA 1CKNB 3UDGA 2KCMA 5GROA 3I2ZA 5GADC 2PQAA 2D62A 4JC0A 3G6EA 3L7ZC 4DV4L 2UUCQ 3HOZH 4A3DH 4JI8L 4YCVA 1N36Q 1E1TA 1G291 2KHJA 2NN6I 4H02A 1VQMA 2IX0A 2HIXA 3GD7A 1K8GA 1YITA 1XTDA 3KJPA 4R4TA 4LFAL 2A19A 1GM5A 4DR7L 1FJGL 1EIYB 3ICEA 2OWOA 1KRSA 3HOUH 4NXML 2NN6G 1VQDA 1O7IA 3LGJA 4LF5Q 2UXBQ 2RF4A 4KI0A 1KAWA 4IJLA 4A4IA 3CMAA 4DV7Q 3T1YL 4DR6L 1N32Q 5JJLA 1EIFA 1KD1C 4JI3Q 4L5RC 4A3FG 4A75A 2YYZA 5ELOA 3TRZA 1Y1WG 4KHPQ 2R93H 2Z6KC 3S17H 4TVAB 4DV1Q 3KJOA 3EBEA 1M90C 4IFDI 1VQBA 3GO5A 4AQYL 4B3ML 3ULPA 3HOWH 4DR4Q 3GTLH 1KL9A 4BBRG 5IT9c 2IHEA 2K75A 4PZ6A 5IE8A 4BXXG 4B3SL 1PYBA 3KF8B 3UDFA 3JAMc 3RN5A 4P74A 5HY6A 3H3VH 1E22A 1Q8KA 3STBC 3NBHB 2IT1A 2Y0SE 3M4PA 5E7NA 4A76A 4GNXB 1SLJA 3CQZH 3KF6B 3J81c 4JI6Q 2AMCB 4NB3A 4JOIA 3S16H 3E0EA 2CWAA 2QEXA 4A3MH 4BY7H 1CSQA 3M9BA 2Q2UA 4BBSG 1XMQL 3J80c 4IPCA 4DAMA 1EQRA 4JI1L 3AFPA 3U4ZA 4IOAA 1J6QA 3EIVA 1XMOL 1XNQL 2WAQE 4DV2Q 1TWGH 2JEAI 2MFIA 4X6AH 2N3SA 1ASYA 4A3LG 2BA1A 4C3HH 4DNIA 5C0XG 5C4XG 1KHIA 3T1HL 1NMFA 2JQOA 3TEHB 3M4OH 1LUZA 3CMEA 3DM3A 3PGZA 1VQHA 2VS1A 5M5YH 3J80i 4LF7L 2BH8A 5FLMG 3PIPA 2CKZB 2Y0SG 1JMCA 3HOXH 3HOYG 5IYCH 1K9MC 3D31A 3RR5A 4DV1L 4POGA 1Y14B 2K52A 4LFBL 3VDYA 4A3KG 5IY0A 1IZ6A 4YHHL 2R92G 3HKZE 3RN2A 1YEZA 2YTVA 3I4MH 3BZCA 3G71A 1JJ2A 4A3EH 3S2DH 1IYJB 1YHAA 4P71A 3G48A 1TWCH 1CUKA 2CFMA 2LXJA 3PO3G 4OX9Q 1NE3A 2FXQA 1VQFA 2BH2A 2PI2E 1Q1BA 4B3TL 4JI2Q 1GD7A 3FKIG 4X64Q 2ZM6Q 3K7UC 3IRBA 5GQOA 1HZ9A 4R4CA 1K83H 2L15A 1QZHA 4A3BH 4JI0Q 4RG1A 4C3IH 2JJQA 1IBMQ 4A3JH 1PH1A 4LF4Q 2JA7G 2VUMH 1A63A 4GLVB 5DLQE 3GTOH 4MNOA 1W2BA 1SFOH 3CCSA 4A3CH 2Q2TA 4JCVE 4Y52H 4HIKA 4B3RQ 3PO2H 3CCEA 4YCWA 4C2MH 1H95A 3UDXA 3RZOH 1IL2A 2PI2A 4HJAA 1EYGA 2QGQA 2K50A 1NY4A 1HZBA 3E9HA 1TWFH 3ULJA 4X65L 3CCJA 2K5HA 5IWAL 1VQ9A 2DUDA 4QL5A 1I50H 2WAQG 3CF5A 2F4VL 2CQOA 3S1MH 3NEMA 1SRUA 2OQ0A 4XTCS 4MZ9A 1NMGA 4DR5L 2UUAQ 3HFZB 3CAMA 1HNXL 4IPHA 1VQJA 3J7ZC 4PG3A 4RMFA 4YHHQ 5LMNL 1X9NA 2JA8H 2ZJQA 3OTOL 1BBUA 3PUWA 4DR7Q 2UXDQ 3GTKH 3MEFA 3U58A 4OXPA 1CSPA 1B70B 4JI7Q 1OXSC 2KCTA 4QQBX 1I94L 1FVIA 1TWAH 1AE3A 1D8LA 2JEBI 1P16A 1YNXA 1L1OB 4DR3Q 2KHIA 1JJCB 2F52A 2OTJA 2F3IA 3HOWG 2ZTEA 1GVPA 2NVXH 4L5QA 1PH2A 2R7FA 1NBWA 4LF4L 1UEBA 4IFDJ 4J15A 4BXXH 2KBNA 4DR2L 2QA4A 1VQ4A 5FJ8G 1E1OA 5C44H 4NXNQ 1HJPA 4LF6L 4B3SQ 4NPSA 3H15A 1KQSA 1LTLA 4KHZA 4YCUA 4IJHA 4QGUA 2E2IH 2HHHL 4JYAQ 1HNZL 1WCMG 3KDFA 1JE5A 3PF4A 4A3MG 4BY7G 5JJKA 4DV6L 3K7AH 5IWAQ 4JI8Q 1N36L 1N33L 1YZ6A 2VQFL 2B29A 2I5HA 3K80C 1QVFA 1Q12A 4DR5Q 1JB7A 4LFAQ 1X56A 2VQEL 3TQYA 5C0XJ 2ZJRA 1VQPA 2PMZE 5IP9G 1N9WA 1EFWA 1IBLL 3KYHC 1PA6A 2JA9A 3I4OA 4A3LH 4YWMA 1YHBA 3AFQA 3H3VI 4IO9A 1HZAA 5AJ3Q 4DR6Q 1N32L 4YWKA 1YJNA 1VQ5A 3PV0A 4LUVA 4JI3L 2ZTCA 5BR8Q 4UP9A 4LUOA 1XJVA 4R1JA 4BY1H 1BKBA 4UPAA 4AYBG 3HOXG 3HOYH 4GKKQ 4KHPL 4UP7A 1Z9FA 1L1OA 2VZAA 3TS2A 2ATWA 1X3FA 3A74A 4DK3C 5M3FH 4AQYQ 3K8AA 4JBWA 3CC2A 1HR0W 1VQNA 3I4MG 2KENA 4DR1L 1A0IA 4A3EG 1AE2A 4DR2Q 1S72A 1AH9A 3D0FA 4X66Q 1KIXA 1Q1EA 4GLXA 3W1GA 1A62A 1E7ZA 1V1QA 4K0KQ 2AWNA 2R7ZG 4JYAL 3UDIA 1SE8A 3S24A 1Q82C 4DKAC 1PH6A 4DV6Q 4A3BG 2RCNA 2JA7H 1WYDA 2PNHA 4GOPA 4A3JG 2VUMG 1VQAA 1B8AA 1EWIA 2MO0A 3SGIA 5IYDH 3CCMA 3S14H 4A3CG 4BA1I 4O2DA 4DV0L 2GN5A 4BA2I 1YJ9A 4GNXA 3GTPH 2LSSA 4B3RL 4LF8Q 1WFQA 5IYBG 3H0GG 1OXUA 2A8VA 3CCLA 4A3IH 3CCQA 2ALYB 3FP9A 5AJ3L 3CC4A 1P8LA 3L0OA 3PUYA 1ASZA 4JI4L 4LF7Q 2AWOA 1UE6A 5GAGC 3GTMH 3F2DA 5LMNW 1QZGA 1W3SA 1FJGQ 4LW1A 3W5OA 3JC66 1WOCA 3I55A 3M85A 2E2JH 2JA8G 4UY8C 5EAYA 1KRTA 5HGQA 4GN5A 1UWVA 4OWXB 4IPDA 4A3GG 2K14A 4LFCQ 2ASBA 2GVBA 4GNXC 1VQOA 1PV4A 4PZ7A 5JEAJ 1X3GA 1E3PA 2GVAA 1L0WA 4DV7L 4OX9L 4DAYB 4JI7L 3NELA 4LF9Q 2K5VA 4JI2L 2AKWB 1X65A 1K8AC 1OXTA 4B3MQ 1WI5A 4DUYL 1PVOA 2JK8A 4GLAC 2IY5B 1JT8A 1SROA 1YHQA 3UE1A 4JBKA 4DR4L 1RIPA 4JI5L 1LM0A 3HOVH 1MKHA 5FJ8H 3M7NA 5C44G 1S40A 3OYYA 1YJWA 5LMUL 2UXCQ 3U50C 4LF8L 1N34Q 3TS0A 2HT1A 1QUQB 4P72A 3F2CA 1C0AA 4GS3A 2I0QA 2VY3A 1A8VA 1WCMH 5C3EG 2Z0SA 2VW9A 2D0OA 3GDEA 1XPRA 2HHHQ 3F1ZA 5IP7H 4A93G 5JJIA 1HNZQ 3AQQA 3K0XA 1M1KC 4QY7A 3CPWA 2E5LL 4WJ3M 3S1QH 1PH9A 5K36G 2R6GA 3DLLA 1V43A 3S1RH 4GN3B 4XIGS 1XMQQ 2E8GA 4HJ8A 2OTLA 4JOIC 1OXXK 3PUXA 3CP0A 2AHOB 2RHQB 2XGTA 3M4QA 2MNAA 3GTJH 1VQIA 5IP9H 2VQFQ 1HNXQ 3OTOQ 1CKMA 1SR3A 5C4JH 3Q8DA 3STBD 4DV2L 1XMOQ 4LFCL 3A0JA 3PIOA 4DUZL 4EQ5A 3F8TA 4IPGA 4YY3Q 3J81j 4EX5A 1I94Q 4GOPC 4OWWB 2B63G 3T1HQ 4BY1G 3AEVA 1B7YB 1CKOA 3I4NH 3MXNB 3PSIA 2EXDA 3BZKA 4ALPA 1XPOA 2JA6H 2JA5G 3BU2A 3ZJYC 4GKKL 5M3FG 4DUYQ 3UE0A 2Z6KA 1IBKL 2WP8J 3PF5A 1HR0Q 1I5FA 1MJCA 1S3OA 1U5KA 3FHWA 1KXLA 4TQUS 1Q7YC 1NTGA 2V1CC 4PMWA 5M3MG 3J7A5 1UE1A 4HJ5A 4LF6Q 2VL6A 4C3JH 1PHJA 2NVYH 1G6PA 4X66L 5C0XI 4IFDG 2WB1G 4YWLA 1VQ8A 2RHSB 2LXKA 2CCZA 1Y1VH 1X3EA 3ULLA 2R7ZH 1L1OC 1X55A 1G51A 1QVCA 4QIWE 4K0KL 4LUZA 1HH2P 4GKJQ 1K3RA 1N33Q 4GN4B 2K4KA 5M5WH 1VQKA 2A1AA 1PFSA 5IYDG 1N8RC 4OWTB 1VQ6A 2YTYA 1D7QA 1QUQA 1SN8A 1PH7A 2C35B 3BJUA 1Q81C 4JBMA 4IOCA 4JV5L 5IYBH 4X65Q 3H0GH 4HJ9A 1KC8C 4P73A 2UU9L 1MIUA 1X6OA 4A3IG 4JI6L 1C9OA 1TXYA 1V9PA 1XPUA 4WJ4A 4YY3L 1L2FA 2ZJPA 1PH8A 4A3DG 3HOZG 1OTCA 3TREA 1EOVA 4LWCA 2UUAL 1Q86C 4AH6A 4JI1Q 5LMNQ 1CKNA 2I5MX 1OXVA 4NXMQ 2YU9H 1BBWA 4LF5L 2UXBL 2YTXA 1IBKQ 3T1YQ 3KF6A 2ZTDA 4R4OA 1HR0L 3HOUG 2ID0A 1NJIC 1I6HH 3PUVA 3F2BA 3CCVA 2UUBQ 3GTQH 4A3GH 4ME3A 4DV5L 4JG2A 4UP8A 3ERSX 4KLKA 1PH4A 1I3QH 4L5SA 3CXCA 1RL2A 3HKZG 4A3FH 1J5EQ 2NVTH 1R9TH 4OONA 1Y1WH 4QJFA 1YBYA 2R93G 3JAMi 1EUJA 4LF9L 3CD6A 1LYLA 2DGYA 4LFBQ 4O0AA 1VQ7A 1T9HA 1HNWQ 1VQEA 4MTNA 4P75A 4GKJL 2ES2A 2N78A 3CCRA 4OO1G 4BBRH 3B6YA 4NXNL 1VS0A 5M5XH 4HIOA 3S15H 1HZCA 3A5ZB 3HOVG 2PQAB 1Z47A 2EQSA 2H5XA 4DV0Q 4JI5Q 2E2HH 2YV5A 4DPGA 4AYBE 4PZ8A 1YI2A 1TWHH 3KOJA 4OO1I 5H1SE 1EQQA 4R4QA 4X64L 2ZM6L 2MQHA 4JV5Q 2UU9Q 1WJJA 4HIDA 2JE6I 1YVCA 5C3EH 5GAEC 3U4VA 4A93H 4JI4Q 5IP7G 4JBJA 5FLXc 3J81i 3A5UA 3M3YH 4BBSH 4AIMA 3CPFA 4GOPB 3KDFB 3RNUA 1BVSA 2R7DA 1PH3A 3WWVA 1PH5A 2N49A 4X62L 4DV3L 4APVA 1XNQQ 2E5LQ 1JJGA 2OQKA 2BA0A
chains in the Genus database with same CATH superfamily
1PFNA 2KVMA 2MO1A 1SMXA 1VQLA 2IX1A 4RH6A 1EY0A 2VQEQ 5J39A 4BWGB 4DV5Q 1TVXA 2F4VQ 1ESRA 1EYAA 3J80L 3KLWA 2A5HA 1QVGA 5IYCG 3PUZA 2JYOA 2K5NA 3C46A 2Q2HA 4HIMA 1HNWL 2F0IA 2E76C 2IW3A 3H94A 1DZ1A 1IXRA 2NZHA 4POFA 1Q8IA 3QR8A 3RLOA 1FL0A 2HDLA 3PO3H 1PTOB 4L5TA 3SK4A 2CVRA 1SYEA 1DGSA 1K3BC 3GTGH 1SE2A 3HOZB 3FPUB 5E1FA 1FD7D 4KKSA 2OCEA 3PCOB 3L2PA 2Z4IA 3DHQA 2PCFB 3ER0A 2WFWA 4RA8A 1EY9A 2HCCA 3U9SA 3OW2A 2X6LA 1C4QA 2HQLA 3LNNA 2WKCA 2KCMA 2MJ8A 3I2ZA 2D62A 3G6EA 4DV4L 1RCVD 1SSOA 3V2TA 3P1HA 4F87A 4PNYA 1EIYB 3HOUH 1TS2A 1SYCA 2NN6G 1O7IA 1W6JA 4KI0A 4DV7Q 1N32Q 4JI3Q 2EOTA 4P2CB 3BS1A 5COYA 5ELOA 1Y1WG 3S1QB 1Z7TA 1JICA 2DJFC 1BOSA 1Q90A 1MI2A 3GO5A 4B3ML 3HKZB 1ZXTA 4OIKA 3GTLH 4BXXG 3KF8B 3JAMc 3OOCA 2F0SA 1Q8KA 3STBC 2KA7A 3BVMA 4A76A 1HUNA 3MTSA 2XN9C 3CQZH 1GJXA 5IGCA 3J81c 2X69A 3E0EA 5EPJA 4XQNA 2Q2UA 3S1NB 3AFPA 2HCIA 1XMOL 2WAQE 1TWGH 2N3SA 2Z9HA 5CGKA 2RSOA 4ZYSA 1T5XD 4C3HH 4DNTB 4DNIA 5C0XG 5C4XG 1PZID 2RDFA 1NMFA 3TEHB 3D6WA 1QILA 1X3QA 5M5YH 1SYGA 3S15B 1PRTC 5C4HA 1JOOA 1QE6A 4DV1L 4LFBL 2R92G 5IY0A 3RN2A 2OXPA 1UUPA 1YEZA 2X6GA 3QJYA 4NKLA 3G48A 1TWCH 2CFMA 1NE3A 2FXQA 4B3TL 4JI2Q 1I4XA 1D5XC 2ZM6Q 3K7UC 1TR5A 3SK6A 5IT9L 1HZ9A 3HG9A 4R4CA 3VR4A 4KKTA 4RG1A 4LF4Q 1A63A 2NWGA 1Y1VB 2A69C 3I70A 3HEJA 1E2WA 1NAPA 3LWEA 3CCEA 4YCWA 3K59A 3GV3A 1LTBD 1IL2A 3V96A 2PI2A 4ID6A 2ZXPA 3J80E 4ZUIA 3HOVB 2OT2A 1DD2A 2RBMA 4QL5A 3CF5A 2F4VL 4CJ1B 3K5LA 3NP8A 4DR5L 2UUAQ 4IPHA 1VQJA 4PG3A 4YHHQ 2I07B 1BBUA 2O4XA 3K0YA 2I46A 3GTKH 3MEFA 5CORA 4OXPA 2CH4A 4G4KA 3M3YB 2FMMA 1OXSC 1I94L 1YNXA 3VYRA 4RFBA 2JP1A 1B3AA 1JJCB 2F52A 5ELDA 2OTJA 2F3IA 2ZTEA 2R7FA 1UEBA 4DR2L 1E1OA 3FDTA 2EJFC 4CGYB 3EQLC 3K7AB 4KHZA 4YCUA 4IJHA 1B9MA 1S5DD 1HNZL 3KDFA 4BY7G 3K7AH 5IWAQ 1LABA 1ILPA 4DXGA 5IGEA 4FXGC 3RUZA 1Q12A 1JB7A 2VQEL 3TQYA 4UDUC 1PFMA 5C0XJ 2F0QA 5C44B 1VQPA 2F03A 1IBLL 3AFQA 1CFMA 1N32L 5AJ3Q 1HA5A 3OIPA 1YJNA 1VQ5A 4UP9A 4LUOA 1CQVA 4AYBG 4GKKQ 1TS3A 1SNCA 3KBGA 1L1OA 1C48A 4N8FA 1GUTA 3DEPA 4KV6A 5JPMC 1GXDC 2FFKB 3JAML 3KK7A 4C3JG 4KN7C 1ENCA 1EFID 1V1QA 4G57A 1JORA 1MD2D 3S24A 1PH6A 5L37A 1CZWA 2N88A 1EIGA 4A3BG 5M3FB 2JA7H 2K5QA 1EWIA 3SGIA 1JWMD 3CCMA 4A3CG 2RVLA 4DV0L 2L12A 4FF2A 2B8GA 1U4MA 3H0GG 3CCQA 2RA4A 3Q0AA 4LF7Q 3N6RA 2WB1B 2Y0SB 5I4DA 1A2UA 1BCPD 2F0UA 4Y7NB 1ET9A 3TZDA 3M85A 2B2YA 1UWVA 1HFGA 1XX8A 4IPDA 2B2UA 2GVBA 4GNXC 1VQOA 1E0BA 1LLRD 4PZ7A 1X3GA 1WCMB 3P20A 5M5YB 3ERQA 4LF9Q 2AUKA 1MHWC 4JI2L 3MA2B 3N52A 4N9TA 4IUQA 2AKWB 1X65A 4B3MQ 5C4ZA 1WI5A 4ME5A 4YIJA 5IOCA 1HXYD 4RHSA 1VF7A 4K5WA 1MKHA 2QF7A 2B2UC 3RMHA 3OYYA 1YJWA 2JSOA 4G7HC 4LF8L 1N34Q 2D9UA 3ONAB 1VDZA 2VY3A 1A8VA 2EDGA 1MBYA 4MIUA 5IP7H 1HNZQ 3K0XA 5K36G 4FYDA 1G91A 4LK1C 1KNEA 4HJ8A 1XWEA 1SNOA 1QNUA 3GTLB 4RGTA 3OTOQ 5C4JH 3PO2B 4DV2L 3NTKA 4LFCL 3FEWX 1RODA 4YY3Q 4R9WA 3BDCA 2B63G 4WJWA 2OF1A 4BY1G 1XPOA 3BYYB 2F0TA 1STNA 1BF4A 3A8KE 4IQZA 1B4OA 2K5WA 5CYUA 1S3OA 3OMCA 4TQUS 1WTHA 2LMCB 1NTGA 2V1CC 2XNAC 5M3MG 2VL6A 5C0XI 2G5DA 1LV9A 4CDCC 1X3EA 2R7ZH 1HTLD 2PZWA 1HH2P 3DMUA 4LUZA 1N33Q 5CMDA 2XIWA 1WTRA 1VQKA 1PFSA 1N8RC 5JEAH 1D7QA 2OEOA 1PH7A 4A3BB 1PZKD 1SYBA 3SE0A 1F2LA 4JV5L 1KC8C 4JI6L 1K8OA 4A3IG 2B2WA 2EJMA 1D1KA 1L2FA 4CKBA 3HOZG 4FVMA 2XWJB 4LWCA 1DM0B 2K05A 4IN3A 4JI1Q 2I5MX 4NXMQ 1BBWA 4DA2A 2UXBL 1IBKQ 3T1YQ 4A3FB 2ID0A 1I6HH 3F2BA 3I4MB 4A3GH 4DV5L 1KDAA 4QF4A 1SMYC 1PH4A 2A73B 5KNCA 3HKZG 1EWHA 1HUMA 3JAMi 1EUJA 2B8FA 3OSOA 3CD6A 2KQ3A 1B1ZA 1HNWQ 1B9NA 4GKJL 4I7AA 3D8GA 2Z6BA 4BBRH 3B6YA 4NXNL 4DAPA 1EY4A 4KD3A 1HZCA 3HOVG 2PQAB 4MTKA 2EQSA 2H5XA 4ZRZA 1AZQA 1OO9B 4OO1I 3DXJC 5H1SE 4X64L 4GZYC 2EYFA 1YVCA 5C3EH 1RJTA 2WACA 3FKIB 3IKJA 3W2DA 3FPPA 1A2TA 3CPFA 3MEHA 1QCBD 3KDFB 2R7DA 5TSSA 1SBBB 2F4IA 1Y1WB 2Z4HA 2BA0A 2JXMB 4IALA 1VQGA 1PTOC 3I72A 1GKHA 1K28A 2EXZA 2ZT9C 3RLNA 2UUBL 3I90A 4OHJA 4DV4Q 5C3WA 3S1NH 4H0LC 2QKIC 3I4NG 2FHTA 2C9OA 1EZ6A 3NENA 4XYQA 3EVQA 5BR8L 5J3BA 4LNQA 2JA5H 2HDMA 1G6ZA 3F2UA 1UE5A 4FDBA 4Q5VA 5EGTA 2B3GA 4RGNA 2MGSA 2K7VA 4C56C 1A3VA 2IHFA 3ZYYX 2NVQH 3K81C 3S2HB 4L63B 2XSCA 4HCEA 2UXCL 4IFDH 2Z8LA 1FR3A 4Z9CB 3FKIH 3HZXA 1ICFB 5KRUA 1N34L 5CV4A 2JN4A 3W1BA 1MJEA 3EA6A 2FJ2A 4KKUA 4ZQ3A 1YIJA 5GAHC 4CDEC 1GO3E 3A7AB 1HCZA 3HOWB 2WB1E 1QJOA 1WD1A 3G7LA 3PO2G 1XNRQ 1NR4A 5ELNA 5CV6A 2B2TA 2N8NA 3RLFA 1D1IA 1A3UA 1CKNB 5GROA 4IURA 5GADC 2PQAA 3KF8A 1N36Q 3TP5A 4H02A 2IX0A 2DNCA 1K8GA 1EY5A 4R4TA 4LFAL 4DK1A 2PYKA 4DR7L 1DOMA 1FJGL 3ICEA 2OWOA 1KRSA 1VQDA 5A35A 4DAYA 2UXBQ 4C3HB 3T1YL 4A4IA 3NQIA 4DR6L 4X3UA 3R2IA 4K5XA 4QB4A 4L5RC 4A3FG 2YYZA 1ONLA 2R93H 1BQQT 1EYCA 4TVAB 4DV1Q 2F0OA 1I4RA 1NCVA 4OO1H 5I6YA 1X32A 3NWTA 1MSHA 2ZXRA 5IT9c 5IE8A 1CHQD 4IUPA 3UDFA 2KCNA 1GUGA 5AFWA 4G7OC 1B50A 1E22A 4GNXB 1SLJA 2R7ZB 1E2ZA 2DY8A 1DXMA 2CWAA 3L3OC 2QEXA 4A3MH 4RWSC 5EJWA 4A3DB 4BBSG 3W3AA 4DAMA 1EQRA 3U4ZA 1JOQA 5G3LD 3EIVA 2E2DC 3C1EA 4DV2Q 2KHSA 2MFIA 1ASYA 4A3LG 2RCFA 4HCSA 2EZVA 1D5ZC 2O5JC 3T1HL 3M4OH 2JQOA 1LUZA 3CMEA 3DM3A 3E0JA 2VS1A 3BVZA 3NUCA 1DOKA 1V1PA 2BH8A 5NUCA 4K6LA 2F0VA 2Y0SG 1XTCD 5IYCH 3D6CA 4J6HA 3KLSX 3X3NA 4YHHL 3HKZE 1PFBA 3I4MH 3K5OA 3SR1A 4A3EH 1JJ2A 3S2DH 3VR5A 4P71A 2F0DA 3D3RA 3E5SA 2LXJA 3PO3G 4OX9Q 4A3GB 3EROA 4U673 1A3TA 1YNJC 3HOUB 4KMUC 1XXGA 4J1MA 1R4PB 4C3IH 1IBMQ 4A3JH 4MNOA 1SFOH 5E3FA 2Q2TA 4C2MH 3VA7A 3UDXA 1CHPD 5I2XA 2EE1A 1EYGA 3I4NB 4KY6A 2QGQA 1HZBA 3CCJA 5I9OA 2NVYB 3WOFA 5IWAL 2DUDA 4CJ0B 1I50H 2WAQG 1VQ9A 3S1MH 5ELCA 5I9PA 2EY2A 2OQ0A 1AZPA 1UNSA 3BZDB 1HNXL 3MZ5A 1X9NA 5LMNL 5I2YA 3S2DB 2NN6H 3PUWA 3U58A 1CSPA 1B70B 1DYQA 4JI7Q 4QQBX 1FVIA 1TWAH 4ZKBB 1QB5D 1P16A 1EU3A 2KUMA 1G2TA 4DR3Q 2KHIA 1MSGA 4FF3A 1GVPA 4L5QA 3MFGA 5IGGA 4LF4L 4BXXH 4ODGA 1IKLA 1UEAB 4B3SQ 3H15A 1PRTD 1ZYRC 1R4QB 2E2IH 2C5CA 5JJKA 4DV6L 1QG7A 4M1UB 1TWHB 1WTXA 1QVFA 4S3SA 4DR5Q 4LFAQ 1X56A 3R93A 5IP9G 3GTPB 1N9WA 1EFWA 1PA6A 5ISRA 5FO7B 3MWYW 4PMCA 4C3HG 3H3VI 1HZAA 4EQNA 3GTOB 4RKBA 3RD4A 2IWHA 4LUVA 4XYOA 1YNND 4KN4C 4A3IB 4R1JA 1II3A 1BKBA 4UPAA 1O78A 4RKLA 2A74C 1Z9FA 2ATWA 1G2SA 2KEEA 1JQYD 3CC2A 1HR0W 3VR6A 1IHZA 2KENA 4DR1L 2QEJC 4DR2Q 5FLXE 1AW7A 2N55A 4KD4A 3TP7A 4DF7A 4K0KQ 2AWNA 4X3SA 4WRDA 2L55A 1Q82C 2B63B 1WYDA 4KJNA 3AB9A 2JA5B 4BA1I 3J7AF 4O2DA 1O80A 4BA2I 5JPNC 4L8JA 1YJ9A 4GNXA 3GTPH 1WFQA 1EY8A 1EEID 1ESFA 2A6HC 3CCLA 2ALYB 3FP9A 3CRKC 1ASZA 4JI4L 1F9RA 1PTOF 5GAGC 3GV6A 2R3ZA 3F2DA 1QZGA 1TKWB 1CZGA 2G9DA 5G3LF 4NMZA 1KRTA 4GN5A 1S4ZA 2FINB 4EQOA 1WTWA 4OWXB 4ZUJA 4LFCQ 5A2QL 3S14B 1LACA 4DV7L 1LTTD 2QDLA 4DAYB 2LKVA 1DOLA 1AEXA 2NYZD 4JI7L 1SJHD 2AQ2B 3H6MA 2K5VA 4CHTB 1K8AC 2WKDA 5IIFA 2ICEC 3NSWA 3DUZA 2JK8A 2IY5B 2IPKD 1SROA 1BNZA 1ZKOA 1RIPA 5JVG3 1LM0A 4KK7A 3M7NA 3DWPA 5IODA 5LMUL 3U50C 3J7AV 3NWSA 4HSPA 4JPBW 2RDHA 2B39A 2Z0SA 2VW9A 2D0OA 3DM1A 3GDEA 4KY7A 3F1ZA 1XPRA 4FF1A 4A93G 5JJIA 3ND8A 4QY7A 1HFNA 2R6GA 5EKLA 1V43A 3DLLA 4G7ZC 1XMQQ 2E8GA 3C1FA 1OXXK 1O7ZA 3M4QA 4QUCA 2MNAA 2K01A 2MHVA 4ZK9B 1CKMA 1SR3A 3BG3A 4EQ5A 1SEBD 2K33A 3O13A 3OWEB 5KIXA 4OWWB 3AEVA 1H9SB 2JA6H 3BZKA 1CM9A 4C3IB 3UI2A 1BCPF 1IBKL 4MHEA 1I5FA 1V1PB 2B2TC 1MJCA 3D4WA 1Q7YC 3TDQA 4HJ5A 4LF6Q 4C3JH 2F0FA 2L5TA 2M00A 4XQJA 1G6PA 1U4PA 1HTPA 1Y1VH 2NTSA 1SXTA 2ICIA 2K4KA 5M5WH 5JAVA 2A1AA 1VQ6A 4FF4A 1WTQA 1QUQA 3QG1A 4IOCA 3H0GH 4HJ9A 4EGVA 1MIUA 4WJ4A 1TQOA 4YY3L 2ZJPA 4A3DG 1RKNA 1OTCA 2SNMA 1WTOA 3KLSA 1Q86C 4AH6A 3TMEA 4R8NA 5LMNQ 4B9WA 1CKNA 2YU9H 1BUVT 4A3MB 2E2HB 2PZUA 3TBIB 3PUVA 2UUBQ 4B08A 4ME3A 2F1MA 5FK9C 5FOBB 1CTMA 3VA5A 1I4QA 4L5SA 1BO0A 4WFN3 1EY6A 1TT2A 3RZDB 1LYLA 4LFBQ 4O0AA 2R92B 2BE5D 1VQEA 4A3JB 3S15H 3A5ZB 1Z47A 4IUVA 2LS01 1LO5D 2E2HH 2L0CA 3HRZC 2L9HA 2YV5A 1QOHA 2DY7A 1TWHH 3KOJA 1EQQA 1D5MC 1KLUD 3R2TA 1KDCA 4JI4Q 3DEOA 5IP7G 1H9SA 3A5UA 4LMQD 4AIMA 5K36H 5EQ0A 3WWVA 1PH5A 4X62L 1XNQQ 2FMCA 4APVA 2JA8B 4ZCKA 3TRZA 4CJ2C 2K32A 1XNRL 1F2YA 1EYDA 2K28A 1Q46A 2NTTA 4ILWA 2CWPA 3E9IA 4BBRB 5M3MB 1IBLQ 2VUMB 3TN2A 1FGUA 5K5PA 2HIVA 4HMJA 1E24A 1YNJD 2RKSA 2B63H 1J5EL 5T1IA 5FLMH 1AFPA 2F3WA 3AYHB 4DK6C 1KABA 2Q2IA 1U4LA 4A3KH 1TWFB 2UXDL 4Y7NH 4B3TQ 5M3MH 1NNXA 5LMUQ 3HKSA 4L6TB 3I7FA 2D0PA 1W6KA 3ITPA 1U0LA 3A56A 3KUPA 1PYSB 1VQCA 1K73C 4FXKC 1K0RA 2EIFA 3OW7A 3G4SA 4DV3Q 3K6OA 5JEAG 2F0NA 1SE4A 3RZDH 4OIJA 3PO3B 1VCIA 1STBA 2UUCQ 4X3TA 1PRTF 2PZTA 3HOZH 4JI8L 5IGBA 1E1TA 2KHJA 2VXWA 4H44C 1D2BA 2HIXA 1YITA 1VMPA 1XTDA 3KJPA 4OEMB 4IUNA 1IW7D 2CH4W 3S1RB 2EYMA 3LGJA 4F8MA 4LF5Q 2RF4A 2A68C 5IGFA 4IJLA 3CMAA 2PMZB 4K8IA 2PNRC 5JJLA 1KD1C 4RAUC 3S16B 2PW5A 4B9XA 4A75A 4KHPQ 2Z6KC 3MXUA 2EYLA 3KJOA 3EBEA 1M90C 4IFDI 2BE5C 2K04A 5DAUA 5C5LA 4AQYL 3ULPA 3HOWH 4DR4Q 2WAQB 1KL9A 4BBRG 2VB2X 5CV8A 1UAPA 5ELBA 1JR0D 4N9PA 3RN5A 1GUWA 2SOBA 1JWSD 2D2CC 2K6AA 2P5ZX 2IT1A 3NBHB 2Y0SE 5ELEA 2PQEA 3M4PA 4K14A 5E7NA 4V190 1PZJD 1F77A 3KF6B 2AMCB 4NB3A 3S16H 1CSQA 3M9BA 1XMQL 3J80c 4DNRB 2BOSA 2EYJA 1Y8OB 3DWQA 4HR7B 2DN8A 4CDFC 3I73A 1JOKA 4IOAA 3BVGA 1J6QA 4C2MB 1XNQL 2JEAI 4HTHA 3WDNA 2BA1A 2EY5A 3OIQA 1KHIA 1H9JA 4I7ZC 2PO4A 1VQHA 4LF7L 2H1EA 5M5XB 4J8QA 4HSVA 3HOYG 3HOXH 5CV5A 1K9MC 1LT4D 4ABNA 4POGA 2K52A 5EBCA 3VDYA 2KCCA 1IZ6A 3HP3A 2EPBA 2J0TD 3BZCA 1SMYD 1U9RA 5C3XA 1IYJB 1ET6A 1YHAA 3T16A 5I6WA 3MXPA 3G6JB 2PI2E 1Q1BA 3PMFA 3FKIG 2QILA 1S5ED 2L15A 2G9HD 1O7LA 1QZHA 3E6ZX 3TP6A 2JJQA 3D4RA 2A68D 2VUMH 4GLVB 5DLQE 3GTOH 1LTRD 5KNBA 3CCSA 5KNDA 2NBFA 4JCVE 5KYLA 5C4JB 3PO2H 3IL8A 3DWAA 1H95A 3RZOH 2XRQD 1T5EA 1Z6HA 4HJAA 3MXGA 4C1NI 4RGOS 1NY4A 3H3VH 4X65L 1EZ8A 4C3JB 1SRUA 4XTCS 4MZ9A 2NUCA 3Q6SA 1NMGA 3HFZB 4PV1C 4RMFA 1NUCA 4UHVA 2JA8H 4LJZC 2ZJQA 3OTOL 2UXDQ 1ENFA 3C3LA 4DGZA 4JW0A 2D5DA 2IX3A 1AE3A 1HA6A 3T53B 1JCKB 2BCOA 2B2VC 2BDNA 3AU7A 1QNKA 1HPCA 4M8AA 2NVXH 1LT6D 1IW7C 4QUFA 4IFDJ 4J15A 2KBNA 2F0PA 1VQ4A 5FJ8G 5C44H 4NXNQ 2DNEA 1HJPA 3NHHA 5CBEE 3RZOB 2HD3A 2HHHL 2A6ED 1CK1A 1WCMG 3PF4A 3K57A 3QWNA 1CQFA 4A3MG 4F88A 5IT9E 4JI8Q 1I50B 1N33L 4QMGA 3MFYA 4K2KA 1EWCA 1L0YB 1IKMA 1YZ6A 2F0HA 3QOLA 1B53A 3VR2A 1WTPA 2YU9B 2NVXB 5KEEA 2H4OA 3J7YW 3I4OA 4A3LH 3KBXA 1O7YA 1YHBA 3GTQB 4FO2A 1HHVA 5M5WB 2E74C 3PV0A 2JA7B 4JI3L 2ZTCA 2EYPA 4KHPL 3K58A 2NZ1D 1KDBA 4KHVA 2VZAA 3H09A 4KY5A 4ZLTF 1X3FA 3A74A 5M3FH 4AQYQ 3MC0B 4JBWA 3MAQA 3EJIA 1MGSA 3I4MG 1A0IA 4A3EG 2E2JB 1S72A 1AH9A 2EVBA 3D0FA 5LHY1 4HAEA 1KIXA 2F0EA 1EEFD 1PLFA 4GLXA 1A62A 4OELB 2F3VA 1F2ZA 1CI3M 4JYAL 2Q8RE 3UDIA 1SE8A 5DEHA 3D4DA 4DV6Q 2RCNA 4C3IG 3ND9A 4GOPA 4A3JG 1SYFA 1TS5A 2MO0A 5IYDH 1I6VC 2GN5A 2QW7A 1RHPA 3SEBA 2LSSA 3MHBA 2JA6B 1SDFA 5IYBG 3EFXD 1OXUA 1EQVA 1P8LA 3L0OA 3M7GA 2ENBA 1UE6A 4V0BA 5LMNW 4R8IA 1W3SA 1A6XA 4LW1A 3W5OA 3H0GB 3V05A 4K5VA 1M4VA 4UY8C 1WVLA 5EAYA 5HGQA 2K14A 4K6DA 5JEAJ 1E3PA 1L0WA 3NELA 3K5MA 1FNUA 4TRDA 5J1ZA 1F9QA 1OXTA 1S5CD 3GQBA 5D65A 5EPKA 5JOBA 4GLAC 3UE1A 5HGTA 1E2VA 3NTHA 1S40A 1JE4A 2UXCQ 1ML0D 3JAME 5JJZA 1S5FD 2HT1A 3TS0A 3F2CA 4TSSA 2I0QA 2HHHQ 3C2PA 3AQQA 3TP8A 1M1KC 2E5LL 4WJ3M 1PH9A 4GN3B 1KLGD 4XIGS 3A8JE 4JOIC 2OTLA 3PUXA 2AHOB 3CP0A 1SJED 2RHQB 3GTJH 1VQIA 5IP9H 3PQIA 2L1BA 1TU2B 3Q8DA 3STBD 5A2QE 2LY7A 3PIOA 4DUZL 3F8TA 5EPLA 3VYSA 4EX5A 1I94Q 1LTAD 1IL8A 3T1HQ 1CKOA 3MXNB 1CA6A 1Y8PB 4DFAA 3BU2A 4GKKL 2QDBA 4DUYQ 5ELFA 2WP8J 4H7BA 5CV7A 5C6AA 2K1BA 3A54A 3VR3A 3J81L 1U5KA 4DAVA 1KXLA 3HS0C 3NE5B 1EOTA 3T56B 2NVYH 4F7XA 2WB1G 4YWLA 1SNMA 1KTKA 2J4XA 3I3CA 4JVZA 2CCZA 1L1OC 1X55A 1G51A 1QVCA 4QIWE 1KNAA 4XT1B 1K3RA 4HEDA 4GN4B 3VYTA 2TMPA 4OWTB 4OGQC 1NR2A 2WV6D 1SN8A 1TWCB 1TWGB 2C35B 1Q81C 5DNFA 4X65Q 2UU9L 1C9OA 1TXYA 4E6IA 5IGDA 3TREA 3CHBD 2UUAL 1K83B 1OXVA 1WD0A 2MP1A 2R93B 2YTXA 5F2DA 3HOUG 4R4OA 1HR0L 1S5BD 3CCVA 3GTQH 1H9KA 2R61A 3ERSX 4KLKA 1SAPA 1XYIA 1J5EQ 4XXEA 1Y1WH 4QJFA 1YBYA 4LF9L 4A3KB 1LT3D 2K5DA 2N78A 1SNDA 3CCRA 4HIOA 2E75C 5JVH3 1Q3LA 5E4XA 2AUJD 4DV0Q 2HQEA 2KJXA 4AYBE 1YI2A 3IAYA 3QOJA 4R4QA 2Z1CA 1WJJA 2JE6I 2F0LA 3U4VA 2IJ0A 4A93H 2EYOA 4JBJA 5FLXc 1PH3A 4GOPB 5D3IB 2MPMA 4QIWB 2N49A 4DV3L 1EIHA 1EL0A 2E5LQ 1JC7A 1JJGA 3SK8A 3FVQA 1UE7A 3I56A 3CW2C 1C7YA 1BBXC 3S2HH 2NVQB 5C4XH 1ICWA 5C0XH 2EY1A 2UUCL 5LL6X 4DUZQ 1X54A 1ZYRD 4RCOA 2JA6G 4K8JA 1FYCA 4JK1C 2R92H 2XTIA 1B3QA 2RDGA 4FNFA 2Q8IB 3CC7A 3FMCA 3CCUA 3QIAA 2KOLA 4DR1Q 4HJ7A 2NZOA 3EN2A 3GTMB 1PRTB 2TSSA 1K0SA 4A93B 4R4IA 1Y1VG 2VNUD 1STHA 2CHBD 4DR3L 4JI0L 1IBML 1STAA 1STGA 1I4GA 1TWAB 3GTGB 2RQXA 4X62Q 2B2WC 3KFUA 1B2TA 3CKIB 4CBVA 2I5LX 1PTOD 3NTIA 3UDGA 1I4HA 4JC0A 3L7ZC 4A3DH 4KTAA 4YCVA 1G291 2L11A 2NN6I 1VQMA 3E3XA 1BCPB 3GD7A 2J7ZA 2A19A 1GM5A 1IYVA 1HQMC 4NXML 1KAWA 2F0JA 3NPPA 1EQTA 1EIFA 5KGUA 3OPOA 4CDDC 2Q8TA 1A15A 1EY7A 1GUSA 4DN4M 3S17H 1VQBA 1FGBD 2IHEA 2K75A 4PZ6A 3S17B 4B3SL 1PYBA 1V8QA 1R9TB 4P74A 3I8ZA 4A3EB 5HY6A 5BN4A 1GOZA 1GUNA 1RDPD 1YNNC 4JI6Q 4JOIA 1JB3A 4BY7H 1NSNS 5D14A 1F9SA 5E4WC 4IPCA 2EYHA 1F9PA 4JI1L 1EU4A 3GP7A 1I3QB 3T13A 4XT3B 4X6AH 4HMIA 2SEBD 1FNVA 3J81E 2F0MA 1F2MA 2RSNA 2A6EC 1HRJA 3PGZA 4ZKCB 3J80i 3SDZA 5FLMG 3PIPA 2CKZB 1JMCA 1J9OA 2PPBC 3D31A 3RR5A 1Y14B 3TSSA 3LX0A 4Q0FA 4O1NA 3BDOA 4A3KG 1TIID 3MXNA 2F0KA 3GTJB 2YTVA 3G71A 4N8X1 1CUKA 3SXHA 3Q23A 1BR9A 1VQFA 4I65A 2BH2A 2XWBB 2EY6A 1GD7A 1AP0A 4X64Q 1HQRD 2M2LA 3IRBA 5GQOA 1TS4A 1K83H 1AN8A 2BDOA 5HURA 4A3BH 2CQAA 3L9AX 3K5NA 3U9OA 4JI0Q 2JA7G 1PH1A 1GHKA 4C1NK 3OWFA 1W2BA 3X3MA 4A3CH 4Y52H 1CT1D 4HIKA 4B3RQ 3NQTA 3KLRA 2KECA 4QCLA 1RD9D 2M9VA 2K50A 2XVSA 3E9HA 1TWFH 3ULJA 2K5HA 2V4DA 4WORA 4K2LA 2CQOA 5C3EB 3NEMA 1BXTA 1FNWA 1PTOH 1SNPA 1QWYA 3CAMA 5EBDA 4X3KA 1M8AA 5FO9B 4IUTA 3J7ZC 4RGMA 1RF2D 3T4AC 4DR7Q 1G8ZD 2KCTA 1D8LA 1D6EC 2JEBI 4LAAA 1L1OB 3VYUA 3PIP3 4PQXA 3HOWG 1PH2A 1NBWA 5KYIA 1L0XB 2QA4A 1I6HB 4RHRA 2HUGA 3GTKB 4LF6L 1B44D 4NPSA 1KQSA 1LTLA 3MVVA 4DXFA 4QGUA 2SDFA 4JYAQ 1Y8NB 4EQPA 1JE5A 3A7LA 2AQ1B 5BN5A 1N36L 4O42A 5FKAC 4NP5A 2VQFL 2B29A 2I5HA 3K80C 3I91A 5FO8B 4KJOA 3OHXC 4DK0A 3NBHA 2ZJRA 4UAIA 1X3PA 2PMZE 5T1GA 3KYHC 2JA9A 4FP5D 4YWMA 4IO9A 1GUOA 3Q22A 4DR6Q 4YWKA 2O5IC 3A55A 1H9RA 5BR8Q 1XJVA 4BY1H 5BN3A 3HOYH 3HOXG 4UP7A 5M9OA 3TS2A 4IZ8A 4DK3C 3AMUA 3K8AA 1TY0A 4HN7A 1VQNA 1AE2A 3P75A 4X66Q 1Q1EA 3W1GA 1E7ZA 1SE3A 4XQQA 3FRPB 3CU7A 3H3VC 4PMBA 2R7ZG 2CW0C 4DKAC 4BY1B 2PNHA 2VUMG 1VQAA 4ZAIA 1B8AA 4EVOA 5D3DA 3S14H 5C5MA 3WOEA 1J8IA 4B3RL 3QB3A 1SYDA 3PIO3 4LF8Q 2A8VA 3I4LA 4A3IH 5C4XB 5AJ3L 3CC4A 3PUYA 3T51B 5DM63 2AWOA 3Q24A 4NDXA 3GTMH 3HOYB 1FJGQ 1STYA 3R3OA 3JC66 1WOCA 3BDLA 3I55A 2JA8G 2E2JH 4RCNA 2F0GA 4XDXA 3TZUA 4A3GG 3NK9A 2ASBA 1IYUA 1PV4A 2GVAA 2A6HD 4OX9L 4NW2A 3M4OB 1VMCA 1PYWD 1RTOA 3H91A 4DUYL 1PVOA 2CW0D 1JT8A 1YHQA 4JBKA 4FXDA 4DR4L 4JI5L 4BS9A 3HOVH 5FJ8H 5C44G 1KAAA 1DJRD 2B2YC 1K8MA 5FLXL 1VF5C 1QUQB 2GA4B 4P72A 1C8CA 3SHLA 3R8BA 4GS3A 4IUUA 5C3EG 5CR3A 1WCMH 1C0AA 5LL6S 2ZXOA 3CPWA 3S1QH 3S1RH 2F0WA 1I4PA 1Y69U 3A8IE 2VQFQ 2XGTA 1HNXQ 1PDQA 1XMOQ 3HGBA 4H13C 3A0JA 3BYTB 1PMRA 2LFNA 4IPGA 3J81j 1ZEQX 4GOPC 3I4NH 2VB3X 1B7YB 5CV9A 2A69D 1GHJA 3PSIA 2EXDA 4ALPA 2JA5G 1WTVA 1LTGD 3ZJYC 1CA5A 5M3FG 3UE0A 2Z6KA 3CRLC 3PF5A 1HR0Q 1SFOB 1ENAA 3M4YA 1JWUD 3FHWA 4DU9A 3J7A5 4PMWA 2AQ3B 1UE1A 2L4NA 3CQZB 1PHJA 2NB0A 4X66L 5J22A 4IFDG 2QCPX 1VQ8A 2RHSB 1DCZA 2LXKA 3ULLA 4ULLA 2XRSD 1V1OA 4K0KL 4GKJQ 3IFDA 4OL7A 5IYDG 2SNSA 4MN3A 2YTYA 1STEA 1ILQA 3LWUA 1LT5D 3OMGA 3BJUA 4JBMA 1U4RA 5IYBH 4P73A 1BDOA 1XPUA 1X6OA 1V9PA 1DONA 1PH8A 3URYA 1EOVA 4BBSB 2WIIB 5DM73 4AYBB 3HOXB 3QO2A 3IFTA 4LF5L 2WINB 3KF6A 2ZTDA 4BY7B 3NBIA 1NJIC 2K03A 5EKIA 2MUYA 5CBAE 4JG2A 4UP8A 1RTNA 1I3QH 3CXCA 1RL2A 4A3FH 2NVTH 5CC4A 3S1MB 1TY2A 1R9TH 4OONA 2R93G 2DGYA 1VQ7A 1T9HA 4U68A 2B2VA 4MTNA 4P75A 3SVMA 1SNQA 2ES2A 2NVTB 4CKCA 1BCPC 4OO1G 2EJGC 1VS0A 5M5XH 1LTSD 2E2IB 3P7JA 4CKEA 4JI5Q 1PXUA 4DPGA 2O2LD 2PW7A 4PZ8A 4JV5Q 2ZM6L 1H9MA 1LTID 2MQHA 2UU9Q 4HIDA 3S9WA 5GAEC 2DJGC 3SK5A 3M3YH 3J81i 4BBSH 5EKKA 3RNUA 1BVSA 2IL8A 4TKOB 2KEDA 3NXWA 2OQKA
chains in the Genus database with same CATH topology
2MO1A 1XNRL 1SMXA 1VQLA 2IX1A 1VQGA 2VQEQ 1Q46A 1UE7A 3I56A 1GKHA 2CWPA 3CW2C 3E9IA 3RLNA 1C7YA 1IBLQ 2UUBL 3S2HH 5C4XH 4DV5Q 1FGUA 2UUCL 4DV4Q 2HIVA 3S1NH 1E24A 2B63H 2F4VQ 3I4NG 4DUZQ 3NENA 1J5EL 5FLMH 3KLWA 1QVGA 1X54A 3AYHB 5IYCG 5BR8L 3PUZA 2JA6G 2K5NA 5J3BA 4DK6C 4LNQA 2JA5H 2Q2HA 2Q2IA 4HIMA 1HNWL 4A3KH 2R92H 2XTIA 1IXRA 1UE5A 2NZHA 4FDBA 4POFA 3CC7A 2B3GA 2UXDL 4Y7NH 3RLOA 1FL0A 3CCUA 2IHFA 4B3TQ 5M3MH 3K81C 4HJ7A 2NZOA 4L5TA 5LMUQ 4DR1Q 3HKSA 2NVQH 3PO3H 3EN2A 2UXCL 1DGSA 3FKIH 4R4IA 3I7FA 1N34L 3GTGH 1Y1VG 2VNUD 3W1BA 4DR3L 4JI0L 1IBML 2D0PA 1MJEA 1U0LA 1YIJA 5GAHC 2OCEA 1GO3E 3PCOB 3L2PA 1PYSB 1VQCA 1K73C 1K0RA 2EIFA 3ER0A 4X62Q 2WFWA 5JEAG 2WB1E 3G4SA 4DV3Q 3KFUA 3PO2G 3RZDH 1XNRQ 3OW2A 5ELNA 2N8NA 3RLFA 2HQLA 2I5LX 1VCIA 1CKNB 3UDGA 2KCMA 5GROA 3I2ZA 5GADC 2PQAA 2D62A 4JC0A 3G6EA 3L7ZC 4DV4L 2UUCQ 3HOZH 4A3DH 4JI8L 4YCVA 1N36Q 1E1TA 1G291 2KHJA 2NN6I 4H02A 1VQMA 2IX0A 2HIXA 3GD7A 1K8GA 1YITA 1XTDA 3KJPA 4R4TA 4LFAL 2A19A 1GM5A 4DR7L 1FJGL 1EIYB 3ICEA 2OWOA 1KRSA 3HOUH 4NXML 2NN6G 1VQDA 1O7IA 3LGJA 4LF5Q 2UXBQ 2RF4A 4KI0A 1KAWA 4IJLA 4A4IA 3CMAA 4DV7Q 3T1YL 4DR6L 1N32Q 5JJLA 1EIFA 1KD1C 4JI3Q 4L5RC 4A3FG 4A75A 2YYZA 5ELOA 3TRZA 1Y1WG 4KHPQ 2R93H 2Z6KC 3S17H 4TVAB 4DV1Q 3KJOA 3EBEA 1M90C 4IFDI 1VQBA 3GO5A 4AQYL 4B3ML 3ULPA 3HOWH 4DR4Q 3GTLH 1KL9A 4BBRG 5IT9c 2IHEA 2K75A 4PZ6A 5IE8A 4BXXG 4B3SL 1PYBA 3KF8B 3UDFA 3JAMc 3RN5A 4P74A 5HY6A 3H3VH 1E22A 1Q8KA 3STBC 3NBHB 2IT1A 2Y0SE 3M4PA 5E7NA 4A76A 4GNXB 1SLJA 3CQZH 3KF6B 3J81c 4JI6Q 2AMCB 4NB3A 4JOIA 3S16H 3E0EA 2CWAA 2QEXA 4A3MH 4BY7H 1CSQA 3M9BA 2Q2UA 4BBSG 1XMQL 3J80c 4IPCA 4DAMA 1EQRA 4JI1L 3AFPA 3U4ZA 4IOAA 1J6QA 3EIVA 1XMOL 1XNQL 2WAQE 4DV2Q 1TWGH 2JEAI 2MFIA 4X6AH 2N3SA 1ASYA 4A3LG 2BA1A 4C3HH 4DNIA 5C0XG 5C4XG 1KHIA 3T1HL 1NMFA 2JQOA 3TEHB 3M4OH 1LUZA 3CMEA 3DM3A 3PGZA 1VQHA 2VS1A 5M5YH 3J80i 4LF7L 2BH8A 5FLMG 3PIPA 2CKZB 2Y0SG 1JMCA 3HOXH 3HOYG 5IYCH 1K9MC 3D31A 3RR5A 4DV1L 4POGA 1Y14B 2K52A 4LFBL 3VDYA 4A3KG 5IY0A 1IZ6A 4YHHL 2R92G 3HKZE 3RN2A 1YEZA 2YTVA 3I4MH 3BZCA 3G71A 1JJ2A 4A3EH 3S2DH 1IYJB 1YHAA 4P71A 3G48A 1TWCH 1CUKA 2CFMA 2LXJA 3PO3G 4OX9Q 1NE3A 2FXQA 1VQFA 2BH2A 2PI2E 1Q1BA 4B3TL 4JI2Q 1GD7A 3FKIG 4X64Q 2ZM6Q 3K7UC 3IRBA 5GQOA 1HZ9A 4R4CA 1K83H 2L15A 1QZHA 4A3BH 4JI0Q 4RG1A 4C3IH 2JJQA 1IBMQ 4A3JH 1PH1A 4LF4Q 2JA7G 2VUMH 1A63A 4GLVB 5DLQE 3GTOH 4MNOA 1W2BA 1SFOH 3CCSA 4A3CH 2Q2TA 4JCVE 4Y52H 4HIKA 4B3RQ 3PO2H 3CCEA 4YCWA 4C2MH 1H95A 3UDXA 3RZOH 1IL2A 2PI2A 4HJAA 1EYGA 2QGQA 2K50A 1NY4A 1HZBA 3E9HA 1TWFH 3ULJA 4X65L 3CCJA 2K5HA 5IWAL 1VQ9A 2DUDA 4QL5A 1I50H 2WAQG 3CF5A 2F4VL 2CQOA 3S1MH 3NEMA 1SRUA 2OQ0A 4XTCS 4MZ9A 1NMGA 4DR5L 2UUAQ 3HFZB 3CAMA 1HNXL 4IPHA 1VQJA 3J7ZC 4PG3A 4RMFA 4YHHQ 5LMNL 1X9NA 2JA8H 2ZJQA 3OTOL 1BBUA 3PUWA 4DR7Q 2UXDQ 3GTKH 3MEFA 3U58A 4OXPA 1CSPA 1B70B 4JI7Q 1OXSC 2KCTA 4QQBX 1I94L 1FVIA 1TWAH 1AE3A 1D8LA 2JEBI 1P16A 1YNXA 1L1OB 4DR3Q 2KHIA 1JJCB 2F52A 2OTJA 2F3IA 3HOWG 2ZTEA 1GVPA 2NVXH 4L5QA 1PH2A 2R7FA 1NBWA 4LF4L 1UEBA 4IFDJ 4J15A 4BXXH 2KBNA 4DR2L 2QA4A 1VQ4A 5FJ8G 1E1OA 5C44H 4NXNQ 1HJPA 4LF6L 4B3SQ 4NPSA 3H15A 1KQSA 1LTLA 4KHZA 4YCUA 4IJHA 4QGUA 2E2IH 2HHHL 4JYAQ 1HNZL 1WCMG 3KDFA 1JE5A 3PF4A 4A3MG 4BY7G 5JJKA 4DV6L 3K7AH 5IWAQ 4JI8Q 1N36L 1N33L 1YZ6A 2VQFL 2B29A 2I5HA 3K80C 1QVFA 1Q12A 4DR5Q 1JB7A 4LFAQ 1X56A 2VQEL 3TQYA 5C0XJ 2ZJRA 1VQPA 2PMZE 5IP9G 1N9WA 1EFWA 1IBLL 3KYHC 1PA6A 2JA9A 3I4OA 4A3LH 4YWMA 1YHBA 3AFQA 3H3VI 4IO9A 1HZAA 5AJ3Q 4DR6Q 1N32L 4YWKA 1YJNA 1VQ5A 3PV0A 4LUVA 4JI3L 2ZTCA 5BR8Q 4UP9A 4LUOA 1XJVA 4R1JA 4BY1H 1BKBA 4UPAA 4AYBG 3HOXG 3HOYH 4GKKQ 4KHPL 4UP7A 1Z9FA 1L1OA 2VZAA 3TS2A 2ATWA 1X3FA 3A74A 4DK3C 5M3FH 4AQYQ 3K8AA 4JBWA 3CC2A 1HR0W 1VQNA 3I4MG 2KENA 4DR1L 1A0IA 4A3EG 1AE2A 4DR2Q 1S72A 1AH9A 3D0FA 4X66Q 1KIXA 1Q1EA 4GLXA 3W1GA 1A62A 1E7ZA 1V1QA 4K0KQ 2AWNA 2R7ZG 4JYAL 3UDIA 1SE8A 3S24A 1Q82C 4DKAC 1PH6A 4DV6Q 4A3BG 2RCNA 2JA7H 1WYDA 2PNHA 4GOPA 4A3JG 2VUMG 1VQAA 1B8AA 1EWIA 2MO0A 3SGIA 5IYDH 3CCMA 3S14H 4A3CG 4BA1I 4O2DA 4DV0L 2GN5A 4BA2I 1YJ9A 4GNXA 3GTPH 2LSSA 4B3RL 4LF8Q 1WFQA 5IYBG 3H0GG 1OXUA 2A8VA 3CCLA 4A3IH 3CCQA 2ALYB 3FP9A 5AJ3L 3CC4A 1P8LA 3L0OA 3PUYA 1ASZA 4JI4L 4LF7Q 2AWOA 1UE6A 5GAGC 3GTMH 3F2DA 5LMNW 1QZGA 1W3SA 1FJGQ 4LW1A 3W5OA 3JC66 1WOCA 3I55A 3M85A 2E2JH 2JA8G 4UY8C 5EAYA 1KRTA 5HGQA 4GN5A 1UWVA 4OWXB 4IPDA 4A3GG 2K14A 4LFCQ 2ASBA 2GVBA 4GNXC 1VQOA 1PV4A 4PZ7A 5JEAJ 1X3GA 1E3PA 2GVAA 1L0WA 4DV7L 4OX9L 4DAYB 4JI7L 3NELA 4LF9Q 2K5VA 4JI2L 2AKWB 1X65A 1K8AC 1OXTA 4B3MQ 1WI5A 4DUYL 1PVOA 2JK8A 4GLAC 2IY5B 1JT8A 1SROA 1YHQA 3UE1A 4JBKA 4DR4L 1RIPA 4JI5L 1LM0A 3HOVH 1MKHA 5FJ8H 3M7NA 5C44G 1S40A 3OYYA 1YJWA 5LMUL 2UXCQ 3U50C 4LF8L 1N34Q 3TS0A 2HT1A 1QUQB 4P72A 3F2CA 1C0AA 4GS3A 2I0QA 2VY3A 1A8VA 1WCMH 5C3EG 2Z0SA 2VW9A 2D0OA 3GDEA 1XPRA 2HHHQ 3F1ZA 5IP7H 4A93G 5JJIA 1HNZQ 3AQQA 3K0XA 1M1KC 4QY7A 3CPWA 2E5LL 4WJ3M 3S1QH 1PH9A 5K36G 2R6GA 3DLLA 1V43A 3S1RH 4GN3B 4XIGS 1XMQQ 2E8GA 4HJ8A 2OTLA 4JOIC 1OXXK 3PUXA 3CP0A 2AHOB 2RHQB 2XGTA 3M4QA 2MNAA 3GTJH 1VQIA 5IP9H 2VQFQ 1HNXQ 3OTOQ 1CKMA 1SR3A 5C4JH 3Q8DA 3STBD 4DV2L 1XMOQ 4LFCL 3A0JA 3PIOA 4DUZL 4EQ5A 3F8TA 4IPGA 4YY3Q 3J81j 4EX5A 1I94Q 4GOPC 4OWWB 2B63G 3T1HQ 4BY1G 3AEVA 1B7YB 1CKOA 3I4NH 3MXNB 3PSIA 2EXDA 3BZKA 4ALPA 1XPOA 2JA6H 2JA5G 3BU2A 3ZJYC 4GKKL 5M3FG 4DUYQ 3UE0A 2Z6KA 1IBKL 2WP8J 3PF5A 1HR0Q 1I5FA 1MJCA 1S3OA 1U5KA 3FHWA 1KXLA 4TQUS 1Q7YC 1NTGA 2V1CC 4PMWA 5M3MG 3J7A5 1UE1A 4HJ5A 4LF6Q 2VL6A 4C3JH 1PHJA 2NVYH 1G6PA 4X66L 5C0XI 4IFDG 2WB1G 4YWLA 1VQ8A 2RHSB 2LXKA 2CCZA 1Y1VH 1X3EA 3ULLA 2R7ZH 1L1OC 1X55A 1G51A 1QVCA 4QIWE 4K0KL 4LUZA 1HH2P 4GKJQ 1K3RA 1N33Q 4GN4B 2K4KA 5M5WH 1VQKA 2A1AA 1PFSA 5IYDG 1N8RC 4OWTB 1VQ6A 2YTYA 1D7QA 1QUQA 1SN8A 1PH7A 2C35B 3BJUA 1Q81C 4JBMA 4IOCA 4JV5L 5IYBH 4X65Q 3H0GH 4HJ9A 1KC8C 4P73A 2UU9L 1MIUA 1X6OA 4A3IG 4JI6L 1C9OA 1TXYA 1V9PA 1XPUA 4WJ4A 4YY3L 1L2FA 2ZJPA 1PH8A 4A3DG 3HOZG 1OTCA 3TREA 1EOVA 4LWCA 2UUAL 1Q86C 4AH6A 4JI1Q 5LMNQ 1CKNA 2I5MX 1OXVA 4NXMQ 2YU9H 1BBWA 4LF5L 2UXBL 2YTXA 1IBKQ 3T1YQ 3KF6A 2ZTDA 4R4OA 1HR0L 3HOUG 2ID0A 1NJIC 1I6HH 3PUVA 3F2BA 3CCVA 2UUBQ 3GTQH 4A3GH 4ME3A 4DV5L 4JG2A 4UP8A 3ERSX 4KLKA 1PH4A 1I3QH 4L5SA 3CXCA 1RL2A 3HKZG 4A3FH 1J5EQ 2NVTH 1R9TH 4OONA 1Y1WH 4QJFA 1YBYA 2R93G 3JAMi 1EUJA 4LF9L 3CD6A 1LYLA 2DGYA 4LFBQ 4O0AA 1VQ7A 1T9HA 1HNWQ 1VQEA 4MTNA 4P75A 4GKJL 2ES2A 2N78A 3CCRA 4OO1G 4BBRH 3B6YA 4NXNL 1VS0A 5M5XH 4HIOA 3S15H 1HZCA 3A5ZB 3HOVG 2PQAB 1Z47A 2EQSA 2H5XA 4DV0Q 4JI5Q 2E2HH 2YV5A 4DPGA 4AYBE 4PZ8A 1YI2A 1TWHH 3KOJA 4OO1I 5H1SE 1EQQA 4R4QA 4X64L 2ZM6L 2MQHA 4JV5Q 2UU9Q 1WJJA 4HIDA 2JE6I 1YVCA 5C3EH 5GAEC 3U4VA 4A93H 4JI4Q 5IP7G 4JBJA 5FLXc 3J81i 3A5UA 3M3YH 4BBSH 4AIMA 3CPFA 4GOPB 3KDFB 3RNUA 1BVSA 2R7DA 1PH3A 3WWVA 1PH5A 2N49A 4X62L 4DV3L 4APVA 1XNQQ 2E5LQ 1JJGA 2OQKA 2BA0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MO1 A;  1XNR L;  1SMX A;  1VQL A;  2IX1 A;  1VQG A;  2VQE Q;  1Q46 A;  1UE7 A;  3I56 A;  1GKH A;  2CWP A;  3CW2 C;  3E9I A;  3RLN A;  1C7Y A;  1IBL Q;  2UUB L;  3S2H H;  5C4X H;  4DV5 Q;  1FGU A;  2UUC L;  4DV4 Q;  2HIV A;  3S1N H;  1E24 A;  2B63 H;  2F4V Q;  3I4N G;  4DUZ Q;  3NEN A;  1J5E L;  5FLM H;  3KLW A;  1QVG A;  1X54 A;  3AYH B;  5IYC G;  5BR8 L;  3PUZ A;  2JA6 G;  2K5N A;  5J3B A;  4DK6 C;  4LNQ A;  2JA5 H;  2Q2H A;  2Q2I A;  4HIM A;  1HNW L;  4A3K H;  2R92 H;  2XTI A;  1IXR A;  1UE5 A;  2NZH A;  4FDB A;  4POF A;  3CC7 A;  2B3G A;  2UXD L;  4Y7N H;  3RLO A;  1FL0 A;  3CCU A;  2IHF A;  4B3T Q;  5M3M H;  3K81 C;  4HJ7 A;  2NZO A;  4L5T A;  5LMU Q;  4DR1 Q;  3HKS A;  2NVQ H;  3PO3 H;  3EN2 A;  2UXC L;  1DGS A;  3FKI H;  4R4I A;  3I7F A;  1N34 L;  3GTG H;  1Y1V G;  2VNU D;  3W1B A;  4DR3 L;  4JI0 L;  1IBM L;  2D0P A;  1MJE A;  1U0L A;  1YIJ A;  5GAH C;  2OCE A;  1GO3 E;  3PCO B;  3L2P A;  1PYS B;  1VQC A;  1K73 C;  1K0R A;  2EIF A;  3ER0 A;  4X62 Q;  2WFW A;  5JEA G;  2WB1 E;  3G4S A;  4DV3 Q;  3KFU A;  3PO2 G;  3RZD H;  1XNR Q;  3OW2 A;  5ELN A;  2N8N A;  3RLF A;  2HQL A;  2I5L X;  1VCI A;  1CKN B;  3UDG A;  2KCM A;  5GRO A;  3I2Z A;  5GAD C;  2PQA A;  2D62 A;  4JC0 A;  3G6E A;  3L7Z C;  4DV4 L;  2UUC Q;  3HOZ H;  4A3D H;  4JI8 L;  4YCV A;  1N36 Q;  1E1T A;  1G29 1;  2KHJ A;  2NN6 I;  4H02 A;  1VQM A;  2IX0 A;  2HIX A;  3GD7 A;  1K8G A;  1YIT A;  1XTD A;  3KJP A;  4R4T A;  4LFA L;  2A19 A;  1GM5 A;  4DR7 L;  1FJG L;  1EIY B;  3ICE A;  2OWO A;  1KRS A;  3HOU H;  4NXM L;  2NN6 G;  1VQD A;  1O7I A;  3LGJ A;  4LF5 Q;  2UXB Q;  2RF4 A;  4KI0 A;  1KAW A;  4IJL A;  4A4I A;  3CMA A;  4DV7 Q;  3T1Y L;  4DR6 L;  1N32 Q;  5JJL A;  1EIF A;  1KD1 C;  4JI3 Q;  4L5R C;  4A3F G;  4A75 A;  2YYZ A;  5ELO A;  3TRZ A;  1Y1W G;  4KHP Q;  2R93 H;  2Z6K C;  3S17 H;  4TVA B;  4DV1 Q;  3KJO A;  3EBE A;  1M90 C;  4IFD I;  1VQB A;  3GO5 A;  4AQY L;  4B3M L;  3ULP A;  3HOW H;  4DR4 Q;  3GTL H;  1KL9 A;  4BBR G;  5IT9 c;  2IHE A;  2K75 A;  4PZ6 A;  5IE8 A;  4BXX G;  4B3S L;  1PYB A;  3KF8 B;  3UDF A;  3JAM c;  3RN5 A;  4P74 A;  5HY6 A;  3H3V H;  1E22 A;  1Q8K A;  3STB C;  3NBH B;  2IT1 A;  2Y0S E;  3M4P A;  5E7N A;  4A76 A;  4GNX B;  1SLJ A;  3CQZ H;  3KF6 B;  3J81 c;  4JI6 Q;  2AMC B;  4NB3 A;  4JOI A;  3S16 H;  3E0E A;  2CWA A;  2QEX A;  4A3M H;  4BY7 H;  1CSQ A;  3M9B A;  2Q2U A;  4BBS G;  1XMQ L;  3J80 c;  4IPC A;  4DAM A;  1EQR A;  4JI1 L;  3AFP A;  3U4Z A;  4IOA A;  1J6Q A;  3EIV A;  1XMO L;  1XNQ L;  2WAQ E;  4DV2 Q;  1TWG H;  2JEA I;  2MFI A;  4X6A H;  2N3S A;  1ASY A;  4A3L G;  2BA1 A;  4C3H H;  4DNI A;  5C0X G;  5C4X G;  1KHI A;  3T1H L;  1NMF A;  2JQO A;  3TEH B;  3M4O H;  1LUZ A;  3CME A;  3DM3 A;  3PGZ A;  1VQH A;  2VS1 A;  5M5Y H;  3J80 i;  4LF7 L;  2BH8 A;  5FLM G;  3PIP A;  2CKZ B;  2Y0S G;  1JMC A;  3HOX H;  3HOY G;  5IYC H;  1K9M C;  3D31 A;  3RR5 A;  4DV1 L;  4POG A;  1Y14 B;  2K52 A;  4LFB L;  3VDY A;  4A3K G;  5IY0 A;  1IZ6 A;  4YHH L;  2R92 G;  3HKZ E;  3RN2 A;  1YEZ A;  2YTV A;  3I4M H;  3BZC A;  3G71 A;  1JJ2 A;  4A3E H;  3S2D H;  1IYJ B;  1YHA A;  4P71 A;  3G48 A;  1TWC H;  1CUK A;  2CFM A;  2LXJ A;  3PO3 G;  4OX9 Q;  1NE3 A;  2FXQ A;  1VQF A;  2BH2 A;  2PI2 E;  1Q1B A;  4B3T L;  4JI2 Q;  1GD7 A;  3FKI G;  4X64 Q;  2ZM6 Q;  3K7U C;  3IRB A;  5GQO A;  1HZ9 A;  4R4C A;  1K83 H;  2L15 A;  1QZH A;  4A3B H;  4JI0 Q;  4RG1 A;  4C3I H;  2JJQ A;  1IBM Q;  4A3J H;  1PH1 A;  4LF4 Q;  2JA7 G;  2VUM H;  1A63 A;  4GLV B;  5DLQ E;  3GTO H;  4MNO A;  1W2B A;  1SFO H;  3CCS A;  4A3C H;  2Q2T A;  4JCV E;  4Y52 H;  4HIK A;  4B3R Q;  3PO2 H;  3CCE A;  4YCW A;  4C2M H;  1H95 A;  3UDX A;  3RZO H;  1IL2 A;  2PI2 A;  4HJA A;  1EYG A;  2QGQ A;  2K50 A;  1NY4 A;  1HZB A;  3E9H A;  1TWF H;  3ULJ A;  4X65 L;  3CCJ A;  2K5H A;  5IWA L;  1VQ9 A;  2DUD A;  4QL5 A;  1I50 H;  2WAQ G;  3CF5 A;  2F4V L;  2CQO A;  3S1M H;  3NEM A;  1SRU A;  2OQ0 A;  4XTC S;  4MZ9 A;  1NMG A;  4DR5 L;  2UUA Q;  3HFZ B;  3CAM A;  1HNX L;  4IPH A;  1VQJ A;  3J7Z C;  4PG3 A;  4RMF A;  4YHH Q;  5LMN L;  1X9N A;  2JA8 H;  2ZJQ A;  3OTO L;  1BBU A;  3PUW A;  4DR7 Q;  2UXD Q;  3GTK H;  3MEF A;  3U58 A;  4OXP A;  1CSP A;  1B70 B;  4JI7 Q;  1OXS C;  2KCT A;  4QQB X;  1I94 L;  1FVI A;  1TWA H;  1AE3 A;  1D8L A;  2JEB I;  1P16 A;  1YNX A;  1L1O B;  4DR3 Q;  2KHI A;  1JJC B;  2F52 A;  2OTJ A;  2F3I A;  3HOW G;  2ZTE A;  1GVP A;  2NVX H;  4L5Q A;  1PH2 A;  2R7F A;  1NBW A;  4LF4 L;  1UEB A;  4IFD J;  4J15 A;  4BXX H;  2KBN A;  4DR2 L;  2QA4 A;  1VQ4 A;  5FJ8 G;  1E1O A;  5C44 H;  4NXN Q;  1HJP A;  4LF6 L;  4B3S Q;  4NPS A;  3H15 A;  1KQS A;  1LTL A;  4KHZ A;  4YCU A;  4IJH A;  4QGU A;  2E2I H;  2HHH L;  4JYA Q;  1HNZ L;  1WCM G;  3KDF A;  1JE5 A;  3PF4 A;  4A3M G;  4BY7 G;  5JJK A;  4DV6 L;  3K7A H;  5IWA Q;  4JI8 Q;  1N36 L;  1N33 L;  1YZ6 A;  2VQF L;  2B29 A;  2I5H A;  3K80 C;  1QVF A;  1Q12 A;  4DR5 Q;  1JB7 A;  4LFA Q;  1X56 A;  2VQE L;  3TQY A;  5C0X J;  2ZJR A;  1VQP A;  2PMZ E;  5IP9 G;  1N9W A;  1EFW A;  1IBL L;  3KYH C;  1PA6 A;  2JA9 A;  3I4O A;  4A3L H;  4YWM A;  1YHB A;  3AFQ A;  3H3V I;  4IO9 A;  1HZA A;  5AJ3 Q;  4DR6 Q;  1N32 L;  4YWK A;  1YJN A;  1VQ5 A;  3PV0 A;  4LUV A;  4JI3 L;  2ZTC A;  5BR8 Q;  4UP9 A;  4LUO A;  1XJV A;  4R1J A;  4BY1 H;  1BKB A;  4UPA A;  4AYB G;  3HOX G;  3HOY H;  4GKK Q;  4KHP L;  4UP7 A;  1Z9F A;  1L1O A;  2VZA A;  3TS2 A;  2ATW A;  1X3F A;  3A74 A;  4DK3 C;  5M3F H;  4AQY Q;  3K8A A;  4JBW A;  3CC2 A;  1HR0 W;  1VQN A;  3I4M G;  2KEN A;  4DR1 L;  1A0I A;  4A3E G;  1AE2 A;  4DR2 Q;  1S72 A;  1AH9 A;  3D0F A;  4X66 Q;  1KIX A;  1Q1E A;  4GLX A;  3W1G A;  1A62 A;  1E7Z A;  1V1Q A;  4K0K Q;  2AWN A;  2R7Z G;  4JYA L;  3UDI A;  1SE8 A;  3S24 A;  1Q82 C;  4DKA C;  1PH6 A;  4DV6 Q;  4A3B G;  2RCN A;  2JA7 H;  1WYD A;  2PNH A;  4GOP A;  4A3J G;  2VUM G;  1VQA A;  1B8A A;  1EWI A;  2MO0 A;  3SGI A;  5IYD H;  3CCM A;  3S14 H;  4A3C G;  4BA1 I;  4O2D A;  4DV0 L;  2GN5 A;  4BA2 I;  1YJ9 A;  4GNX A;  3GTP H;  2LSS A;  4B3R L;  4LF8 Q;  1WFQ A;  5IYB G;  3H0G G;  1OXU A;  2A8V A;  3CCL A;  4A3I H;  3CCQ A;  2ALY B;  3FP9 A;  5AJ3 L;  3CC4 A;  1P8L A;  3L0O A;  3PUY A;  1ASZ A;  4JI4 L;  4LF7 Q;  2AWO A;  1UE6 A;  5GAG C;  3GTM H;  3F2D A;  5LMN W;  1QZG A;  1W3S A;  1FJG Q;  4LW1 A;  3W5O A;  3JC6 6;  1WOC A;  3I55 A;  3M85 A;  2E2J H;  2JA8 G;  4UY8 C;  5EAY A;  1KRT A;  5HGQ A;  4GN5 A;  1UWV A;  4OWX B;  4IPD A;  4A3G G;  2K14 A;  4LFC Q;  2ASB A;  2GVB A;  4GNX C;  1VQO A;  1PV4 A;  4PZ7 A;  5JEA J;  1X3G A;  1E3P A;  2GVA A;  1L0W A;  4DV7 L;  4OX9 L;  4DAY B;  4JI7 L;  3NEL A;  4LF9 Q;  2K5V A;  4JI2 L;  2AKW B;  1X65 A;  1K8A C;  1OXT A;  4B3M Q;  1WI5 A;  4DUY L;  1PVO A;  2JK8 A;  4GLA C;  2IY5 B;  1JT8 A;  1SRO A;  1YHQ A;  3UE1 A;  4JBK A;  4DR4 L;  1RIP A;  4JI5 L;  1LM0 A;  3HOV H;  1MKH A;  5FJ8 H;  3M7N A;  5C44 G;  1S40 A;  3OYY A;  1YJW A;  5LMU L;  2UXC Q;  3U50 C;  4LF8 L;  1N34 Q;  3TS0 A;  2HT1 A;  1QUQ B;  4P72 A;  3F2C A;  1C0A A;  4GS3 A;  2I0Q A;  2VY3 A;  1A8V A;  1WCM H;  5C3E G;  2Z0S A;  2VW9 A;  2D0O A;  3GDE A;  1XPR A;  2HHH Q;  3F1Z A;  5IP7 H;  4A93 G;  5JJI A;  1HNZ Q;  3AQQ A;  3K0X A;  1M1K C;  4QY7 A;  3CPW A;  2E5L L;  4WJ3 M;  3S1Q H;  1PH9 A;  5K36 G;  2R6G A;  3DLL A;  1V43 A;  3S1R H;  4GN3 B;  4XIG S;  1XMQ Q;  2E8G A;  4HJ8 A;  2OTL A;  4JOI C;  1OXX K;  3PUX A;  3CP0 A;  2AHO B;  2RHQ B;  2XGT A;  3M4Q A;  2MNA A;  3GTJ H;  1VQI A;  5IP9 H;  2VQF Q;  1HNX Q;  3OTO Q;  1CKM A;  1SR3 A;  5C4J H;  3Q8D A;  3STB D;  4DV2 L;  1XMO Q;  4LFC L;  3A0J A;  3PIO A;  4DUZ L;  4EQ5 A;  3F8T A;  4IPG A;  4YY3 Q;  3J81 j;  4EX5 A;  1I94 Q;  4GOP C;  4OWW B;  2B63 G;  3T1H Q;  4BY1 G;  3AEV A;  1B7Y B;  1CKO A;  3I4N H;  3MXN B;  3PSI A;  2EXD A;  3BZK A;  4ALP A;  1XPO A;  2JA6 H;  2JA5 G;  3BU2 A;  3ZJY C;  4GKK L;  5M3F G;  4DUY Q;  3UE0 A;  2Z6K A;  1IBK L;  2WP8 J;  3PF5 A;  1HR0 Q;  1I5F A;  1MJC A;  1S3O A;  1U5K A;  3FHW A;  1KXL A;  4TQU S;  1Q7Y C;  1NTG A;  2V1C C;  4PMW A;  5M3M G;  3J7A 5;  1UE1 A;  4HJ5 A;  4LF6 Q;  2VL6 A;  4C3J H;  1PHJ A;  2NVY H;  1G6P A;  4X66 L;  5C0X I;  4IFD G;  2WB1 G;  4YWL A;  1VQ8 A;  2RHS B;  2LXK A;  2CCZ A;  1Y1V H;  1X3E A;  3ULL A;  2R7Z H;  1L1O C;  1X55 A;  1G51 A;  1QVC A;  4QIW E;  4K0K L;  4LUZ A;  1HH2 P;  4GKJ Q;  1K3R A;  1N33 Q;  4GN4 B;  2K4K A;  5M5W H;  1VQK A;  2A1A A;  1PFS A;  5IYD G;  1N8R C;  4OWT B;  1VQ6 A;  2YTY A;  1D7Q A;  1QUQ A;  1SN8 A;  1PH7 A;  2C35 B;  3BJU A;  1Q81 C;  4JBM A;  4IOC A;  4JV5 L;  5IYB H;  4X65 Q;  3H0G H;  4HJ9 A;  1KC8 C;  4P73 A;  2UU9 L;  1MIU A;  1X6O A;  4A3I G;  4JI6 L;  1C9O A;  1TXY A;  1V9P A;  1XPU A;  4WJ4 A;  4YY3 L;  1L2F A;  2ZJP A;  1PH8 A;  4A3D G;  3HOZ G;  1OTC A;  3TRE A;  1EOV A;  4LWC A;  2UUA L;  1Q86 C;  4AH6 A;  4JI1 Q;  5LMN Q;  1CKN A;  2I5M X;  1OXV A;  4NXM Q;  2YU9 H;  1BBW A;  4LF5 L;  2UXB L;  2YTX A;  1IBK Q;  3T1Y Q;  3KF6 A;  2ZTD A;  4R4O A;  1HR0 L;  3HOU G;  2ID0 A;  1NJI C;  1I6H H;  3PUV A;  3F2B A;  3CCV A;  2UUB Q;  3GTQ H;  4A3G H;  4ME3 A;  4DV5 L;  4JG2 A;  4UP8 A;  3ERS X;  4KLK A;  1PH4 A;  1I3Q H;  4L5S A;  3CXC A;  1RL2 A;  3HKZ G;  4A3F H;  1J5E Q;  2NVT H;  1R9T H;  4OON A;  1Y1W H;  4QJF A;  1YBY A;  2R93 G;  3JAM i;  1EUJ A;  4LF9 L;  3CD6 A;  1LYL A;  2DGY A;  4LFB Q;  4O0A A;  1VQ7 A;  1T9H A;  1HNW Q;  1VQE A;  4MTN A;  4P75 A;  4GKJ L;  2ES2 A;  2N78 A;  3CCR A;  4OO1 G;  4BBR H;  3B6Y A;  4NXN L;  1VS0 A;  5M5X H;  4HIO A;  3S15 H;  1HZC A;  3A5Z B;  3HOV G;  2PQA B;  1Z47 A;  2EQS A;  2H5X A;  4DV0 Q;  4JI5 Q;  2E2H H;  2YV5 A;  4DPG A;  4AYB E;  4PZ8 A;  1YI2 A;  1TWH H;  3KOJ A;  4OO1 I;  5H1S E;  1EQQ A;  4R4Q A;  4X64 L;  2ZM6 L;  2MQH A;  4JV5 Q;  2UU9 Q;  1WJJ A;  4HID A;  2JE6 I;  1YVC A;  5C3E H;  5GAE C;  3U4V A;  4A93 H;  4JI4 Q;  5IP7 G;  4JBJ A;  5FLX c;  3J81 i;  3A5U A;  3M3Y H;  4BBS H;  4AIM A;  3CPF A;  4GOP B;  3KDF B;  3RNU A;  1BVS A;  2R7D A;  1PH3 A;  3WWV A;  1PH5 A;  2N49 A;  4X62 L;  4DV3 L;  4APV A;  1XNQ Q;  2E5L Q;  1JJG A;  2OQK A;  2BA0 A; 
#chains in the Genus database with same CATH topology
 1PFN A;  2KVM A;  2MO1 A;  1SMX A;  1VQL A;  2IX1 A;  4RH6 A;  1EY0 A;  2VQE Q;  5J39 A;  4BWG B;  4DV5 Q;  1TVX A;  2F4V Q;  1ESR A;  1EYA A;  3J80 L;  3KLW A;  2A5H A;  1QVG A;  5IYC G;  3PUZ A;  2JYO A;  2K5N A;  3C46 A;  2Q2H A;  4HIM A;  1HNW L;  2F0I A;  2E76 C;  2IW3 A;  3H94 A;  1DZ1 A;  1IXR A;  2NZH A;  4POF A;  1Q8I A;  3QR8 A;  3RLO A;  1FL0 A;  2HDL A;  3PO3 H;  1PTO B;  4L5T A;  3SK4 A;  2CVR A;  1SYE A;  1DGS A;  1K3B C;  3GTG H;  1SE2 A;  3HOZ B;  3FPU B;  5E1F A;  1FD7 D;  4KKS A;  2OCE A;  3PCO B;  3L2P A;  2Z4I A;  3DHQ A;  2PCF B;  3ER0 A;  2WFW A;  4RA8 A;  1EY9 A;  2HCC A;  3U9S A;  3OW2 A;  2X6L A;  1C4Q A;  2HQL A;  3LNN A;  2WKC A;  2KCM A;  2MJ8 A;  3I2Z A;  2D62 A;  3G6E A;  4DV4 L;  1RCV D;  1SSO A;  3V2T A;  3P1H A;  4F87 A;  4PNY A;  1EIY B;  3HOU H;  1TS2 A;  1SYC A;  2NN6 G;  1O7I A;  1W6J A;  4KI0 A;  4DV7 Q;  1N32 Q;  4JI3 Q;  2EOT A;  4P2C B;  3BS1 A;  5COY A;  5ELO A;  1Y1W G;  3S1Q B;  1Z7T A;  1JIC A;  2DJF C;  1BOS A;  1Q90 A;  1MI2 A;  3GO5 A;  4B3M L;  3HKZ B;  1ZXT A;  4OIK A;  3GTL H;  4BXX G;  3KF8 B;  3JAM c;  3OOC A;  2F0S A;  1Q8K A;  3STB C;  2KA7 A;  3BVM A;  4A76 A;  1HUN A;  3MTS A;  2XN9 C;  3CQZ H;  1GJX A;  5IGC A;  3J81 c;  2X69 A;  3E0E A;  5EPJ A;  4XQN A;  2Q2U A;  3S1N B;  3AFP A;  2HCI A;  1XMO L;  2WAQ E;  1TWG H;  2N3S A;  2Z9H A;  5CGK A;  2RSO A;  4ZYS A;  1T5X D;  4C3H H;  4DNT B;  4DNI A;  5C0X G;  5C4X G;  1PZI D;  2RDF A;  1NMF A;  3TEH B;  3D6W A;  1QIL A;  1X3Q A;  5M5Y H;  1SYG A;  3S15 B;  1PRT C;  5C4H A;  1JOO A;  1QE6 A;  4DV1 L;  4LFB L;  2R92 G;  5IY0 A;  3RN2 A;  2OXP A;  1UUP A;  1YEZ A;  2X6G A;  3QJY A;  4NKL A;  3G48 A;  1TWC H;  2CFM A;  1NE3 A;  2FXQ A;  4B3T L;  4JI2 Q;  1I4X A;  1D5X C;  2ZM6 Q;  3K7U C;  1TR5 A;  3SK6 A;  5IT9 L;  1HZ9 A;  3HG9 A;  4R4C A;  3VR4 A;  4KKT A;  4RG1 A;  4LF4 Q;  1A63 A;  2NWG A;  1Y1V B;  2A69 C;  3I70 A;  3HEJ A;  1E2W A;  1NAP A;  3LWE A;  3CCE A;  4YCW A;  3K59 A;  3GV3 A;  1LTB D;  1IL2 A;  3V96 A;  2PI2 A;  4ID6 A;  2ZXP A;  3J80 E;  4ZUI A;  3HOV B;  2OT2 A;  1DD2 A;  2RBM A;  4QL5 A;  3CF5 A;  2F4V L;  4CJ1 B;  3K5L A;  3NP8 A;  4DR5 L;  2UUA Q;  4IPH A;  1VQJ A;  4PG3 A;  4YHH Q;  2I07 B;  1BBU A;  2O4X A;  3K0Y A;  2I46 A;  3GTK H;  3MEF A;  5COR A;  4OXP A;  2CH4 A;  4G4K A;  3M3Y B;  2FMM A;  1OXS C;  1I94 L;  1YNX A;  3VYR A;  4RFB A;  2JP1 A;  1B3A A;  1JJC B;  2F52 A;  5ELD A;  2OTJ A;  2F3I A;  2ZTE A;  2R7F A;  1UEB A;  4DR2 L;  1E1O A;  3FDT A;  2EJF C;  4CGY B;  3EQL C;  3K7A B;  4KHZ A;  4YCU A;  4IJH A;  1B9M A;  1S5D D;  1HNZ L;  3KDF A;  4BY7 G;  3K7A H;  5IWA Q;  1LAB A;  1ILP A;  4DXG A;  5IGE A;  4FXG C;  3RUZ A;  1Q12 A;  1JB7 A;  2VQE L;  3TQY A;  4UDU C;  1PFM A;  5C0X J;  2F0Q A;  5C44 B;  1VQP A;  2F03 A;  1IBL L;  3AFQ A;  1CFM A;  1N32 L;  5AJ3 Q;  1HA5 A;  3OIP A;  1YJN A;  1VQ5 A;  4UP9 A;  4LUO A;  1CQV A;  4AYB G;  4GKK Q;  1TS3 A;  1SNC A;  3KBG A;  1L1O A;  1C48 A;  4N8F A;  1GUT A;  3DEP A;  4KV6 A;  5JPM C;  1GXD C;  2FFK B;  3JAM L;  3KK7 A;  4C3J G;  4KN7 C;  1ENC A;  1EFI D;  1V1Q A;  4G57 A;  1JOR A;  1MD2 D;  3S24 A;  1PH6 A;  5L37 A;  1CZW A;  2N88 A;  1EIG A;  4A3B G;  5M3F B;  2JA7 H;  2K5Q A;  1EWI A;  3SGI A;  1JWM D;  3CCM A;  4A3C G;  2RVL A;  4DV0 L;  2L12 A;  4FF2 A;  2B8G A;  1U4M A;  3H0G G;  3CCQ A;  2RA4 A;  3Q0A A;  4LF7 Q;  3N6R A;  2WB1 B;  2Y0S B;  5I4D A;  1A2U A;  1BCP D;  2F0U A;  4Y7N B;  1ET9 A;  3TZD A;  3M85 A;  2B2Y A;  1UWV A;  1HFG A;  1XX8 A;  4IPD A;  2B2U A;  2GVB A;  4GNX C;  1VQO A;  1E0B A;  1LLR D;  4PZ7 A;  1X3G A;  1WCM B;  3P20 A;  5M5Y B;  3ERQ A;  4LF9 Q;  2AUK A;  1MHW C;  4JI2 L;  3MA2 B;  3N52 A;  4N9T A;  4IUQ A;  2AKW B;  1X65 A;  4B3M Q;  5C4Z A;  1WI5 A;  4ME5 A;  4YIJ A;  5IOC A;  1HXY D;  4RHS A;  1VF7 A;  4K5W A;  1MKH A;  2QF7 A;  2B2U C;  3RMH A;  3OYY A;  1YJW A;  2JSO A;  4G7H C;  4LF8 L;  1N34 Q;  2D9U A;  3ONA B;  1VDZ A;  2VY3 A;  1A8V A;  2EDG A;  1MBY A;  4MIU A;  5IP7 H;  1HNZ Q;  3K0X A;  5K36 G;  4FYD A;  1G91 A;  4LK1 C;  1KNE A;  4HJ8 A;  1XWE A;  1SNO A;  1QNU A;  3GTL B;  4RGT A;  3OTO Q;  5C4J H;  3PO2 B;  4DV2 L;  3NTK A;  4LFC L;  3FEW X;  1ROD A;  4YY3 Q;  4R9W A;  3BDC A;  2B63 G;  4WJW A;  2OF1 A;  4BY1 G;  1XPO A;  3BYY B;  2F0T A;  1STN A;  1BF4 A;  3A8K E;  4IQZ A;  1B4O A;  2K5W A;  5CYU A;  1S3O A;  3OMC A;  4TQU S;  1WTH A;  2LMC B;  1NTG A;  2V1C C;  2XNA C;  5M3M G;  2VL6 A;  5C0X I;  2G5D A;  1LV9 A;  4CDC C;  1X3E A;  2R7Z H;  1HTL D;  2PZW A;  1HH2 P;  3DMU A;  4LUZ A;  1N33 Q;  5CMD A;  2XIW A;  1WTR A;  1VQK A;  1PFS A;  1N8R C;  5JEA H;  1D7Q A;  2OEO A;  1PH7 A;  4A3B B;  1PZK D;  1SYB A;  3SE0 A;  1F2L A;  4JV5 L;  1KC8 C;  4JI6 L;  1K8O A;  4A3I G;  2B2W A;  2EJM A;  1D1K A;  1L2F A;  4CKB A;  3HOZ G;  4FVM A;  2XWJ B;  4LWC A;  1DM0 B;  2K05 A;  4IN3 A;  4JI1 Q;  2I5M X;  4NXM Q;  1BBW A;  4DA2 A;  2UXB L;  1IBK Q;  3T1Y Q;  4A3F B;  2ID0 A;  1I6H H;  3F2B A;  3I4M B;  4A3G H;  4DV5 L;  1KDA A;  4QF4 A;  1SMY C;  1PH4 A;  2A73 B;  5KNC A;  3HKZ G;  1EWH A;  1HUM A;  3JAM i;  1EUJ A;  2B8F A;  3OSO A;  3CD6 A;  2KQ3 A;  1B1Z A;  1HNW Q;  1B9N A;  4GKJ L;  4I7A A;  3D8G A;  2Z6B A;  4BBR H;  3B6Y A;  4NXN L;  4DAP A;  1EY4 A;  4KD3 A;  1HZC A;  3HOV G;  2PQA B;  4MTK A;  2EQS A;  2H5X A;  4ZRZ A;  1AZQ A;  1OO9 B;  4OO1 I;  3DXJ C;  5H1S E;  4X64 L;  4GZY C;  2EYF A;  1YVC A;  5C3E H;  1RJT A;  2WAC A;  3FKI B;  3IKJ A;  3W2D A;  3FPP A;  1A2T A;  3CPF A;  3MEH A;  1QCB D;  3KDF B;  2R7D A;  5TSS A;  1SBB B;  2F4I A;  1Y1W B;  2Z4H A;  2BA0 A;  2JXM B;  4IAL A;  1VQG A;  1PTO C;  3I72 A;  1GKH A;  1K28 A;  2EXZ A;  2ZT9 C;  3RLN A;  2UUB L;  3I90 A;  4OHJ A;  4DV4 Q;  5C3W A;  3S1N H;  4H0L C;  2QKI C;  3I4N G;  2FHT A;  2C9O A;  1EZ6 A;  3NEN A;  4XYQ A;  3EVQ A;  5BR8 L;  5J3B A;  4LNQ A;  2JA5 H;  2HDM A;  1G6Z A;  3F2U A;  1UE5 A;  4FDB A;  4Q5V A;  5EGT A;  2B3G A;  4RGN A;  2MGS A;  2K7V A;  4C56 C;  1A3V A;  2IHF A;  3ZYY X;  2NVQ H;  3K81 C;  3S2H B;  4L63 B;  2XSC A;  4HCE A;  2UXC L;  4IFD H;  2Z8L A;  1FR3 A;  4Z9C B;  3FKI H;  3HZX A;  1ICF B;  5KRU A;  1N34 L;  5CV4 A;  2JN4 A;  3W1B A;  1MJE A;  3EA6 A;  2FJ2 A;  4KKU A;  4ZQ3 A;  1YIJ A;  5GAH C;  4CDE C;  1GO3 E;  3A7A B;  1HCZ A;  3HOW B;  2WB1 E;  1QJO A;  1WD1 A;  3G7L A;  3PO2 G;  1XNR Q;  1NR4 A;  5ELN A;  5CV6 A;  2B2T A;  2N8N A;  3RLF A;  1D1I A;  1A3U A;  1CKN B;  5GRO A;  4IUR A;  5GAD C;  2PQA A;  3KF8 A;  1N36 Q;  3TP5 A;  4H02 A;  2IX0 A;  2DNC A;  1K8G A;  1EY5 A;  4R4T A;  4LFA L;  4DK1 A;  2PYK A;  4DR7 L;  1DOM A;  1FJG L;  3ICE A;  2OWO A;  1KRS A;  1VQD A;  5A35 A;  4DAY A;  2UXB Q;  4C3H B;  3T1Y L;  4A4I A;  3NQI A;  4DR6 L;  4X3U A;  3R2I A;  4K5X A;  4QB4 A;  4L5R C;  4A3F G;  2YYZ A;  1ONL A;  2R93 H;  1BQQ T;  1EYC A;  4TVA B;  4DV1 Q;  2F0O A;  1I4R A;  1NCV A;  4OO1 H;  5I6Y A;  1X32 A;  3NWT A;  1MSH A;  2ZXR A;  5IT9 c;  5IE8 A;  1CHQ D;  4IUP A;  3UDF A;  2KCN A;  1GUG A;  5AFW A;  4G7O C;  1B50 A;  1E22 A;  4GNX B;  1SLJ A;  2R7Z B;  1E2Z A;  2DY8 A;  1DXM A;  2CWA A;  3L3O C;  2QEX A;  4A3M H;  4RWS C;  5EJW A;  4A3D B;  4BBS G;  3W3A A;  4DAM A;  1EQR A;  3U4Z A;  1JOQ A;  5G3L D;  3EIV A;  2E2D C;  3C1E A;  4DV2 Q;  2KHS A;  2MFI A;  1ASY A;  4A3L G;  2RCF A;  4HCS A;  2EZV A;  1D5Z C;  2O5J C;  3T1H L;  3M4O H;  2JQO A;  1LUZ A;  3CME A;  3DM3 A;  3E0J A;  2VS1 A;  3BVZ A;  3NUC A;  1DOK A;  1V1P A;  2BH8 A;  5NUC A;  4K6L A;  2F0V A;  2Y0S G;  1XTC D;  5IYC H;  3D6C A;  4J6H A;  3KLS X;  3X3N A;  4YHH L;  3HKZ E;  1PFB A;  3I4M H;  3K5O A;  3SR1 A;  4A3E H;  1JJ2 A;  3S2D H;  3VR5 A;  4P71 A;  2F0D A;  3D3R A;  3E5S A;  2LXJ A;  3PO3 G;  4OX9 Q;  4A3G B;  3ERO A;  4U67 3;  1A3T A;  1YNJ C;  3HOU B;  4KMU C;  1XXG A;  4J1M A;  1R4P B;  4C3I H;  1IBM Q;  4A3J H;  4MNO A;  1SFO H;  5E3F A;  2Q2T A;  4C2M H;  3VA7 A;  3UDX A;  1CHP D;  5I2X A;  2EE1 A;  1EYG A;  3I4N B;  4KY6 A;  2QGQ A;  1HZB A;  3CCJ A;  5I9O A;  2NVY B;  3WOF A;  5IWA L;  2DUD A;  4CJ0 B;  1I50 H;  2WAQ G;  1VQ9 A;  3S1M H;  5ELC A;  5I9P A;  2EY2 A;  2OQ0 A;  1AZP A;  1UNS A;  3BZD B;  1HNX L;  3MZ5 A;  1X9N A;  5LMN L;  5I2Y A;  3S2D B;  2NN6 H;  3PUW A;  3U58 A;  1CSP A;  1B70 B;  1DYQ A;  4JI7 Q;  4QQB X;  1FVI A;  1TWA H;  4ZKB B;  1QB5 D;  1P16 A;  1EU3 A;  2KUM A;  1G2T A;  4DR3 Q;  2KHI A;  1MSG A;  4FF3 A;  1GVP A;  4L5Q A;  3MFG A;  5IGG A;  4LF4 L;  4BXX H;  4ODG A;  1IKL A;  1UEA B;  4B3S Q;  3H15 A;  1PRT D;  1ZYR C;  1R4Q B;  2E2I H;  2C5C A;  5JJK A;  4DV6 L;  1QG7 A;  4M1U B;  1TWH B;  1WTX A;  1QVF A;  4S3S A;  4DR5 Q;  4LFA Q;  1X56 A;  3R93 A;  5IP9 G;  3GTP B;  1N9W A;  1EFW A;  1PA6 A;  5ISR A;  5FO7 B;  3MWY W;  4PMC A;  4C3H G;  3H3V I;  1HZA A;  4EQN A;  3GTO B;  4RKB A;  3RD4 A;  2IWH A;  4LUV A;  4XYO A;  1YNN D;  4KN4 C;  4A3I B;  4R1J A;  1II3 A;  1BKB A;  4UPA A;  1O78 A;  4RKL A;  2A74 C;  1Z9F A;  2ATW A;  1G2S A;  2KEE A;  1JQY D;  3CC2 A;  1HR0 W;  3VR6 A;  1IHZ A;  2KEN A;  4DR1 L;  2QEJ C;  4DR2 Q;  5FLX E;  1AW7 A;  2N55 A;  4KD4 A;  3TP7 A;  4DF7 A;  4K0K Q;  2AWN A;  4X3S A;  4WRD A;  2L55 A;  1Q82 C;  2B63 B;  1WYD A;  4KJN A;  3AB9 A;  2JA5 B;  4BA1 I;  3J7A F;  4O2D A;  1O80 A;  4BA2 I;  5JPN C;  4L8J A;  1YJ9 A;  4GNX A;  3GTP H;  1WFQ A;  1EY8 A;  1EEI D;  1ESF A;  2A6H C;  3CCL A;  2ALY B;  3FP9 A;  3CRK C;  1ASZ A;  4JI4 L;  1F9R A;  1PTO F;  5GAG C;  3GV6 A;  2R3Z A;  3F2D A;  1QZG A;  1TKW B;  1CZG A;  2G9D A;  5G3L F;  4NMZ A;  1KRT A;  4GN5 A;  1S4Z A;  2FIN B;  4EQO A;  1WTW A;  4OWX B;  4ZUJ A;  4LFC Q;  5A2Q L;  3S14 B;  1LAC A;  4DV7 L;  1LTT D;  2QDL A;  4DAY B;  2LKV A;  1DOL A;  1AEX A;  2NYZ D;  4JI7 L;  1SJH D;  2AQ2 B;  3H6M A;  2K5V A;  4CHT B;  1K8A C;  2WKD A;  5IIF A;  2ICE C;  3NSW A;  3DUZ A;  2JK8 A;  2IY5 B;  2IPK D;  1SRO A;  1BNZ A;  1ZKO A;  1RIP A;  5JVG 3;  1LM0 A;  4KK7 A;  3M7N A;  3DWP A;  5IOD A;  5LMU L;  3U50 C;  3J7A V;  3NWS A;  4HSP A;  4JPB W;  2RDH A;  2B39 A;  2Z0S A;  2VW9 A;  2D0O A;  3DM1 A;  3GDE A;  4KY7 A;  3F1Z A;  1XPR A;  4FF1 A;  4A93 G;  5JJI A;  3ND8 A;  4QY7 A;  1HFN A;  2R6G A;  5EKL A;  1V43 A;  3DLL A;  4G7Z C;  1XMQ Q;  2E8G A;  3C1F A;  1OXX K;  1O7Z A;  3M4Q A;  4QUC A;  2MNA A;  2K01 A;  2MHV A;  4ZK9 B;  1CKM A;  1SR3 A;  3BG3 A;  4EQ5 A;  1SEB D;  2K33 A;  3O13 A;  3OWE B;  5KIX A;  4OWW B;  3AEV A;  1H9S B;  2JA6 H;  3BZK A;  1CM9 A;  4C3I B;  3UI2 A;  1BCP F;  1IBK L;  4MHE A;  1I5F A;  1V1P B;  2B2T C;  1MJC A;  3D4W A;  1Q7Y C;  3TDQ A;  4HJ5 A;  4LF6 Q;  4C3J H;  2F0F A;  2L5T A;  2M00 A;  4XQJ A;  1G6P A;  1U4P A;  1HTP A;  1Y1V H;  2NTS A;  1SXT A;  2ICI A;  2K4K A;  5M5W H;  5JAV A;  2A1A A;  1VQ6 A;  4FF4 A;  1WTQ A;  1QUQ A;  3QG1 A;  4IOC A;  3H0G H;  4HJ9 A;  4EGV A;  1MIU A;  4WJ4 A;  1TQO A;  4YY3 L;  2ZJP A;  4A3D G;  1RKN A;  1OTC A;  2SNM A;  1WTO A;  3KLS A;  1Q86 C;  4AH6 A;  3TME A;  4R8N A;  5LMN Q;  4B9W A;  1CKN A;  2YU9 H;  1BUV T;  4A3M B;  2E2H B;  2PZU A;  3TBI B;  3PUV A;  2UUB Q;  4B08 A;  4ME3 A;  2F1M A;  5FK9 C;  5FOB B;  1CTM A;  3VA5 A;  1I4Q A;  4L5S A;  1BO0 A;  4WFN 3;  1EY6 A;  1TT2 A;  3RZD B;  1LYL A;  4LFB Q;  4O0A A;  2R92 B;  2BE5 D;  1VQE A;  4A3J B;  3S15 H;  3A5Z B;  1Z47 A;  4IUV A;  2LS0 1;  1LO5 D;  2E2H H;  2L0C A;  3HRZ C;  2L9H A;  2YV5 A;  1QOH A;  2DY7 A;  1TWH H;  3KOJ A;  1EQQ A;  1D5M C;  1KLU D;  3R2T A;  1KDC A;  4JI4 Q;  3DEO A;  5IP7 G;  1H9S A;  3A5U A;  4LMQ D;  4AIM A;  5K36 H;  5EQ0 A;  3WWV A;  1PH5 A;  4X62 L;  1XNQ Q;  2FMC A;  4APV A;  2JA8 B;  4ZCK A;  3TRZ A;  4CJ2 C;  2K32 A;  1XNR L;  1F2Y A;  1EYD A;  2K28 A;  1Q46 A;  2NTT A;  4ILW A;  2CWP A;  3E9I A;  4BBR B;  5M3M B;  1IBL Q;  2VUM B;  3TN2 A;  1FGU A;  5K5P A;  2HIV A;  4HMJ A;  1E24 A;  1YNJ D;  2RKS A;  2B63 H;  1J5E L;  5T1I A;  5FLM H;  1AFP A;  2F3W A;  3AYH B;  4DK6 C;  1KAB A;  2Q2I A;  1U4L A;  4A3K H;  1TWF B;  2UXD L;  4Y7N H;  4B3T Q;  5M3M H;  1NNX A;  5LMU Q;  3HKS A;  4L6T B;  3I7F A;  2D0P A;  1W6K A;  3ITP A;  1U0L A;  3A56 A;  3KUP A;  1PYS B;  1VQC A;  1K73 C;  4FXK C;  1K0R A;  2EIF A;  3OW7 A;  3G4S A;  4DV3 Q;  3K6O A;  5JEA G;  2F0N A;  1SE4 A;  3RZD H;  4OIJ A;  3PO3 B;  1VCI A;  1STB A;  2UUC Q;  4X3T A;  1PRT F;  2PZT A;  3HOZ H;  4JI8 L;  5IGB A;  1E1T A;  2KHJ A;  2VXW A;  4H44 C;  1D2B A;  2HIX A;  1YIT A;  1VMP A;  1XTD A;  3KJP A;  4OEM B;  4IUN A;  1IW7 D;  2CH4 W;  3S1R B;  2EYM A;  3LGJ A;  4F8M A;  4LF5 Q;  2RF4 A;  2A68 C;  5IGF A;  4IJL A;  3CMA A;  2PMZ B;  4K8I A;  2PNR C;  5JJL A;  1KD1 C;  4RAU C;  3S16 B;  2PW5 A;  4B9X A;  4A75 A;  4KHP Q;  2Z6K C;  3MXU A;  2EYL A;  3KJO A;  3EBE A;  1M90 C;  4IFD I;  2BE5 C;  2K04 A;  5DAU A;  5C5L A;  4AQY L;  3ULP A;  3HOW H;  4DR4 Q;  2WAQ B;  1KL9 A;  4BBR G;  2VB2 X;  5CV8 A;  1UAP A;  5ELB A;  1JR0 D;  4N9P A;  3RN5 A;  1GUW A;  2SOB A;  1JWS D;  2D2C C;  2K6A A;  2P5Z X;  2IT1 A;  3NBH B;  2Y0S E;  5ELE A;  2PQE A;  3M4P A;  4K14 A;  5E7N A;  4V19 0;  1PZJ D;  1F77 A;  3KF6 B;  2AMC B;  4NB3 A;  3S16 H;  1CSQ A;  3M9B A;  1XMQ L;  3J80 c;  4DNR B;  2BOS A;  2EYJ A;  1Y8O B;  3DWQ A;  4HR7 B;  2DN8 A;  4CDF C;  3I73 A;  1JOK A;  4IOA A;  3BVG A;  1J6Q A;  4C2M B;  1XNQ L;  2JEA I;  4HTH A;  3WDN A;  2BA1 A;  2EY5 A;  3OIQ A;  1KHI A;  1H9J A;  4I7Z C;  2PO4 A;  1VQH A;  4LF7 L;  2H1E A;  5M5X B;  4J8Q A;  4HSV A;  3HOY G;  3HOX H;  5CV5 A;  1K9M C;  1LT4 D;  4ABN A;  4POG A;  2K52 A;  5EBC A;  3VDY A;  2KCC A;  1IZ6 A;  3HP3 A;  2EPB A;  2J0T D;  3BZC A;  1SMY D;  1U9R A;  5C3X A;  1IYJ B;  1ET6 A;  1YHA A;  3T16 A;  5I6W A;  3MXP A;  3G6J B;  2PI2 E;  1Q1B A;  3PMF A;  3FKI G;  2QIL A;  1S5E D;  2L15 A;  2G9H D;  1O7L A;  1QZH A;  3E6Z X;  3TP6 A;  2JJQ A;  3D4R A;  2A68 D;  2VUM H;  4GLV B;  5DLQ E;  3GTO H;  1LTR D;  5KNB A;  3CCS A;  5KND A;  2NBF A;  4JCV E;  5KYL A;  5C4J B;  3PO2 H;  3IL8 A;  3DWA A;  1H95 A;  3RZO H;  2XRQ D;  1T5E A;  1Z6H A;  4HJA A;  3MXG A;  4C1N I;  4RGO S;  1NY4 A;  3H3V H;  4X65 L;  1EZ8 A;  4C3J B;  1SRU A;  4XTC S;  4MZ9 A;  2NUC A;  3Q6S A;  1NMG A;  3HFZ B;  4PV1 C;  4RMF A;  1NUC A;  4UHV A;  2JA8 H;  4LJZ C;  2ZJQ A;  3OTO L;  2UXD Q;  1ENF A;  3C3L A;  4DGZ A;  4JW0 A;  2D5D A;  2IX3 A;  1AE3 A;  1HA6 A;  3T53 B;  1JCK B;  2BCO A;  2B2V C;  2BDN A;  3AU7 A;  1QNK A;  1HPC A;  4M8A A;  2NVX H;  1LT6 D;  1IW7 C;  4QUF A;  4IFD J;  4J15 A;  2KBN A;  2F0P A;  1VQ4 A;  5FJ8 G;  5C44 H;  4NXN Q;  2DNE A;  1HJP A;  3NHH A;  5CBE E;  3RZO B;  2HD3 A;  2HHH L;  2A6E D;  1CK1 A;  1WCM G;  3PF4 A;  3K57 A;  3QWN A;  1CQF A;  4A3M G;  4F88 A;  5IT9 E;  4JI8 Q;  1I50 B;  1N33 L;  4QMG A;  3MFY A;  4K2K A;  1EWC A;  1L0Y B;  1IKM A;  1YZ6 A;  2F0H A;  3QOL A;  1B53 A;  3VR2 A;  1WTP A;  2YU9 B;  2NVX B;  5KEE A;  2H4O A;  3J7Y W;  3I4O A;  4A3L H;  3KBX A;  1O7Y A;  1YHB A;  3GTQ B;  4FO2 A;  1HHV A;  5M5W B;  2E74 C;  3PV0 A;  2JA7 B;  4JI3 L;  2ZTC A;  2EYP A;  4KHP L;  3K58 A;  2NZ1 D;  1KDB A;  4KHV A;  2VZA A;  3H09 A;  4KY5 A;  4ZLT F;  1X3F A;  3A74 A;  5M3F H;  4AQY Q;  3MC0 B;  4JBW A;  3MAQ A;  3EJI A;  1MGS A;  3I4M G;  1A0I A;  4A3E G;  2E2J B;  1S72 A;  1AH9 A;  2EVB A;  3D0F A;  5LHY 1;  4HAE A;  1KIX A;  2F0E A;  1EEF D;  1PLF A;  4GLX A;  1A62 A;  4OEL B;  2F3V A;  1F2Z A;  1CI3 M;  4JYA L;  2Q8R E;  3UDI A;  1SE8 A;  5DEH A;  3D4D A;  4DV6 Q;  2RCN A;  4C3I G;  3ND9 A;  4GOP A;  4A3J G;  1SYF A;  1TS5 A;  2MO0 A;  5IYD H;  1I6V C;  2GN5 A;  2QW7 A;  1RHP A;  3SEB A;  2LSS A;  3MHB A;  2JA6 B;  1SDF A;  5IYB G;  3EFX D;  1OXU A;  1EQV A;  1P8L A;  3L0O A;  3M7G A;  2ENB A;  1UE6 A;  4V0B A;  5LMN W;  4R8I A;  1W3S A;  1A6X A;  4LW1 A;  3W5O A;  3H0G B;  3V05 A;  4K5V A;  1M4V A;  4UY8 C;  1WVL A;  5EAY A;  5HGQ A;  2K14 A;  4K6D A;  5JEA J;  1E3P A;  1L0W A;  3NEL A;  3K5M A;  1FNU A;  4TRD A;  5J1Z A;  1F9Q A;  1OXT A;  1S5C D;  3GQB A;  5D65 A;  5EPK A;  5JOB A;  4GLA C;  3UE1 A;  5HGT A;  1E2V A;  3NTH A;  1S40 A;  1JE4 A;  2UXC Q;  1ML0 D;  3JAM E;  5JJZ A;  1S5F D;  2HT1 A;  3TS0 A;  3F2C A;  4TSS A;  2I0Q A;  2HHH Q;  3C2P A;  3AQQ A;  3TP8 A;  1M1K C;  2E5L L;  4WJ3 M;  1PH9 A;  4GN3 B;  1KLG D;  4XIG S;  3A8J E;  4JOI C;  2OTL A;  3PUX A;  2AHO B;  3CP0 A;  1SJE D;  2RHQ B;  3GTJ H;  1VQI A;  5IP9 H;  3PQI A;  2L1B A;  1TU2 B;  3Q8D A;  3STB D;  5A2Q E;  2LY7 A;  3PIO A;  4DUZ L;  3F8T A;  5EPL A;  3VYS A;  4EX5 A;  1I94 Q;  1LTA D;  1IL8 A;  3T1H Q;  1CKO A;  3MXN B;  1CA6 A;  1Y8P B;  4DFA A;  3BU2 A;  4GKK L;  2QDB A;  4DUY Q;  5ELF A;  2WP8 J;  4H7B A;  5CV7 A;  5C6A A;  2K1B A;  3A54 A;  3VR3 A;  3J81 L;  1U5K A;  4DAV A;  1KXL A;  3HS0 C;  3NE5 B;  1EOT A;  3T56 B;  2NVY H;  4F7X A;  2WB1 G;  4YWL A;  1SNM A;  1KTK A;  2J4X A;  3I3C A;  4JVZ A;  2CCZ A;  1L1O C;  1X55 A;  1G51 A;  1QVC A;  4QIW E;  1KNA A;  4XT1 B;  1K3R A;  4HED A;  4GN4 B;  3VYT A;  2TMP A;  4OWT B;  4OGQ C;  1NR2 A;  2WV6 D;  1SN8 A;  1TWC B;  1TWG B;  2C35 B;  1Q81 C;  5DNF A;  4X65 Q;  2UU9 L;  1C9O A;  1TXY A;  4E6I A;  5IGD A;  3TRE A;  3CHB D;  2UUA L;  1K83 B;  1OXV A;  1WD0 A;  2MP1 A;  2R93 B;  2YTX A;  5F2D A;  3HOU G;  4R4O A;  1HR0 L;  1S5B D;  3CCV A;  3GTQ H;  1H9K A;  2R61 A;  3ERS X;  4KLK A;  1SAP A;  1XYI A;  1J5E Q;  4XXE A;  1Y1W H;  4QJF A;  1YBY A;  4LF9 L;  4A3K B;  1LT3 D;  2K5D A;  2N78 A;  1SND A;  3CCR A;  4HIO A;  2E75 C;  5JVH 3;  1Q3L A;  5E4X A;  2AUJ D;  4DV0 Q;  2HQE A;  2KJX A;  4AYB E;  1YI2 A;  3IAY A;  3QOJ A;  4R4Q A;  2Z1C A;  1WJJ A;  2JE6 I;  2F0L A;  3U4V A;  2IJ0 A;  4A93 H;  2EYO A;  4JBJ A;  5FLX c;  1PH3 A;  4GOP B;  5D3I B;  2MPM A;  4QIW B;  2N49 A;  4DV3 L;  1EIH A;  1EL0 A;  2E5L Q;  1JC7 A;  1JJG A;  3SK8 A;  3FVQ A;  1UE7 A;  3I56 A;  3CW2 C;  1C7Y A;  1BBX C;  3S2H H;  2NVQ B;  5C4X H;  1ICW A;  5C0X H;  2EY1 A;  2UUC L;  5LL6 X;  4DUZ Q;  1X54 A;  1ZYR D;  4RCO A;  2JA6 G;  4K8J A;  1FYC A;  4JK1 C;  2R92 H;  2XTI A;  1B3Q A;  2RDG A;  4FNF A;  2Q8I B;  3CC7 A;  3FMC A;  3CCU A;  3QIA A;  2KOL A;  4DR1 Q;  4HJ7 A;  2NZO A;  3EN2 A;  3GTM B;  1PRT B;  2TSS A;  1K0S A;  4A93 B;  4R4I A;  1Y1V G;  2VNU D;  1STH A;  2CHB D;  4DR3 L;  4JI0 L;  1IBM L;  1STA A;  1STG A;  1I4G A;  1TWA B;  3GTG B;  2RQX A;  4X62 Q;  2B2W C;  3KFU A;  1B2T A;  3CKI B;  4CBV A;  2I5L X;  1PTO D;  3NTI A;  3UDG A;  1I4H A;  4JC0 A;  3L7Z C;  4A3D H;  4KTA A;  4YCV A;  1G29 1;  2L11 A;  2NN6 I;  1VQM A;  3E3X A;  1BCP B;  3GD7 A;  2J7Z A;  2A19 A;  1GM5 A;  1IYV A;  1HQM C;  4NXM L;  1KAW A;  2F0J A;  3NPP A;  1EQT A;  1EIF A;  5KGU A;  3OPO A;  4CDD C;  2Q8T A;  1A15 A;  1EY7 A;  1GUS A;  4DN4 M;  3S17 H;  1VQB A;  1FGB D;  2IHE A;  2K75 A;  4PZ6 A;  3S17 B;  4B3S L;  1PYB A;  1V8Q A;  1R9T B;  4P74 A;  3I8Z A;  4A3E B;  5HY6 A;  5BN4 A;  1GOZ A;  1GUN A;  1RDP D;  1YNN C;  4JI6 Q;  4JOI A;  1JB3 A;  4BY7 H;  1NSN S;  5D14 A;  1F9S A;  5E4W C;  4IPC A;  2EYH A;  1F9P A;  4JI1 L;  1EU4 A;  3GP7 A;  1I3Q B;  3T13 A;  4XT3 B;  4X6A H;  4HMI A;  2SEB D;  1FNV A;  3J81 E;  2F0M A;  1F2M A;  2RSN A;  2A6E C;  1HRJ A;  3PGZ A;  4ZKC B;  3J80 i;  3SDZ A;  5FLM G;  3PIP A;  2CKZ B;  1JMC A;  1J9O A;  2PPB C;  3D31 A;  3RR5 A;  1Y14 B;  3TSS A;  3LX0 A;  4Q0F A;  4O1N A;  3BDO A;  4A3K G;  1TII D;  3MXN A;  2F0K A;  3GTJ B;  2YTV A;  3G71 A;  4N8X 1;  1CUK A;  3SXH A;  3Q23 A;  1BR9 A;  1VQF A;  4I65 A;  2BH2 A;  2XWB B;  2EY6 A;  1GD7 A;  1AP0 A;  4X64 Q;  1HQR D;  2M2L A;  3IRB A;  5GQO A;  1TS4 A;  1K83 H;  1AN8 A;  2BDO A;  5HUR A;  4A3B H;  2CQA A;  3L9A X;  3K5N A;  3U9O A;  4JI0 Q;  2JA7 G;  1PH1 A;  1GHK A;  4C1N K;  3OWF A;  1W2B A;  3X3M A;  4A3C H;  4Y52 H;  1CT1 D;  4HIK A;  4B3R Q;  3NQT A;  3KLR A;  2KEC A;  4QCL A;  1RD9 D;  2M9V A;  2K50 A;  2XVS A;  3E9H A;  1TWF H;  3ULJ A;  2K5H A;  2V4D A;  4WOR A;  4K2L A;  2CQO A;  5C3E B;  3NEM A;  1BXT A;  1FNW A;  1PTO H;  1SNP A;  1QWY A;  3CAM A;  5EBD A;  4X3K A;  1M8A A;  5FO9 B;  4IUT A;  3J7Z C;  4RGM A;  1RF2 D;  3T4A C;  4DR7 Q;  1G8Z D;  2KCT A;  1D8L A;  1D6E C;  2JEB I;  4LAA A;  1L1O B;  3VYU A;  3PIP 3;  4PQX A;  3HOW G;  1PH2 A;  1NBW A;  5KYI A;  1L0X B;  2QA4 A;  1I6H B;  4RHR A;  2HUG A;  3GTK B;  4LF6 L;  1B44 D;  4NPS A;  1KQS A;  1LTL A;  3MVV A;  4DXF A;  4QGU A;  2SDF A;  4JYA Q;  1Y8N B;  4EQP A;  1JE5 A;  3A7L A;  2AQ1 B;  5BN5 A;  1N36 L;  4O42 A;  5FKA C;  4NP5 A;  2VQF L;  2B29 A;  2I5H A;  3K80 C;  3I91 A;  5FO8 B;  4KJO A;  3OHX C;  4DK0 A;  3NBH A;  2ZJR A;  4UAI A;  1X3P A;  2PMZ E;  5T1G A;  3KYH C;  2JA9 A;  4FP5 D;  4YWM A;  4IO9 A;  1GUO A;  3Q22 A;  4DR6 Q;  4YWK A;  2O5I C;  3A55 A;  1H9R A;  5BR8 Q;  1XJV A;  4BY1 H;  5BN3 A;  3HOY H;  3HOX G;  4UP7 A;  5M9O A;  3TS2 A;  4IZ8 A;  4DK3 C;  3AMU A;  3K8A A;  1TY0 A;  4HN7 A;  1VQN A;  1AE2 A;  3P75 A;  4X66 Q;  1Q1E A;  3W1G A;  1E7Z A;  1SE3 A;  4XQQ A;  3FRP B;  3CU7 A;  3H3V C;  4PMB A;  2R7Z G;  2CW0 C;  4DKA C;  4BY1 B;  2PNH A;  2VUM G;  1VQA A;  4ZAI A;  1B8A A;  4EVO A;  5D3D A;  3S14 H;  5C5M A;  3WOE A;  1J8I A;  4B3R L;  3QB3 A;  1SYD A;  3PIO 3;  4LF8 Q;  2A8V A;  3I4L A;  4A3I H;  5C4X B;  5AJ3 L;  3CC4 A;  3PUY A;  3T51 B;  5DM6 3;  2AWO A;  3Q24 A;  4NDX A;  3GTM H;  3HOY B;  1FJG Q;  1STY A;  3R3O A;  3JC6 6;  1WOC A;  3BDL A;  3I55 A;  2JA8 G;  2E2J H;  4RCN A;  2F0G A;  4XDX A;  3TZU A;  4A3G G;  3NK9 A;  2ASB A;  1IYU A;  1PV4 A;  2GVA A;  2A6H D;  4OX9 L;  4NW2 A;  3M4O B;  1VMC A;  1PYW D;  1RTO A;  3H91 A;  4DUY L;  1PVO A;  2CW0 D;  1JT8 A;  1YHQ A;  4JBK A;  4FXD A;  4DR4 L;  4JI5 L;  4BS9 A;  3HOV H;  5FJ8 H;  5C44 G;  1KAA A;  1DJR D;  2B2Y C;  1K8M A;  5FLX L;  1VF5 C;  1QUQ B;  2GA4 B;  4P72 A;  1C8C A;  3SHL A;  3R8B A;  4GS3 A;  4IUU A;  5C3E G;  5CR3 A;  1WCM H;  1C0A A;  5LL6 S;  2ZXO A;  3CPW A;  3S1Q H;  3S1R H;  2F0W A;  1I4P A;  1Y69 U;  3A8I E;  2VQF Q;  2XGT A;  1HNX Q;  1PDQ A;  1XMO Q;  3HGB A;  4H13 C;  3A0J A;  3BYT B;  1PMR A;  2LFN A;  4IPG A;  3J81 j;  1ZEQ X;  4GOP C;  3I4N H;  2VB3 X;  1B7Y B;  5CV9 A;  2A69 D;  1GHJ A;  3PSI A;  2EXD A;  4ALP A;  2JA5 G;  1WTV A;  1LTG D;  3ZJY C;  1CA5 A;  5M3F G;  3UE0 A;  2Z6K A;  3CRL C;  3PF5 A;  1HR0 Q;  1SFO B;  1ENA A;  3M4Y A;  1JWU D;  3FHW A;  4DU9 A;  3J7A 5;  4PMW A;  2AQ3 B;  1UE1 A;  2L4N A;  3CQZ B;  1PHJ A;  2NB0 A;  4X66 L;  5J22 A;  4IFD G;  2QCP X;  1VQ8 A;  2RHS B;  1DCZ A;  2LXK A;  3ULL A;  4ULL A;  2XRS D;  1V1O A;  4K0K L;  4GKJ Q;  3IFD A;  4OL7 A;  5IYD G;  2SNS A;  4MN3 A;  2YTY A;  1STE A;  1ILQ A;  3LWU A;  1LT5 D;  3OMG A;  3BJU A;  4JBM A;  1U4R A;  5IYB H;  4P73 A;  1BDO A;  1XPU A;  1X6O A;  1V9P A;  1DON A;  1PH8 A;  3URY A;  1EOV A;  4BBS B;  2WII B;  5DM7 3;  4AYB B;  3HOX B;  3QO2 A;  3IFT A;  4LF5 L;  2WIN B;  3KF6 A;  2ZTD A;  4BY7 B;  3NBI A;  1NJI C;  2K03 A;  5EKI A;  2MUY A;  5CBA E;  4JG2 A;  4UP8 A;  1RTN A;  1I3Q H;  3CXC A;  1RL2 A;  4A3F H;  2NVT H;  5CC4 A;  3S1M B;  1TY2 A;  1R9T H;  4OON A;  2R93 G;  2DGY A;  1VQ7 A;  1T9H A;  4U68 A;  2B2V A;  4MTN A;  4P75 A;  3SVM A;  1SNQ A;  2ES2 A;  2NVT B;  4CKC A;  1BCP C;  4OO1 G;  2EJG C;  1VS0 A;  5M5X H;  1LTS D;  2E2I B;  3P7J A;  4CKE A;  4JI5 Q;  1PXU A;  4DPG A;  2O2L D;  2PW7 A;  4PZ8 A;  4JV5 Q;  2ZM6 L;  1H9M A;  1LTI D;  2MQH A;  2UU9 Q;  4HID A;  3S9W A;  5GAE C;  2DJG C;  3SK5 A;  3M3Y H;  3J81 i;  4BBS H;  5EKK A;  3RNU A;  1BVS A;  2IL8 A;  4TKO B;  2KED A;  3NXW A;  2OQK A; 
#chains in the Genus database with same CATH homology
 2MO1 A;  1XNR L;  1SMX A;  1VQL A;  2IX1 A;  1VQG A;  2VQE Q;  1Q46 A;  1UE7 A;  3I56 A;  1GKH A;  2CWP A;  3CW2 C;  3E9I A;  3RLN A;  1C7Y A;  1IBL Q;  2UUB L;  3S2H H;  5C4X H;  4DV5 Q;  1FGU A;  2UUC L;  4DV4 Q;  2HIV A;  3S1N H;  1E24 A;  2B63 H;  2F4V Q;  3I4N G;  4DUZ Q;  3NEN A;  1J5E L;  5FLM H;  3KLW A;  1QVG A;  1X54 A;  3AYH B;  5IYC G;  5BR8 L;  3PUZ A;  2JA6 G;  2K5N A;  5J3B A;  4DK6 C;  4LNQ A;  2JA5 H;  2Q2H A;  2Q2I A;  4HIM A;  1HNW L;  4A3K H;  2R92 H;  2XTI A;  1IXR A;  1UE5 A;  2NZH A;  4FDB A;  4POF A;  3CC7 A;  2B3G A;  2UXD L;  4Y7N H;  3RLO A;  1FL0 A;  3CCU A;  2IHF A;  4B3T Q;  5M3M H;  3K81 C;  4HJ7 A;  2NZO A;  4L5T A;  5LMU Q;  4DR1 Q;  3HKS A;  2NVQ H;  3PO3 H;  3EN2 A;  2UXC L;  1DGS A;  3FKI H;  4R4I A;  3I7F A;  1N34 L;  3GTG H;  1Y1V G;  2VNU D;  3W1B A;  4DR3 L;  4JI0 L;  1IBM L;  2D0P A;  1MJE A;  1U0L A;  1YIJ A;  5GAH C;  2OCE A;  1GO3 E;  3PCO B;  3L2P A;  1PYS B;  1VQC A;  1K73 C;  1K0R A;  2EIF A;  3ER0 A;  4X62 Q;  2WFW A;  5JEA G;  2WB1 E;  3G4S A;  4DV3 Q;  3KFU A;  3PO2 G;  3RZD H;  1XNR Q;  3OW2 A;  5ELN A;  2N8N A;  3RLF A;  2HQL A;  2I5L X;  1VCI A;  1CKN B;  3UDG A;  2KCM A;  5GRO A;  3I2Z A;  5GAD C;  2PQA A;  2D62 A;  4JC0 A;  3G6E A;  3L7Z C;  4DV4 L;  2UUC Q;  3HOZ H;  4A3D H;  4JI8 L;  4YCV A;  1N36 Q;  1E1T A;  1G29 1;  2KHJ A;  2NN6 I;  4H02 A;  1VQM A;  2IX0 A;  2HIX A;  3GD7 A;  1K8G A;  1YIT A;  1XTD A;  3KJP A;  4R4T A;  4LFA L;  2A19 A;  1GM5 A;  4DR7 L;  1FJG L;  1EIY B;  3ICE A;  2OWO A;  1KRS A;  3HOU H;  4NXM L;  2NN6 G;  1VQD A;  1O7I A;  3LGJ A;  4LF5 Q;  2UXB Q;  2RF4 A;  4KI0 A;  1KAW A;  4IJL A;  4A4I A;  3CMA A;  4DV7 Q;  3T1Y L;  4DR6 L;  1N32 Q;  5JJL A;  1EIF A;  1KD1 C;  4JI3 Q;  4L5R C;  4A3F G;  4A75 A;  2YYZ A;  5ELO A;  3TRZ A;  1Y1W G;  4KHP Q;  2R93 H;  2Z6K C;  3S17 H;  4TVA B;  4DV1 Q;  3KJO A;  3EBE A;  1M90 C;  4IFD I;  1VQB A;  3GO5 A;  4AQY L;  4B3M L;  3ULP A;  3HOW H;  4DR4 Q;  3GTL H;  1KL9 A;  4BBR G;  5IT9 c;  2IHE A;  2K75 A;  4PZ6 A;  5IE8 A;  4BXX G;  4B3S L;  1PYB A;  3KF8 B;  3UDF A;  3JAM c;  3RN5 A;  4P74 A;  5HY6 A;  3H3V H;  1E22 A;  1Q8K A;  3STB C;  3NBH B;  2IT1 A;  2Y0S E;  3M4P A;  5E7N A;  4A76 A;  4GNX B;  1SLJ A;  3CQZ H;  3KF6 B;  3J81 c;  4JI6 Q;  2AMC B;  4NB3 A;  4JOI A;  3S16 H;  3E0E A;  2CWA A;  2QEX A;  4A3M H;  4BY7 H;  1CSQ A;  3M9B A;  2Q2U A;  4BBS G;  1XMQ L;  3J80 c;  4IPC A;  4DAM A;  1EQR A;  4JI1 L;  3AFP A;  3U4Z A;  4IOA A;  1J6Q A;  3EIV A;  1XMO L;  1XNQ L;  2WAQ E;  4DV2 Q;  1TWG H;  2JEA I;  2MFI A;  4X6A H;  2N3S A;  1ASY A;  4A3L G;  2BA1 A;  4C3H H;  4DNI A;  5C0X G;  5C4X G;  1KHI A;  3T1H L;  1NMF A;  2JQO A;  3TEH B;  3M4O H;  1LUZ A;  3CME A;  3DM3 A;  3PGZ A;  1VQH A;  2VS1 A;  5M5Y H;  3J80 i;  4LF7 L;  2BH8 A;  5FLM G;  3PIP A;  2CKZ B;  2Y0S G;  1JMC A;  3HOX H;  3HOY G;  5IYC H;  1K9M C;  3D31 A;  3RR5 A;  4DV1 L;  4POG A;  1Y14 B;  2K52 A;  4LFB L;  3VDY A;  4A3K G;  5IY0 A;  1IZ6 A;  4YHH L;  2R92 G;  3HKZ E;  3RN2 A;  1YEZ A;  2YTV A;  3I4M H;  3BZC A;  3G71 A;  1JJ2 A;  4A3E H;  3S2D H;  1IYJ B;  1YHA A;  4P71 A;  3G48 A;  1TWC H;  1CUK A;  2CFM A;  2LXJ A;  3PO3 G;  4OX9 Q;  1NE3 A;  2FXQ A;  1VQF A;  2BH2 A;  2PI2 E;  1Q1B A;  4B3T L;  4JI2 Q;  1GD7 A;  3FKI G;  4X64 Q;  2ZM6 Q;  3K7U C;  3IRB A;  5GQO A;  1HZ9 A;  4R4C A;  1K83 H;  2L15 A;  1QZH A;  4A3B H;  4JI0 Q;  4RG1 A;  4C3I H;  2JJQ A;  1IBM Q;  4A3J H;  1PH1 A;  4LF4 Q;  2JA7 G;  2VUM H;  1A63 A;  4GLV B;  5DLQ E;  3GTO H;  4MNO A;  1W2B A;  1SFO H;  3CCS A;  4A3C H;  2Q2T A;  4JCV E;  4Y52 H;  4HIK A;  4B3R Q;  3PO2 H;  3CCE A;  4YCW A;  4C2M H;  1H95 A;  3UDX A;  3RZO H;  1IL2 A;  2PI2 A;  4HJA A;  1EYG A;  2QGQ A;  2K50 A;  1NY4 A;  1HZB A;  3E9H A;  1TWF H;  3ULJ A;  4X65 L;  3CCJ A;  2K5H A;  5IWA L;  1VQ9 A;  2DUD A;  4QL5 A;  1I50 H;  2WAQ G;  3CF5 A;  2F4V L;  2CQO A;  3S1M H;  3NEM A;  1SRU A;  2OQ0 A;  4XTC S;  4MZ9 A;  1NMG A;  4DR5 L;  2UUA Q;  3HFZ B;  3CAM A;  1HNX L;  4IPH A;  1VQJ A;  3J7Z C;  4PG3 A;  4RMF A;  4YHH Q;  5LMN L;  1X9N A;  2JA8 H;  2ZJQ A;  3OTO L;  1BBU A;  3PUW A;  4DR7 Q;  2UXD Q;  3GTK H;  3MEF A;  3U58 A;  4OXP A;  1CSP A;  1B70 B;  4JI7 Q;  1OXS C;  2KCT A;  4QQB X;  1I94 L;  1FVI A;  1TWA H;  1AE3 A;  1D8L A;  2JEB I;  1P16 A;  1YNX A;  1L1O B;  4DR3 Q;  2KHI A;  1JJC B;  2F52 A;  2OTJ A;  2F3I A;  3HOW G;  2ZTE A;  1GVP A;  2NVX H;  4L5Q A;  1PH2 A;  2R7F A;  1NBW A;  4LF4 L;  1UEB A;  4IFD J;  4J15 A;  4BXX H;  2KBN A;  4DR2 L;  2QA4 A;  1VQ4 A;  5FJ8 G;  1E1O A;  5C44 H;  4NXN Q;  1HJP A;  4LF6 L;  4B3S Q;  4NPS A;  3H15 A;  1KQS A;  1LTL A;  4KHZ A;  4YCU A;  4IJH A;  4QGU A;  2E2I H;  2HHH L;  4JYA Q;  1HNZ L;  1WCM G;  3KDF A;  1JE5 A;  3PF4 A;  4A3M G;  4BY7 G;  5JJK A;  4DV6 L;  3K7A H;  5IWA Q;  4JI8 Q;  1N36 L;  1N33 L;  1YZ6 A;  2VQF L;  2B29 A;  2I5H A;  3K80 C;  1QVF A;  1Q12 A;  4DR5 Q;  1JB7 A;  4LFA Q;  1X56 A;  2VQE L;  3TQY A;  5C0X J;  2ZJR A;  1VQP A;  2PMZ E;  5IP9 G;  1N9W A;  1EFW A;  1IBL L;  3KYH C;  1PA6 A;  2JA9 A;  3I4O A;  4A3L H;  4YWM A;  1YHB A;  3AFQ A;  3H3V I;  4IO9 A;  1HZA A;  5AJ3 Q;  4DR6 Q;  1N32 L;  4YWK A;  1YJN A;  1VQ5 A;  3PV0 A;  4LUV A;  4JI3 L;  2ZTC A;  5BR8 Q;  4UP9 A;  4LUO A;  1XJV A;  4R1J A;  4BY1 H;  1BKB A;  4UPA A;  4AYB G;  3HOX G;  3HOY H;  4GKK Q;  4KHP L;  4UP7 A;  1Z9F A;  1L1O A;  2VZA A;  3TS2 A;  2ATW A;  1X3F A;  3A74 A;  4DK3 C;  5M3F H;  4AQY Q;  3K8A A;  4JBW A;  3CC2 A;  1HR0 W;  1VQN A;  3I4M G;  2KEN A;  4DR1 L;  1A0I A;  4A3E G;  1AE2 A;  4DR2 Q;  1S72 A;  1AH9 A;  3D0F A;  4X66 Q;  1KIX A;  1Q1E A;  4GLX A;  3W1G A;  1A62 A;  1E7Z A;  1V1Q A;  4K0K Q;  2AWN A;  2R7Z G;  4JYA L;  3UDI A;  1SE8 A;  3S24 A;  1Q82 C;  4DKA C;  1PH6 A;  4DV6 Q;  4A3B G;  2RCN A;  2JA7 H;  1WYD A;  2PNH A;  4GOP A;  4A3J G;  2VUM G;  1VQA A;  1B8A A;  1EWI A;  2MO0 A;  3SGI A;  5IYD H;  3CCM A;  3S14 H;  4A3C G;  4BA1 I;  4O2D A;  4DV0 L;  2GN5 A;  4BA2 I;  1YJ9 A;  4GNX A;  3GTP H;  2LSS A;  4B3R L;  4LF8 Q;  1WFQ A;  5IYB G;  3H0G G;  1OXU A;  2A8V A;  3CCL A;  4A3I H;  3CCQ A;  2ALY B;  3FP9 A;  5AJ3 L;  3CC4 A;  1P8L A;  3L0O A;  3PUY A;  1ASZ A;  4JI4 L;  4LF7 Q;  2AWO A;  1UE6 A;  5GAG C;  3GTM H;  3F2D A;  5LMN W;  1QZG A;  1W3S A;  1FJG Q;  4LW1 A;  3W5O A;  3JC6 6;  1WOC A;  3I55 A;  3M85 A;  2E2J H;  2JA8 G;  4UY8 C;  5EAY A;  1KRT A;  5HGQ A;  4GN5 A;  1UWV A;  4OWX B;  4IPD A;  4A3G G;  2K14 A;  4LFC Q;  2ASB A;  2GVB A;  4GNX C;  1VQO A;  1PV4 A;  4PZ7 A;  5JEA J;  1X3G A;  1E3P A;  2GVA A;  1L0W A;  4DV7 L;  4OX9 L;  4DAY B;  4JI7 L;  3NEL A;  4LF9 Q;  2K5V A;  4JI2 L;  2AKW B;  1X65 A;  1K8A C;  1OXT A;  4B3M Q;  1WI5 A;  4DUY L;  1PVO A;  2JK8 A;  4GLA C;  2IY5 B;  1JT8 A;  1SRO A;  1YHQ A;  3UE1 A;  4JBK A;  4DR4 L;  1RIP A;  4JI5 L;  1LM0 A;  3HOV H;  1MKH A;  5FJ8 H;  3M7N A;  5C44 G;  1S40 A;  3OYY A;  1YJW A;  5LMU L;  2UXC Q;  3U50 C;  4LF8 L;  1N34 Q;  3TS0 A;  2HT1 A;  1QUQ B;  4P72 A;  3F2C A;  1C0A A;  4GS3 A;  2I0Q A;  2VY3 A;  1A8V A;  1WCM H;  5C3E G;  2Z0S A;  2VW9 A;  2D0O A;  3GDE A;  1XPR A;  2HHH Q;  3F1Z A;  5IP7 H;  4A93 G;  5JJI A;  1HNZ Q;  3AQQ A;  3K0X A;  1M1K C;  4QY7 A;  3CPW A;  2E5L L;  4WJ3 M;  3S1Q H;  1PH9 A;  5K36 G;  2R6G A;  3DLL A;  1V43 A;  3S1R H;  4GN3 B;  4XIG S;  1XMQ Q;  2E8G A;  4HJ8 A;  2OTL A;  4JOI C;  1OXX K;  3PUX A;  3CP0 A;  2AHO B;  2RHQ B;  2XGT A;  3M4Q A;  2MNA A;  3GTJ H;  1VQI A;  5IP9 H;  2VQF Q;  1HNX Q;  3OTO Q;  1CKM A;  1SR3 A;  5C4J H;  3Q8D A;  3STB D;  4DV2 L;  1XMO Q;  4LFC L;  3A0J A;  3PIO A;  4DUZ L;  4EQ5 A;  3F8T A;  4IPG A;  4YY3 Q;  3J81 j;  4EX5 A;  1I94 Q;  4GOP C;  4OWW B;  2B63 G;  3T1H Q;  4BY1 G;  3AEV A;  1B7Y B;  1CKO A;  3I4N H;  3MXN B;  3PSI A;  2EXD A;  3BZK A;  4ALP A;  1XPO A;  2JA6 H;  2JA5 G;  3BU2 A;  3ZJY C;  4GKK L;  5M3F G;  4DUY Q;  3UE0 A;  2Z6K A;  1IBK L;  2WP8 J;  3PF5 A;  1HR0 Q;  1I5F A;  1MJC A;  1S3O A;  1U5K A;  3FHW A;  1KXL A;  4TQU S;  1Q7Y C;  1NTG A;  2V1C C;  4PMW A;  5M3M G;  3J7A 5;  1UE1 A;  4HJ5 A;  4LF6 Q;  2VL6 A;  4C3J H;  1PHJ A;  2NVY H;  1G6P A;  4X66 L;  5C0X I;  4IFD G;  2WB1 G;  4YWL A;  1VQ8 A;  2RHS B;  2LXK A;  2CCZ A;  1Y1V H;  1X3E A;  3ULL A;  2R7Z H;  1L1O C;  1X55 A;  1G51 A;  1QVC A;  4QIW E;  4K0K L;  4LUZ A;  1HH2 P;  4GKJ Q;  1K3R A;  1N33 Q;  4GN4 B;  2K4K A;  5M5W H;  1VQK A;  2A1A A;  1PFS A;  5IYD G;  1N8R C;  4OWT B;  1VQ6 A;  2YTY A;  1D7Q A;  1QUQ A;  1SN8 A;  1PH7 A;  2C35 B;  3BJU A;  1Q81 C;  4JBM A;  4IOC A;  4JV5 L;  5IYB H;  4X65 Q;  3H0G H;  4HJ9 A;  1KC8 C;  4P73 A;  2UU9 L;  1MIU A;  1X6O A;  4A3I G;  4JI6 L;  1C9O A;  1TXY A;  1V9P A;  1XPU A;  4WJ4 A;  4YY3 L;  1L2F A;  2ZJP A;  1PH8 A;  4A3D G;  3HOZ G;  1OTC A;  3TRE A;  1EOV A;  4LWC A;  2UUA L;  1Q86 C;  4AH6 A;  4JI1 Q;  5LMN Q;  1CKN A;  2I5M X;  1OXV A;  4NXM Q;  2YU9 H;  1BBW A;  4LF5 L;  2UXB L;  2YTX A;  1IBK Q;  3T1Y Q;  3KF6 A;  2ZTD A;  4R4O A;  1HR0 L;  3HOU G;  2ID0 A;  1NJI C;  1I6H H;  3PUV A;  3F2B A;  3CCV A;  2UUB Q;  3GTQ H;  4A3G H;  4ME3 A;  4DV5 L;  4JG2 A;  4UP8 A;  3ERS X;  4KLK A;  1PH4 A;  1I3Q H;  4L5S A;  3CXC A;  1RL2 A;  3HKZ G;  4A3F H;  1J5E Q;  2NVT H;  1R9T H;  4OON A;  1Y1W H;  4QJF A;  1YBY A;  2R93 G;  3JAM i;  1EUJ A;  4LF9 L;  3CD6 A;  1LYL A;  2DGY A;  4LFB Q;  4O0A A;  1VQ7 A;  1T9H A;  1HNW Q;  1VQE A;  4MTN A;  4P75 A;  4GKJ L;  2ES2 A;  2N78 A;  3CCR A;  4OO1 G;  4BBR H;  3B6Y A;  4NXN L;  1VS0 A;  5M5X H;  4HIO A;  3S15 H;  1HZC A;  3A5Z B;  3HOV G;  2PQA B;  1Z47 A;  2EQS A;  2H5X A;  4DV0 Q;  4JI5 Q;  2E2H H;  2YV5 A;  4DPG A;  4AYB E;  4PZ8 A;  1YI2 A;  1TWH H;  3KOJ A;  4OO1 I;  5H1S E;  1EQQ A;  4R4Q A;  4X64 L;  2ZM6 L;  2MQH A;  4JV5 Q;  2UU9 Q;  1WJJ A;  4HID A;  2JE6 I;  1YVC A;  5C3E H;  5GAE C;  3U4V A;  4A93 H;  4JI4 Q;  5IP7 G;  4JBJ A;  5FLX c;  3J81 i;  3A5U A;  3M3Y H;  4BBS H;  4AIM A;  3CPF A;  4GOP B;  3KDF B;  3RNU A;  1BVS A;  2R7D A;  1PH3 A;  3WWV A;  1PH5 A;  2N49 A;  4X62 L;  4DV3 L;  4APV A;  1XNQ Q;  2E5L Q;  1JJG A;  2OQK A;  2BA0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...