2Z6KC

Crystal structure of full-length human rpa14/32 heterodimer
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
117
structure length
117
Chain Sequence
VDMMDLPRSRINAGMLAQFIDKPVCFVGRLEKIHPTGKMFILSDGEGKNGTIELMEPLDEEISGIVEVVGRVTAKATILCTSYVQFKEDSHPFDLGLYNEAVKIIHDFPQFYPLGIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Replication protein A 32 kDa subunit
publication title Structure of the Full-length Human RPA14/32 Complex Gives Insights into the Mechanism of DNA Binding and Complex Formation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Replication
total genus 22
structure length 117
sequence length 117
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF08661 Rep_fac-A_3 Replication factor A protein 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2z6kC00
4DR1L 5IYDH 3CPWA 3UDGA 4B3ML 4LW1A 4HJ9A 1YNXA 2R6GA 2JE6I 1V1QA 4NB3A 1C9OA 1QUQB 2VW9A 1GO3E 4POGA 1HZBA 2WP8J 4BY1G 2A1AA 1Q46A 1XNQQ 2Q2UA 3K0XA 4DV7Q 1WJJA 2E8GA 3JAMi 5GAHC 5AJ3Q 3HOXG 4B3RL 1H95A 1XMQL 2JA5G 1QVFA 2JQOA 2VNUD 3HOWH 1KRSA 5FLMH 1XNRL 1WCMH 3J80c 4LF6Q 4DR2Q 4A3KH 3L7ZC 1BBUA 2UUAL 1HNWQ 1XMOL 2RCNA 4YHHL 4A3IH 3K8AA 2VS1A 3G48A 1PHJA 4KHPQ 2UXBL 2JA6H 1VQIA 4RMFA 2R92H 4HJ7A 3H3VI 1FL0A 2WAQG 1Q86C 1N32Q 3KLWA 2HIVA 3ER0A 5IE8A 2E2HH 3KF8B 3GDEA 3WWVA 1NY4A 5GADC 5IP7H 1VQOA 1I6HH 2OCEA 4DV5L 3S17H 4WJ3M 3PF5A 3S2HH 3S1NH 2HHHL 2IX0A 2QEXA 2V1CC 1Y1WG 3JC66 1UEBA 3BZCA 3A74A 1XNRQ 3HOVG 4GLXA 1UE1A 4IJHA 1PH5A 4A3DH 2UUAQ 1LM0A 1X3GA 3GTKH 4JV5Q 1AE3A 2ZTEA 4YHHQ 2UXDQ 1QUQA 3HOUH 3S15H 3CD6A 2UXCL 2UUBL 1KHIA 3RZDH 1KRTA 1PH7A 1YVCA 4JOIC 3KJPA 1TXYA 1NTGA 1CKNB 1MKHA 3RZOH 1K9MC 1LUZA 2Z0SA 5C44G 5BR8L 1MJCA 3G71A 2HQLA 3ICEA 4K0KQ 4LFAQ 1RIPA 4HIDA 1HZ9A 1K3RA 4A3GH 2JJQA 4PG3A 3W5OA 2DUDA 2Z6KA 3J81c 4A3MH 2IY5B 2HIXA 3B6YA 1CUKA 3NENA 5C0XJ 3A5UA 4L5SA 5IYDG 4KI0A 2KCTA 2BH2A 2K4KA 1YHAA 4QJFA 4JI1L 3CMEA 2UUBQ 1EQQA 2I5MX 3U58A 1JJ2A 3PF4A 4QIWE 1RL2A 2R92G 1E1OA 4JI7Q 2ZJRA 4B3SL 3NELA 1VQGA 2H5XA 3T1HQ 5E7NA 3HOWG 3OTOQ 4GN5A 1L0WA 5FLMG 4J15A 4L5RC 1WCMG 3E9HA 4A3KG 1NMFA 2B3GA 2NVXH 3STBD 4JG2A 2RHSB 4A75A 1UE5A 4A3IG 1KIXA 4BXXH 1L2FA 2F3IA 4AYBG 2JA6G 4NXNL 4GKKL 3HOYH 2MQHA 1CKNA 2LXKA 5HGQA 1Q81C 4JI1Q 1C0AA 3EIVA 3F2DA 4LF8L 4R4CA 5IP7G 4ALPA 1HR0L 3MXNB 4LF5L 1FJGQ 5JJIA 1A63A 1JT8A 1X3FA 3S1QH 5C0XI 1JB7A 3J7A5 4R4OA 3TEHB 3AEVA 1X65A 1YEZA 2ES2A 4A4IA 5FLXc 2UUCQ 1EOVA 3NBHB 1KQSA 4A3DG 5JJKA 1R9TH 3LGJA 4TQUS 5IP9H 4AH6A 2N78A 4DAYB 2I5LX 3H3VH 4O0AA 2OQKA 4R4QA 2NVQH 3HOUG 4R4IA 4JI8Q 2AMCB 1E22A 2ATWA 4OXPA 4DV1L 4JYAQ 5C4JH 2Q2IA 1IBML 3L0OA 2ZM6L 4LF5Q 2GVAA 4X65Q 2I0QA 4APVA 3S1RH 1JMCA 1VQ7A 1YITA 5FJ8H 3IRBA 1YJWA 5C3EH 1CSQA 4A3MG 1VQKA 1WI5A 2K5HA 4X62Q 4JI5Q 3RLNA 2F52A 1XNQL 4A76A 3RR5A 5AJ3L 3PUVA 4OWWB 1G51A 1VQNA 1GM5A 2B29A 4LF9Q 1SR3A 1SRUA 2UU9Q 4DR4L 1KC8C 2NN6I 2ZM6Q 1WYDA 1Y1VH 5IY0A 3CF5A 4JBJA 4DUYQ 4DR2L 4AQYQ 1IBKQ 4LF6L 3PSIA 1HNWL 1FGUA 1OXSC 3AFPA 2EXDA 3D0FA 2E5LL 4DR6Q 1EFWA 1PFSA 3I4OA 4YY3Q 2R7ZH 1GKHA 1N32L 3S16H 4DAMA 1PH8A 1OXXK 4HIOA 3TS2A 4HIKA 4BXXG 3ULJA 1QZHA 4JC0A 4JBMA 1OXTA 3HOYG 1TWHH 1UE7A 3CCRA 1NJIC 1UWVA 2D0PA 2B63H 3H0GH 4DR4Q 1A8VA 1J6QA 4JI2Q 1N8RC 1CKOA 4JV5L 1PYBA 2MO0A 2LXJA 5JEAG 4GKKQ 4GNXC 1UE6A 1VQCA 2UXDL 4X66Q 4BBSH 5GAEC 2E5LQ 2OWOA 1HZAA 4WJ4A 2FXQA 4GOPA 1Q7YC 4P71A 4A3JH 1IBLQ 2OTJA 1D7QA 1LTLA 3CC4A 2Y0SE 2MFIA 2PMZE 2N3SA 2K5NA 1SN8A 1XTDA 4R4TA 5IT9c 5LMNL 5IP9G 1BBWA 4L5TA 1EIFA 4JI6Q 1DGSA 4KLKA 5LMUQ 1JE5A 1CSPA 4K0KL 5JJLA 5M5YH 4LFAL 3I7FA 3RLOA 1HNXL 1G6PA 2ASBA 1GD7A 4IJLA 5HY6A 4LUOA 3FP9A 4HJ8A 3MEFA 2RF4A 5IYBH 1K83H 1U0LA 3RN5A 5FJ8G 3CCSA 4DUZQ 4LUVA 4UP9A 4DR3Q 3F2BA 2KCMA 5C3EG 3TREA 4DV3Q 1B8AA 4H02A 2YYZA 4A3EH 1NMGA 1XPUA 2N8NA 3U4VA 3G6EA 1W2BA 5LMNQ 2JA9A 3HKZE 3BJUA 1N34Q 3NEMA 1OTCA 4JI7L 2K52A 1VQHA 4AYBE 4MZ9A 4YCVA 2R7DA 2R93H 3SGIA 4NPSA 4X64Q 4JBKA 4DV0Q 3T1HL 4LF4Q 3OTOL 1HNXQ 1YI2A 1SMXA 3DLLA 3STBC 1Y1VG 4OWXB 3KFUA 1EIYB 3G4SA 3Q8DA 2PI2E 3AQQA 2VQEQ 1VCIA 5M3MH 1N9WA 2Y0SG 3KOJA 3JAMc 4DK6C 2VL6A 5DLQE 1E1TA 4DKAC 2R7ZG 4GNXB 3S14H 4BBRH 1XJVA 3CAMA 2Q2TA 4IFDJ 1FJGL 3AYHB 1I5FA 2KENA 2Q2HA 2YV5A 2B63G 1EWIA 3H0GG 4MNOA 1X6OA 1AE2A 1QZGA 2UUCL 3CCVA 2NZOA 4P72A 2RHQB 1NBWA 4BA2I 1ASZA 4JI4L 1KL9A 3HKZG 3T1YQ 3CCEA 4Y52H 4BBSG 1PYSB 1Q12A 1HR0W 4JI8L 4A3JG 2F4VQ 3J7ZC 3ULPA 4JYAL 1K73C 1FVIA 4JI0L 1SE8A 1VQEA 4X65L 1VQAA 5J3BA 2GN5A 2I5HA 1MIUA 3FHWA 1K0RA 4IPGA 2D0OA 4GKJQ 1IZ6A 4C3HH 1VQJA 2AWOA 3GO5A 4MTNA 4JI5L 4X62L 3GTPH 5C0XG 4LFBL 4LWCA 5IYBG 4IFDI 4GNXA 4XTCS 4JI4Q 2K50A 4A3FH 3CQZH 2E2JH 3K7AH 3I55A 4BY7H 4DR7Q 2ID0A 5IWAL 2ZJQA 4LF9L 4A3EG 4HIMA 3ERSX 4JBWA 2UU9L 4L5QA 1IL2A 3CMAA 1A62A 4JI0Q 1OXVA 4DUYL 4HJ5A 1IBKL 1C7YA 4AQYL 2KBNA 5C4XH 4A3BH 1N36L 4YCWA 2R93G 3UDXA 4DV6Q 3CXCA 1PA6A 3PIOA 2C35B 4DV4L 5M5XH 4DR6L 4EQ5A 1V43A 4YCUA 1HNZQ 4JI3L 4YY3L 1VQLA 1V9PA 1N33Q 3VDYA 5M3MG 4LFBQ 2YTXA 1TWAH 2K75A 3CP0A 3J80i 3UDFA 2IX1A 2NVTH 1A0IA 3UDIA 1E24A 5IWAQ 1S40A 4LF7Q 2GVBA 4BBRG 4DR5Q 4NXMQ 4JOIA 5GAGC 3K81C 4JI2L 4QQBX 4C2MH 1X9NA 3S1MH 4C3JH 4GLVB 3E9IA 3I2ZA 1PH6A 3M7NA 1PVOA 1Q1EA 4DV2Q 2N49A 4UPAA 3PUZA 3U50C 2Z6KC 1IXRA 1JJCB 1VQDA 1N36Q 2NN6G 2AKWB 1Z9FA 3M4QA 1MJEA 3A0JA 4X66L 1L1OC 2YTYA 2XTIA 5ELNA 3TQYA 4DV4Q 3HKSA 3RLFA 3I4NH 1QVCA 2IT1A 1IBLL 1XPOA 4R1JA 4JI3Q 2VQFL 3GTQH 3CCMA 1E3PA 1VQ4A 4A3CH 5K36G 3GD7A 4PMWA 3PUWA 4JI6L 4QY7A 5LMUL 2EIFA 1YIJA 1SLJA 3PUXA 1ASYA 3E0EA 1I50H 4LFCQ 3HOZH 4DNIA 4TVAB 1PH3A 1J5EQ 3I4MH 4JCVE 4DPGA 4DUZL 2CKZB 4DR3L 1I94Q 4UY8C 2WB1E 1KAWA 1XMQQ 2KHIA 4DV3L 3CC2A 3PCOB 2MNAA 1XPRA 3BZKA 2VQFQ 1N34L 4AIMA 4PZ8A 1X56A 4A3FG 3J81i 3CW2C 4A93H 1SROA 4BY7G 1KD1C 5M3FH 4X64L 1VQMA 1QVGA 4DV0L 4LF4L 3PO2H 1HZCA 4B3TQ 3UE0A 5GQOA 3UE1A 3J81j 3PO3H 1NE3A 3AFQA 2QA4A 1YJNA 1PV4A 3CCLA 5C4XG 2VQEL 4A3BG 3M85A 3FKIH 3ULLA 3KF6B 2E2IH 2IHFA 1HJPA 4DR1Q 3TRZA 1L1OB 1P8LA 2LSSA 3L2PA 4KHZA 4B3MQ 5EAYA 2R7FA 2IHEA 2YU9H 4PZ6A 2JA7H 1YBYA 4C3IH 2ZTCA 4IO9A 1PH4A 1YJ9A 3F8TA 1Q1BA 4GN3B 1T9HA 2JA8H 4B3RQ 2D62A 4GS3A 4A3LH 2WB1G 1BVSA 3BU2A 3GTGH 3S24A 3CCQA 4P73A 1VS0A 1EYGA 3OW2A 4UP8A 4Y7NH 4P74A 1YHQA 4YWLA 3T1YL 4FDBA 3ZJYC 1XMOQ 1S3OA 2NVYH 1VQBA 2UXBQ 2JK8A 3I4NG 2CWPA 5IYCH 1U5KA 2F4VL 1WOCA 2BA1A 1K8AC 3K80C 1EUJA 1VQ9A 4A3CG 2VZAA 3GTMH 1SFOH 4IPHA 2QGQA 1Y14B 5LMNW 4DV5Q 3TS0A 2XGTA 3CPFA 4OO1I 3PGZA 3HOZG 3W1GA 4GKJL 5ELOA 2CQOA 4QL5A 2HHHQ 3I4MG 2L15A 1PH9A 1GVPA 1TWFH 3KYHC 4ME3A 4OO1G 3KF6A 4GLAC 3GTJH 3A5ZB 2BH8A 2AHOB 3S2DH 3KDFB 1L1OA 4P75A 3CCJA 4IOCA 2A19A 3I56A 3RN2A 1Q82C 2CCZA 4DR7L 4OX9L 1BKBA 1TWCH 2UXCQ 1I3QH 4BA1I 1KXLA 1X3EA 2JEBI 4DK3C 4EX5A 1HH2P 1X54A 2OQ0A 3DM3A 4A93G 2K5VA 5M3FG 2KHJA 3PO2G 2CWAA 4RG1A 4DV6L 1K8GA 5M5WH 5BR8Q 2VUMH 2PNHA 3PO3G 1HNZL 1AH9A 2EQSA 4GN4B 4PZ7A 2WFWA 1VQ6A 2ALYB 3EN2A 1N33L 2ZTDA 2K14A 1P16A 4GOPC 1VQPA 3FKIG 3HFZB 3OYYA 1TWGH 1G291 1O7IA 1E7ZA 4IPDA 4YWMA 5H1SE 4BY1H 4LF7L 4OX9Q 4DR5L 2NZHA 4IPCA 3HOXH 4NXML 4IFDG 3M9BA 2YTVA 2JA5H 1VQ5A 2JA7G 4POFA 2PI2A 4DV2L 1VQ8A 4B3SQ 2JA8G 3M3YH 4YWKA 3U4ZA 2PQAB 4A3LG 3KJOA 3PIPA 2A8VA 1X55A 3KDFA 4X6AH 3F2CA 5GROA 1CKMA 2ZJPA 2DGYA 4QGUA 1S72A 1IYJB 3M4PA 3CC7A 1B70B 1WFQA 4OONA 4LFCL 5IYCG 4NXNQ 1LYLA 1OXUA 1YHBA 3M4OH 1J5EL 1Y1WH 4LF8Q 3D31A 1HR0Q 3HOVH 2VY3A 3PV0A 1PH1A 3RNUA 3GTOH 3EBEA 3W1BA 4O2DA 1I94L 3CCUA 4HJAA 4XIGS 2HT1A 1M1KC 3H15A 1W3SA 1EQRA 5JEAJ 4A3GG 1M90C 2CFMA 1Q8KA 4LUZA 3GTLH 4IOAA 4GOPB 1B7YB 1D8LA 4DV7L 2MO1A 1JJGA 5C44H 2WAQE 4LNQA 3F1ZA 4B3TL 2JEAI 2BA0A 4DV1Q 4UP7A 3K7UC 1VQFA 4OWTB 1IBMQ 2PQAA 2VUMG 1PH2A 2OTLA 3PUYA 2AWNA 1Z47A 4KHPL 1YZ6A
chains in the Genus database with same CATH superfamily
4HJ9A 1XX8A 2JE6I 4OIKA 1C9OA 1EY5A 1IYUA 3TZDA 2WP8J 1XNQQ 1Q46A 3K0XA 2EY2A 1WJJA 2JA5G 1GUSA 5JJZA 4KHVA 1BO0A 5FLMH 4A3KH 2UUAL 4G7OC 2F3WA 1XMOL 4A3IH 4DN4M 2JA6H 3PMFA 4HJ7A 2D9UA 1Q86C 1N32Q 2K04A 3I4NB 2HIVA 2B2UA 3ER0A 4KY5A 3WWVA 4HTHA 5C5MA 1F2ZA 4DV5L 2H1EA 2SOBA 3S2HH 3EQLC 3NQIA 3S1NH 4X3KA 1ENFA 2B63B 3OIQA 2QEXA 4GLXA 4IJHA 4A3DH 2UUAQ 3HKZB 1TS3A 5KNDA 1CFMA 4BBSB 3RZDH 2K32A 1KRTA 1F2YA 3D3RA 1F9PA 1NTGA 3ITPA 5BR8L 2HQLA 3ICEA 5M3FB 4LFAQ 1RIPA 3PO2B 4RGTA 2JJQA 3W5OA 2Z6KA 4DNRB 4A3MH 3C3LA 2IY5B 3NENA 1CUKA 5C0XJ 5I6WA 1EY7A 2KCTA 4NMZA 5FO8B 2B39A 2E2IB 1IKMA 4JI1L 3PF4A 1B53A 1JJ2A 4QIWE 4JI7Q 2ZJRA 2XVSA 3NELA 4OL7A 1VQGA 2M9VA 1MSHA 2MPMA 1KNAA 3OTOQ 3OSOA 3KBGA 2XSCA 3E9HA 4C1NK 3TBIB 4A75A 1L2FA 4NXNL 5D14A 4FNFA 2EY1A 4JI1Q 3F2DA 3SXHA 3WOFA 5IP7G 3MXNB 1A63A 3J80L 5JJIA 1JT8A 5CYUA 1SE2A 1U4RA 3AEVA 3JAME 3EA6A 2ES2A 4A4IA 5FLXc 1JE4A 1R9TH 5IP9H 1RTOA 4DAYB 3HOUG 4O0AA 3LWUA 4R4IA 2AMCB 3EROA 5C4JH 2Q2IA 1IBML 1SJHD 3CKIB 2I0QA 4RWSC 3S1RH 1YITA 3FPUB 3NUCA 2VUMB 3BDLA 4ODGA 1CSQA 1VQKA 1WI5A 4X62Q 4JI5Q 1H9SB 3VYSA 3PUVA 1HRJA 1GM5A 4LF9Q 4MTKA 3MXNA 1SRUA 4DR4L 1KC8C 2R61A 3RUZA 4LF6L 3J81L 4DR2L 1EU3A 5FLXE 4JPBW 1OXSC 1RD9D 1NAPA 3VR4A 4K6LA 2XWJB 1PFSA 3BVZA 4DAYA 2F0JA 3FMCA 4HIKA 3ULJA 1TWAB 4JC0A 1TWHH 3MVVA 1UE7A 1NJIC 2D0PA 4DR4Q 2BOSA 5J22A 3VR5A 3V2TA 1LACA 1G91A 4GKKQ 1UE6A 1HZAA 3MFYA 2FXQA 2OTJA 1A3TA 1H9SA 3CC4A 5LMNL 2K5NA 2PMZE 3BDCA 4LMQD 1BBWA 4JI6Q 3AB9A 3KUPA 3HOZB 4IJLA 4DK1A 3FP9A 3MEFA 3RN5A 4DR3Q 1QCBD 4B9WA 1B8AA 2E75C 2F4IA 2N8NA 5LMNQ 3HKZE 4U68A 2MGSA 3BJUA 4XQQA 1SNOA 4KMUC 3I4LA 4K14A 4JBKA 4F8MA 4DV0Q 4LF4Q 4H44C 1SMXA 1ML0D 4OWXB 2B8FA 3AQQA 2VQEQ 1N9WA 4FXGC 2VL6A 3FKIB 1E1TA 4GNXB 3S14H 3H09A 1NSNS 3W2DA 1FJGL 2YV5A 1V1OA 5KNBA 1EWIA 4K5WA 2PCFB 3S17B 1I4XA 4MNOA 1B9MA 1AE2A 1QZGA 3PQIA 2UUCL 1EY9A 1ASZA 3CCEA 1XYIA 4OGQC 4IALA 1QNKA 1KTKA 1WTWA 3HZXA 4A3JG 3HOUB 1EYDA 3WOEA 1K73C 3S15B 4JYAL 4X65L 3QOJA 2N88A 4PNYA 1SFOB 2GN5A 2I5HA 3I3CA 3FHWA 2AQ2B 2RSNA 1KDAA 1Q90A 1F77A 1GJXA 5IT9L 4GNXA 2K50A 4K8IA 3CQZH 2E2JH 3K7AH 3I55A 1TKWB 2BE5C 2ID0A 4A3EG 3ERSX 3MC0B 2UU9L 4L5QA 3BYYB 1A62A 1TWCB 4DUYL 1G6ZA 4A3BH 3CXCA 2C35B 3CHBD 5CGKA 4DR6L 5EPLA 4EQ5A 1A15A 3VR3A 2K01A 5M3MG 1EYAA 1KLUD 4OEMB 3T4AC 2IX1A 2F0UA 3UDIA 3SK6A 5IIFA 2GVBA 4BBRG 2OF1A 1H9MA 5GAGC 4HN7A 1CA6A 4JI2L 4JVZA 4Z9CB 3M7NA 4HEDA 1IXRA 1Z9FA 2L9HA 3MWYW 3A0JA 4IURA 1HTPA 5BN3A 5ELNA 3TQYA 3MXPA 3I4NH 2IT1A 1U9RA 5CORA 1O80A 2WAQB 1VQ4A 5K36G 4S3SA 1PRTF 2KHSA 5LMUL 1C4QA 1SLJA 3PUXA 2XIWA 1WTQA 4NDXA 3I4MH 3K59A 1Y1WB 2NWGA 4UY8C 2CKZB 3GV3A 3GTOB 1IYVA 4KK7A 4DV3L 3PCOB 2MNAA 1PYWD 4C56C 1AW7A 1LO5D 3DUZA 4A93H 3BG3A 5K5PA 4ZQ3A 1KD1C 1SYFA 5KRUA 5M3FH 3I91A 4X64L 4G57A 5I4DA 5CC4A 1VQMA 5JPMC 3PO2H 3Q22A 1HZCA 5GQOA 1NE3A 1ONLA 3AFQA 4WFN3 1B3QA 3OWEB 1HQRD 5C4XG 4ZLTF 3T51B 3I72A 5L37A 3ULLA 2E2IH 2WKCA 1HJPA 3L2PA 5EAYA 1NCVA 1YBYA 5CV8A 2IPKD 2ZTCA 4IO9A 2FMMA 5ELDA 2WB1G 4IUPA 3DWPA 3S24A 4P73A 4XXEA 3ND8A 1EIHA 3T1YL 1JC7A 4RAUC 3ZJYC 1VQBA 2CWPA 4A3IB 4AYBB 2JA6B 1SYGA 1ENAA 1B50A 1EUJA 4A3CG 1L0YB 2FFKB 3WDNA 1PRTB 4OO1I 3W1GA 5ELOA 3S2HB 1TY0A 3QG1A 5M5YB 1PH9A 1TWFH 3KYHC 2BH8A 4P75A 4WJWA 4A3DB 1STEA 1E2ZA 3I70A 4HCEA 1BKBA 3IAYA 1I3QH 3AU7A 1YNJC 4A3EB 3MHBA 1PMRA 3RZDB 1JR0D 4UHVA 2VUMH 1K8GA 3PO3G 1AH9A 1SXTA 4GN4B 4PZ7A 3F2UA 1VQ6A 2ALYB 5ISRA 3EN2A 3A54A 1N33L 2ZTDA 5CR3A 1P16A 2B2VA 4GOPC 4A3MB 5H1SE 1O7IA 1V1PB 5M3MB 1RCVD 4LF7L 3TMEA 4IPCA 1PFBA 2JA5H 5CV7A 1ICWA 2F0DA 1QWYA 1VQ8A 4B3SQ 1TQOA 2JA8G 3VYTA 3U4ZA 1ET6A 3PIPA 1SSOA 4RGMA 2V4DA 4IUTA 3FPPA 1H9JA 1K8MA 1O7LA 2DGYA 2EYPA 4LAAA 4O42A 3ND9A 2RA4A 3OOCA 4KY7A 1OXUA 3MXUA 4GZYC 1MSGA 1STHA 1VF5C 2Z9HA 3PV0A 2BDNA 2F1MA 3EBEA 1CZWA 1I94L 3CCUA 1LTRD 1W3SA 4LJZC 4A3GG 1V1PA 1PTOH 1QB5D 2R3ZA 2CFMA 3SDZA 1R9TB 4XQJA 2DNCA 3A8IE 2WAQE 4B3TL 2JEAI 4ILWA 4DV1Q 2A5HA 1EYCA 4OO1H 1I6VC 1PH2A 3PIO3 5C4XB 2AWNA 1JOKA 1D1KA 3MEHA 4B3ML 2Z4IA 2R6GA 4NB3A 2VW9A 1B4OA 1GO3E 4ID6A 2J7ZA 3BYTB 5E1FA 1QVFA 4X3SA 1EOTA 4C2MB 2WB1B 1BBUA 2M2LA 4YHHL 4XDXA 3K8AA 1BBXC 2UXBL 4RMFA 4F87A 5IE8A 4FXDA 3KF8B 3SK5A 5IP7H 1BNZA 2OCEA 3S17H 4H7BA 5C3XA 3PF5A 1TWHB 1DOMA 1B9NA 2HHHL 2IX0A 3JC66 5EPJA 4EQPA 1UEBA 3BZCA 4ZK9B 3HOVG 3N52A 1EL0A 1PH5A 1UAPA 1X3GA 5ELBA 3K5OA 4YHHQ 2UXDQ 3HOUH 3S15H 4TSSA 2UXCL 3P75A 1H9RA 1CKNB 1K9MC 4QB4A 1EEID 3NTHA 3H6MA 4JW0A 3G71A 1DCZA 4K0KQ 3KK7A 1EFID 1HZ9A 4KKUA 3PO3B 2TMPA 1GUNA 1T5EA 1MHWC 4KI0A 5IYDG 3KF8A 3LWEA 5TSSA 3T13A 1YHAA 2F0VA 3U58A 1STGA 4QUFA 1PXUA 1RL2A 1O7ZA 1HCZA 1XTCD 1TS4A 4ZUIA 3HOWG 2JA8B 1L0WA 3IL8A 3GTGB 2B3GA 2NVXH 3STBD 4JG2A 2F0NA 1MI2A 1CKNA 2LXKA 4H0LC 1C0AA 4LF8L 4ALPA 1HR0L 5FOBB 2QILA 1X3FA 1JB7A 2FINB 3E0JA 1YEZA 1WTPA 4IUQA 3LGJA 4CDDC 4MHEA 2NVQH 1WTRA 2C9OA 3TZUA 1SNCA 2RQXA 1SJED 1K0SA 3T56B 4QUCA 3R2IA 5M5WB 3IRBA 1YJWA 2K5HA 1A2UA 1LTTD 3I73A 4DNTB 1XNQL 1NUCA 1JORA 4A76A 3RR5A 4U673 1VQNA 1G51A 2E2JB 3RMHA 1SR3A 2QCPX 1AP0A 3OWFA 1QNUA 1IBKQ 4AQYQ 1OO9B 3PSIA 4EQNA 5HGTA 1CZGA 1SAPA 1N32L 1STNA 2K03A 5G3LF 3T53B 4YY3Q 3DEOA 1PH8A 1ESFA 3U9OA 4HIOA 3TS2A 4BXXG 1QZHA 4JBMA 3HOYG 2Q8IB 4K6DA 5IGDA 1UWVA 4BS9A 1KDBA 1VDZA 5KIXA 2X6GA 2VB2X 2EYFA 1CKOA 3HRZC 2LXJA 2MO0A 5JEAG 4GNXC 2F0PA 1GUTA 4FF4A 4GOPA 4A3JH 4XT1B 1LTLA 2Y0SE 2N3SA 5LL6S 4R4TA 4HCSA 4L5TA 1JE5A 1G6PA 5M5YH 4LFAL 1Z6HA 1TVXA 4LUOA 3I4MB 4NKLA 5FJ8G 4DUZQ 4UP9A 2WV6D 2RBMA 3NXWA 2YYZA 4DK0A 3VYUA 3TP7A 4CDCC 4A3EH 3U4VA 2JA9A 3NEMA 4JI7L 2K52A 2F3VA 3NWTA 4MZ9A 5F2DA 3DWAA 4YCVA 4A93B 4UDUC 1W6JA 4M1UB 3J7AF 1PRTD 3OTOL 5FO9B 1YI2A 3DLLA 3STBC 1Y1VG 1EIYB 1JQYD 5JPNC 3HOWB 3R2TA 1VMCA 4KJOA 1RF2D 3QIAA 5M3MH 3KOJA 1PFNA 4HMIA 3JAMc 1ZYRC 5DLQE 2CH4A 3BZDB 4BBRH 5CV6A 3CAMA 2NZ1D 2B2TC 2Q2TA 1PZID 2K5DA 1SYEA 3Q6SA 4FF1A 5A2QE 3H0GG 1D5XC 5DAUA 1E2VA 3QR8A 1DOKA 2RHQB 1KL9A 3BVGA 5K36H 5FKAC 4Y52H 1VF7A 4RHSA 1FYCA 1VQEA 2L12A 5IGFA 1VQAA 3RD4A 5J3BA 1M4VA 2C5CA 3RZOB 2L0CA 1K0RA 1NR4A 1IZ6A 3GO5A 2AWOA 4JI5L 4X62L 3GTPH 1PTOF 1TWFB 4XTCS 5KNCA 4LF9L 2K33A 4HIMA 1V8QA 1ZXTA 1GHJA 1I3QB 2EYHA 4HJ5A 1C7YA 1CM9A 1O7YA 2A6ED 3GV6A 2SNSA 5C4XH 2R93G 1RKNA 5I2YA 4DV4L 5M5XH 1V43A 1HNZQ 1JWSD 1RTNA 1CQFA 4FF3A 1MGSA 1S40A 2B2WC 4DR5Q 4NXMQ 2BE5D 4QQBX 4C2MH 1TT2A 2JA5B 3E9IA 4DV2Q 1VQDA 1JJCB 4GKKL 4DV4Q 3S1QB 3RLFA 3NQTA 2F0EA 2O2LD 4A3CH 4JI6L 3IFTA 4QY7A 3VR6A 1AZPA 5EBDA 4DNIA 3VA7A 1PH3A 1J5EQ 1Y8OB 4DR3L 2B2VC 3TDQA 2CVRA 4C3HG 1EZ8A 2K6AA 5IGEA 1XPRA 2CHBD 4K5VA 1PTOB 4NP5A 4BY7G 1SROA 1PRTC 1QVGA 2K7VA 4DV0L 4LF4L 1X3QA 3A8JE 1VMPA 3TSSA 3UE0A 3PO3H 1F9RA 1YJNA 3CCLA 3X3NA 2VQEL 4K5XA 2XNAC 4DR1Q 2OXPA 3A56A 1P8LA 3TRZA 4RKBA 2R7FA 3EJIA 3E5SA 3S16B 1PH4A 2PO4A 1YJ9A 1A2TA 3F8TA 4GN3B 2JA8H 4B3RQ 2D62A 1BVSA 4IQZA 4C3JG 3GTGH 1BF4A 2F0IA 1YHQA 1S3OA 1IL8A 2MHVA 3K80C 4XYQA 1VQ9A 3KLSX 1SEBD 1Y14B 3TS0A 3CPFA 4FP5D 3PGZA 1JICA 2CQOA 1I4GA 1GVPA 3A5ZB 2OT2A 3I56A 3RN2A 1K83B 3TP8A 5IGGA 4TKOB 2A6EC 3TP6A 2EOTA 1KXLA 4M8AA 2JEBI 2KQ3A 2K5VA 2EZVA 5M5WH 2RSOA 2F0TA 1DONA 3NSWA 2IJ0A 2EQSA 2WFWA 4G4KA 4I7AA 2K14A 3OYYA 1TWGH 1G291 1E7ZA 4YWMA 1TS5A 4IFDG 3R8BA 2JA7G 3HG9A 4KKTA 4C3IG 4ZKCB 1RDPD 5JVH3 1YNJD 2PI2A 2SEBD 1EIGA 4YWKA 1EZ6A 4V0BA 5CBEE 4DU9A 5C6AA 4KN4C 1S72A 3LX0A 2NVXB 3CC7A 1B70B 1WFQA 4OONA 1D5ZC 1LYLA 2EYJA 1YHBA 2EDGA 3HOVH 2KOLA 3W1BA 4HJAA 4XIGS 2HT1A 1EQRA 5JAVA 1M90C 4C3HB 4IZ8A 5C5LA 1HXYD 2IL8A 1SYBA 1Q8KA 1HFGA 3GTLH 4IOAA 4DV7L 4HSPA 4LNQA 2B2TA 2KEDA 1PZKD 3F1ZA 1MBYA 5C4HA 2NVQB 5CMDA 2F0QA 4UP7A 3URYA 3K7UC 4ZAIA 1FNVA 3A55A 1JWMD 2PNRC 3PUYA 5IYDH 1ILQA 2M00A 3UDGA 1YNXA 1V1QA 5EJWA 2ZT9C 4RGNA 4QMGA 4DV7Q 2E8GA 3JAMi 2A68C 3D6CA 3SVMA 5AJ3Q 1H95A 2EYMA 2O5JC 2JQOA 1DD2A 1ZKOA 3HOWH 3K5MA 3J80c 4C3JB 1HNWQ 2EJFC 1II3A 2VS1A 3G48A 1PHJA 4B08A 1VQIA 3H3VI 1FL0A 3GP7A 2G9DA 2E2HH 1I6HH 1NY4A 1VQOA 1I4QA 3SEBA 3I90A 1JCKB 4CJ1B 1UE1A 4G7HC 4JV5Q 1AE3A 4EGVA 4Q0FA 3CRKC 1KHIA 5EBCA 5EKLA 4A3JB 2RKSA 1JWUD 3KJPA 1TXYA 1MKHA 3RZOH 2B2WA 1LUZA 2Z0SA 3J80E 2NBFA 2EY6A 4CJ2C 1K3RA 2DUDA 3J81c 3VYRA 1LV9A 3QJYA 3A5UA 4L5SA 1YNND 1K8OA 2XWBB 5CV5A 2BH2A 2K4KA 3HP3A 3CMEA 3LNNA 1EQQA 5NUCA 2R92G 1IW7D 4B3SL 1D5MC 3T1HQ 4GN5A 3KBXA 1HUNA 4L5RC 1WCMG 1NMFA 2MJ8A 4KN7C 2RHSB 2K1BA 1UE5A 4BXXH 5D3IB 2F3IA 3CRLC 3X3MA 4B9XA 5CBAE 3HOYH 1Q81C 4BBRB 3EIVA 4R4CA 5E3FA 4KTAA 1LT3D 4RGOS 3J81E 3S1QH 3TEHB 2CH4W 5JEAH 1X65A 4YIJA 1WVLA 1R4QB 1QJOA 2HDLA 1F2MA 1EOVA 1KQSA 2Z1CA 5C3WA 4R9WA 1JB3A 3OMCA 4TQUS 4AH6A 2N78A 3H3VH 1G2TA 1WD1A 4JI8Q 2L11A 2RDHA 4DV1L 2F0HA 4EQOA 4APVA 1HQMC 5FJ8H 4K2KA 5ELFA 4KV6A 1BDOA 2DY7A 2QDBA 3L3OC 5AFWA 3GTPB 2F52A 3E3XA 3QWNA 1BOSA 1ICFB 2B29A 3SE0A 4CHTB 3ZYYX 1SBBB 1WYDA 1Y1VH 1HUMA 1FGUA 2MUYA 3AFPA 3JAML 4IUVA 1BCPF 1TU2B 2L1BA 5M5XB 1GKHA 3S16H 1DOLA 3VR2A 1B3AA 4DAMA 1OXXK 4P2CB 3HS0C 1PTOD 1XXGA 2KA7A 1PFMA 2JSOA 5COYA 3H0GH 2WINB 1DZ1A 5I2XA 1N8RC 3M4OB 1LTBD 2KJXA 2UXDL 4X66Q 5GAEC 1IBLQ 4P71A 1D7QA 2EY5A 5IT9c 1SN8A 3SHLA 1XTDA 1DGSA 2KECA 4KLKA 4K0KL 3I7FA 3RLOA 2E76C 2ASBA 1GD7A 4PMBA 5FLXL 1YNNC 3E6ZX 5E4XA 2RF4A 1K83H 1U0LA 2GA4B 2A74C 3F2BA 2KCMA 5C3EG 1STBA 4H02A 4MN3A 2F0KA 1IW7C 1NMGA 5ELCA 1XPUA 3G6EA 1N34Q 4ME5A 1G8ZD 1VQHA 4O1NA 1QE6A 3R3OA 4AYBE 2R93H 3SGIA 4NPSA 4KY6A 2KCNA 1TR5A 1KNEA 4C1NI 1B44D 4ZKBB 2IW3A 3G4SA 2A69D 4KKSA 3S9WA 1VCIA 1WCMB 2L4NA 5IT9E 1BCPB 2R7ZG 1CT1D 1LABA 3V05A 3AYHB 1I5FA 2KENA 4QF4A 2B63G 1X3PA 1X6OA 5I9OA 1FR3A 2A73B 4BA2I 4IN3A 5LL6X 4JI4L 2LMCB 3HKZG 2QW7A 3FVQA 5ELEA 3P7JA 4BBSG 1PYSB 1Q12A 3GTKB 3DEPA 4QIWB 2DJGC 1TY2A 2XRSD 2F4VQ 1C48A 1ZYRD 1SYDA 3J7ZC 3ULPA 1S5FD 1SNPA 3CU7A 3OMGA 2QF7A 4OELB 4RFBA 5LHY1 2D0OA 4GKJQ 2N55A 4C3HH 1BR9A 4IUNA 4NW2A 5C0XG 4A3GB 4LFBL 4LWCA 5IYBG 4IFDI 4JI4Q 4BY7H 4DR7Q 3H3VC 1E0BA 1FGBD 5IWAL 2ZJQA 4JBWA 2H4OA 5JOBA 4XYOA 1IBKL 3FRPB 4AQYL 1JOQA 3D4WA 4DV6Q 1PA6A 5D65A 5EQ0A 3PIOA 2E74C 2FJ2A 4YY3L 1X32A 4DAPA 1PTOC 1V9PA 3VDYA 4LFBQ 2YTXA 2QDLA 3J80i 2NVTH 1IHZA 2JYOA 1A0IA 4FYDA 3QOLA 5IWAQ 1TWGB 2ICIA 1S4ZA 3KLRA 2IX3A 3QB3A 4QCLA 1GHKA 4J1MA 3S1MH 4C3JH 3I2ZA 1PH6A 1PVOA 2N49A 4UPAA 3PUZA 2G5DA 1I4PA 2NN6G 3M4QA 2YTYA 1EWCA 2XTIA 1QVCA 1KLGD 1R4PB 4R1JA 3GTQH 2G9HD 4L6TB 1E3PA 2PZUA 1DM0B 3OPOA 5IODA 2EIFA 2HD3A 1ASYA 4LFCQ 3E0EA 3DM1A 1F9SA 3DMUA 3NTIA 2L55A 2P5ZX 3HOVB 4DUZL 2Z4HA 2WB1E 1KAWA 2X69A 2KHIA 4DGZA 2LFNA 3CC2A 4CJ0B 3MAQA 5C3EB 4ZCKA 1X56A 4A3FG 3J81i 3CW2C 3GTLB 4CDFC 2JXMB 2A69C 4N9TA 1HA5A 2RVLA 3DHQA 2VXWA 3J81j 2QA4A 4DAVA 1PV4A 3M4YA 5IGBA 1SMYD 3OHXC 2PZWA 2IHFA 2PMZB 1L1OB 4KHZA 4IFDH 2YU9H 2R7ZB 4PZ6A 2JA7H 4C3IH 3QO2A 3BVMA 4ZRZA 3G6JB 3P1HA 3CCQA 3OW2A 4Y7NH 2QKIC 2OEOA 4JK1C 3UI2A 1AN8A 4L63B 1XMOQ 1HFNA 2NVYH 3L9AX 5BN5A 5T1IA 3NK9A 2WKDA 2BA1A 3FDTA 4Q5VA 3GTMH 1KDCA 2E2HB 4IPHA 1I6HB 5LMNW 4DV5Q 3HOZG 4ZYSA 4QL5A 5FK9C 4OO1G 4DXGA 2AHOB 2NUCA 1L1OA 1Q82C 4OX9L 1W6KA 1X3EA 1HH2P 1O78A 2KHJA 2CWAA 4RG1A 4X3TA 5BR8Q 4WRDA 1ENCA 2PNHA 1HNZL 2AQ1B 5KGUA 1SNQA 2EVBA 3FKIG 3HFZB 3NTKA 4IPDA 4OX9Q 1XWEA 4N8X1 4DR5L 2NZHA 4NXML 3M9BA 2K28A 3D4DA 2J0TD 1A6XA 4POFA 5KYLA 4DV2L 4DF7A 1QOHA 2PQAB 4A3LG 3KJOA 1WTVA 1X55A 2PW7A 4X6AH 1CI3M 3NBIA 4FVMA 2VB3X 5GROA 2ZJPA 1B2TA 1ILPA 1IYJB 5IYCG 4NXNQ 3HOYB 3M4OH 4J8QA 1J5EL 2ENBA 2DJFC 2K5QA 3RNUA 1L0XB 3MTSA 2D2CC 5HURA 1CQVA 5JEAJ 4I7ZC 3ONAB 1NNXA 2EE1A 3D8GA 3A7AB 2IWHA 1AZQA 4PV1C 3AMUA 4E6IA 2MO1A 4J6HA 4A3FB 5FO7B 1SNMA 1WD0A 2J4XA 1IBMQ 1VQFA 1SMYC 4OWTB 2PQAA 3BDOA 4LK1C 2B2YC 4F88A 4KHPL 1YZ6A 4DR1L 1K3BC 3CPWA 4K8JA 4LW1A 1D1IA 4CBVA 1QUQB 2QEJC 2HQEA 4POGA 1HZBA 4BY1G 2R92H 1I4RA 2A1AA 2EYLA 3P20A 2Q2UA 2FMCA 5GAHC 3HOXG 4B3RL 1S5DD 2VNUD 4RKLA 1KRSA 4KD4A 4L8JA 1XNRL 1WCMH 4LF6Q 4DR2Q 1Y1VB 3L7ZC 3NP8A 2RCNA 4KHPQ 4WORA 4HAEA 3M3YB 3O13A 2WAQG 2PQEA 3KLWA 1J9OA 5GADC 3GDEA 1LT6D 4WJ3M 1Q3LA 3TN2A 1HTLD 2O4XA 1F2LA 1SYCA 5BN4A 1I50B 2A68D 2V1CC 3H0GB 1Y1WG 3A74A 1XNRQ 2RDFA 4TRDA 2SDFA 1LM0A 3W3AA 3GTKH 3GQBA 2ZTEA 3A7LA 1EY8A 1QUQA 1IKLA 1JOOA 3CD6A 1BCPD 3NHHA 2UUBL 5KYIA 1PH7A 1RODA 1NR2A 1YVCA 3DWQA 4JOIC 2O5IC 5C44G 1MJCA 4MIUA 4HIDA 4CKCA 2E2DC 4PG3A 2EJGC 3Q0AA 2DNEA 4V190 4A3GH 2HIXA 3B6YA 4RCNA 2LS01 2ICEC 4QJFA 2UUBQ 1HPCA 2I5MX 3D4RA 1E2WA 1ET9A 2ZXOA 1E1OA 3MA2B 2H5XA 2R93B 1S5CD 5E7NA 5FLMG 1QG7A 2PZTA 4J15A 1D2BA 4A3KG 2RCFA 3OW7A 4DA2A 1KIXA 4ULLA 1I4HA 4A3IG 1CA5A 2F03A 2HDMA 4AYBG 2JA6G 2MQHA 5HGQA 5T1GA 2CW0D 3J7AV 4LF5L 1FJGQ 2Q8RE 5J1ZA 1KAAA 3ERQA 2A6HD 5C0XI 3J7A5 4R4OA 5M9OA 4RCOA 2UUCQ 5I6YA 3NBHB 2XRQD 4PMCA 2NYZD 4A3DG 5JJKA 1PZJD 5CV4A 2BCOA 3GTJB 3S2DB 2I5LX 2OQKA 4R4QA 2ZXRA 4FXKC 1E22A 2ATWA 4OXPA 4JYAQ 3L0OA 2ZM6L 3C2PA 4LF5Q 2GVAA 4X65Q 1JMCA 1DXMA 1VQ7A 2XN9C 2Z6BA 2L5TA 5C3EH 4A3MG 1RHPA 3VA5A 3RLNA 4HR7B 2PPBC 5EKIA 4OWWB 5AJ3L 4BY7B 4BY1B 5CV9A 2AUJD 2UU9Q 1UEAB 2F0WA 3HOXB 2NN6I 4H13C 2ZM6Q 3CF5A 5IY0A 4DUYQ 4JBJA 1HNWL 1LLRD 2EPBA 1WTXA 1DYQA 1FNWA 2X6LA 3PIP3 2EXDA 3D0FA 3NBHA 5DM73 3D6WA 3K6OA 1Y69U 2E5LL 2DN8A 4DR6Q 1EFWA 2JP1A 3I4OA 2R7ZH 5KEEA 1WTOA 2AUKA 1EU4A 2NTTA 1J8IA 1STAA 4OIJA 2NVTB 1OXTA 3R93A 2F0OA 3CCRA 3NPPA 2B63H 3NE5B 1A8VA 1J6QA 1DJRD 4JI2Q 2EXZA 1LTID 3S1MB 1K28A 4RA8A 2B8GA 4JV5L 1PYBA 1BCPC 1UNSA 1VQCA 1PDQA 4BBSH 2E5LQ 2OWOA 3N6RA 4WJ4A 1Q7YC 1S5BD 2MFIA 3GTQB 3K58A 2Z8LA 5IP9G 1EIFA 5LMUQ 4FO2A 5JJLA 1CSPA 2CQAA 1HNXL 5C44B 5HY6A 3IFDA 4HJ8A 5C0XH 2HUGA 4XT3B 1S5ED 3SK8A 5IYBH 2SNMA 3CCSA 4LUVA 1CHQD 4DXFA 1GXDC 3TREA 1CHPD 4DV3Q 5EKKA 3IKJA 1W2BA 5G3LD 1OTCA 1M8AA 2R7DA 1BQQT 4X64Q 1AFPA 3T1HL 1T5XD 1HNXQ 1A3UA 1H9KA 3KFUA 1U4PA 3Q8DA 2PI2E 2JN4A 2Y0SG 4R8IA 4A3KB 3U9SA 2CW0C 4DK6C 2FHTA 4DKAC 4N9PA 1XJVA 1AEXA 2K05A 3K5NA 2A6HC 2D5DA 4IFDJ 2YU9B 2JA7B 3A8KE 1ZEQX 4C3IB 2Q2HA 2NN6H 2ZXPA 4XQNA 1UUPA 5IOCA 2WACA 2LY7A 3S1NB 2B2YA 1Q8IA 3CCVA 2F0GA 2NZOA 3DXJC 1NBWA 4P72A 5IGCA 3BS1A 1EY4A 3J7YW 4Y7NB 3T1YQ 3C46A 2I46A 2K5WA 2NVYB 4JI8L 4CKEA 1FVIA 4JI0L 1SE8A 5A35A 4CDEC 3GTMB 1MIUA 4IPGA 1VQJA 4MTNA 3MZ5A 4A3FH 3K0YA 2B2UC 2F0SA 4K2LA 1IL2A 1FNUA 3CMAA 3NWSA 3I8ZA 1C8CA 4JI0Q 1OXVA 2F0MA 3K57A 1CTMA 2KBNA 5EGTA 5A2QL 1N36L 4YCWA 3UDXA 1MD2D 4OHJA 4YCUA 2I07B 4JI3L 3TP5A 1VQLA 4G7ZC 1N33Q 1TWAH 3CP0A 1LTSD 2F0FA 2K75A 3UDFA 2NB0A 5J39A 1F9QA 1E24A 4LF7Q 4JOIA 3H91A 3K81C 3SR1A 1X9NA 4GLVB 1Q1EA 1ESRA 1N36Q 3U50C 2Z6KC 1MJEA 1HR0W 2AKWB 5DNFA 3M3YH 4X66L 1XMQL 1L1OC 3HKSA 4JI3Q 1IBLL 3C1FA 1XPOA 2VQFL 3CCMA 2LKVA 5DM63 1FD7D 3OIPA 3GD7A 4PMWA 3PUWA 4CGYB 1YIJA 1B1ZA 1SE4A 1I50H 2KVMA 3HOZH 3K5LA 4TVAB 2KCCA 1QILA 1U4MA 5C4JB 4JCVE 4DPGA 1I94Q 1GOZA 1STYA 1XMQQ 3S1RB 4KD3A 1HHVA 5EPKA 1BXTA 3BZKA 2VQFQ 1N34L 4AIMA 3KLSA 4PZ8A 1EEFD 5JVG3 1SNDA 1WTHA 2EJMA 4B3TQ 3UE1A 2Q8TA 2BDOA 3MXGA 4A3BG 5C4ZA 4KJNA 3M85A 3FKIH 1BUVT 3HEJA 3EVQA 3KF6B 2Y0SB 3HGBA 1SE3A 2MP1A 2LSSA 4B3MQ 2PW5A 2IHEA 5E4WC 1Y8PB 2AQ3B 1GUOA 2WIIB 2R92B 1Q1BA 1GUGA 1T9HA 4A3LH 4GS3A 1LT5D 3BU2A 1VS0A 1EYGA 4UP8A 4P74A 4YWLA 4FDBA 2UXBQ 2JK8A 3I4NG 2RDGA 3Q24A 5IYCH 1U5KA 4PQXA 4RHRA 2F4VL 1WOCA 1EY0A 1K8AC 1LTGD 2VZAA 1SFOH 2QGQA 4UAIA 3T16A 5I9PA 2XGTA 4GKJL 1RJTA 2PYKA 2HHHQ 3I4MG 2L15A 3G7LA 1D6EC 4ME3A 4GLAC 1G2SA 3FEWX 3KF6A 1EQTA 3GTJH 3S2DH 3KDFB 3CCJA 4IOCA 2KEEA 2A19A 4DR7L 2CCZA 1Y8NB 4CKBA 2EYOA 1TWCH 2UXCQ 4BA1I 1TIID 1EY6A 4DK3C 4EX5A 1X54A 2OQ0A 3DM3A 4F7XA 4A93G 2KUMA 1KABA 5D3DA 5M3FG 3PO2G 4DV6L 3H94A 1EWHA 1VQPA 3C1EA 3MFGA 4BY1H 3HOXH 4DFAA 2YTVA 5DEHA 1VQ5A 3S14B 4ABNA 1A3VA 2HCIA 2DY8A 4EVOA 2NTSA 4N8FA 3SK4A 2A8VA 3KDFA 3Q23A 3F2CA 1CKMA 4QGUA 1Z7TA 1TS2A 3M4PA 1GUWA 4LFCL 4ZUJA 1U4LA 2TSSA 4HSVA 1Y1WH 4LF8Q 3D31A 1HR0Q 2VY3A 4X3UA 3V96A 1PH1A 3GTOH 1LT4D 4O2DA 2HCCA 1PLFA 4BWGB 1HA6A 4IUUA 1M1KC 3H15A 3M7GA 2F0LA 1LTAD 1EQVA 4LUZA 4GOPB 1B7YB 4HMJA 1D8LA 3CQZB 5C44H 3K7AB 4RH6A 1JJGA 4R8NA 3EFXD 2BA0A 1CK1A 1SDFA 2VUMG 2OTLA 4I65A 4A3BB 1Z47A 4FF2A
chains in the Genus database with same CATH topology
4DR1L 5IYDH 3CPWA 3UDGA 4B3ML 4LW1A 4HJ9A 1YNXA 2R6GA 2JE6I 1V1QA 4NB3A 1C9OA 1QUQB 2VW9A 1GO3E 4POGA 1HZBA 2WP8J 4BY1G 2A1AA 1Q46A 1XNQQ 2Q2UA 3K0XA 4DV7Q 1WJJA 2E8GA 3JAMi 5GAHC 5AJ3Q 3HOXG 4B3RL 1H95A 1XMQL 2JA5G 1QVFA 2JQOA 2VNUD 3HOWH 1KRSA 5FLMH 1XNRL 1WCMH 3J80c 4LF6Q 4DR2Q 4A3KH 3L7ZC 1BBUA 2UUAL 1HNWQ 1XMOL 2RCNA 4YHHL 4A3IH 3K8AA 2VS1A 3G48A 1PHJA 4KHPQ 2UXBL 2JA6H 1VQIA 4RMFA 2R92H 4HJ7A 3H3VI 1FL0A 2WAQG 1Q86C 1N32Q 3KLWA 2HIVA 3ER0A 5IE8A 2E2HH 3KF8B 3GDEA 3WWVA 1NY4A 5GADC 5IP7H 1VQOA 1I6HH 2OCEA 4DV5L 3S17H 4WJ3M 3PF5A 3S2HH 3S1NH 2HHHL 2IX0A 2QEXA 2V1CC 1Y1WG 3JC66 1UEBA 3BZCA 3A74A 1XNRQ 3HOVG 4GLXA 1UE1A 4IJHA 1PH5A 4A3DH 2UUAQ 1LM0A 1X3GA 3GTKH 4JV5Q 1AE3A 2ZTEA 4YHHQ 2UXDQ 1QUQA 3HOUH 3S15H 3CD6A 2UXCL 2UUBL 1KHIA 3RZDH 1KRTA 1PH7A 1YVCA 4JOIC 3KJPA 1TXYA 1NTGA 1CKNB 1MKHA 3RZOH 1K9MC 1LUZA 2Z0SA 5C44G 5BR8L 1MJCA 3G71A 2HQLA 3ICEA 4K0KQ 4LFAQ 1RIPA 4HIDA 1HZ9A 1K3RA 4A3GH 2JJQA 4PG3A 3W5OA 2DUDA 2Z6KA 3J81c 4A3MH 2IY5B 2HIXA 3B6YA 1CUKA 3NENA 5C0XJ 3A5UA 4L5SA 5IYDG 4KI0A 2KCTA 2BH2A 2K4KA 1YHAA 4QJFA 4JI1L 3CMEA 2UUBQ 1EQQA 2I5MX 3U58A 1JJ2A 3PF4A 4QIWE 1RL2A 2R92G 1E1OA 4JI7Q 2ZJRA 4B3SL 3NELA 1VQGA 2H5XA 3T1HQ 5E7NA 3HOWG 3OTOQ 4GN5A 1L0WA 5FLMG 4J15A 4L5RC 1WCMG 3E9HA 4A3KG 1NMFA 2B3GA 2NVXH 3STBD 4JG2A 2RHSB 4A75A 1UE5A 4A3IG 1KIXA 4BXXH 1L2FA 2F3IA 4AYBG 2JA6G 4NXNL 4GKKL 3HOYH 2MQHA 1CKNA 2LXKA 5HGQA 1Q81C 4JI1Q 1C0AA 3EIVA 3F2DA 4LF8L 4R4CA 5IP7G 4ALPA 1HR0L 3MXNB 4LF5L 1FJGQ 5JJIA 1A63A 1JT8A 1X3FA 3S1QH 5C0XI 1JB7A 3J7A5 4R4OA 3TEHB 3AEVA 1X65A 1YEZA 2ES2A 4A4IA 5FLXc 2UUCQ 1EOVA 3NBHB 1KQSA 4A3DG 5JJKA 1R9TH 3LGJA 4TQUS 5IP9H 4AH6A 2N78A 4DAYB 2I5LX 3H3VH 4O0AA 2OQKA 4R4QA 2NVQH 3HOUG 4R4IA 4JI8Q 2AMCB 1E22A 2ATWA 4OXPA 4DV1L 4JYAQ 5C4JH 2Q2IA 1IBML 3L0OA 2ZM6L 4LF5Q 2GVAA 4X65Q 2I0QA 4APVA 3S1RH 1JMCA 1VQ7A 1YITA 5FJ8H 3IRBA 1YJWA 5C3EH 1CSQA 4A3MG 1VQKA 1WI5A 2K5HA 4X62Q 4JI5Q 3RLNA 2F52A 1XNQL 4A76A 3RR5A 5AJ3L 3PUVA 4OWWB 1G51A 1VQNA 1GM5A 2B29A 4LF9Q 1SR3A 1SRUA 2UU9Q 4DR4L 1KC8C 2NN6I 2ZM6Q 1WYDA 1Y1VH 5IY0A 3CF5A 4JBJA 4DUYQ 4DR2L 4AQYQ 1IBKQ 4LF6L 3PSIA 1HNWL 1FGUA 1OXSC 3AFPA 2EXDA 3D0FA 2E5LL 4DR6Q 1EFWA 1PFSA 3I4OA 4YY3Q 2R7ZH 1GKHA 1N32L 3S16H 4DAMA 1PH8A 1OXXK 4HIOA 3TS2A 4HIKA 4BXXG 3ULJA 1QZHA 4JC0A 4JBMA 1OXTA 3HOYG 1TWHH 1UE7A 3CCRA 1NJIC 1UWVA 2D0PA 2B63H 3H0GH 4DR4Q 1A8VA 1J6QA 4JI2Q 1N8RC 1CKOA 4JV5L 1PYBA 2MO0A 2LXJA 5JEAG 4GKKQ 4GNXC 1UE6A 1VQCA 2UXDL 4X66Q 4BBSH 5GAEC 2E5LQ 2OWOA 1HZAA 4WJ4A 2FXQA 4GOPA 1Q7YC 4P71A 4A3JH 1IBLQ 2OTJA 1D7QA 1LTLA 3CC4A 2Y0SE 2MFIA 2PMZE 2N3SA 2K5NA 1SN8A 1XTDA 4R4TA 5IT9c 5LMNL 5IP9G 1BBWA 4L5TA 1EIFA 4JI6Q 1DGSA 4KLKA 5LMUQ 1JE5A 1CSPA 4K0KL 5JJLA 5M5YH 4LFAL 3I7FA 3RLOA 1HNXL 1G6PA 2ASBA 1GD7A 4IJLA 5HY6A 4LUOA 3FP9A 4HJ8A 3MEFA 2RF4A 5IYBH 1K83H 1U0LA 3RN5A 5FJ8G 3CCSA 4DUZQ 4LUVA 4UP9A 4DR3Q 3F2BA 2KCMA 5C3EG 3TREA 4DV3Q 1B8AA 4H02A 2YYZA 4A3EH 1NMGA 1XPUA 2N8NA 3U4VA 3G6EA 1W2BA 5LMNQ 2JA9A 3HKZE 3BJUA 1N34Q 3NEMA 1OTCA 4JI7L 2K52A 1VQHA 4AYBE 4MZ9A 4YCVA 2R7DA 2R93H 3SGIA 4NPSA 4X64Q 4JBKA 4DV0Q 3T1HL 4LF4Q 3OTOL 1HNXQ 1YI2A 1SMXA 3DLLA 3STBC 1Y1VG 4OWXB 3KFUA 1EIYB 3G4SA 3Q8DA 2PI2E 3AQQA 2VQEQ 1VCIA 5M3MH 1N9WA 2Y0SG 3KOJA 3JAMc 4DK6C 2VL6A 5DLQE 1E1TA 4DKAC 2R7ZG 4GNXB 3S14H 4BBRH 1XJVA 3CAMA 2Q2TA 4IFDJ 1FJGL 3AYHB 1I5FA 2KENA 2Q2HA 2YV5A 2B63G 1EWIA 3H0GG 4MNOA 1X6OA 1AE2A 1QZGA 2UUCL 3CCVA 2NZOA 4P72A 2RHQB 1NBWA 4BA2I 1ASZA 4JI4L 1KL9A 3HKZG 3T1YQ 3CCEA 4Y52H 4BBSG 1PYSB 1Q12A 1HR0W 4JI8L 4A3JG 2F4VQ 3J7ZC 3ULPA 4JYAL 1K73C 1FVIA 4JI0L 1SE8A 1VQEA 4X65L 1VQAA 5J3BA 2GN5A 2I5HA 1MIUA 3FHWA 1K0RA 4IPGA 2D0OA 4GKJQ 1IZ6A 4C3HH 1VQJA 2AWOA 3GO5A 4MTNA 4JI5L 4X62L 3GTPH 5C0XG 4LFBL 4LWCA 5IYBG 4IFDI 4GNXA 4XTCS 4JI4Q 2K50A 4A3FH 3CQZH 2E2JH 3K7AH 3I55A 4BY7H 4DR7Q 2ID0A 5IWAL 2ZJQA 4LF9L 4A3EG 4HIMA 3ERSX 4JBWA 2UU9L 4L5QA 1IL2A 3CMAA 1A62A 4JI0Q 1OXVA 4DUYL 4HJ5A 1IBKL 1C7YA 4AQYL 2KBNA 5C4XH 4A3BH 1N36L 4YCWA 2R93G 3UDXA 4DV6Q 3CXCA 1PA6A 3PIOA 2C35B 4DV4L 5M5XH 4DR6L 4EQ5A 1V43A 4YCUA 1HNZQ 4JI3L 4YY3L 1VQLA 1V9PA 1N33Q 3VDYA 5M3MG 4LFBQ 2YTXA 1TWAH 2K75A 3CP0A 3J80i 3UDFA 2IX1A 2NVTH 1A0IA 3UDIA 1E24A 5IWAQ 1S40A 4LF7Q 2GVBA 4BBRG 4DR5Q 4NXMQ 4JOIA 5GAGC 3K81C 4JI2L 4QQBX 4C2MH 1X9NA 3S1MH 4C3JH 4GLVB 3E9IA 3I2ZA 1PH6A 3M7NA 1PVOA 1Q1EA 4DV2Q 2N49A 4UPAA 3PUZA 3U50C 2Z6KC 1IXRA 1JJCB 1VQDA 1N36Q 2NN6G 2AKWB 1Z9FA 3M4QA 1MJEA 3A0JA 4X66L 1L1OC 2YTYA 2XTIA 5ELNA 3TQYA 4DV4Q 3HKSA 3RLFA 3I4NH 1QVCA 2IT1A 1IBLL 1XPOA 4R1JA 4JI3Q 2VQFL 3GTQH 3CCMA 1E3PA 1VQ4A 4A3CH 5K36G 3GD7A 4PMWA 3PUWA 4JI6L 4QY7A 5LMUL 2EIFA 1YIJA 1SLJA 3PUXA 1ASYA 3E0EA 1I50H 4LFCQ 3HOZH 4DNIA 4TVAB 1PH3A 1J5EQ 3I4MH 4JCVE 4DPGA 4DUZL 2CKZB 4DR3L 1I94Q 4UY8C 2WB1E 1KAWA 1XMQQ 2KHIA 4DV3L 3CC2A 3PCOB 2MNAA 1XPRA 3BZKA 2VQFQ 1N34L 4AIMA 4PZ8A 1X56A 4A3FG 3J81i 3CW2C 4A93H 1SROA 4BY7G 1KD1C 5M3FH 4X64L 1VQMA 1QVGA 4DV0L 4LF4L 3PO2H 1HZCA 4B3TQ 3UE0A 5GQOA 3UE1A 3J81j 3PO3H 1NE3A 3AFQA 2QA4A 1YJNA 1PV4A 3CCLA 5C4XG 2VQEL 4A3BG 3M85A 3FKIH 3ULLA 3KF6B 2E2IH 2IHFA 1HJPA 4DR1Q 3TRZA 1L1OB 1P8LA 2LSSA 3L2PA 4KHZA 4B3MQ 5EAYA 2R7FA 2IHEA 2YU9H 4PZ6A 2JA7H 1YBYA 4C3IH 2ZTCA 4IO9A 1PH4A 1YJ9A 3F8TA 1Q1BA 4GN3B 1T9HA 2JA8H 4B3RQ 2D62A 4GS3A 4A3LH 2WB1G 1BVSA 3BU2A 3GTGH 3S24A 3CCQA 4P73A 1VS0A 1EYGA 3OW2A 4UP8A 4Y7NH 4P74A 1YHQA 4YWLA 3T1YL 4FDBA 3ZJYC 1XMOQ 1S3OA 2NVYH 1VQBA 2UXBQ 2JK8A 3I4NG 2CWPA 5IYCH 1U5KA 2F4VL 1WOCA 2BA1A 1K8AC 3K80C 1EUJA 1VQ9A 4A3CG 2VZAA 3GTMH 1SFOH 4IPHA 2QGQA 1Y14B 5LMNW 4DV5Q 3TS0A 2XGTA 3CPFA 4OO1I 3PGZA 3HOZG 3W1GA 4GKJL 5ELOA 2CQOA 4QL5A 2HHHQ 3I4MG 2L15A 1PH9A 1GVPA 1TWFH 3KYHC 4ME3A 4OO1G 3KF6A 4GLAC 3GTJH 3A5ZB 2BH8A 2AHOB 3S2DH 3KDFB 1L1OA 4P75A 3CCJA 4IOCA 2A19A 3I56A 3RN2A 1Q82C 2CCZA 4DR7L 4OX9L 1BKBA 1TWCH 2UXCQ 1I3QH 4BA1I 1KXLA 1X3EA 2JEBI 4DK3C 4EX5A 1HH2P 1X54A 2OQ0A 3DM3A 4A93G 2K5VA 5M3FG 2KHJA 3PO2G 2CWAA 4RG1A 4DV6L 1K8GA 5M5WH 5BR8Q 2VUMH 2PNHA 3PO3G 1HNZL 1AH9A 2EQSA 4GN4B 4PZ7A 2WFWA 1VQ6A 2ALYB 3EN2A 1N33L 2ZTDA 2K14A 1P16A 4GOPC 1VQPA 3FKIG 3HFZB 3OYYA 1TWGH 1G291 1O7IA 1E7ZA 4IPDA 4YWMA 5H1SE 4BY1H 4LF7L 4OX9Q 4DR5L 2NZHA 4IPCA 3HOXH 4NXML 4IFDG 3M9BA 2YTVA 2JA5H 1VQ5A 2JA7G 4POFA 2PI2A 4DV2L 1VQ8A 4B3SQ 2JA8G 3M3YH 4YWKA 3U4ZA 2PQAB 4A3LG 3KJOA 3PIPA 2A8VA 1X55A 3KDFA 4X6AH 3F2CA 5GROA 1CKMA 2ZJPA 2DGYA 4QGUA 1S72A 1IYJB 3M4PA 3CC7A 1B70B 1WFQA 4OONA 4LFCL 5IYCG 4NXNQ 1LYLA 1OXUA 1YHBA 3M4OH 1J5EL 1Y1WH 4LF8Q 3D31A 1HR0Q 3HOVH 2VY3A 3PV0A 1PH1A 3RNUA 3GTOH 3EBEA 3W1BA 4O2DA 1I94L 3CCUA 4HJAA 4XIGS 2HT1A 1M1KC 3H15A 1W3SA 1EQRA 5JEAJ 4A3GG 1M90C 2CFMA 1Q8KA 4LUZA 3GTLH 4IOAA 4GOPB 1B7YB 1D8LA 4DV7L 2MO1A 1JJGA 5C44H 2WAQE 4LNQA 3F1ZA 4B3TL 2JEAI 2BA0A 4DV1Q 4UP7A 3K7UC 1VQFA 4OWTB 1IBMQ 2PQAA 2VUMG 1PH2A 2OTLA 3PUYA 2AWNA 1Z47A 4KHPL 1YZ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR1 L;  5IYD H;  3CPW A;  3UDG A;  4B3M L;  4LW1 A;  4HJ9 A;  1YNX A;  2R6G A;  2JE6 I;  1V1Q A;  4NB3 A;  1C9O A;  1QUQ B;  2VW9 A;  1GO3 E;  4POG A;  1HZB A;  2WP8 J;  4BY1 G;  2A1A A;  1Q46 A;  1XNQ Q;  2Q2U A;  3K0X A;  4DV7 Q;  1WJJ A;  2E8G A;  3JAM i;  5GAH C;  5AJ3 Q;  3HOX G;  4B3R L;  1H95 A;  1XMQ L;  2JA5 G;  1QVF A;  2JQO A;  2VNU D;  3HOW H;  1KRS A;  5FLM H;  1XNR L;  1WCM H;  3J80 c;  4LF6 Q;  4DR2 Q;  4A3K H;  3L7Z C;  1BBU A;  2UUA L;  1HNW Q;  1XMO L;  2RCN A;  4YHH L;  4A3I H;  3K8A A;  2VS1 A;  3G48 A;  1PHJ A;  4KHP Q;  2UXB L;  2JA6 H;  1VQI A;  4RMF A;  2R92 H;  4HJ7 A;  3H3V I;  1FL0 A;  2WAQ G;  1Q86 C;  1N32 Q;  3KLW A;  2HIV A;  3ER0 A;  5IE8 A;  2E2H H;  3KF8 B;  3GDE A;  3WWV A;  1NY4 A;  5GAD C;  5IP7 H;  1VQO A;  1I6H H;  2OCE A;  4DV5 L;  3S17 H;  4WJ3 M;  3PF5 A;  3S2H H;  3S1N H;  2HHH L;  2IX0 A;  2QEX A;  2V1C C;  1Y1W G;  3JC6 6;  1UEB A;  3BZC A;  3A74 A;  1XNR Q;  3HOV G;  4GLX A;  1UE1 A;  4IJH A;  1PH5 A;  4A3D H;  2UUA Q;  1LM0 A;  1X3G A;  3GTK H;  4JV5 Q;  1AE3 A;  2ZTE A;  4YHH Q;  2UXD Q;  1QUQ A;  3HOU H;  3S15 H;  3CD6 A;  2UXC L;  2UUB L;  1KHI A;  3RZD H;  1KRT A;  1PH7 A;  1YVC A;  4JOI C;  3KJP A;  1TXY A;  1NTG A;  1CKN B;  1MKH A;  3RZO H;  1K9M C;  1LUZ A;  2Z0S A;  5C44 G;  5BR8 L;  1MJC A;  3G71 A;  2HQL A;  3ICE A;  4K0K Q;  4LFA Q;  1RIP A;  4HID A;  1HZ9 A;  1K3R A;  4A3G H;  2JJQ A;  4PG3 A;  3W5O A;  2DUD A;  2Z6K A;  3J81 c;  4A3M H;  2IY5 B;  2HIX A;  3B6Y A;  1CUK A;  3NEN A;  5C0X J;  3A5U A;  4L5S A;  5IYD G;  4KI0 A;  2KCT A;  2BH2 A;  2K4K A;  1YHA A;  4QJF A;  4JI1 L;  3CME A;  2UUB Q;  1EQQ A;  2I5M X;  3U58 A;  1JJ2 A;  3PF4 A;  4QIW E;  1RL2 A;  2R92 G;  1E1O A;  4JI7 Q;  2ZJR A;  4B3S L;  3NEL A;  1VQG A;  2H5X A;  3T1H Q;  5E7N A;  3HOW G;  3OTO Q;  4GN5 A;  1L0W A;  5FLM G;  4J15 A;  4L5R C;  1WCM G;  3E9H A;  4A3K G;  1NMF A;  2B3G A;  2NVX H;  3STB D;  4JG2 A;  2RHS B;  4A75 A;  1UE5 A;  4A3I G;  1KIX A;  4BXX H;  1L2F A;  2F3I A;  4AYB G;  2JA6 G;  4NXN L;  4GKK L;  3HOY H;  2MQH A;  1CKN A;  2LXK A;  5HGQ A;  1Q81 C;  4JI1 Q;  1C0A A;  3EIV A;  3F2D A;  4LF8 L;  4R4C A;  5IP7 G;  4ALP A;  1HR0 L;  3MXN B;  4LF5 L;  1FJG Q;  5JJI A;  1A63 A;  1JT8 A;  1X3F A;  3S1Q H;  5C0X I;  1JB7 A;  3J7A 5;  4R4O A;  3TEH B;  3AEV A;  1X65 A;  1YEZ A;  2ES2 A;  4A4I A;  5FLX c;  2UUC Q;  1EOV A;  3NBH B;  1KQS A;  4A3D G;  5JJK A;  1R9T H;  3LGJ A;  4TQU S;  5IP9 H;  4AH6 A;  2N78 A;  4DAY B;  2I5L X;  3H3V H;  4O0A A;  2OQK A;  4R4Q A;  2NVQ H;  3HOU G;  4R4I A;  4JI8 Q;  2AMC B;  1E22 A;  2ATW A;  4OXP A;  4DV1 L;  4JYA Q;  5C4J H;  2Q2I A;  1IBM L;  3L0O A;  2ZM6 L;  4LF5 Q;  2GVA A;  4X65 Q;  2I0Q A;  4APV A;  3S1R H;  1JMC A;  1VQ7 A;  1YIT A;  5FJ8 H;  3IRB A;  1YJW A;  5C3E H;  1CSQ A;  4A3M G;  1VQK A;  1WI5 A;  2K5H A;  4X62 Q;  4JI5 Q;  3RLN A;  2F52 A;  1XNQ L;  4A76 A;  3RR5 A;  5AJ3 L;  3PUV A;  4OWW B;  1G51 A;  1VQN A;  1GM5 A;  2B29 A;  4LF9 Q;  1SR3 A;  1SRU A;  2UU9 Q;  4DR4 L;  1KC8 C;  2NN6 I;  2ZM6 Q;  1WYD A;  1Y1V H;  5IY0 A;  3CF5 A;  4JBJ A;  4DUY Q;  4DR2 L;  4AQY Q;  1IBK Q;  4LF6 L;  3PSI A;  1HNW L;  1FGU A;  1OXS C;  3AFP A;  2EXD A;  3D0F A;  2E5L L;  4DR6 Q;  1EFW A;  1PFS A;  3I4O A;  4YY3 Q;  2R7Z H;  1GKH A;  1N32 L;  3S16 H;  4DAM A;  1PH8 A;  1OXX K;  4HIO A;  3TS2 A;  4HIK A;  4BXX G;  3ULJ A;  1QZH A;  4JC0 A;  4JBM A;  1OXT A;  3HOY G;  1TWH H;  1UE7 A;  3CCR A;  1NJI C;  1UWV A;  2D0P A;  2B63 H;  3H0G H;  4DR4 Q;  1A8V A;  1J6Q A;  4JI2 Q;  1N8R C;  1CKO A;  4JV5 L;  1PYB A;  2MO0 A;  2LXJ A;  5JEA G;  4GKK Q;  4GNX C;  1UE6 A;  1VQC A;  2UXD L;  4X66 Q;  4BBS H;  5GAE C;  2E5L Q;  2OWO A;  1HZA A;  4WJ4 A;  2FXQ A;  4GOP A;  1Q7Y C;  4P71 A;  4A3J H;  1IBL Q;  2OTJ A;  1D7Q A;  1LTL A;  3CC4 A;  2Y0S E;  2MFI A;  2PMZ E;  2N3S A;  2K5N A;  1SN8 A;  1XTD A;  4R4T A;  5IT9 c;  5LMN L;  5IP9 G;  1BBW A;  4L5T A;  1EIF A;  4JI6 Q;  1DGS A;  4KLK A;  5LMU Q;  1JE5 A;  1CSP A;  4K0K L;  5JJL A;  5M5Y H;  4LFA L;  3I7F A;  3RLO A;  1HNX L;  1G6P A;  2ASB A;  1GD7 A;  4IJL A;  5HY6 A;  4LUO A;  3FP9 A;  4HJ8 A;  3MEF A;  2RF4 A;  5IYB H;  1K83 H;  1U0L A;  3RN5 A;  5FJ8 G;  3CCS A;  4DUZ Q;  4LUV A;  4UP9 A;  4DR3 Q;  3F2B A;  2KCM A;  5C3E G;  3TRE A;  4DV3 Q;  1B8A A;  4H02 A;  2YYZ A;  4A3E H;  1NMG A;  1XPU A;  2N8N A;  3U4V A;  3G6E A;  1W2B A;  5LMN Q;  2JA9 A;  3HKZ E;  3BJU A;  1N34 Q;  3NEM A;  1OTC A;  4JI7 L;  2K52 A;  1VQH A;  4AYB E;  4MZ9 A;  4YCV A;  2R7D A;  2R93 H;  3SGI A;  4NPS A;  4X64 Q;  4JBK A;  4DV0 Q;  3T1H L;  4LF4 Q;  3OTO L;  1HNX Q;  1YI2 A;  1SMX A;  3DLL A;  3STB C;  1Y1V G;  4OWX B;  3KFU A;  1EIY B;  3G4S A;  3Q8D A;  2PI2 E;  3AQQ A;  2VQE Q;  1VCI A;  5M3M H;  1N9W A;  2Y0S G;  3KOJ A;  3JAM c;  4DK6 C;  2VL6 A;  5DLQ E;  1E1T A;  4DKA C;  2R7Z G;  4GNX B;  3S14 H;  4BBR H;  1XJV A;  3CAM A;  2Q2T A;  4IFD J;  1FJG L;  3AYH B;  1I5F A;  2KEN A;  2Q2H A;  2YV5 A;  2B63 G;  1EWI A;  3H0G G;  4MNO A;  1X6O A;  1AE2 A;  1QZG A;  2UUC L;  3CCV A;  2NZO A;  4P72 A;  2RHQ B;  1NBW A;  4BA2 I;  1ASZ A;  4JI4 L;  1KL9 A;  3HKZ G;  3T1Y Q;  3CCE A;  4Y52 H;  4BBS G;  1PYS B;  1Q12 A;  1HR0 W;  4JI8 L;  4A3J G;  2F4V Q;  3J7Z C;  3ULP A;  4JYA L;  1K73 C;  1FVI A;  4JI0 L;  1SE8 A;  1VQE A;  4X65 L;  1VQA A;  5J3B A;  2GN5 A;  2I5H A;  1MIU A;  3FHW A;  1K0R A;  4IPG A;  2D0O A;  4GKJ Q;  1IZ6 A;  4C3H H;  1VQJ A;  2AWO A;  3GO5 A;  4MTN A;  4JI5 L;  4X62 L;  3GTP H;  5C0X G;  4LFB L;  4LWC A;  5IYB G;  4IFD I;  4GNX A;  4XTC S;  4JI4 Q;  2K50 A;  4A3F H;  3CQZ H;  2E2J H;  3K7A H;  3I55 A;  4BY7 H;  4DR7 Q;  2ID0 A;  5IWA L;  2ZJQ A;  4LF9 L;  4A3E G;  4HIM A;  3ERS X;  4JBW A;  2UU9 L;  4L5Q A;  1IL2 A;  3CMA A;  1A62 A;  4JI0 Q;  1OXV A;  4DUY L;  4HJ5 A;  1IBK L;  1C7Y A;  4AQY L;  2KBN A;  5C4X H;  4A3B H;  1N36 L;  4YCW A;  2R93 G;  3UDX A;  4DV6 Q;  3CXC A;  1PA6 A;  3PIO A;  2C35 B;  4DV4 L;  5M5X H;  4DR6 L;  4EQ5 A;  1V43 A;  4YCU A;  1HNZ Q;  4JI3 L;  4YY3 L;  1VQL A;  1V9P A;  1N33 Q;  3VDY A;  5M3M G;  4LFB Q;  2YTX A;  1TWA H;  2K75 A;  3CP0 A;  3J80 i;  3UDF A;  2IX1 A;  2NVT H;  1A0I A;  3UDI A;  1E24 A;  5IWA Q;  1S40 A;  4LF7 Q;  2GVB A;  4BBR G;  4DR5 Q;  4NXM Q;  4JOI A;  5GAG C;  3K81 C;  4JI2 L;  4QQB X;  4C2M H;  1X9N A;  3S1M H;  4C3J H;  4GLV B;  3E9I A;  3I2Z A;  1PH6 A;  3M7N A;  1PVO A;  1Q1E A;  4DV2 Q;  2N49 A;  4UPA A;  3PUZ A;  3U50 C;  2Z6K C;  1IXR A;  1JJC B;  1VQD A;  1N36 Q;  2NN6 G;  2AKW B;  1Z9F A;  3M4Q A;  1MJE A;  3A0J A;  4X66 L;  1L1O C;  2YTY A;  2XTI A;  5ELN A;  3TQY A;  4DV4 Q;  3HKS A;  3RLF A;  3I4N H;  1QVC A;  2IT1 A;  1IBL L;  1XPO A;  4R1J A;  4JI3 Q;  2VQF L;  3GTQ H;  3CCM A;  1E3P A;  1VQ4 A;  4A3C H;  5K36 G;  3GD7 A;  4PMW A;  3PUW A;  4JI6 L;  4QY7 A;  5LMU L;  2EIF A;  1YIJ A;  1SLJ A;  3PUX A;  1ASY A;  3E0E A;  1I50 H;  4LFC Q;  3HOZ H;  4DNI A;  4TVA B;  1PH3 A;  1J5E Q;  3I4M H;  4JCV E;  4DPG A;  4DUZ L;  2CKZ B;  4DR3 L;  1I94 Q;  4UY8 C;  2WB1 E;  1KAW A;  1XMQ Q;  2KHI A;  4DV3 L;  3CC2 A;  3PCO B;  2MNA A;  1XPR A;  3BZK A;  2VQF Q;  1N34 L;  4AIM A;  4PZ8 A;  1X56 A;  4A3F G;  3J81 i;  3CW2 C;  4A93 H;  1SRO A;  4BY7 G;  1KD1 C;  5M3F H;  4X64 L;  1VQM A;  1QVG A;  4DV0 L;  4LF4 L;  3PO2 H;  1HZC A;  4B3T Q;  3UE0 A;  5GQO A;  3UE1 A;  3J81 j;  3PO3 H;  1NE3 A;  3AFQ A;  2QA4 A;  1YJN A;  1PV4 A;  3CCL A;  5C4X G;  2VQE L;  4A3B G;  3M85 A;  3FKI H;  3ULL A;  3KF6 B;  2E2I H;  2IHF A;  1HJP A;  4DR1 Q;  3TRZ A;  1L1O B;  1P8L A;  2LSS A;  3L2P A;  4KHZ A;  4B3M Q;  5EAY A;  2R7F A;  2IHE A;  2YU9 H;  4PZ6 A;  2JA7 H;  1YBY A;  4C3I H;  2ZTC A;  4IO9 A;  1PH4 A;  1YJ9 A;  3F8T A;  1Q1B A;  4GN3 B;  1T9H A;  2JA8 H;  4B3R Q;  2D62 A;  4GS3 A;  4A3L H;  2WB1 G;  1BVS A;  3BU2 A;  3GTG H;  3S24 A;  3CCQ A;  4P73 A;  1VS0 A;  1EYG A;  3OW2 A;  4UP8 A;  4Y7N H;  4P74 A;  1YHQ A;  4YWL A;  3T1Y L;  4FDB A;  3ZJY C;  1XMO Q;  1S3O A;  2NVY H;  1VQB A;  2UXB Q;  2JK8 A;  3I4N G;  2CWP A;  5IYC H;  1U5K A;  2F4V L;  1WOC A;  2BA1 A;  1K8A C;  3K80 C;  1EUJ A;  1VQ9 A;  4A3C G;  2VZA A;  3GTM H;  1SFO H;  4IPH A;  2QGQ A;  1Y14 B;  5LMN W;  4DV5 Q;  3TS0 A;  2XGT A;  3CPF A;  4OO1 I;  3PGZ A;  3HOZ G;  3W1G A;  4GKJ L;  5ELO A;  2CQO A;  4QL5 A;  2HHH Q;  3I4M G;  2L15 A;  1PH9 A;  1GVP A;  1TWF H;  3KYH C;  4ME3 A;  4OO1 G;  3KF6 A;  4GLA C;  3GTJ H;  3A5Z B;  2BH8 A;  2AHO B;  3S2D H;  3KDF B;  1L1O A;  4P75 A;  3CCJ A;  4IOC A;  2A19 A;  3I56 A;  3RN2 A;  1Q82 C;  2CCZ A;  4DR7 L;  4OX9 L;  1BKB A;  1TWC H;  2UXC Q;  1I3Q H;  4BA1 I;  1KXL A;  1X3E A;  2JEB I;  4DK3 C;  4EX5 A;  1HH2 P;  1X54 A;  2OQ0 A;  3DM3 A;  4A93 G;  2K5V A;  5M3F G;  2KHJ A;  3PO2 G;  2CWA A;  4RG1 A;  4DV6 L;  1K8G A;  5M5W H;  5BR8 Q;  2VUM H;  2PNH A;  3PO3 G;  1HNZ L;  1AH9 A;  2EQS A;  4GN4 B;  4PZ7 A;  2WFW A;  1VQ6 A;  2ALY B;  3EN2 A;  1N33 L;  2ZTD A;  2K14 A;  1P16 A;  4GOP C;  1VQP A;  3FKI G;  3HFZ B;  3OYY A;  1TWG H;  1G29 1;  1O7I A;  1E7Z A;  4IPD A;  4YWM A;  5H1S E;  4BY1 H;  4LF7 L;  4OX9 Q;  4DR5 L;  2NZH A;  4IPC A;  3HOX H;  4NXM L;  4IFD G;  3M9B A;  2YTV A;  2JA5 H;  1VQ5 A;  2JA7 G;  4POF A;  2PI2 A;  4DV2 L;  1VQ8 A;  4B3S Q;  2JA8 G;  3M3Y H;  4YWK A;  3U4Z A;  2PQA B;  4A3L G;  3KJO A;  3PIP A;  2A8V A;  1X55 A;  3KDF A;  4X6A H;  3F2C A;  5GRO A;  1CKM A;  2ZJP A;  2DGY A;  4QGU A;  1S72 A;  1IYJ B;  3M4P A;  3CC7 A;  1B70 B;  1WFQ A;  4OON A;  4LFC L;  5IYC G;  4NXN Q;  1LYL A;  1OXU A;  1YHB A;  3M4O H;  1J5E L;  1Y1W H;  4LF8 Q;  3D31 A;  1HR0 Q;  3HOV H;  2VY3 A;  3PV0 A;  1PH1 A;  3RNU A;  3GTO H;  3EBE A;  3W1B A;  4O2D A;  1I94 L;  3CCU A;  4HJA A;  4XIG S;  2HT1 A;  1M1K C;  3H15 A;  1W3S A;  1EQR A;  5JEA J;  4A3G G;  1M90 C;  2CFM A;  1Q8K A;  4LUZ A;  3GTL H;  4IOA A;  4GOP B;  1B7Y B;  1D8L A;  4DV7 L;  2MO1 A;  1JJG A;  5C44 H;  2WAQ E;  4LNQ A;  3F1Z A;  4B3T L;  2JEA I;  2BA0 A;  4DV1 Q;  4UP7 A;  3K7U C;  1VQF A;  4OWT B;  1IBM Q;  2PQA A;  2VUM G;  1PH2 A;  2OTL A;  3PUY A;  2AWN A;  1Z47 A;  4KHP L;  1YZ6 A; 
#chains in the Genus database with same CATH topology
 4HJ9 A;  1XX8 A;  2JE6 I;  4OIK A;  1C9O A;  1EY5 A;  1IYU A;  3TZD A;  2WP8 J;  1XNQ Q;  1Q46 A;  3K0X A;  2EY2 A;  1WJJ A;  2JA5 G;  1GUS A;  5JJZ A;  4KHV A;  1BO0 A;  5FLM H;  4A3K H;  2UUA L;  4G7O C;  2F3W A;  1XMO L;  4A3I H;  4DN4 M;  2JA6 H;  3PMF A;  4HJ7 A;  2D9U A;  1Q86 C;  1N32 Q;  2K04 A;  3I4N B;  2HIV A;  2B2U A;  3ER0 A;  4KY5 A;  3WWV A;  4HTH A;  5C5M A;  1F2Z A;  4DV5 L;  2H1E A;  2SOB A;  3S2H H;  3EQL C;  3NQI A;  3S1N H;  4X3K A;  1ENF A;  2B63 B;  3OIQ A;  2QEX A;  4GLX A;  4IJH A;  4A3D H;  2UUA Q;  3HKZ B;  1TS3 A;  5KND A;  1CFM A;  4BBS B;  3RZD H;  2K32 A;  1KRT A;  1F2Y A;  3D3R A;  1F9P A;  1NTG A;  3ITP A;  5BR8 L;  2HQL A;  3ICE A;  5M3F B;  4LFA Q;  1RIP A;  3PO2 B;  4RGT A;  2JJQ A;  3W5O A;  2Z6K A;  4DNR B;  4A3M H;  3C3L A;  2IY5 B;  3NEN A;  1CUK A;  5C0X J;  5I6W A;  1EY7 A;  2KCT A;  4NMZ A;  5FO8 B;  2B39 A;  2E2I B;  1IKM A;  4JI1 L;  3PF4 A;  1B53 A;  1JJ2 A;  4QIW E;  4JI7 Q;  2ZJR A;  2XVS A;  3NEL A;  4OL7 A;  1VQG A;  2M9V A;  1MSH A;  2MPM A;  1KNA A;  3OTO Q;  3OSO A;  3KBG A;  2XSC A;  3E9H A;  4C1N K;  3TBI B;  4A75 A;  1L2F A;  4NXN L;  5D14 A;  4FNF A;  2EY1 A;  4JI1 Q;  3F2D A;  3SXH A;  3WOF A;  5IP7 G;  3MXN B;  1A63 A;  3J80 L;  5JJI A;  1JT8 A;  5CYU A;  1SE2 A;  1U4R A;  3AEV A;  3JAM E;  3EA6 A;  2ES2 A;  4A4I A;  5FLX c;  1JE4 A;  1R9T H;  5IP9 H;  1RTO A;  4DAY B;  3HOU G;  4O0A A;  3LWU A;  4R4I A;  2AMC B;  3ERO A;  5C4J H;  2Q2I A;  1IBM L;  1SJH D;  3CKI B;  2I0Q A;  4RWS C;  3S1R H;  1YIT A;  3FPU B;  3NUC A;  2VUM B;  3BDL A;  4ODG A;  1CSQ A;  1VQK A;  1WI5 A;  4X62 Q;  4JI5 Q;  1H9S B;  3VYS A;  3PUV A;  1HRJ A;  1GM5 A;  4LF9 Q;  4MTK A;  3MXN A;  1SRU A;  4DR4 L;  1KC8 C;  2R61 A;  3RUZ A;  4LF6 L;  3J81 L;  4DR2 L;  1EU3 A;  5FLX E;  4JPB W;  1OXS C;  1RD9 D;  1NAP A;  3VR4 A;  4K6L A;  2XWJ B;  1PFS A;  3BVZ A;  4DAY A;  2F0J A;  3FMC A;  4HIK A;  3ULJ A;  1TWA B;  4JC0 A;  1TWH H;  3MVV A;  1UE7 A;  1NJI C;  2D0P A;  4DR4 Q;  2BOS A;  5J22 A;  3VR5 A;  3V2T A;  1LAC A;  1G91 A;  4GKK Q;  1UE6 A;  1HZA A;  3MFY A;  2FXQ A;  2OTJ A;  1A3T A;  1H9S A;  3CC4 A;  5LMN L;  2K5N A;  2PMZ E;  3BDC A;  4LMQ D;  1BBW A;  4JI6 Q;  3AB9 A;  3KUP A;  3HOZ B;  4IJL A;  4DK1 A;  3FP9 A;  3MEF A;  3RN5 A;  4DR3 Q;  1QCB D;  4B9W A;  1B8A A;  2E75 C;  2F4I A;  2N8N A;  5LMN Q;  3HKZ E;  4U68 A;  2MGS A;  3BJU A;  4XQQ A;  1SNO A;  4KMU C;  3I4L A;  4K14 A;  4JBK A;  4F8M A;  4DV0 Q;  4LF4 Q;  4H44 C;  1SMX A;  1ML0 D;  4OWX B;  2B8F A;  3AQQ A;  2VQE Q;  1N9W A;  4FXG C;  2VL6 A;  3FKI B;  1E1T A;  4GNX B;  3S14 H;  3H09 A;  1NSN S;  3W2D A;  1FJG L;  2YV5 A;  1V1O A;  5KNB A;  1EWI A;  4K5W A;  2PCF B;  3S17 B;  1I4X A;  4MNO A;  1B9M A;  1AE2 A;  1QZG A;  3PQI A;  2UUC L;  1EY9 A;  1ASZ A;  3CCE A;  1XYI A;  4OGQ C;  4IAL A;  1QNK A;  1KTK A;  1WTW A;  3HZX A;  4A3J G;  3HOU B;  1EYD A;  3WOE A;  1K73 C;  3S15 B;  4JYA L;  4X65 L;  3QOJ A;  2N88 A;  4PNY A;  1SFO B;  2GN5 A;  2I5H A;  3I3C A;  3FHW A;  2AQ2 B;  2RSN A;  1KDA A;  1Q90 A;  1F77 A;  1GJX A;  5IT9 L;  4GNX A;  2K50 A;  4K8I A;  3CQZ H;  2E2J H;  3K7A H;  3I55 A;  1TKW B;  2BE5 C;  2ID0 A;  4A3E G;  3ERS X;  3MC0 B;  2UU9 L;  4L5Q A;  3BYY B;  1A62 A;  1TWC B;  4DUY L;  1G6Z A;  4A3B H;  3CXC A;  2C35 B;  3CHB D;  5CGK A;  4DR6 L;  5EPL A;  4EQ5 A;  1A15 A;  3VR3 A;  2K01 A;  5M3M G;  1EYA A;  1KLU D;  4OEM B;  3T4A C;  2IX1 A;  2F0U A;  3UDI A;  3SK6 A;  5IIF A;  2GVB A;  4BBR G;  2OF1 A;  1H9M A;  5GAG C;  4HN7 A;  1CA6 A;  4JI2 L;  4JVZ A;  4Z9C B;  3M7N A;  4HED A;  1IXR A;  1Z9F A;  2L9H A;  3MWY W;  3A0J A;  4IUR A;  1HTP A;  5BN3 A;  5ELN A;  3TQY A;  3MXP A;  3I4N H;  2IT1 A;  1U9R A;  5COR A;  1O80 A;  2WAQ B;  1VQ4 A;  5K36 G;  4S3S A;  1PRT F;  2KHS A;  5LMU L;  1C4Q A;  1SLJ A;  3PUX A;  2XIW A;  1WTQ A;  4NDX A;  3I4M H;  3K59 A;  1Y1W B;  2NWG A;  4UY8 C;  2CKZ B;  3GV3 A;  3GTO B;  1IYV A;  4KK7 A;  4DV3 L;  3PCO B;  2MNA A;  1PYW D;  4C56 C;  1AW7 A;  1LO5 D;  3DUZ A;  4A93 H;  3BG3 A;  5K5P A;  4ZQ3 A;  1KD1 C;  1SYF A;  5KRU A;  5M3F H;  3I91 A;  4X64 L;  4G57 A;  5I4D A;  5CC4 A;  1VQM A;  5JPM C;  3PO2 H;  3Q22 A;  1HZC A;  5GQO A;  1NE3 A;  1ONL A;  3AFQ A;  4WFN 3;  1B3Q A;  3OWE B;  1HQR D;  5C4X G;  4ZLT F;  3T51 B;  3I72 A;  5L37 A;  3ULL A;  2E2I H;  2WKC A;  1HJP A;  3L2P A;  5EAY A;  1NCV A;  1YBY A;  5CV8 A;  2IPK D;  2ZTC A;  4IO9 A;  2FMM A;  5ELD A;  2WB1 G;  4IUP A;  3DWP A;  3S24 A;  4P73 A;  4XXE A;  3ND8 A;  1EIH A;  3T1Y L;  1JC7 A;  4RAU C;  3ZJY C;  1VQB A;  2CWP A;  4A3I B;  4AYB B;  2JA6 B;  1SYG A;  1ENA A;  1B50 A;  1EUJ A;  4A3C G;  1L0Y B;  2FFK B;  3WDN A;  1PRT B;  4OO1 I;  3W1G A;  5ELO A;  3S2H B;  1TY0 A;  3QG1 A;  5M5Y B;  1PH9 A;  1TWF H;  3KYH C;  2BH8 A;  4P75 A;  4WJW A;  4A3D B;  1STE A;  1E2Z A;  3I70 A;  4HCE A;  1BKB A;  3IAY A;  1I3Q H;  3AU7 A;  1YNJ C;  4A3E B;  3MHB A;  1PMR A;  3RZD B;  1JR0 D;  4UHV A;  2VUM H;  1K8G A;  3PO3 G;  1AH9 A;  1SXT A;  4GN4 B;  4PZ7 A;  3F2U A;  1VQ6 A;  2ALY B;  5ISR A;  3EN2 A;  3A54 A;  1N33 L;  2ZTD A;  5CR3 A;  1P16 A;  2B2V A;  4GOP C;  4A3M B;  5H1S E;  1O7I A;  1V1P B;  5M3M B;  1RCV D;  4LF7 L;  3TME A;  4IPC A;  1PFB A;  2JA5 H;  5CV7 A;  1ICW A;  2F0D A;  1QWY A;  1VQ8 A;  4B3S Q;  1TQO A;  2JA8 G;  3VYT A;  3U4Z A;  1ET6 A;  3PIP A;  1SSO A;  4RGM A;  2V4D A;  4IUT A;  3FPP A;  1H9J A;  1K8M A;  1O7L A;  2DGY A;  2EYP A;  4LAA A;  4O42 A;  3ND9 A;  2RA4 A;  3OOC A;  4KY7 A;  1OXU A;  3MXU A;  4GZY C;  1MSG A;  1STH A;  1VF5 C;  2Z9H A;  3PV0 A;  2BDN A;  2F1M A;  3EBE A;  1CZW A;  1I94 L;  3CCU A;  1LTR D;  1W3S A;  4LJZ C;  4A3G G;  1V1P A;  1PTO H;  1QB5 D;  2R3Z A;  2CFM A;  3SDZ A;  1R9T B;  4XQJ A;  2DNC A;  3A8I E;  2WAQ E;  4B3T L;  2JEA I;  4ILW A;  4DV1 Q;  2A5H A;  1EYC A;  4OO1 H;  1I6V C;  1PH2 A;  3PIO 3;  5C4X B;  2AWN A;  1JOK A;  1D1K A;  3MEH A;  4B3M L;  2Z4I A;  2R6G A;  4NB3 A;  2VW9 A;  1B4O A;  1GO3 E;  4ID6 A;  2J7Z A;  3BYT B;  5E1F A;  1QVF A;  4X3S A;  1EOT A;  4C2M B;  2WB1 B;  1BBU A;  2M2L A;  4YHH L;  4XDX A;  3K8A A;  1BBX C;  2UXB L;  4RMF A;  4F87 A;  5IE8 A;  4FXD A;  3KF8 B;  3SK5 A;  5IP7 H;  1BNZ A;  2OCE A;  3S17 H;  4H7B A;  5C3X A;  3PF5 A;  1TWH B;  1DOM A;  1B9N A;  2HHH L;  2IX0 A;  3JC6 6;  5EPJ A;  4EQP A;  1UEB A;  3BZC A;  4ZK9 B;  3HOV G;  3N52 A;  1EL0 A;  1PH5 A;  1UAP A;  1X3G A;  5ELB A;  3K5O A;  4YHH Q;  2UXD Q;  3HOU H;  3S15 H;  4TSS A;  2UXC L;  3P75 A;  1H9R A;  1CKN B;  1K9M C;  4QB4 A;  1EEI D;  3NTH A;  3H6M A;  4JW0 A;  3G71 A;  1DCZ A;  4K0K Q;  3KK7 A;  1EFI D;  1HZ9 A;  4KKU A;  3PO3 B;  2TMP A;  1GUN A;  1T5E A;  1MHW C;  4KI0 A;  5IYD G;  3KF8 A;  3LWE A;  5TSS A;  3T13 A;  1YHA A;  2F0V A;  3U58 A;  1STG A;  4QUF A;  1PXU A;  1RL2 A;  1O7Z A;  1HCZ A;  1XTC D;  1TS4 A;  4ZUI A;  3HOW G;  2JA8 B;  1L0W A;  3IL8 A;  3GTG B;  2B3G A;  2NVX H;  3STB D;  4JG2 A;  2F0N A;  1MI2 A;  1CKN A;  2LXK A;  4H0L C;  1C0A A;  4LF8 L;  4ALP A;  1HR0 L;  5FOB B;  2QIL A;  1X3F A;  1JB7 A;  2FIN B;  3E0J A;  1YEZ A;  1WTP A;  4IUQ A;  3LGJ A;  4CDD C;  4MHE A;  2NVQ H;  1WTR A;  2C9O A;  3TZU A;  1SNC A;  2RQX A;  1SJE D;  1K0S A;  3T56 B;  4QUC A;  3R2I A;  5M5W B;  3IRB A;  1YJW A;  2K5H A;  1A2U A;  1LTT D;  3I73 A;  4DNT B;  1XNQ L;  1NUC A;  1JOR A;  4A76 A;  3RR5 A;  4U67 3;  1VQN A;  1G51 A;  2E2J B;  3RMH A;  1SR3 A;  2QCP X;  1AP0 A;  3OWF A;  1QNU A;  1IBK Q;  4AQY Q;  1OO9 B;  3PSI A;  4EQN A;  5HGT A;  1CZG A;  1SAP A;  1N32 L;  1STN A;  2K03 A;  5G3L F;  3T53 B;  4YY3 Q;  3DEO A;  1PH8 A;  1ESF A;  3U9O A;  4HIO A;  3TS2 A;  4BXX G;  1QZH A;  4JBM A;  3HOY G;  2Q8I B;  4K6D A;  5IGD A;  1UWV A;  4BS9 A;  1KDB A;  1VDZ A;  5KIX A;  2X6G A;  2VB2 X;  2EYF A;  1CKO A;  3HRZ C;  2LXJ A;  2MO0 A;  5JEA G;  4GNX C;  2F0P A;  1GUT A;  4FF4 A;  4GOP A;  4A3J H;  4XT1 B;  1LTL A;  2Y0S E;  2N3S A;  5LL6 S;  4R4T A;  4HCS A;  4L5T A;  1JE5 A;  1G6P A;  5M5Y H;  4LFA L;  1Z6H A;  1TVX A;  4LUO A;  3I4M B;  4NKL A;  5FJ8 G;  4DUZ Q;  4UP9 A;  2WV6 D;  2RBM A;  3NXW A;  2YYZ A;  4DK0 A;  3VYU A;  3TP7 A;  4CDC C;  4A3E H;  3U4V A;  2JA9 A;  3NEM A;  4JI7 L;  2K52 A;  2F3V A;  3NWT A;  4MZ9 A;  5F2D A;  3DWA A;  4YCV A;  4A93 B;  4UDU C;  1W6J A;  4M1U B;  3J7A F;  1PRT D;  3OTO L;  5FO9 B;  1YI2 A;  3DLL A;  3STB C;  1Y1V G;  1EIY B;  1JQY D;  5JPN C;  3HOW B;  3R2T A;  1VMC A;  4KJO A;  1RF2 D;  3QIA A;  5M3M H;  3KOJ A;  1PFN A;  4HMI A;  3JAM c;  1ZYR C;  5DLQ E;  2CH4 A;  3BZD B;  4BBR H;  5CV6 A;  3CAM A;  2NZ1 D;  2B2T C;  2Q2T A;  1PZI D;  2K5D A;  1SYE A;  3Q6S A;  4FF1 A;  5A2Q E;  3H0G G;  1D5X C;  5DAU A;  1E2V A;  3QR8 A;  1DOK A;  2RHQ B;  1KL9 A;  3BVG A;  5K36 H;  5FKA C;  4Y52 H;  1VF7 A;  4RHS A;  1FYC A;  1VQE A;  2L12 A;  5IGF A;  1VQA A;  3RD4 A;  5J3B A;  1M4V A;  2C5C A;  3RZO B;  2L0C A;  1K0R A;  1NR4 A;  1IZ6 A;  3GO5 A;  2AWO A;  4JI5 L;  4X62 L;  3GTP H;  1PTO F;  1TWF B;  4XTC S;  5KNC A;  4LF9 L;  2K33 A;  4HIM A;  1V8Q A;  1ZXT A;  1GHJ A;  1I3Q B;  2EYH A;  4HJ5 A;  1C7Y A;  1CM9 A;  1O7Y A;  2A6E D;  3GV6 A;  2SNS A;  5C4X H;  2R93 G;  1RKN A;  5I2Y A;  4DV4 L;  5M5X H;  1V43 A;  1HNZ Q;  1JWS D;  1RTN A;  1CQF A;  4FF3 A;  1MGS A;  1S40 A;  2B2W C;  4DR5 Q;  4NXM Q;  2BE5 D;  4QQB X;  4C2M H;  1TT2 A;  2JA5 B;  3E9I A;  4DV2 Q;  1VQD A;  1JJC B;  4GKK L;  4DV4 Q;  3S1Q B;  3RLF A;  3NQT A;  2F0E A;  2O2L D;  4A3C H;  4JI6 L;  3IFT A;  4QY7 A;  3VR6 A;  1AZP A;  5EBD A;  4DNI A;  3VA7 A;  1PH3 A;  1J5E Q;  1Y8O B;  4DR3 L;  2B2V C;  3TDQ A;  2CVR A;  4C3H G;  1EZ8 A;  2K6A A;  5IGE A;  1XPR A;  2CHB D;  4K5V A;  1PTO B;  4NP5 A;  4BY7 G;  1SRO A;  1PRT C;  1QVG A;  2K7V A;  4DV0 L;  4LF4 L;  1X3Q A;  3A8J E;  1VMP A;  3TSS A;  3UE0 A;  3PO3 H;  1F9R A;  1YJN A;  3CCL A;  3X3N A;  2VQE L;  4K5X A;  2XNA C;  4DR1 Q;  2OXP A;  3A56 A;  1P8L A;  3TRZ A;  4RKB A;  2R7F A;  3EJI A;  3E5S A;  3S16 B;  1PH4 A;  2PO4 A;  1YJ9 A;  1A2T A;  3F8T A;  4GN3 B;  2JA8 H;  4B3R Q;  2D62 A;  1BVS A;  4IQZ A;  4C3J G;  3GTG H;  1BF4 A;  2F0I A;  1YHQ A;  1S3O A;  1IL8 A;  2MHV A;  3K80 C;  4XYQ A;  1VQ9 A;  3KLS X;  1SEB D;  1Y14 B;  3TS0 A;  3CPF A;  4FP5 D;  3PGZ A;  1JIC A;  2CQO A;  1I4G A;  1GVP A;  3A5Z B;  2OT2 A;  3I56 A;  3RN2 A;  1K83 B;  3TP8 A;  5IGG A;  4TKO B;  2A6E C;  3TP6 A;  2EOT A;  1KXL A;  4M8A A;  2JEB I;  2KQ3 A;  2K5V A;  2EZV A;  5M5W H;  2RSO A;  2F0T A;  1DON A;  3NSW A;  2IJ0 A;  2EQS A;  2WFW A;  4G4K A;  4I7A A;  2K14 A;  3OYY A;  1TWG H;  1G29 1;  1E7Z A;  4YWM A;  1TS5 A;  4IFD G;  3R8B A;  2JA7 G;  3HG9 A;  4KKT A;  4C3I G;  4ZKC B;  1RDP D;  5JVH 3;  1YNJ D;  2PI2 A;  2SEB D;  1EIG A;  4YWK A;  1EZ6 A;  4V0B A;  5CBE E;  4DU9 A;  5C6A A;  4KN4 C;  1S72 A;  3LX0 A;  2NVX B;  3CC7 A;  1B70 B;  1WFQ A;  4OON A;  1D5Z C;  1LYL A;  2EYJ A;  1YHB A;  2EDG A;  3HOV H;  2KOL A;  3W1B A;  4HJA A;  4XIG S;  2HT1 A;  1EQR A;  5JAV A;  1M90 C;  4C3H B;  4IZ8 A;  5C5L A;  1HXY D;  2IL8 A;  1SYB A;  1Q8K A;  1HFG A;  3GTL H;  4IOA A;  4DV7 L;  4HSP A;  4LNQ A;  2B2T A;  2KED A;  1PZK D;  3F1Z A;  1MBY A;  5C4H A;  2NVQ B;  5CMD A;  2F0Q A;  4UP7 A;  3URY A;  3K7U C;  4ZAI A;  1FNV A;  3A55 A;  1JWM D;  2PNR C;  3PUY A;  5IYD H;  1ILQ A;  2M00 A;  3UDG A;  1YNX A;  1V1Q A;  5EJW A;  2ZT9 C;  4RGN A;  4QMG A;  4DV7 Q;  2E8G A;  3JAM i;  2A68 C;  3D6C A;  3SVM A;  5AJ3 Q;  1H95 A;  2EYM A;  2O5J C;  2JQO A;  1DD2 A;  1ZKO A;  3HOW H;  3K5M A;  3J80 c;  4C3J B;  1HNW Q;  2EJF C;  1II3 A;  2VS1 A;  3G48 A;  1PHJ A;  4B08 A;  1VQI A;  3H3V I;  1FL0 A;  3GP7 A;  2G9D A;  2E2H H;  1I6H H;  1NY4 A;  1VQO A;  1I4Q A;  3SEB A;  3I90 A;  1JCK B;  4CJ1 B;  1UE1 A;  4G7H C;  4JV5 Q;  1AE3 A;  4EGV A;  4Q0F A;  3CRK C;  1KHI A;  5EBC A;  5EKL A;  4A3J B;  2RKS A;  1JWU D;  3KJP A;  1TXY A;  1MKH A;  3RZO H;  2B2W A;  1LUZ A;  2Z0S A;  3J80 E;  2NBF A;  2EY6 A;  4CJ2 C;  1K3R A;  2DUD A;  3J81 c;  3VYR A;  1LV9 A;  3QJY A;  3A5U A;  4L5S A;  1YNN D;  1K8O A;  2XWB B;  5CV5 A;  2BH2 A;  2K4K A;  3HP3 A;  3CME A;  3LNN A;  1EQQ A;  5NUC A;  2R92 G;  1IW7 D;  4B3S L;  1D5M C;  3T1H Q;  4GN5 A;  3KBX A;  1HUN A;  4L5R C;  1WCM G;  1NMF A;  2MJ8 A;  4KN7 C;  2RHS B;  2K1B A;  1UE5 A;  4BXX H;  5D3I B;  2F3I A;  3CRL C;  3X3M A;  4B9X A;  5CBA E;  3HOY H;  1Q81 C;  4BBR B;  3EIV A;  4R4C A;  5E3F A;  4KTA A;  1LT3 D;  4RGO S;  3J81 E;  3S1Q H;  3TEH B;  2CH4 W;  5JEA H;  1X65 A;  4YIJ A;  1WVL A;  1R4Q B;  1QJO A;  2HDL A;  1F2M A;  1EOV A;  1KQS A;  2Z1C A;  5C3W A;  4R9W A;  1JB3 A;  3OMC A;  4TQU S;  4AH6 A;  2N78 A;  3H3V H;  1G2T A;  1WD1 A;  4JI8 Q;  2L11 A;  2RDH A;  4DV1 L;  2F0H A;  4EQO A;  4APV A;  1HQM C;  5FJ8 H;  4K2K A;  5ELF A;  4KV6 A;  1BDO A;  2DY7 A;  2QDB A;  3L3O C;  5AFW A;  3GTP B;  2F52 A;  3E3X A;  3QWN A;  1BOS A;  1ICF B;  2B29 A;  3SE0 A;  4CHT B;  3ZYY X;  1SBB B;  1WYD A;  1Y1V H;  1HUM A;  1FGU A;  2MUY A;  3AFP A;  3JAM L;  4IUV A;  1BCP F;  1TU2 B;  2L1B A;  5M5X B;  1GKH A;  3S16 H;  1DOL A;  3VR2 A;  1B3A A;  4DAM A;  1OXX K;  4P2C B;  3HS0 C;  1PTO D;  1XXG A;  2KA7 A;  1PFM A;  2JSO A;  5COY A;  3H0G H;  2WIN B;  1DZ1 A;  5I2X A;  1N8R C;  3M4O B;  1LTB D;  2KJX A;  2UXD L;  4X66 Q;  5GAE C;  1IBL Q;  4P71 A;  1D7Q A;  2EY5 A;  5IT9 c;  1SN8 A;  3SHL A;  1XTD A;  1DGS A;  2KEC A;  4KLK A;  4K0K L;  3I7F A;  3RLO A;  2E76 C;  2ASB A;  1GD7 A;  4PMB A;  5FLX L;  1YNN C;  3E6Z X;  5E4X A;  2RF4 A;  1K83 H;  1U0L A;  2GA4 B;  2A74 C;  3F2B A;  2KCM A;  5C3E G;  1STB A;  4H02 A;  4MN3 A;  2F0K A;  1IW7 C;  1NMG A;  5ELC A;  1XPU A;  3G6E A;  1N34 Q;  4ME5 A;  1G8Z D;  1VQH A;  4O1N A;  1QE6 A;  3R3O A;  4AYB E;  2R93 H;  3SGI A;  4NPS A;  4KY6 A;  2KCN A;  1TR5 A;  1KNE A;  4C1N I;  1B44 D;  4ZKB B;  2IW3 A;  3G4S A;  2A69 D;  4KKS A;  3S9W A;  1VCI A;  1WCM B;  2L4N A;  5IT9 E;  1BCP B;  2R7Z G;  1CT1 D;  1LAB A;  3V05 A;  3AYH B;  1I5F A;  2KEN A;  4QF4 A;  2B63 G;  1X3P A;  1X6O A;  5I9O A;  1FR3 A;  2A73 B;  4BA2 I;  4IN3 A;  5LL6 X;  4JI4 L;  2LMC B;  3HKZ G;  2QW7 A;  3FVQ A;  5ELE A;  3P7J A;  4BBS G;  1PYS B;  1Q12 A;  3GTK B;  3DEP A;  4QIW B;  2DJG C;  1TY2 A;  2XRS D;  2F4V Q;  1C48 A;  1ZYR D;  1SYD A;  3J7Z C;  3ULP A;  1S5F D;  1SNP A;  3CU7 A;  3OMG A;  2QF7 A;  4OEL B;  4RFB A;  5LHY 1;  2D0O A;  4GKJ Q;  2N55 A;  4C3H H;  1BR9 A;  4IUN A;  4NW2 A;  5C0X G;  4A3G B;  4LFB L;  4LWC A;  5IYB G;  4IFD I;  4JI4 Q;  4BY7 H;  4DR7 Q;  3H3V C;  1E0B A;  1FGB D;  5IWA L;  2ZJQ A;  4JBW A;  2H4O A;  5JOB A;  4XYO A;  1IBK L;  3FRP B;  4AQY L;  1JOQ A;  3D4W A;  4DV6 Q;  1PA6 A;  5D65 A;  5EQ0 A;  3PIO A;  2E74 C;  2FJ2 A;  4YY3 L;  1X32 A;  4DAP A;  1PTO C;  1V9P A;  3VDY A;  4LFB Q;  2YTX A;  2QDL A;  3J80 i;  2NVT H;  1IHZ A;  2JYO A;  1A0I A;  4FYD A;  3QOL A;  5IWA Q;  1TWG B;  2ICI A;  1S4Z A;  3KLR A;  2IX3 A;  3QB3 A;  4QCL A;  1GHK A;  4J1M A;  3S1M H;  4C3J H;  3I2Z A;  1PH6 A;  1PVO A;  2N49 A;  4UPA A;  3PUZ A;  2G5D A;  1I4P A;  2NN6 G;  3M4Q A;  2YTY A;  1EWC A;  2XTI A;  1QVC A;  1KLG D;  1R4P B;  4R1J A;  3GTQ H;  2G9H D;  4L6T B;  1E3P A;  2PZU A;  1DM0 B;  3OPO A;  5IOD A;  2EIF A;  2HD3 A;  1ASY A;  4LFC Q;  3E0E A;  3DM1 A;  1F9S A;  3DMU A;  3NTI A;  2L55 A;  2P5Z X;  3HOV B;  4DUZ L;  2Z4H A;  2WB1 E;  1KAW A;  2X69 A;  2KHI A;  4DGZ A;  2LFN A;  3CC2 A;  4CJ0 B;  3MAQ A;  5C3E B;  4ZCK A;  1X56 A;  4A3F G;  3J81 i;  3CW2 C;  3GTL B;  4CDF C;  2JXM B;  2A69 C;  4N9T A;  1HA5 A;  2RVL A;  3DHQ A;  2VXW A;  3J81 j;  2QA4 A;  4DAV A;  1PV4 A;  3M4Y A;  5IGB A;  1SMY D;  3OHX C;  2PZW A;  2IHF A;  2PMZ B;  1L1O B;  4KHZ A;  4IFD H;  2YU9 H;  2R7Z B;  4PZ6 A;  2JA7 H;  4C3I H;  3QO2 A;  3BVM A;  4ZRZ A;  3G6J B;  3P1H A;  3CCQ A;  3OW2 A;  4Y7N H;  2QKI C;  2OEO A;  4JK1 C;  3UI2 A;  1AN8 A;  4L63 B;  1XMO Q;  1HFN A;  2NVY H;  3L9A X;  5BN5 A;  5T1I A;  3NK9 A;  2WKD A;  2BA1 A;  3FDT A;  4Q5V A;  3GTM H;  1KDC A;  2E2H B;  4IPH A;  1I6H B;  5LMN W;  4DV5 Q;  3HOZ G;  4ZYS A;  4QL5 A;  5FK9 C;  4OO1 G;  4DXG A;  2AHO B;  2NUC A;  1L1O A;  1Q82 C;  4OX9 L;  1W6K A;  1X3E A;  1HH2 P;  1O78 A;  2KHJ A;  2CWA A;  4RG1 A;  4X3T A;  5BR8 Q;  4WRD A;  1ENC A;  2PNH A;  1HNZ L;  2AQ1 B;  5KGU A;  1SNQ A;  2EVB A;  3FKI G;  3HFZ B;  3NTK A;  4IPD A;  4OX9 Q;  1XWE A;  4N8X 1;  4DR5 L;  2NZH A;  4NXM L;  3M9B A;  2K28 A;  3D4D A;  2J0T D;  1A6X A;  4POF A;  5KYL A;  4DV2 L;  4DF7 A;  1QOH A;  2PQA B;  4A3L G;  3KJO A;  1WTV A;  1X55 A;  2PW7 A;  4X6A H;  1CI3 M;  3NBI A;  4FVM A;  2VB3 X;  5GRO A;  2ZJP A;  1B2T A;  1ILP A;  1IYJ B;  5IYC G;  4NXN Q;  3HOY B;  3M4O H;  4J8Q A;  1J5E L;  2ENB A;  2DJF C;  2K5Q A;  3RNU A;  1L0X B;  3MTS A;  2D2C C;  5HUR A;  1CQV A;  5JEA J;  4I7Z C;  3ONA B;  1NNX A;  2EE1 A;  3D8G A;  3A7A B;  2IWH A;  1AZQ A;  4PV1 C;  3AMU A;  4E6I A;  2MO1 A;  4J6H A;  4A3F B;  5FO7 B;  1SNM A;  1WD0 A;  2J4X A;  1IBM Q;  1VQF A;  1SMY C;  4OWT B;  2PQA A;  3BDO A;  4LK1 C;  2B2Y C;  4F88 A;  4KHP L;  1YZ6 A;  4DR1 L;  1K3B C;  3CPW A;  4K8J A;  4LW1 A;  1D1I A;  4CBV A;  1QUQ B;  2QEJ C;  2HQE A;  4POG A;  1HZB A;  4BY1 G;  2R92 H;  1I4R A;  2A1A A;  2EYL A;  3P20 A;  2Q2U A;  2FMC A;  5GAH C;  3HOX G;  4B3R L;  1S5D D;  2VNU D;  4RKL A;  1KRS A;  4KD4 A;  4L8J A;  1XNR L;  1WCM H;  4LF6 Q;  4DR2 Q;  1Y1V B;  3L7Z C;  3NP8 A;  2RCN A;  4KHP Q;  4WOR A;  4HAE A;  3M3Y B;  3O13 A;  2WAQ G;  2PQE A;  3KLW A;  1J9O A;  5GAD C;  3GDE A;  1LT6 D;  4WJ3 M;  1Q3L A;  3TN2 A;  1HTL D;  2O4X A;  1F2L A;  1SYC A;  5BN4 A;  1I50 B;  2A68 D;  2V1C C;  3H0G B;  1Y1W G;  3A74 A;  1XNR Q;  2RDF A;  4TRD A;  2SDF A;  1LM0 A;  3W3A A;  3GTK H;  3GQB A;  2ZTE A;  3A7L A;  1EY8 A;  1QUQ A;  1IKL A;  1JOO A;  3CD6 A;  1BCP D;  3NHH A;  2UUB L;  5KYI A;  1PH7 A;  1ROD A;  1NR2 A;  1YVC A;  3DWQ A;  4JOI C;  2O5I C;  5C44 G;  1MJC A;  4MIU A;  4HID A;  4CKC A;  2E2D C;  4PG3 A;  2EJG C;  3Q0A A;  2DNE A;  4V19 0;  4A3G H;  2HIX A;  3B6Y A;  4RCN A;  2LS0 1;  2ICE C;  4QJF A;  2UUB Q;  1HPC A;  2I5M X;  3D4R A;  1E2W A;  1ET9 A;  2ZXO A;  1E1O A;  3MA2 B;  2H5X A;  2R93 B;  1S5C D;  5E7N A;  5FLM G;  1QG7 A;  2PZT A;  4J15 A;  1D2B A;  4A3K G;  2RCF A;  3OW7 A;  4DA2 A;  1KIX A;  4ULL A;  1I4H A;  4A3I G;  1CA5 A;  2F03 A;  2HDM A;  4AYB G;  2JA6 G;  2MQH A;  5HGQ A;  5T1G A;  2CW0 D;  3J7A V;  4LF5 L;  1FJG Q;  2Q8R E;  5J1Z A;  1KAA A;  3ERQ A;  2A6H D;  5C0X I;  3J7A 5;  4R4O A;  5M9O A;  4RCO A;  2UUC Q;  5I6Y A;  3NBH B;  2XRQ D;  4PMC A;  2NYZ D;  4A3D G;  5JJK A;  1PZJ D;  5CV4 A;  2BCO A;  3GTJ B;  3S2D B;  2I5L X;  2OQK A;  4R4Q A;  2ZXR A;  4FXK C;  1E22 A;  2ATW A;  4OXP A;  4JYA Q;  3L0O A;  2ZM6 L;  3C2P A;  4LF5 Q;  2GVA A;  4X65 Q;  1JMC A;  1DXM A;  1VQ7 A;  2XN9 C;  2Z6B A;  2L5T A;  5C3E H;  4A3M G;  1RHP A;  3VA5 A;  3RLN A;  4HR7 B;  2PPB C;  5EKI A;  4OWW B;  5AJ3 L;  4BY7 B;  4BY1 B;  5CV9 A;  2AUJ D;  2UU9 Q;  1UEA B;  2F0W A;  3HOX B;  2NN6 I;  4H13 C;  2ZM6 Q;  3CF5 A;  5IY0 A;  4DUY Q;  4JBJ A;  1HNW L;  1LLR D;  2EPB A;  1WTX A;  1DYQ A;  1FNW A;  2X6L A;  3PIP 3;  2EXD A;  3D0F A;  3NBH A;  5DM7 3;  3D6W A;  3K6O A;  1Y69 U;  2E5L L;  2DN8 A;  4DR6 Q;  1EFW A;  2JP1 A;  3I4O A;  2R7Z H;  5KEE A;  1WTO A;  2AUK A;  1EU4 A;  2NTT A;  1J8I A;  1STA A;  4OIJ A;  2NVT B;  1OXT A;  3R93 A;  2F0O A;  3CCR A;  3NPP A;  2B63 H;  3NE5 B;  1A8V A;  1J6Q A;  1DJR D;  4JI2 Q;  2EXZ A;  1LTI D;  3S1M B;  1K28 A;  4RA8 A;  2B8G A;  4JV5 L;  1PYB A;  1BCP C;  1UNS A;  1VQC A;  1PDQ A;  4BBS H;  2E5L Q;  2OWO A;  3N6R A;  4WJ4 A;  1Q7Y C;  1S5B D;  2MFI A;  3GTQ B;  3K58 A;  2Z8L A;  5IP9 G;  1EIF A;  5LMU Q;  4FO2 A;  5JJL A;  1CSP A;  2CQA A;  1HNX L;  5C44 B;  5HY6 A;  3IFD A;  4HJ8 A;  5C0X H;  2HUG A;  4XT3 B;  1S5E D;  3SK8 A;  5IYB H;  2SNM A;  3CCS A;  4LUV A;  1CHQ D;  4DXF A;  1GXD C;  3TRE A;  1CHP D;  4DV3 Q;  5EKK A;  3IKJ A;  1W2B A;  5G3L D;  1OTC A;  1M8A A;  2R7D A;  1BQQ T;  4X64 Q;  1AFP A;  3T1H L;  1T5X D;  1HNX Q;  1A3U A;  1H9K A;  3KFU A;  1U4P A;  3Q8D A;  2PI2 E;  2JN4 A;  2Y0S G;  4R8I A;  4A3K B;  3U9S A;  2CW0 C;  4DK6 C;  2FHT A;  4DKA C;  4N9P A;  1XJV A;  1AEX A;  2K05 A;  3K5N A;  2A6H C;  2D5D A;  4IFD J;  2YU9 B;  2JA7 B;  3A8K E;  1ZEQ X;  4C3I B;  2Q2H A;  2NN6 H;  2ZXP A;  4XQN A;  1UUP A;  5IOC A;  2WAC A;  2LY7 A;  3S1N B;  2B2Y A;  1Q8I A;  3CCV A;  2F0G A;  2NZO A;  3DXJ C;  1NBW A;  4P72 A;  5IGC A;  3BS1 A;  1EY4 A;  3J7Y W;  4Y7N B;  3T1Y Q;  3C46 A;  2I46 A;  2K5W A;  2NVY B;  4JI8 L;  4CKE A;  1FVI A;  4JI0 L;  1SE8 A;  5A35 A;  4CDE C;  3GTM B;  1MIU A;  4IPG A;  1VQJ A;  4MTN A;  3MZ5 A;  4A3F H;  3K0Y A;  2B2U C;  2F0S A;  4K2L A;  1IL2 A;  1FNU A;  3CMA A;  3NWS A;  3I8Z A;  1C8C A;  4JI0 Q;  1OXV A;  2F0M A;  3K57 A;  1CTM A;  2KBN A;  5EGT A;  5A2Q L;  1N36 L;  4YCW A;  3UDX A;  1MD2 D;  4OHJ A;  4YCU A;  2I07 B;  4JI3 L;  3TP5 A;  1VQL A;  4G7Z C;  1N33 Q;  1TWA H;  3CP0 A;  1LTS D;  2F0F A;  2K75 A;  3UDF A;  2NB0 A;  5J39 A;  1F9Q A;  1E24 A;  4LF7 Q;  4JOI A;  3H91 A;  3K81 C;  3SR1 A;  1X9N A;  4GLV B;  1Q1E A;  1ESR A;  1N36 Q;  3U50 C;  2Z6K C;  1MJE A;  1HR0 W;  2AKW B;  5DNF A;  3M3Y H;  4X66 L;  1XMQ L;  1L1O C;  3HKS A;  4JI3 Q;  1IBL L;  3C1F A;  1XPO A;  2VQF L;  3CCM A;  2LKV A;  5DM6 3;  1FD7 D;  3OIP A;  3GD7 A;  4PMW A;  3PUW A;  4CGY B;  1YIJ A;  1B1Z A;  1SE4 A;  1I50 H;  2KVM A;  3HOZ H;  3K5L A;  4TVA B;  2KCC A;  1QIL A;  1U4M A;  5C4J B;  4JCV E;  4DPG A;  1I94 Q;  1GOZ A;  1STY A;  1XMQ Q;  3S1R B;  4KD3 A;  1HHV A;  5EPK A;  1BXT A;  3BZK A;  2VQF Q;  1N34 L;  4AIM A;  3KLS A;  4PZ8 A;  1EEF D;  5JVG 3;  1SND A;  1WTH A;  2EJM A;  4B3T Q;  3UE1 A;  2Q8T A;  2BDO A;  3MXG A;  4A3B G;  5C4Z A;  4KJN A;  3M85 A;  3FKI H;  1BUV T;  3HEJ A;  3EVQ A;  3KF6 B;  2Y0S B;  3HGB A;  1SE3 A;  2MP1 A;  2LSS A;  4B3M Q;  2PW5 A;  2IHE A;  5E4W C;  1Y8P B;  2AQ3 B;  1GUO A;  2WII B;  2R92 B;  1Q1B A;  1GUG A;  1T9H A;  4A3L H;  4GS3 A;  1LT5 D;  3BU2 A;  1VS0 A;  1EYG A;  4UP8 A;  4P74 A;  4YWL A;  4FDB A;  2UXB Q;  2JK8 A;  3I4N G;  2RDG A;  3Q24 A;  5IYC H;  1U5K A;  4PQX A;  4RHR A;  2F4V L;  1WOC A;  1EY0 A;  1K8A C;  1LTG D;  2VZA A;  1SFO H;  2QGQ A;  4UAI A;  3T16 A;  5I9P A;  2XGT A;  4GKJ L;  1RJT A;  2PYK A;  2HHH Q;  3I4M G;  2L15 A;  3G7L A;  1D6E C;  4ME3 A;  4GLA C;  1G2S A;  3FEW X;  3KF6 A;  1EQT A;  3GTJ H;  3S2D H;  3KDF B;  3CCJ A;  4IOC A;  2KEE A;  2A19 A;  4DR7 L;  2CCZ A;  1Y8N B;  4CKB A;  2EYO A;  1TWC H;  2UXC Q;  4BA1 I;  1TII D;  1EY6 A;  4DK3 C;  4EX5 A;  1X54 A;  2OQ0 A;  3DM3 A;  4F7X A;  4A93 G;  2KUM A;  1KAB A;  5D3D A;  5M3F G;  3PO2 G;  4DV6 L;  3H94 A;  1EWH A;  1VQP A;  3C1E A;  3MFG A;  4BY1 H;  3HOX H;  4DFA A;  2YTV A;  5DEH A;  1VQ5 A;  3S14 B;  4ABN A;  1A3V A;  2HCI A;  2DY8 A;  4EVO A;  2NTS A;  4N8F A;  3SK4 A;  2A8V A;  3KDF A;  3Q23 A;  3F2C A;  1CKM A;  4QGU A;  1Z7T A;  1TS2 A;  3M4P A;  1GUW A;  4LFC L;  4ZUJ A;  1U4L A;  2TSS A;  4HSV A;  1Y1W H;  4LF8 Q;  3D31 A;  1HR0 Q;  2VY3 A;  4X3U A;  3V96 A;  1PH1 A;  3GTO H;  1LT4 D;  4O2D A;  2HCC A;  1PLF A;  4BWG B;  1HA6 A;  4IUU A;  1M1K C;  3H15 A;  3M7G A;  2F0L A;  1LTA D;  1EQV A;  4LUZ A;  4GOP B;  1B7Y B;  4HMJ A;  1D8L A;  3CQZ B;  5C44 H;  3K7A B;  4RH6 A;  1JJG A;  4R8N A;  3EFX D;  2BA0 A;  1CK1 A;  1SDF A;  2VUM G;  2OTL A;  4I65 A;  4A3B B;  1Z47 A;  4FF2 A; 
#chains in the Genus database with same CATH homology
 4DR1 L;  5IYD H;  3CPW A;  3UDG A;  4B3M L;  4LW1 A;  4HJ9 A;  1YNX A;  2R6G A;  2JE6 I;  1V1Q A;  4NB3 A;  1C9O A;  1QUQ B;  2VW9 A;  1GO3 E;  4POG A;  1HZB A;  2WP8 J;  4BY1 G;  2A1A A;  1Q46 A;  1XNQ Q;  2Q2U A;  3K0X A;  4DV7 Q;  1WJJ A;  2E8G A;  3JAM i;  5GAH C;  5AJ3 Q;  3HOX G;  4B3R L;  1H95 A;  1XMQ L;  2JA5 G;  1QVF A;  2JQO A;  2VNU D;  3HOW H;  1KRS A;  5FLM H;  1XNR L;  1WCM H;  3J80 c;  4LF6 Q;  4DR2 Q;  4A3K H;  3L7Z C;  1BBU A;  2UUA L;  1HNW Q;  1XMO L;  2RCN A;  4YHH L;  4A3I H;  3K8A A;  2VS1 A;  3G48 A;  1PHJ A;  4KHP Q;  2UXB L;  2JA6 H;  1VQI A;  4RMF A;  2R92 H;  4HJ7 A;  3H3V I;  1FL0 A;  2WAQ G;  1Q86 C;  1N32 Q;  3KLW A;  2HIV A;  3ER0 A;  5IE8 A;  2E2H H;  3KF8 B;  3GDE A;  3WWV A;  1NY4 A;  5GAD C;  5IP7 H;  1VQO A;  1I6H H;  2OCE A;  4DV5 L;  3S17 H;  4WJ3 M;  3PF5 A;  3S2H H;  3S1N H;  2HHH L;  2IX0 A;  2QEX A;  2V1C C;  1Y1W G;  3JC6 6;  1UEB A;  3BZC A;  3A74 A;  1XNR Q;  3HOV G;  4GLX A;  1UE1 A;  4IJH A;  1PH5 A;  4A3D H;  2UUA Q;  1LM0 A;  1X3G A;  3GTK H;  4JV5 Q;  1AE3 A;  2ZTE A;  4YHH Q;  2UXD Q;  1QUQ A;  3HOU H;  3S15 H;  3CD6 A;  2UXC L;  2UUB L;  1KHI A;  3RZD H;  1KRT A;  1PH7 A;  1YVC A;  4JOI C;  3KJP A;  1TXY A;  1NTG A;  1CKN B;  1MKH A;  3RZO H;  1K9M C;  1LUZ A;  2Z0S A;  5C44 G;  5BR8 L;  1MJC A;  3G71 A;  2HQL A;  3ICE A;  4K0K Q;  4LFA Q;  1RIP A;  4HID A;  1HZ9 A;  1K3R A;  4A3G H;  2JJQ A;  4PG3 A;  3W5O A;  2DUD A;  2Z6K A;  3J81 c;  4A3M H;  2IY5 B;  2HIX A;  3B6Y A;  1CUK A;  3NEN A;  5C0X J;  3A5U A;  4L5S A;  5IYD G;  4KI0 A;  2KCT A;  2BH2 A;  2K4K A;  1YHA A;  4QJF A;  4JI1 L;  3CME A;  2UUB Q;  1EQQ A;  2I5M X;  3U58 A;  1JJ2 A;  3PF4 A;  4QIW E;  1RL2 A;  2R92 G;  1E1O A;  4JI7 Q;  2ZJR A;  4B3S L;  3NEL A;  1VQG A;  2H5X A;  3T1H Q;  5E7N A;  3HOW G;  3OTO Q;  4GN5 A;  1L0W A;  5FLM G;  4J15 A;  4L5R C;  1WCM G;  3E9H A;  4A3K G;  1NMF A;  2B3G A;  2NVX H;  3STB D;  4JG2 A;  2RHS B;  4A75 A;  1UE5 A;  4A3I G;  1KIX A;  4BXX H;  1L2F A;  2F3I A;  4AYB G;  2JA6 G;  4NXN L;  4GKK L;  3HOY H;  2MQH A;  1CKN A;  2LXK A;  5HGQ A;  1Q81 C;  4JI1 Q;  1C0A A;  3EIV A;  3F2D A;  4LF8 L;  4R4C A;  5IP7 G;  4ALP A;  1HR0 L;  3MXN B;  4LF5 L;  1FJG Q;  5JJI A;  1A63 A;  1JT8 A;  1X3F A;  3S1Q H;  5C0X I;  1JB7 A;  3J7A 5;  4R4O A;  3TEH B;  3AEV A;  1X65 A;  1YEZ A;  2ES2 A;  4A4I A;  5FLX c;  2UUC Q;  1EOV A;  3NBH B;  1KQS A;  4A3D G;  5JJK A;  1R9T H;  3LGJ A;  4TQU S;  5IP9 H;  4AH6 A;  2N78 A;  4DAY B;  2I5L X;  3H3V H;  4O0A A;  2OQK A;  4R4Q A;  2NVQ H;  3HOU G;  4R4I A;  4JI8 Q;  2AMC B;  1E22 A;  2ATW A;  4OXP A;  4DV1 L;  4JYA Q;  5C4J H;  2Q2I A;  1IBM L;  3L0O A;  2ZM6 L;  4LF5 Q;  2GVA A;  4X65 Q;  2I0Q A;  4APV A;  3S1R H;  1JMC A;  1VQ7 A;  1YIT A;  5FJ8 H;  3IRB A;  1YJW A;  5C3E H;  1CSQ A;  4A3M G;  1VQK A;  1WI5 A;  2K5H A;  4X62 Q;  4JI5 Q;  3RLN A;  2F52 A;  1XNQ L;  4A76 A;  3RR5 A;  5AJ3 L;  3PUV A;  4OWW B;  1G51 A;  1VQN A;  1GM5 A;  2B29 A;  4LF9 Q;  1SR3 A;  1SRU A;  2UU9 Q;  4DR4 L;  1KC8 C;  2NN6 I;  2ZM6 Q;  1WYD A;  1Y1V H;  5IY0 A;  3CF5 A;  4JBJ A;  4DUY Q;  4DR2 L;  4AQY Q;  1IBK Q;  4LF6 L;  3PSI A;  1HNW L;  1FGU A;  1OXS C;  3AFP A;  2EXD A;  3D0F A;  2E5L L;  4DR6 Q;  1EFW A;  1PFS A;  3I4O A;  4YY3 Q;  2R7Z H;  1GKH A;  1N32 L;  3S16 H;  4DAM A;  1PH8 A;  1OXX K;  4HIO A;  3TS2 A;  4HIK A;  4BXX G;  3ULJ A;  1QZH A;  4JC0 A;  4JBM A;  1OXT A;  3HOY G;  1TWH H;  1UE7 A;  3CCR A;  1NJI C;  1UWV A;  2D0P A;  2B63 H;  3H0G H;  4DR4 Q;  1A8V A;  1J6Q A;  4JI2 Q;  1N8R C;  1CKO A;  4JV5 L;  1PYB A;  2MO0 A;  2LXJ A;  5JEA G;  4GKK Q;  4GNX C;  1UE6 A;  1VQC A;  2UXD L;  4X66 Q;  4BBS H;  5GAE C;  2E5L Q;  2OWO A;  1HZA A;  4WJ4 A;  2FXQ A;  4GOP A;  1Q7Y C;  4P71 A;  4A3J H;  1IBL Q;  2OTJ A;  1D7Q A;  1LTL A;  3CC4 A;  2Y0S E;  2MFI A;  2PMZ E;  2N3S A;  2K5N A;  1SN8 A;  1XTD A;  4R4T A;  5IT9 c;  5LMN L;  5IP9 G;  1BBW A;  4L5T A;  1EIF A;  4JI6 Q;  1DGS A;  4KLK A;  5LMU Q;  1JE5 A;  1CSP A;  4K0K L;  5JJL A;  5M5Y H;  4LFA L;  3I7F A;  3RLO A;  1HNX L;  1G6P A;  2ASB A;  1GD7 A;  4IJL A;  5HY6 A;  4LUO A;  3FP9 A;  4HJ8 A;  3MEF A;  2RF4 A;  5IYB H;  1K83 H;  1U0L A;  3RN5 A;  5FJ8 G;  3CCS A;  4DUZ Q;  4LUV A;  4UP9 A;  4DR3 Q;  3F2B A;  2KCM A;  5C3E G;  3TRE A;  4DV3 Q;  1B8A A;  4H02 A;  2YYZ A;  4A3E H;  1NMG A;  1XPU A;  2N8N A;  3U4V A;  3G6E A;  1W2B A;  5LMN Q;  2JA9 A;  3HKZ E;  3BJU A;  1N34 Q;  3NEM A;  1OTC A;  4JI7 L;  2K52 A;  1VQH A;  4AYB E;  4MZ9 A;  4YCV A;  2R7D A;  2R93 H;  3SGI A;  4NPS A;  4X64 Q;  4JBK A;  4DV0 Q;  3T1H L;  4LF4 Q;  3OTO L;  1HNX Q;  1YI2 A;  1SMX A;  3DLL A;  3STB C;  1Y1V G;  4OWX B;  3KFU A;  1EIY B;  3G4S A;  3Q8D A;  2PI2 E;  3AQQ A;  2VQE Q;  1VCI A;  5M3M H;  1N9W A;  2Y0S G;  3KOJ A;  3JAM c;  4DK6 C;  2VL6 A;  5DLQ E;  1E1T A;  4DKA C;  2R7Z G;  4GNX B;  3S14 H;  4BBR H;  1XJV A;  3CAM A;  2Q2T A;  4IFD J;  1FJG L;  3AYH B;  1I5F A;  2KEN A;  2Q2H A;  2YV5 A;  2B63 G;  1EWI A;  3H0G G;  4MNO A;  1X6O A;  1AE2 A;  1QZG A;  2UUC L;  3CCV A;  2NZO A;  4P72 A;  2RHQ B;  1NBW A;  4BA2 I;  1ASZ A;  4JI4 L;  1KL9 A;  3HKZ G;  3T1Y Q;  3CCE A;  4Y52 H;  4BBS G;  1PYS B;  1Q12 A;  1HR0 W;  4JI8 L;  4A3J G;  2F4V Q;  3J7Z C;  3ULP A;  4JYA L;  1K73 C;  1FVI A;  4JI0 L;  1SE8 A;  1VQE A;  4X65 L;  1VQA A;  5J3B A;  2GN5 A;  2I5H A;  1MIU A;  3FHW A;  1K0R A;  4IPG A;  2D0O A;  4GKJ Q;  1IZ6 A;  4C3H H;  1VQJ A;  2AWO A;  3GO5 A;  4MTN A;  4JI5 L;  4X62 L;  3GTP H;  5C0X G;  4LFB L;  4LWC A;  5IYB G;  4IFD I;  4GNX A;  4XTC S;  4JI4 Q;  2K50 A;  4A3F H;  3CQZ H;  2E2J H;  3K7A H;  3I55 A;  4BY7 H;  4DR7 Q;  2ID0 A;  5IWA L;  2ZJQ A;  4LF9 L;  4A3E G;  4HIM A;  3ERS X;  4JBW A;  2UU9 L;  4L5Q A;  1IL2 A;  3CMA A;  1A62 A;  4JI0 Q;  1OXV A;  4DUY L;  4HJ5 A;  1IBK L;  1C7Y A;  4AQY L;  2KBN A;  5C4X H;  4A3B H;  1N36 L;  4YCW A;  2R93 G;  3UDX A;  4DV6 Q;  3CXC A;  1PA6 A;  3PIO A;  2C35 B;  4DV4 L;  5M5X H;  4DR6 L;  4EQ5 A;  1V43 A;  4YCU A;  1HNZ Q;  4JI3 L;  4YY3 L;  1VQL A;  1V9P A;  1N33 Q;  3VDY A;  5M3M G;  4LFB Q;  2YTX A;  1TWA H;  2K75 A;  3CP0 A;  3J80 i;  3UDF A;  2IX1 A;  2NVT H;  1A0I A;  3UDI A;  1E24 A;  5IWA Q;  1S40 A;  4LF7 Q;  2GVB A;  4BBR G;  4DR5 Q;  4NXM Q;  4JOI A;  5GAG C;  3K81 C;  4JI2 L;  4QQB X;  4C2M H;  1X9N A;  3S1M H;  4C3J H;  4GLV B;  3E9I A;  3I2Z A;  1PH6 A;  3M7N A;  1PVO A;  1Q1E A;  4DV2 Q;  2N49 A;  4UPA A;  3PUZ A;  3U50 C;  2Z6K C;  1IXR A;  1JJC B;  1VQD A;  1N36 Q;  2NN6 G;  2AKW B;  1Z9F A;  3M4Q A;  1MJE A;  3A0J A;  4X66 L;  1L1O C;  2YTY A;  2XTI A;  5ELN A;  3TQY A;  4DV4 Q;  3HKS A;  3RLF A;  3I4N H;  1QVC A;  2IT1 A;  1IBL L;  1XPO A;  4R1J A;  4JI3 Q;  2VQF L;  3GTQ H;  3CCM A;  1E3P A;  1VQ4 A;  4A3C H;  5K36 G;  3GD7 A;  4PMW A;  3PUW A;  4JI6 L;  4QY7 A;  5LMU L;  2EIF A;  1YIJ A;  1SLJ A;  3PUX A;  1ASY A;  3E0E A;  1I50 H;  4LFC Q;  3HOZ H;  4DNI A;  4TVA B;  1PH3 A;  1J5E Q;  3I4M H;  4JCV E;  4DPG A;  4DUZ L;  2CKZ B;  4DR3 L;  1I94 Q;  4UY8 C;  2WB1 E;  1KAW A;  1XMQ Q;  2KHI A;  4DV3 L;  3CC2 A;  3PCO B;  2MNA A;  1XPR A;  3BZK A;  2VQF Q;  1N34 L;  4AIM A;  4PZ8 A;  1X56 A;  4A3F G;  3J81 i;  3CW2 C;  4A93 H;  1SRO A;  4BY7 G;  1KD1 C;  5M3F H;  4X64 L;  1VQM A;  1QVG A;  4DV0 L;  4LF4 L;  3PO2 H;  1HZC A;  4B3T Q;  3UE0 A;  5GQO A;  3UE1 A;  3J81 j;  3PO3 H;  1NE3 A;  3AFQ A;  2QA4 A;  1YJN A;  1PV4 A;  3CCL A;  5C4X G;  2VQE L;  4A3B G;  3M85 A;  3FKI H;  3ULL A;  3KF6 B;  2E2I H;  2IHF A;  1HJP A;  4DR1 Q;  3TRZ A;  1L1O B;  1P8L A;  2LSS A;  3L2P A;  4KHZ A;  4B3M Q;  5EAY A;  2R7F A;  2IHE A;  2YU9 H;  4PZ6 A;  2JA7 H;  1YBY A;  4C3I H;  2ZTC A;  4IO9 A;  1PH4 A;  1YJ9 A;  3F8T A;  1Q1B A;  4GN3 B;  1T9H A;  2JA8 H;  4B3R Q;  2D62 A;  4GS3 A;  4A3L H;  2WB1 G;  1BVS A;  3BU2 A;  3GTG H;  3S24 A;  3CCQ A;  4P73 A;  1VS0 A;  1EYG A;  3OW2 A;  4UP8 A;  4Y7N H;  4P74 A;  1YHQ A;  4YWL A;  3T1Y L;  4FDB A;  3ZJY C;  1XMO Q;  1S3O A;  2NVY H;  1VQB A;  2UXB Q;  2JK8 A;  3I4N G;  2CWP A;  5IYC H;  1U5K A;  2F4V L;  1WOC A;  2BA1 A;  1K8A C;  3K80 C;  1EUJ A;  1VQ9 A;  4A3C G;  2VZA A;  3GTM H;  1SFO H;  4IPH A;  2QGQ A;  1Y14 B;  5LMN W;  4DV5 Q;  3TS0 A;  2XGT A;  3CPF A;  4OO1 I;  3PGZ A;  3HOZ G;  3W1G A;  4GKJ L;  5ELO A;  2CQO A;  4QL5 A;  2HHH Q;  3I4M G;  2L15 A;  1PH9 A;  1GVP A;  1TWF H;  3KYH C;  4ME3 A;  4OO1 G;  3KF6 A;  4GLA C;  3GTJ H;  3A5Z B;  2BH8 A;  2AHO B;  3S2D H;  3KDF B;  1L1O A;  4P75 A;  3CCJ A;  4IOC A;  2A19 A;  3I56 A;  3RN2 A;  1Q82 C;  2CCZ A;  4DR7 L;  4OX9 L;  1BKB A;  1TWC H;  2UXC Q;  1I3Q H;  4BA1 I;  1KXL A;  1X3E A;  2JEB I;  4DK3 C;  4EX5 A;  1HH2 P;  1X54 A;  2OQ0 A;  3DM3 A;  4A93 G;  2K5V A;  5M3F G;  2KHJ A;  3PO2 G;  2CWA A;  4RG1 A;  4DV6 L;  1K8G A;  5M5W H;  5BR8 Q;  2VUM H;  2PNH A;  3PO3 G;  1HNZ L;  1AH9 A;  2EQS A;  4GN4 B;  4PZ7 A;  2WFW A;  1VQ6 A;  2ALY B;  3EN2 A;  1N33 L;  2ZTD A;  2K14 A;  1P16 A;  4GOP C;  1VQP A;  3FKI G;  3HFZ B;  3OYY A;  1TWG H;  1G29 1;  1O7I A;  1E7Z A;  4IPD A;  4YWM A;  5H1S E;  4BY1 H;  4LF7 L;  4OX9 Q;  4DR5 L;  2NZH A;  4IPC A;  3HOX H;  4NXM L;  4IFD G;  3M9B A;  2YTV A;  2JA5 H;  1VQ5 A;  2JA7 G;  4POF A;  2PI2 A;  4DV2 L;  1VQ8 A;  4B3S Q;  2JA8 G;  3M3Y H;  4YWK A;  3U4Z A;  2PQA B;  4A3L G;  3KJO A;  3PIP A;  2A8V A;  1X55 A;  3KDF A;  4X6A H;  3F2C A;  5GRO A;  1CKM A;  2ZJP A;  2DGY A;  4QGU A;  1S72 A;  1IYJ B;  3M4P A;  3CC7 A;  1B70 B;  1WFQ A;  4OON A;  4LFC L;  5IYC G;  4NXN Q;  1LYL A;  1OXU A;  1YHB A;  3M4O H;  1J5E L;  1Y1W H;  4LF8 Q;  3D31 A;  1HR0 Q;  3HOV H;  2VY3 A;  3PV0 A;  1PH1 A;  3RNU A;  3GTO H;  3EBE A;  3W1B A;  4O2D A;  1I94 L;  3CCU A;  4HJA A;  4XIG S;  2HT1 A;  1M1K C;  3H15 A;  1W3S A;  1EQR A;  5JEA J;  4A3G G;  1M90 C;  2CFM A;  1Q8K A;  4LUZ A;  3GTL H;  4IOA A;  4GOP B;  1B7Y B;  1D8L A;  4DV7 L;  2MO1 A;  1JJG A;  5C44 H;  2WAQ E;  4LNQ A;  3F1Z A;  4B3T L;  2JEA I;  2BA0 A;  4DV1 Q;  4UP7 A;  3K7U C;  1VQF A;  4OWT B;  1IBM Q;  2PQA A;  2VUM G;  1PH2 A;  2OTL A;  3PUY A;  2AWN A;  1Z47 A;  4KHP L;  1YZ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...