2Z6KC

Crystal structure of full-length human rpa14/32 heterodimer
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
117
structure length
117
Chain Sequence
VDMMDLPRSRINAGMLAQFIDKPVCFVGRLEKIHPTGKMFILSDGEGKNGTIELMEPLDEEISGIVEVVGRVTAKATILCTSYVQFKEDSHPFDLGLYNEAVKIIHDFPQFYPLGIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Full-length Human RPA14/32 Complex Gives Insights into the Mechanism of DNA Binding and Complex Formation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Replication
molecule keywords Replication protein A 32 kDa subunit
total genus 22
structure length 117
sequence length 117
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF08661 Rep_fac-A_3 Replication factor A protein 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2z6kC00
3KF6A 1J5EQ 1TWHH 1S3OA 1EYGA 1I3QH 2WB1G 3GTGH 3ERSX 1N32L 1HZBA 1PYSB 1ASZA 4JI2L 4NXNQ 1CKNA 4H02A 4JOIC 1VQ4A 1JJ2A 2JA7G 5HGQA 1KRSA 4IPCA 2JA8H 1QZHA 1GO3E 3GTJH 1PH2A 1M90C 4P74A 2PQAA 4HIMA 1WOCA 1EFWA 4JI1Q 1A62A 1WCMH 2R92H 3CC7A 2YTYA 1HR0Q 4JI6L 3HOYG 3H0GG 2XGTA 4DV5Q 4LF9L 1W3SA 1LM0A 3ER0A 5C44H 4HJ7A 1IBML 2XTIA 1PHJA 4DK3C 3HKZG 4DV6L 4DR1Q 1Q46A 3AFQA 4ALPA 3T1HQ 1Q7YC 4OO1I 3PO3G 3PGZA 4BA1I 4GNXC 3CCEA 1RL2A 3HOVH 2MO1A 4GKKQ 3J81c 3SGIA 3NBHB 5IP7G 1P16A 3PUZA 5GAEC 3I4MG 2MNAA 2VQFL 2UXDL 4JI5Q 2JQOA 1Q1EA 1TXYA 4LUVA 1KD1C 1KAWA 3GTOH 3PCOB 2QGQA 1ASYA 2LSSA 3M9BA 5K36G 4GN5A 3D31A 2QEXA 3M4QA 3A5ZB 5C3EH 5C4JH 4AIMA 1PH4A 2B29A 2YYZA 4DR5L 3HKSA 1YJ9A 1LTLA 3GTPH 3U58A 4PG3A 3RZDH 4BY7G 1JJGA 3H3VI 3T1YL 4A93H 4LF7L 5IYBH 3S2HH 2HQLA 4BXXG 1B70B 1D8LA 2GVAA 1TWAH 4B3MQ 4LF8Q 2HHHQ 5LMNL 2IY5B 1UWVA 4IOCA 4X64Q 5IP7H 4GNXA 1VQPA 1XMOQ 1N34Q 2RHSB 2Y0SG 1K8GA 3KF6B 2YU9H 1PH7A 2YTVA 1VQJA 5LMNW 4AQYQ 1X3GA 2AHOB 2L15A 2ZTEA 3WWVA 2JEAI 3S1QH 1VQEA 1SRUA 4DV4L 2DGYA 1Y1VH 1PH1A 3W1GA 2IX0A 1SMXA 1T9HA 2F3IA 4P75A 3UDIA 3CCMA 1HZAA 4DV2Q 1XMQQ 2KHJA 3CC2A 2ATWA 3M3YH 5M3FG 1HNZQ 1M1KC 4LFBL 3DM3A 4P71A 2R93H 2AMCB 1HJPA 4JBJA 5EAYA 4NB3A 1YNXA 4MTNA 2V1CC 3BZKA 1O7IA 5C3EG 4JI3Q 4NPSA 2Q2TA 5IWAQ 1PH6A 3M4OH 5IYCG 5JJKA 3J81j 4X66L 4YY3L 4PZ7A 1EIFA 4QY7A 4LFCL 4B3SL 1HH2P 2JE6I 1I5FA 4LFAL 1JT8A 4TVAB 2UXBQ 4YCWA 2GN5A 1YBYA 5JJLA 2DUDA 3KF8B 1UE6A 2ZM6L 4DV7Q 2E2JH 2PQAB 1YHBA 4C3IH 1IBKQ 1FVIA 3CQZH 4LF4L 4DV3Q 4OONA 4C3JH 3NEMA 3GDEA 5AJ3L 1N36L 1GM5A 1MJEA 1VQBA 4O0AA 4JBKA 1L2FA 4DR4Q 4EX5A 5LMUQ 1S40A 1VQDA 2VUMG 3PF4A 3TS2A 1Z47A 2BA0A 1PV4A 2R7ZG 4L5RC 2MFIA 2BA1A 3RLNA 3CCSA 2UUAL 4L5SA 4DV1L 4B3RQ 2A19A 4DV0L 2A8VA 1YJWA 4LF6Q 4DR2Q 4JV5Q 4NXMQ 3S24A 2AWOA 3CCUA 4X62Q 4BBRH 3HOXH 3S1NH 3KDFA 1BBWA 5BR8Q 1KXLA 4IOAA 5C4XG 3S2DH 2D62A 4P72A 4JG2A 2PMZE 4KHPL 3I56A 2UUCL 4A3BG 1YHAA 1PH5A 4JCVE 3RZOH 1IZ6A 1E3PA 2CKZB 3G4SA 1N8RC 1BVSA 3E0EA 2RHQB 2E5LL 4BXXH 1K0RA 5IP9H 4KI0A 1YHQA 4JBWA 4MNOA 1L1OB 2K4KA 1IL2A 4HIOA 1JJCB 3AFPA 1HNWQ 3JAMc 2UUCQ 4IFDI 1QUQB 3M7NA 4AYBG 1PFSA 4OXPA 4HJ5A 4P73A 1Y1WH 1OTCA 3PO2G 4A3GH 2K75A 3KOJA 2R7ZH 5BR8L 3EIVA 3GD7A 3HOZG 3KJOA 4X62L 1L1OA 2R7DA 3J81i 1IYJB 3PUYA 3HOWG 4NXML 2Q2IA 3CXCA 4BBSH 4DR2L 2VY3A 4HIDA 4GKJQ 3CPWA 4DUZQ 4DV0Q 1YITA 4B3RL 3PUWA 1S72A 2UUAQ 1X56A 2RF4A 1UE5A 3RLOA 4LNQA 2WB1E 1VQFA 2D0OA 4YWLA 3GTKH 4DR4L 5FLXc 4DV3L 4JBMA 2JA8G 4GLAC 2E2HH 1HR0W 4GLXA 2CWAA 3E9HA 4DV7L 4YCUA 4BBRG 2NZHA 2PNHA 3I7FA 4HJ8A 3RNUA 2ALYB 1XJVA 1UE7A 3G71A 3OW2A 2UXBL 1A8VA 1WFQA 5ELNA 5M3MH 3H3VH 4PMWA 4LFCQ 1VQNA 4OX9Q 1K8AC 4X6AH 2K14A 5JEAJ 1E22A 4GS3A 4YY3Q 1YIJA 2WFWA 1KQSA 4B3TL 4MZ9A 1GD7A 4C3HH 3ULLA 3W1BA 4BY1G 5IP9G 1BBUA 3ZJYC 2JA6H 4WJ3M 1E1OA 1L1OC 2NVTH 1WJJA 1PVOA 1VQAA 4QJFA 3RN5A 4B3TQ 4UY8C 1W2BA 4OX9L 2I5HA 2N3SA 1HNZL 1MJCA 4KHZA 4DV2L 1XMQL 3HOWH 1G6PA 1GVPA 4XTCS 2PI2A 2N8NA 4A3JG 4O2DA 4DV4Q 4GOPA 1OXXK 3UE0A 3D0FA 3GTQH 1YI2A 4A3DH 4OO1G 2E2IH 2N78A 4GLVB 2A1AA 2R6GA 3KJPA 1R9TH 1CSPA 4BY7H 1SROA 2NVQH 1TWGH 1XMOL 4R4IA 1KRTA 3FHWA 4DUZL 1NJIC 4GKJL 4AYBE 4A3FH 1YEZA 2B63G 1JE5A 3BU2A 4L5TA 3STBC 4LF8L 1IXRA 3AYHB 3I55A 1MIUA 4LF7Q 3CP0A 5IT9c 3PIPA 1GKHA 1RIPA 3OYYA 4GN3B 4OWXB 1HNWL 2I5MX 3GTLH 2K5HA 1Q86C 2H5XA 4XIGS 2VS1A 4KLKA 2E5LQ 4A3LH 4TQUS 3J7A5 2JEBI 3MXNB 3TS0A 1K9MC 5FLMG 3CD6A 1VQCA 2ZJRA 4KHPQ 1VQKA 2LXKA 1A0IA 4IJLA 3UDXA 1LUZA 2EQSA 4AH6A 2VQFQ 1KIXA 4QQBX 2OTJA 3M85A 3G6EA 1X3EA 4L5QA 2ZTCA 1QZGA 4GKKL 2HT1A 2NN6I 3EN2A 4JV5L 4A3FG 4LF6L 2IT1A 2FXQA 1VQLA 3T1HL 1E1TA 3TRZA 4DV1Q 1K73C 1CKOA 4DKAC 4DV5L 1EUJA 5LMUL 1J6QA 2K50A 1X54A 1Q81C 1N9WA 1N36Q 5M5YH 5AJ3Q 2B63H 3TREA 3HKZE 4LF4Q 1AE2A 1KL9A 3K7UC 1CKMA 3U4ZA 1B8AA 2QA4A 1PH9A 1IBKL 5M5XH 4UP8A 1X55A 1EQRA 2ZM6Q 2ID0A 2YV5A 2JA9A 3CW2C 4LFAQ 4RG1A 1NTGA 4B3SQ 4IFDG 4R4TA 4GN4B 3KDFB 2OQKA 4X66Q 5IYDH 1QVCA 3FKIH 1N32Q 3UE1A 5IWAL 1VQ9A 4APVA 3F2BA 3G48A 5IY0A 4A3KH 4JI3L 2IHEA 5FLMH 1J5EL 3UDFA 4POGA 4QIWE 2VUMH 2MO0A 4JYAQ 3B6YA 4A3DG 2MQHA 2N49A 1OXUA 2CQOA 5IE8A 3HFZB 5M3FH 4A3EH 4LFBQ 5GAGC 2R7FA 4GNXB 1NE3A 3LGJA 4OWTB 4A3JH 1VS0A 3CCJA 1V1QA 1I6HH 1Y1VG 3U4VA 1I94L 4DAMA 5JJIA 4AQYL 3M4PA 3FP9A 1Q8KA 2BH8A 2ES2A 4DK6C 2ASBA 3PV0A 2JK8A 1Y1WG 1C7YA 1Q1BA 1XNRL 3BZCA 1N34L 4A3GG 4X64L 3A5UA 3CCLA 1B7YB 2Z6KC 5LMNQ 1NMGA 1G51A 5GAHC 1QVGA 2HHHL 2F52A 4B3ML 5HY6A 2VQEQ 1OXTA 3ULPA 1UE1A 5IYCH 5C0XJ 1VQGA 3RN2A 4OWWB 1Y14B 4K0KL 2NVXH 2GVBA 3T1YQ 2OWOA 2UXCQ 3K7AH 4LUOA 4HJ9A 3JAMi 3W5OA 1A63A 2B3GA 4DR5Q 4A3EG 1AE3A 1OXSC 2PI2E 4A3MH 2K5VA 4A3LG 1LYLA 3S1MH 2WP8J 2KENA 4JI7L 1XTDA 1QVFA 2NN6G 1DGSA 3J80c 4QGUA 4JI5L 2UXDQ 1TWFH 2E8GA 4Y7NH 4QL5A 3F1ZA 3DLLA 2CCZA 3VDYA 3STBD 1FJGQ 3CF5A 1N33L 4YCVA 4A4IA 2JA6G 3PIOA 1XPOA 1SR3A 2HIXA 3K8AA 3BJUA 4DR1L 3CCRA 3A74A 4DV6Q 1EOVA 5ELOA 1I50H 5C4XH 1IBMQ 4LF9Q 1CKNB 1SE8A 3K81C 5IYBG 1PA6A 3CC4A 2JA7H 4IPDA 4JI6Q 3HOYH 1HR0L 3J80i 3UDGA 2KHIA 5E7NA 4GOPC 4BY1H 4A3CH 4JI1L 1VQ7A 4X65Q 1AH9A 3HOZH 2CFMA 4A3MG 3H15A 1FL0A 3FKIG 4JOIA 4DR3Q 2CWPA 1XPUA 3I2ZA 2JA5H 5GADC 3RLFA 2YTXA 1SN8A 3A0JA 3H0GH 1HZ9A 1HZCA 1QUQA 4NXNL 2K52A 5GROA 4JI2Q 5FJ8H 3L2PA 1KC8C 4R1JA 4LWCA 1Z9FA 1K83H 4YWKA 1X6OA 4R4OA 3TQYA 4A75A 3S1RH 2UUBQ 4DUYQ 1X65A 1V43A 1C9OA 4JI0L 4LW1A 4EQ5A 4JC0A 4DR7L 4ME3A 2UU9L 1MKHA 4JI4L 3EBEA 2Q2HA 4C2MH 3S17H 5JEAG 4HJAA 1YJNA 3PUXA 2I0QA 3Q8DA 4J15A 1HNXQ 1WI5A 1IBLQ 5J3BA 2IHFA 1CSQA 2C35B 2NZOA 4YWMA 1VQIA 1L0WA 5C0XI 1OXVA 1NMFA 2AWNA 4DR6Q 3I4OA 3CMEA 1SLJA 1VCIA 1YVCA 2ZTDA 1WYDA 4R4QA 4POFA 3E9IA 4UPAA 4JI4Q 4A3CG 1JMCA 1PYBA 4DR7Q 1NBWA 5M5WH 4A3IH 4JI0Q 1D7QA 4IPHA 4DUYL 3CPFA 2UUBL 2OTLA 2EXDA 4HIKA 3MEFA 4LF5L 4JI8L 3OTOQ 4R4CA 1V9PA 4A76A 4IJHA 1BKBA 3HOUG 2JJQA 5FJ8G 4YHHL 3JC66 2WAQE 4DPGA 1K3RA 2F4VL 2VL6A 1E24A 1PH8A 3F2DA 2ZJQA 2LXJA 1VQHA 3ICEA 4DR3L 1X9NA 3U50C 4X65L 1XNQL 2HIVA 1WCMG 3S15H 2KCMA 4PZ6A 3CCQA 2R93G 3I4NH 2OCEA 1VQMA 2EIFA 4IO9A 3GO5A 4A3IG 3I4NG 1TWCH 2VNUD 3S16H 1NY4A 4DNIA 2VW9A 4WJ4A 4BBSG 1P8LA 3ULJA 1FJGL 1N33Q 5GQOA 1VQ6A 2I5LX 2JA5G 4Y52H 3F8TA 1U0LA 4IPGA 3I4MH 1YZ6A 4FDBA 1H95A 1XNQQ 3PSIA 5DLQE 4JI7Q 3HOVG 4UP7A 3CCVA 3S14H 5C0XG 3PUVA 3K0XA 4RMFA 3HOUH 3L7ZC 2Y0SE 1EIYB 2OQ0A 1X3FA 2F4VQ 3F2CA 4YHHQ 2ZJPA 3TEHB 1UEBA 2Z6KA 3J7ZC 3CMAA 2RCNA 1EWIA 4K0KQ 4DAYB 4A93G 1E7ZA 2UXCL 4LUZA 1Q12A 2KCTA 3NENA 2VQEL 4A3BH 3OTOL 3KYHC 4JI8Q 2Q2UA 4LF5Q 3KFUA 2D0PA 1XPRA 5M3MG 3HOXG 3L0OA 1JB7A 3AEVA 3PF5A 1VQ5A 2NVYH 1XNRQ 3NELA 4IFDJ 2AKWB 4GOPB 2VZAA 1VQ8A 5C44G 1EQQA 4DR6L 1SFOH 1I94Q 1VQOA 3GTMH 1FGUA 4UP9A 2WAQG 3PO3H 2K5NA 1PH3A 2BH2A 4A3KG 3AQQA 1HNXL 3CAMA 1IBLL 3KLWA 2R92G 1CUKA 1G291 3K80C 3RR5A 1C0AA 1U5KA 1KHIA 1Q82C 3IRBA 3PO2H 5IYDG 4PZ8A 2UU9Q 5H1SE 4JYAL 4BA2I 2IX1A 2KBNA 2Z0SA
chains in the Genus database with same CATH superfamily
4ZKBB 1EYAA 3KF6A 3GTGB 1KLUD 1ZXTA 1LTTD 1STAA 1TWHH 3AB9A 4KN7C 5FLXL 2KCCA 4ILWA 2BDNA 4HN7A 4NXNQ 4OELB 1HPCA 2CW0D 2JA8H 4FNFA 1QZHA 3GTJH 2MGSA 1M90C 2F3VA 5M3FB 2PQAA 4IUVA 1EFWA 3GTJB 3P75A 4IUQA 1EFID 2R92H 2YTYA 4DV5Q 1IBML 1LM0A 4DK3C 3HKZG 3AFQA 4ALPA 1QNKA 4Z9CB 3HOVH 3R93A 2HD3A 2MJ8A 3A56A 1SNPA 2EYFA 3NBIA 3OW7A 3GTOB 4KTAA 4JI5Q 2B63B 1Q1EA 2B2UA 4FXGC 1EY0A 1ASYA 3M4QA 1AN8A 2QKIC 3A5ZB 2A5HA 1BO0A 5C4JH 3ND8A 1PH4A 4RGTA 1ESFA 2B29A 2YYZA 5ELBA 1B9NA 4DR5L 4G7HC 3Q0AA 2PPBC 3RZDH 4DU9A 1B2TA 4M1UB 2E76C 4A93H 2EY6A 3SK4A 1TVXA 5G3LD 1N34Q 2QDLA 3DXJC 1XWEA 5LMNW 4KY5A 1SMXA 3CCMA 4EQOA 1HZAA 5I6WA 3S15H 2ATWA 1HNZQ 4P71A 1BR9A 1HJPA 1UUPA 5EAYA 2V1CC 3C46A 1QWYA 2Q2TA 2XRSD 3TN2A 5JJKA 3FDTA 4YY3L 1ET6A 2RQXA 1EIFA 4QY7A 1HH2P 1JT8A 1WTXA 2UXBQ 4CBVA 2DUDA 3TP8A 2ZM6L 1EEFD 3CQZH 4JBKA 3NEMA 1L2FA 3PF4A 2VUMG 2CW0C 3T13A 2MFIA 3CCSA 2UUAL 2A8VA 3SVMA 1H9SA 3MWYW 4LF6Q 2JN4A 3S24A 3IAYA 4HEDA 3HOXH 3HKZB 3KDFA 1ENFA 1KXLA 1HTPA 3S2DH 1SYEA 5C4XG 2D62A 4P72A 1SJHD 2QILA 2M2LA 1PH5A 4JCVE 2F0NA 1E3PA 1MBYA 1SDFA 2CKZB 2F0PA 1N8RC 2QCPX 2E5LL 2RHQB 1K0RA 1YHQA 1WD1A 3KLSX 1L1OB 4HIOA 1JJCB 2N88A 4IFDI 3M7NA 4OXPA 2KQ3A 3FPUB 1IYJB 5IGGA 3HOWG 4BBSH 3H91A 4V190 1FGBD 5IGCA 1YITA 1X32A 4J6HA 2UUAQ 3M7GA 2LMCB 1VQFA 3W2DA 3TMEA 4YWLA 3HOUB 1PFMA 1ONLA 1GUGA 5I6YA 1ILPA 2CWAA 3S14B 2NZHA 4CDEC 1G6ZA 5EKLA 2IX3A 2EJFC 4PMWA 4A3IB 4LFCQ 2EYMA 3WDNA 1K8AC 5JEAJ 1NR2A 5JJZA 2IJ0A 1JWMD 1GD7A 3W1BA 1BBUA 1L1OC 1STYA 1PVOA 1ICFB 1EOTA 4QJFA 1GXDC 2MP1A 2I5HA 1PRTD 2BE5C 3IL8A 3ONAB 5K36H 1NAPA 4H44C 2EVBA 1EYCA 3D0FA 2Q8TA 4OO1G 1XTCD 3KJPA 3NK9A 2EYJA 4BY7H 1G8ZD 3X3NA 1HCZA 1MSHA 1NJIC 4GKJL 1BCPD 4AYBE 4FXKC 3BU2A 3AYHB 1I3QB 3FMCA 4YIJA 3TZUA 1GKHA 4GN3B 4OWXB 5C4HA 1YNJD 1HNWL 4K2LA 2XN9C 1Q86C 4XIGS 2WACA 2JEBI 3TS0A 5EPLA 3UDXA 4H0LC 2JYOA 2EQSA 2XWBB 1TY0A 2OTJA 3M85A 1A15A 4DA2A 4LAAA 1QZGA 5JPMC 1JB3A 2NN6I 4Q5VA 4JV5L 2FXQA 3TRZA 1CKOA 2ZXOA 2DN8A 2WB1B 5IGFA 1ESRA 2F0JA 4IQZA 2KECA 2B63H 1PH9A 1CKMA 3U4ZA 2QA4A 1SNMA 2ZM6Q 1EY9A 5NUCA 1Y1VB 1D2BA 4R4TA 4RFBA 1QVCA 4APVA 3G48A 3D4RA 3V96A 2B2VC 2F1MA 1SNCA 4LFBQ 2NVXB 2R7FA 4GNXB 4OWTB 3CCJA 3QWNA 1Y1VG 4GZYC 5JJIA 1I6VC 3OWEB 3M4PA 4KHVA 2BH8A 4IURA 1LT6D 2JK8A 5DEHA 4A3GG 1Q1BA 1B7YB 1O7YA 2Z6KC 4RHSA 2F52A 5HY6A 3LWEA 1OXTA 5C0XJ 1SBBB 1V1PA 4OWWB 4K0KL 2NVXH 5DAUA 4HJ9A 3BZDB 1MD2D 1CZWA 4A3EG 1AE3A 2PI2E 3GV6A 2K5VA 1LYLA 5C5MA 1XTDA 1QVFA 3K5MA 1DGSA 1E0BA 1S5ED 4QGUA 4JI5L 2UXDQ 1TWFH 1TWCB 1WTVA 2KOLA 2CCZA 3STBD 1FJGQ 2RKSA 1N33L 2XIWA 3K8AA 3BJUA 3I4LA 2SOBA 1EOVA 3BDOA 1IBMQ 5IYBG 4IPDA 3J80i 3T4AC 4A3CH 4JI1L 1AH9A 4RA8A 1EU3A 3I4MB 3Q24A 3I2ZA 1SE4A 5GADC 3RLFA 2E2HB 2YTXA 1TWGB 3H3VC 4NXNL 2K52A 5FJ8H 5M3MB 4CJ0B 3MXPA 2A6HD 4K6DA 2LS01 4YWKA 4R4OA 3TQYA 3S1RH 1I50B 2I07B 5I2YA 1X65A 4LW1A 4EQ5A 1HTLD 2UU9L 1MKHA 1B53A 4P2CB 4U673 5JEAG 1LTID 2I0QA 3NE5B 2L55A 4J15A 4ZAIA 2IHFA 2C35B 1CQVA 4YWMA 1VQIA 5E3FA 1T5XD 1L0WA 5C0XI 2WINB 2K33A 3CMEA 2IPKD 2ZXRA 2RVLA 4QB4A 1YVCA 5DNFA 4R4QA 5J39A 1CA6A 1PYBA 1X3PA 3MEFA 4LF5L 2NVYB 4IJHA 2K04A 2EXZA 3MZ5A 3HOUG 2JJQA 5FJ8G 3IFTA 5BN3A 4BBRB 1BUVT 4HAEA 3F2DA 3AU7A 2LXJA 1MGSA 4X65L 1XNQL 2ENBA 3SE0A 1I4GA 3S1RB 3OIPA 3EJIA 2VNUD 3S16H 4XYQA 4BBSG 1P8LA 4ODGA 2I5LX 2JA5G 1U0LA 3GTMB 4CJ1B 4A3DB 3S14H 1FYCA 3CU7A 3CCVA 3VR3A 3HOUH 2PMZB 3VYTA 4PMBA 2OQ0A 1DD2A 2ZJPA 4YHHQ 1UEBA 4PNYA 2RCNA 1EWIA 2UXCL 4LUZA 1Q12A 2KCTA 3NENA 5CV6A 3P20A 3PIO3 2B2TC 2MUYA 1CHPD 1TWAB 1S5BD 1SSOA 4GOPB 3HOXB 1SMYD 3GTMH 3PO3H 4A3KG 3AQQA 1HNXL 3CAMA 1IBLL 3KLWA 3K80C 2LY7A 1M4VA 3IRBA 2QDBA 5L37A 1SYCA 5CC4A 4JYAL 4BA2I 1QCBD 1J5EQ 3NSWA 1S3OA 2JA7B 1EYGA 4OO1H 3GTGH 1EIHA 2MHVA 1F2YA 1I6HB 1K83B 1CKNA 4H02A 1VQ4A 1JJ2A 1GOZA 1KRSA 4IPCA 3CQZB 2B2YA 2GA4B 4N8X1 4C3IG 4HIMA 2K1BA 1WCMH 1WTHA 3HZXA 3T53B 4IALA 4LF9L 1W3SA 3D4WA 3ER0A 4B9XA 3GTPB 2XTIA 2EOTA 4DR1Q 1Q7YC 5EGTA 3T1HQ 3NWTA 3PO3G 1K0SA 4OIJA 4FF1A 3NBHB 5ELDA 1P16A 4L63B 3CRLC 1KD1C 1KAWA 2QGQA 3F2UA 3M9BA 4GN5A 2QEXA 4C1NK 1V8QA 2RSOA 5C3EH 5KGUA 1SFOB 3HGBA 1HRJA 3HKSA 3FRPB 1KLGD 4BY7G 2NWGA 3NQTA 2HQLA 1B70B 2XNAC 1D8LA 4B3MQ 3M4OB 4RWSC 3WOFA 1UWVA 4IOCA 3N6RA 5IP7H 4ZLTF 1K8GA 2RHSB 2X69A 2VB2X 5IGDA 1IL8A 1IYUA 1F2MA 2EYLA 1VQJA 5ELCA 4AQYQ 2ZTEA 3WWVA 3S1QH 1RKNA 4XQNA 4DV4L 5C4ZA 2IX0A 4P75A 1T9HA 1VF7A 1LT3D 2F3IA 3RUZA 3UDIA 1XXGA 1ILQA 4JBJA 4C56C 1F9RA 4NB3A 5BN5A 1YNXA 1SYDA 3BZKA 1R9TB 4JI3Q 2F0WA 1PH6A 5EKIA 1PTOD 2B8GA 1TU2B 4B3SL 1TIID 4TKOB 1S5CD 4TVAB 4YCWA 1SXTA 2E2JH 5CV4A 4OONA 1N36L 1GM5A 4DR4Q 1DOLA 1LLRD 1VQBA 2M00A 2MPMA 1S40A 3OIQA 4IUUA 1Z47A 4J1MA 2CQAA 4L5RC 2Z6BA 3RLNA 1CI3M 3I73A 4B3RQ 4DV1L 4DV0L 3H6MA 4DR2Q 2A69C 2NN6H 3FEWX 5BR8Q 2DY7A 2F0MA 4JG2A 5IIFA 2UUCL 3NTKA 1YHAA 2Y0SB 5D14A 2F0IA 3G4SA 3P1HA 1DYQA 1NNXA 3E0EA 4BXXH 4Q0FA 1F77A 1F2LA 1CT1D 2O2LD 4KI0A 4DAYA 2K4KA 2BCOA 1WTPA 1GUWA 1PFSA 4HJ5A 1BQQT 4P73A 5CORA 4A3GH 1MI2A 3EIVA 3GD7A 3KJOA 1L1OA 1TKWB 4NXML 2BOSA 2C9OA 3NXWA 4DR2L 4R8IA 5K5PA 4DUZQ 1Y8OB 4DV0Q 1S72A 1DOMA 2H1EA 2RF4A 2L12A 2EJMA 4PMCA 3CRKC 4DR4L 4DV3L 4GLXA 1NUCA 1H9SB 3RNUA 4HJ8A 1XJVA 2ALYB 2K03A 3G71A 4X6AH 2K14A 5IT9L 4B3TL 3SXHA 2NZ1D 4ZK9B 3ZJYC 1A3UA 2KA7A 1WJJA 4HSVA 1VQAA 4B3TQ 1W2BA 4OX9L 4DGZA 4KHZA 4TRDA 1G6PA 4XTCS 3J81L 4A3JG 2HCCA 1Y1WB 1OXXK 3UE0A 1PZJD 1T5EA 4Y7NB 4GLVB 2R6GA 4G4KA 1CSPA 3DUZA 3JAML 2NVQH 1KRTA 3FHWA 4BY7B 1YEZA 1JE5A 4L5TA 1EY5A 4IUNA 1IXRA 3TSSA 1MIUA 3A8JE 4LF7Q 3CP0A 1WTQA 5IT9c 3PIPA 1RIPA 3OYYA 2EYHA 4RKLA 3GTLH 2K5HA 3S9WA 2VB3X 3LNNA 3MA2B 3DWPA 3CD6A 2ZJRA 2LXKA 1LABA 1LUZA 4AH6A 4H7BA 3G6EA 4L5QA 2FINB 2ZTCA 2F0VA 3T1HL 4DV1Q 3CHBD 4A3MB 1FNUA 1EL0A 1EQVA 1EUJA 5LMUL 2K50A 4PV1C 1PMRA 5M5YH 4LF4Q 3JAME 3K7UC 1KL9A 3M3YB 2AQ3B 4X3TA 1X55A 4G57A 2ID0A 1EU4A 2YV5A 2JA9A 3CW2C 4KJNA 4LFAQ 3VR2A 2V4DA 4B3SQ 4IFDG 1TS3A 4X66Q 5IYDH 3UE1A 3F2BA 1EY8A 5IY0A 4JI3L 4POGA 1J5EL 1C4QA 5JOBA 2VUMH 4A3JB 1HUMA 4JYAQ 4WORA 2N49A 1OXUA 5IE8A 3BVMA 3HFZB 5M3FH 4A3EH 3EQLC 3LGJA 4A3JH 1VS0A 5D3IB 2A68D 4DAMA 4KV6A 5KNBA 1E2ZA 2BE5D 1B3QA 1Q8KA 2ASBA 3PV0A 2CHBD 1XNRL 1V1PB 4F88A 3SK8A 4N8FA 1NMGA 2FFKB 2HHHL 4R9WA 2XVSA 1UE1A 3IKJA 1VQGA 5CV8A 3RN2A 1GUTA 3DHQA 2OWOA 2R61A 2UXCQ 3K7AH 2WIIB 3QOLA 5I9PA 1PRTB 4A3MH 1DZ1A 4A3LG 4DAVA 3S1MH 3K5NA 3GTKB 3S16B 2E8GA 3C3LA 3F1ZA 4DN4M 3PIOA 1XPOA 2A6HC 1ZYRD 1SNQA 4DR1L 4X3KA 3A74A 5KEEA 2KEDA 1GJXA 5C4XH 4LF9Q 2B8FA 2K32A 2Z4IA 1LV9A 3HOYH 3U9SA 4JI6Q 1HFNA 1HR0L 4IFDH 1EYDA 3I72A 4GOPC 3R2IA 5M5XB 3HOZH 1FL0A 1XPUA 3H0GB 2F0DA 2B2WA 2F0HA 4CKBA 3H0GH 1HZ9A 1HZCA 1UAPA 3L2PA 2OF1A 1Y8NB 5T1IA 2D2CC 4LWCA 1RDPD 1STGA 3KBXA 1EIGA 4BWGB 1K83H 2AQ1B 5C4XB 2QEJC 4RKBA 3C2PA 1V43A 4JI0L 4JC0A 4ME3A 2RA4A 4C2MH 2Q2HA 1ET9A 5A2QL 4HJAA 3PUXA 4QUFA 1STBA 5G3LF 1WI5A 5J3BA 1CSQA 5KNDA 2NZOA 1QOHA 1EY4A 5ISRA 1OXVA 1NMFA 2B2UC 2Z9HA 3D6CA 2ZTDA 1Z7TA 3E9IA 4UPAA 1JMCA 4DR7Q 1D7QA 4DUYL 2UUBL 1L0XB 5M5WB 2TMPA 1KDBA 3KK7A 1V9PA 2F0TA 4K8JA 1NR4A 1BKBA 4YHHL 3JC66 2F4VL 1K3RA 1LTRD 4QIWB 3ICEA 1PTOB 4DR3L 1X9NA 1BNZA 2HIVA 2NTSA 1PTOH 2EY1A 1RTOA 1WVLA 4PZ6A 2A69D 4RCOA 2R93G 3K58A 1SYBA 4ME5A 4QF4A 2EIFA 3CKIB 3WOEA 1CQFA 3GO5A 3I4NG 3I90A 1TWCH 1TWFB 5A2QE 2VW9A 1RD9D 4KKSA 4Y52H 1I4PA 4IPGA 4TSSA 2CH4W 3C1FA 5IGEA 3PSIA 4JI7Q 2IW3A 3HOVG 5FLXE 2K5DA 3K0XA 1U4PA 3BVGA 1O7ZA 3TEHB 1EZ6A 1JC7A 2LFNA 4K0KQ 4DAYB 4A3BH 2NVTB 4EVOA 3OTOL 4JI8Q 2Q2UA 4LF5Q 1JR0D 4C3HB 5M3MG 3L0OA 2NVYH 3J80E 4EQNA 4IFDJ 4DAPA 5EQ0A 2VZAA 3S1NB 4I65A 5C44G 4FVMA 1VQOA 1I4RA 1FGUA 1M8AA 4JVZA 2K5NA 2BH2A 3KLSA 5IOCA 1G291 3RR5A 1U5KA 1TR5A 3I70A 5ELEA 2IX1A 3KDFB 3RMHA 4NP5A 3NPPA 2WB1G 1K28A 1CFMA 3KLRA 2JSOA 1PYSB 3E0JA 1LTSD 4KKTA 1ASZA 4JI2L 1B4OA 4JOIC 4KD4A 3SDZA 2QW7A 5HGTA 5FO9B 1GO3E 1R4QB 3LWUA 1HFGA 1IW7C 3MTSA 4JI1Q 3I4NB 1STNA 3S1MB 1AEXA 1PDQA 3MXUA 1DXMA 4ID6A 5C44H 1PHJA 3I4NH 1QJOA 1Q46A 2P5ZX 4RH6A 2HDLA 2ZT9C 4BA1I 4DNTB 4GNXC 3CCEA 1RL2A 4GKKQ 5IP7G 1H9MA 1SE3A 5GAEC 1GUOA 3I4MG 2MNAA 2VQFL 2UXDL 2JQOA 1TXYA 1FD7D 4LUVA 5LL6X 1CA5A 3PCOB 5C5LA 4AYBB 3TDQA 3SHLA 1KABA 4AIMA 4DFAA 2B2YC 1LTLA 3GTPH 1C48A 4J8QA 3U58A 5JVG3 2R92B 3T1YL 5IYBH 1F2ZA 3S2HH 2WKDA 3T56B 2PZUA 2G5DA 3OWFA 2DY8A 4LF8Q 2SNMA 2E2DC 3MFGA 4ABNA 2IY5B 4IZ8A 4DK1A 2X6LA 4X64Q 3K5OA 2NTTA 4GNXA 1XMOQ 2Y0SG 2YU9H 1PRTF 1PTOC 1PH7A 2YTVA 4ZUIA 2KVMA 1A2TA 1PRTC 1PTOF 2L15A 5A35A 4RHRA 2EE1A 2DGYA 3RD4A 2FMCA 3CC2A 1FR3A 4DV2Q 1XMQQ 3MHBA 3M3YH 4LFBL 5M3FG 2RDGA 5EBDA 4ZCKA 1DOKA 5IWAQ 5J22A 4HCSA 3A8KE 4OIKA 5IYCG 2F0QA 3J81j 1MHWC 2EPBA 4N9PA 4LFCL 4C1NI 2JE6I 1I5FA 3J7AV 2GN5A 1YBYA 1IYVA 1UE6A 3X3MA 4DV7Q 2PQAB 2ICIA 2D5DA 2KJXA 1IBKQ 5IGBA 4C3JH 5EKKA 5AJ3L 3GDEA 4CGYB 4O0AA 3QJYA 3TS2A 2BA0A 4BBSB 2R7ZG 5CV5A 2BA1A 1J9OA 2IWHA 2B2TA 3K59A 4L5SA 3M4YA 1TY2A 3KBGA 4PQXA 1YJWA 4JV5Q 4E6IA 1O80A 1D5XC 4CKEA 3CCUA 4X62Q 1BBWA 3T51B 4IOAA 4CKCA 4KHPL 1RTNA 4K8IA 3RZOH 1IZ6A 5CV7A 4KY6A 5C3WA 5IP9H 1KTKA 4CHTB 1AZQA 1RCVD 1HNWQ 5CYUA 4AYBG 3OSOA 5HURA 4A3KB 1OTCA 3HOZG 4X62L 2R7DA 4LMQD 3PUYA 4C3JG 4UDUC 1JOKA 4GKJQ 3CPWA 2PYKA 2AUJD 1J8IA 1MSGA 1X56A 3BS1A 1B9MA 2WB1E 1C8CA 1JWUD 2D0OA 1K3BC 4CDCC 5JVH3 4JBMA 1K8OA 1HR0W 2BDOA 3E9HA 4DV7L 1D5ZC 2PNHA 3I7FA 2Q8RE 2UXBL 1VMCA 1WFQA 5C3EB 3D8GA 1VQNA 2ZXPA 2HDMA 5CR3A 1AW7A 4YY3Q 1YIJA 2B39A 3A8IE 3ULLA 4C3HH 4DF7A 4ZRZA 5IP9G 4WJ3M 1E1OA 2NVTH 3S17B 2K7VA 3RN5A 4UY8C 4C3IB 1HNZL 1MJCA 3PMFA 4DV2L 1XMQL 4KK7A 3HOWH 1GVPA 1LT5D 1PZKD 4NMZA 4O2DA 1OO9B 3GTQH 1YI2A 3GP7A 3IFDA 2E2IH 4O1NA 2A1AA 4B08A 1PZID 5CBAE 1SROA 1TWGH 2TSSA 1XMOL 4R4IA 4IUTA 4A3FH 1KNEA 3PQIA 2B63G 1STEA 1E2WA 4LK1C 4LF8L 3I55A 4HTHA 4O42A 1LACA 3E5SA 4KJOA 2AQ2B 2H5XA 2YU9B 1CHQD 2VS1A 4KLKA 4RAUC 2E5LQ 1PFNA 3MXNB 5FLMG 3A54A 3SK6A 4QCLA 1VQCA 4KHPQ 1VQKA 2E2JB 4C3JB 4IJLA 1VF5C 2Z8LA 2VQFQ 4QQBX 3QO2A 1TS5A 1X3EA 4GKKL 4ZQ3A 1XX8A 2HT1A 3EN2A 3HEJA 4LF6L 2IT1A 3OHXC 4BY1B 4DKAC 4A3EB 1CTMA 4DV5L 4JW0A 2F4IA 3MAQA 3VR6A 1J6QA 2I46A 2JA5B 5AJ3Q 4U68A 3HKZE 3TREA 1IBKL 1B8AA 2A68C 2RCFA 4RG1A 1NTGA 2OQKA 3MXNA 1TS2A 3NWSA 3FKIH 2J0TD 5IWAL 3E6ZX 2R7ZB 2AUKA 3GV3A 2IHEA 3U9OA 5FLMH 2CH4A 3N52A 5DM63 4F7XA 5KIXA 2Q8IB 2MQHA 4RGOS 1STHA 2CQOA 3V2TA 2DJFC 4KN4C 2F0SA 1V1QA 3NHHA 2K01A 4LJZC 4MTKA 1QE6A 2CVRA 2D9UA 3FP9A 2HUGA 5JEAH 3I91A 2JXMB 1Y1WG 1N34L 5IT9E 1F9SA 4X64L 3A5UA 5GAHC 1G51A 2J4XA 3QIAA 5C6AA 1QVGA 2PO4A 3ULPA 3AMUA 5KRUA 1Y14B 2GVBA 1A3VA 3V05A 3T1YQ 3W5OA 1Q8IA 2B3GA 4ULLA 4DR5Q 1OXSC 4XT1B 3URYA 2PZWA 4XXEA 3RZDB 2WP8J 4JI7L 2ICEC 4UHVA 3FKIB 3BDCA 2NN6G 2NVQB 4ZKCB 5C3XA 1W6JA 3FPPA 3VYUA 4Y7NH 1BOSA 2L0CA 1KNAA 4OL7A 3CF5A 3BDLA 4A4IA 2JA6G 2R93B 4K14A 1SR3A 1QG7A 3VA5A 3CCRA 4OGQC 5TSSA 1I50H 1CKNB 1EQTA 1HA5A 1SE8A 3HRZC 3K81C 3DEOA 1D6EC 3UDGA 2KHIA 1D1KA 3FVQA 5E7NA 3VA7A 4BY1H 1VQ7A 1QNUA 3GQBA 4A3MG 3MEHA 3FKIG 4DR3Q 4JOIA 2CWPA 2O5JC 1O7LA 2JA5H 4RCNA 1SN8A 4K5WA 1QUQA 5KYIA 3ZYYX 4JI2Q 1Z6HA 2VUMB 4FF3A 1I4XA 3I3CA 4R1JA 1X6OA 4A75A 1KDCA 2UUBQ 1GHKA 4DUYQ 1I4HA 1C9OA 4DR7L 2EYOA 4DK0A 5D3DA 4DXFA 1YJNA 5F2DA 1KDAA 1SAPA 2DNCA 1Q90A 2AWNA 4DR6Q 2F0OA 3I4OA 4N9TA 3J7AF 2FMMA 1K8MA 1VCIA 5I4DA 4JI4Q 1KAAA 4A3CG 1HXYD 3OOCA 1NBWA 4JI0Q 4A3IH 3K5LA 4IPHA 2E2IB 1QILA 3CPFA 1ICWA 2OTLA 4JI8L 2OT2A 3OTOQ 1TQOA 3A7AB 4A76A 5D65A 3HOWB 1B1ZA 2RSNA 4RGNA 4MIUA 3GTQB 1WTOA 1PH8A 3GTLB 3U50C 4MHEA 1WCMG 1YNJC 2KHSA 5EPJA 3CCQA 1GHJA 2OCEA 3MC0B 4NDXA 1XYIA 4I7AA 1B44D 3Q22A 2NBFA 3OMGA 3F8TA 3ERQA 5IODA 3TP7A 1H95A 4HCEA 5DLQE 4UP7A 3A7LA 3PUVA 2QF7A 4RMFA 3L7ZC 1X3QA 1BCPB 2Y0SE 4X3SA 3KF8A 1EIYB 2F4VQ 2H4OA 3F2CA 1S5FD 2Z6KA 4XT3B 3CMAA 3G6JB 1E7ZA 2VQEL 1ENCA 4WRDA 3KYHC 4C2MB 4V0BA 1XPRA 3HOXG 1U4RA 5JPNC 3AEVA 3OPOA 3PF5A 1XNRQ 3NELA 2AKWB 2G9HD 4FYDA 3E3XA 2K5QA 1HQRD 3ND9A 5AFWA 4K6LA 2DJGC 1EQQA 1SFOH 1I94Q 2HQEA 3RZOB 2R92G 2EY5A 1CUKA 1PYWD 4CDFC 1TT2A 1KHIA 1NSNS 5IYDG 4IN3A 4PZ8A 5H1SE 3QB3A 2Z0SA 1I3QH 3ERSX 1I4QA 1HZBA 1N32L 3K0YA 1S5DD 3OMCA 2JA7G 5HGQA 3HS0C 3LX0A 1WCMB 3H09A 1WTWA 5J1ZA 4F87A 1PH2A 4P74A 4G7ZC 1WOCA 1A62A 3CC7A 1HR0Q 4JI6L 3HOYG 2A74C 3H0GG 2XGTA 2KEEA 4HJ7A 3UI2A 1II3A 4DV6L 4OO1I 2PQEA 3PGZA 5I9OA 2MO1A 4A3BB 3J81c 3K7AB 3SGIA 2K5WA 3PUZA 4DNRB 2XRQD 3C1EA 5M5YB 3VYRA 3GTOH 2C5CA 2LSSA 1LO5D 5K36G 3D31A 4KY7A 3EA6A 4X3UA 1JCKB 1CK1A 2E75C 3BYYB 2WKCA 4H13C 4PG3A 4NW2A 3H3VI 1S4ZA 4LF7L 1JICA 4BXXG 2GVAA 1TWAH 4K5XA 3BYTB 4HSPA 5LMNL 2HHHQ 3S2HB 1EWHA 1VQPA 2JA8B 5CBEE 3KF6B 5I2XA 3NBHA 3J80L 1EY7A 1X3GA 2AHOB 2JEAI 1VQEA 4EGVA 1SRUA 2O5IC 1PH1A 1Y1VH 3W1GA 3S1QB 1G91A 3Q23A 2KHJA 5C44B 1M1KC 3DM3A 2R93H 2AMCB 2JA6B 4A3FB 1F9PA 1DCZA 4MTNA 2WV6D 5FK9C 5FO7B 4OEMB 1A3TA 1O7IA 5C3EG 1HHVA 3S2DB 1HQMC 1VMPA 3QR8A 1BCPC 4I7ZC 4NPSA 3M4OH 2EY2A 4X66L 1TS4A 4PZ7A 3DWAA 2F0UA 2O4XA 1WTRA 3DM1A 1RODA 4LFAL 3A55A 1PXUA 5JJLA 3KF8B 3R2TA 1YHBA 4C3IH 1FVIA 4LF4L 3QG1A 4DV3Q 1VDZA 5KYLA 1MJEA 4EX5A 5LMUQ 2F3WA 1VQDA 5E4WC 5E1FA 1PV4A 5FO8B 1A2UA 2EYPA 2A19A 1G2TA 2EDGA 3EVQA 1W6KA 4NXMQ 2AWOA 4BBRH 3S1NH 1DJRD 1YNNC 2SEBD 1U4MA 2F0EA 4M8AA 4S3SA 2PMZE 1LTGD 4ZUJA 3I56A 4A3BG 3K57A 1IW7D 5JAVA 1BVSA 1CZGA 4XQQA 3TZDA 1U4LA 3HOZB 4JBWA 4MNOA 1IL2A 2E74C 3AFPA 4XYOA 3JAMc 2UUCQ 1QUQB 1ZYRC 1Y1WH 3PO2G 2K75A 3KOJA 2R7ZH 5BR8L 4XDXA 3T16A 2A73B 4QMGA 3J81i 3QOJA 2EZVA 2KUMA 2Q2IA 3CXCA 2VY3A 1YNND 4HIDA 2SDFA 5CMDA 4B3RL 3PUWA 1UE5A 3RLOA 4LNQA 2NB0A 2R3ZA 2L11A 3GTKH 1AP0A 5FLXc 2JA8G 3TP5A 4GLAC 2E2HH 5DM73 1YJ9A 4YCUA 4BBRG 4FO2A 1UE7A 3OW2A 3K6OA 1A8VA 4FXDA 5ELNA 5M3MH 5C4JB 3H3VH 4OX9Q 1E22A 3W3AA 1QB5D 4GS3A 2WFWA 1O78A 2PW7A 1KQSA 1AFPA 1GUNA 4MZ9A 1B50A 2JA6H 4BY1G 3BG3A 1IHZA 1SNDA 1JOQA 3HOVB 2N3SA 2NUCA 5CV9A 1RF2D 2PI2A 2N8NA 4DV4Q 1BCPF 4A3GB 4GOPA 1IKMA 4A3DH 2N78A 1JQYD 2Z4HA 2M9VA 1R9TH 3MXGA 1WD0A 1BDOA 4OHJA 5FOBB 3BVZA 4DUZL 1UEAB 1UNSA 2L5TA 3STBC 3NTHA 1D5MC 1ZKOA 5FKAC 1DONA 3O13A 2RDFA 1H9JA 2PZTA 3I8ZA 2I5MX 3NUCA 2JP1A 3PO2B 4A3LH 2RBMA 4TQUS 3J7A5 1K9MC 1Y69U 1HA6A 1BXTA 4NKLA 1A0IA 3KUPA 1LTAD 1KIXA 1RJTA 2PW5A 4UAIA 3NTIA 1B3AA 2LKVA 3SK5A 1HUNA 3R8BA 1Q3LA 4A3FG 3J81E 1VQLA 1E1TA 3PIP3 1K73C 2A6ED 4DXGA 1CM9A 3R3OA 4F8MA 3H94A 1SNOA 1X54A 1Q81C 1BF4A 1N9WA 1N36Q 1LT4D 1AE2A 5T1GA 2IL8A 2RDHA 5M5XH 4UP8A 2OEOA 1EQRA 1H9KA 4FP5D 1SEBD 2F0KA 4GN4B 5KNCA 5BN4A 1RHPA 1N32Q 3D3RA 1VQ9A 3L9AX 4A3KH 2A6EC 3UDFA 4QIWE 2MO0A 1SJED 2PCFB 4L6TB 3B6YA 3NP8A 4A3DG 5GAGC 1NE3A 2Z1CA 4KMUC 1I6HH 4JK1C 3U4VA 1I94L 4AQYL 2XSCA 3D4DA 5EBCA 2ES2A 2L1BA 4DK6C 4XQJA 5EJWA 1C7YA 3BZCA 3CCLA 5LMNQ 1JE4A 2K6AA 4B3ML 2VQEQ 4FF4A 3VYSA 5IYCH 3ITPA 5CGKA 1U9RA 2VXWA 1PLFA 2F0GA 1SYFA 4LUOA 3JAMi 1A63A 2KCNA 2FHTA 2K28A 1EZ8A 5COYA 4WFN3 2KENA 1ENAA 3J80c 4K2KA 4MN3A 1BBXC 4QL5A 3DLLA 3VDYA 5E4XA 4WJWA 4YCVA 1JOOA 2EJGC 2HIXA 3SEBA 4KKUA 4DV6Q 1F9QA 5ELOA 1JWSD 3EFXD 1TWHB 3CC4A 1PA6A 2JA7H 3VR5A 2OXPA 1FNVA 4X65Q 1H9RA 2CFMA 1SE2A 3H15A 2DNEA 1IKLA 2N55A 5ELFA 3A0JA 3PO3B 3G7LA 5GROA 5M9OA 1KC8C 3P7JA 1LTBD 1Z9FA 3TBIB 1SMYC 3MFYA 2F0LA 4JI4L 3EBEA 3S17H 4ZYSA 4K5VA 3Q8DA 1HNXQ 1IBLQ 1JORA 3J7YW 3MVVA 1SLJA 3DWQA 1L0YB 1WYDA 4POFA 5EPKA 3DEPA 2G9DA 2WAQB 1SYGA 5M5WH 2B2WC 4C3HG 4B9WA 2EXDA 4HIKA 2J7ZA 4R4CA 3TP6A 4HR7B 1G2SA 2SNSA 2WAQE 4DPGA 4KD3A 2F0FA 2VL6A 1E24A 2ZJQA 1DM0B 1VQHA 3VR4A 1FNWA 4IUPA 3Q6SA 2KCMA 1VQMA 3SR1A 2F03A 2L4NA 4IO9A 4A3IG 4JPBW 1ML0D 2B2VA 4WJ4A 1NY4A 4DNIA 2PNRC 4EQPA 1D1IA 1FJGL 3ULJA 1N33Q 5GQOA 1VQ6A 3DMUA 2FJ2A 4FF2A 3NQIA 1ZEQX 1A6XA 3L3OC 3I4MH 1E2VA 1EEID 1YZ6A 3EROA 3HP3A 4FDBA 5LL6S 4CDDC 1XNQQ 3S15B 1PFBA 5C0XG 2XWJB 4QUCA 3HOYB 4R8NA 1X3FA 3D6WA 4L8JA 3J7ZC 2X6GA 4A93G 4RGMA 1EWCA 2NYZD 3KFUA 2D0PA 1EY6A 3HG9A 4CJ2C 2L9HA 1JB7A 1Y8PB 4BS9A 1VQ5A 1NCVA 1VQ8A 4HMIA 1R4PB 2HCIA 1AZPA 4DR6L 4G7OC 4UP9A 1GUSA 2WAQG 1PH3A 1C0AA 1V1OA 4A93B 1Q82C 3PO2H 2UU9Q 2K05A 4HMJA 2KBNA 5C0XH 1JJGA 5LHY1
chains in the Genus database with same CATH topology
3KF6A 1J5EQ 1TWHH 1S3OA 1EYGA 1I3QH 2WB1G 3GTGH 3ERSX 1N32L 1HZBA 1PYSB 1ASZA 4JI2L 4NXNQ 1CKNA 4H02A 4JOIC 1VQ4A 1JJ2A 2JA7G 5HGQA 1KRSA 4IPCA 2JA8H 1QZHA 1GO3E 3GTJH 1PH2A 1M90C 4P74A 2PQAA 4HIMA 1WOCA 1EFWA 4JI1Q 1A62A 1WCMH 2R92H 3CC7A 2YTYA 1HR0Q 4JI6L 3HOYG 3H0GG 2XGTA 4DV5Q 4LF9L 1W3SA 1LM0A 3ER0A 5C44H 4HJ7A 1IBML 2XTIA 1PHJA 4DK3C 3HKZG 4DV6L 4DR1Q 1Q46A 3AFQA 4ALPA 3T1HQ 1Q7YC 4OO1I 3PO3G 3PGZA 4BA1I 4GNXC 3CCEA 1RL2A 3HOVH 2MO1A 4GKKQ 3J81c 3SGIA 3NBHB 5IP7G 1P16A 3PUZA 5GAEC 3I4MG 2MNAA 2VQFL 2UXDL 4JI5Q 2JQOA 1Q1EA 1TXYA 4LUVA 1KD1C 1KAWA 3GTOH 3PCOB 2QGQA 1ASYA 2LSSA 3M9BA 5K36G 4GN5A 3D31A 2QEXA 3M4QA 3A5ZB 5C3EH 5C4JH 4AIMA 1PH4A 2B29A 2YYZA 4DR5L 3HKSA 1YJ9A 1LTLA 3GTPH 3U58A 4PG3A 3RZDH 4BY7G 1JJGA 3H3VI 3T1YL 4A93H 4LF7L 5IYBH 3S2HH 2HQLA 4BXXG 1B70B 1D8LA 2GVAA 1TWAH 4B3MQ 4LF8Q 2HHHQ 5LMNL 2IY5B 1UWVA 4IOCA 4X64Q 5IP7H 4GNXA 1VQPA 1XMOQ 1N34Q 2RHSB 2Y0SG 1K8GA 3KF6B 2YU9H 1PH7A 2YTVA 1VQJA 5LMNW 4AQYQ 1X3GA 2AHOB 2L15A 2ZTEA 3WWVA 2JEAI 3S1QH 1VQEA 1SRUA 4DV4L 2DGYA 1Y1VH 1PH1A 3W1GA 2IX0A 1SMXA 1T9HA 2F3IA 4P75A 3UDIA 3CCMA 1HZAA 4DV2Q 1XMQQ 2KHJA 3CC2A 2ATWA 3M3YH 5M3FG 1HNZQ 1M1KC 4LFBL 3DM3A 4P71A 2R93H 2AMCB 1HJPA 4JBJA 5EAYA 4NB3A 1YNXA 4MTNA 2V1CC 3BZKA 1O7IA 5C3EG 4JI3Q 4NPSA 2Q2TA 5IWAQ 1PH6A 3M4OH 5IYCG 5JJKA 3J81j 4X66L 4YY3L 4PZ7A 1EIFA 4QY7A 4LFCL 4B3SL 1HH2P 2JE6I 1I5FA 4LFAL 1JT8A 4TVAB 2UXBQ 4YCWA 2GN5A 1YBYA 5JJLA 2DUDA 3KF8B 1UE6A 2ZM6L 4DV7Q 2E2JH 2PQAB 1YHBA 4C3IH 1IBKQ 1FVIA 3CQZH 4LF4L 4DV3Q 4OONA 4C3JH 3NEMA 3GDEA 5AJ3L 1N36L 1GM5A 1MJEA 1VQBA 4O0AA 4JBKA 1L2FA 4DR4Q 4EX5A 5LMUQ 1S40A 1VQDA 2VUMG 3PF4A 3TS2A 1Z47A 2BA0A 1PV4A 2R7ZG 4L5RC 2MFIA 2BA1A 3RLNA 3CCSA 2UUAL 4L5SA 4DV1L 4B3RQ 2A19A 4DV0L 2A8VA 1YJWA 4LF6Q 4DR2Q 4JV5Q 4NXMQ 3S24A 2AWOA 3CCUA 4X62Q 4BBRH 3HOXH 3S1NH 3KDFA 1BBWA 5BR8Q 1KXLA 4IOAA 5C4XG 3S2DH 2D62A 4P72A 4JG2A 2PMZE 4KHPL 3I56A 2UUCL 4A3BG 1YHAA 1PH5A 4JCVE 3RZOH 1IZ6A 1E3PA 2CKZB 3G4SA 1N8RC 1BVSA 3E0EA 2RHQB 2E5LL 4BXXH 1K0RA 5IP9H 4KI0A 1YHQA 4JBWA 4MNOA 1L1OB 2K4KA 1IL2A 4HIOA 1JJCB 3AFPA 1HNWQ 3JAMc 2UUCQ 4IFDI 1QUQB 3M7NA 4AYBG 1PFSA 4OXPA 4HJ5A 4P73A 1Y1WH 1OTCA 3PO2G 4A3GH 2K75A 3KOJA 2R7ZH 5BR8L 3EIVA 3GD7A 3HOZG 3KJOA 4X62L 1L1OA 2R7DA 3J81i 1IYJB 3PUYA 3HOWG 4NXML 2Q2IA 3CXCA 4BBSH 4DR2L 2VY3A 4HIDA 4GKJQ 3CPWA 4DUZQ 4DV0Q 1YITA 4B3RL 3PUWA 1S72A 2UUAQ 1X56A 2RF4A 1UE5A 3RLOA 4LNQA 2WB1E 1VQFA 2D0OA 4YWLA 3GTKH 4DR4L 5FLXc 4DV3L 4JBMA 2JA8G 4GLAC 2E2HH 1HR0W 4GLXA 2CWAA 3E9HA 4DV7L 4YCUA 4BBRG 2NZHA 2PNHA 3I7FA 4HJ8A 3RNUA 2ALYB 1XJVA 1UE7A 3G71A 3OW2A 2UXBL 1A8VA 1WFQA 5ELNA 5M3MH 3H3VH 4PMWA 4LFCQ 1VQNA 4OX9Q 1K8AC 4X6AH 2K14A 5JEAJ 1E22A 4GS3A 4YY3Q 1YIJA 2WFWA 1KQSA 4B3TL 4MZ9A 1GD7A 4C3HH 3ULLA 3W1BA 4BY1G 5IP9G 1BBUA 3ZJYC 2JA6H 4WJ3M 1E1OA 1L1OC 2NVTH 1WJJA 1PVOA 1VQAA 4QJFA 3RN5A 4B3TQ 4UY8C 1W2BA 4OX9L 2I5HA 2N3SA 1HNZL 1MJCA 4KHZA 4DV2L 1XMQL 3HOWH 1G6PA 1GVPA 4XTCS 2PI2A 2N8NA 4A3JG 4O2DA 4DV4Q 4GOPA 1OXXK 3UE0A 3D0FA 3GTQH 1YI2A 4A3DH 4OO1G 2E2IH 2N78A 4GLVB 2A1AA 2R6GA 3KJPA 1R9TH 1CSPA 4BY7H 1SROA 2NVQH 1TWGH 1XMOL 4R4IA 1KRTA 3FHWA 4DUZL 1NJIC 4GKJL 4AYBE 4A3FH 1YEZA 2B63G 1JE5A 3BU2A 4L5TA 3STBC 4LF8L 1IXRA 3AYHB 3I55A 1MIUA 4LF7Q 3CP0A 5IT9c 3PIPA 1GKHA 1RIPA 3OYYA 4GN3B 4OWXB 1HNWL 2I5MX 3GTLH 2K5HA 1Q86C 2H5XA 4XIGS 2VS1A 4KLKA 2E5LQ 4A3LH 4TQUS 3J7A5 2JEBI 3MXNB 3TS0A 1K9MC 5FLMG 3CD6A 1VQCA 2ZJRA 4KHPQ 1VQKA 2LXKA 1A0IA 4IJLA 3UDXA 1LUZA 2EQSA 4AH6A 2VQFQ 1KIXA 4QQBX 2OTJA 3M85A 3G6EA 1X3EA 4L5QA 2ZTCA 1QZGA 4GKKL 2HT1A 2NN6I 3EN2A 4JV5L 4A3FG 4LF6L 2IT1A 2FXQA 1VQLA 3T1HL 1E1TA 3TRZA 4DV1Q 1K73C 1CKOA 4DKAC 4DV5L 1EUJA 5LMUL 1J6QA 2K50A 1X54A 1Q81C 1N9WA 1N36Q 5M5YH 5AJ3Q 2B63H 3TREA 3HKZE 4LF4Q 1AE2A 1KL9A 3K7UC 1CKMA 3U4ZA 1B8AA 2QA4A 1PH9A 1IBKL 5M5XH 4UP8A 1X55A 1EQRA 2ZM6Q 2ID0A 2YV5A 2JA9A 3CW2C 4LFAQ 4RG1A 1NTGA 4B3SQ 4IFDG 4R4TA 4GN4B 3KDFB 2OQKA 4X66Q 5IYDH 1QVCA 3FKIH 1N32Q 3UE1A 5IWAL 1VQ9A 4APVA 3F2BA 3G48A 5IY0A 4A3KH 4JI3L 2IHEA 5FLMH 1J5EL 3UDFA 4POGA 4QIWE 2VUMH 2MO0A 4JYAQ 3B6YA 4A3DG 2MQHA 2N49A 1OXUA 2CQOA 5IE8A 3HFZB 5M3FH 4A3EH 4LFBQ 5GAGC 2R7FA 4GNXB 1NE3A 3LGJA 4OWTB 4A3JH 1VS0A 3CCJA 1V1QA 1I6HH 1Y1VG 3U4VA 1I94L 4DAMA 5JJIA 4AQYL 3M4PA 3FP9A 1Q8KA 2BH8A 2ES2A 4DK6C 2ASBA 3PV0A 2JK8A 1Y1WG 1C7YA 1Q1BA 1XNRL 3BZCA 1N34L 4A3GG 4X64L 3A5UA 3CCLA 1B7YB 2Z6KC 5LMNQ 1NMGA 1G51A 5GAHC 1QVGA 2HHHL 2F52A 4B3ML 5HY6A 2VQEQ 1OXTA 3ULPA 1UE1A 5IYCH 5C0XJ 1VQGA 3RN2A 4OWWB 1Y14B 4K0KL 2NVXH 2GVBA 3T1YQ 2OWOA 2UXCQ 3K7AH 4LUOA 4HJ9A 3JAMi 3W5OA 1A63A 2B3GA 4DR5Q 4A3EG 1AE3A 1OXSC 2PI2E 4A3MH 2K5VA 4A3LG 1LYLA 3S1MH 2WP8J 2KENA 4JI7L 1XTDA 1QVFA 2NN6G 1DGSA 3J80c 4QGUA 4JI5L 2UXDQ 1TWFH 2E8GA 4Y7NH 4QL5A 3F1ZA 3DLLA 2CCZA 3VDYA 3STBD 1FJGQ 3CF5A 1N33L 4YCVA 4A4IA 2JA6G 3PIOA 1XPOA 1SR3A 2HIXA 3K8AA 3BJUA 4DR1L 3CCRA 3A74A 4DV6Q 1EOVA 5ELOA 1I50H 5C4XH 1IBMQ 4LF9Q 1CKNB 1SE8A 3K81C 5IYBG 1PA6A 3CC4A 2JA7H 4IPDA 4JI6Q 3HOYH 1HR0L 3J80i 3UDGA 2KHIA 5E7NA 4GOPC 4BY1H 4A3CH 4JI1L 1VQ7A 4X65Q 1AH9A 3HOZH 2CFMA 4A3MG 3H15A 1FL0A 3FKIG 4JOIA 4DR3Q 2CWPA 1XPUA 3I2ZA 2JA5H 5GADC 3RLFA 2YTXA 1SN8A 3A0JA 3H0GH 1HZ9A 1HZCA 1QUQA 4NXNL 2K52A 5GROA 4JI2Q 5FJ8H 3L2PA 1KC8C 4R1JA 4LWCA 1Z9FA 1K83H 4YWKA 1X6OA 4R4OA 3TQYA 4A75A 3S1RH 2UUBQ 4DUYQ 1X65A 1V43A 1C9OA 4JI0L 4LW1A 4EQ5A 4JC0A 4DR7L 4ME3A 2UU9L 1MKHA 4JI4L 3EBEA 2Q2HA 4C2MH 3S17H 5JEAG 4HJAA 1YJNA 3PUXA 2I0QA 3Q8DA 4J15A 1HNXQ 1WI5A 1IBLQ 5J3BA 2IHFA 1CSQA 2C35B 2NZOA 4YWMA 1VQIA 1L0WA 5C0XI 1OXVA 1NMFA 2AWNA 4DR6Q 3I4OA 3CMEA 1SLJA 1VCIA 1YVCA 2ZTDA 1WYDA 4R4QA 4POFA 3E9IA 4UPAA 4JI4Q 4A3CG 1JMCA 1PYBA 4DR7Q 1NBWA 5M5WH 4A3IH 4JI0Q 1D7QA 4IPHA 4DUYL 3CPFA 2UUBL 2OTLA 2EXDA 4HIKA 3MEFA 4LF5L 4JI8L 3OTOQ 4R4CA 1V9PA 4A76A 4IJHA 1BKBA 3HOUG 2JJQA 5FJ8G 4YHHL 3JC66 2WAQE 4DPGA 1K3RA 2F4VL 2VL6A 1E24A 1PH8A 3F2DA 2ZJQA 2LXJA 1VQHA 3ICEA 4DR3L 1X9NA 3U50C 4X65L 1XNQL 2HIVA 1WCMG 3S15H 2KCMA 4PZ6A 3CCQA 2R93G 3I4NH 2OCEA 1VQMA 2EIFA 4IO9A 3GO5A 4A3IG 3I4NG 1TWCH 2VNUD 3S16H 1NY4A 4DNIA 2VW9A 4WJ4A 4BBSG 1P8LA 3ULJA 1FJGL 1N33Q 5GQOA 1VQ6A 2I5LX 2JA5G 4Y52H 3F8TA 1U0LA 4IPGA 3I4MH 1YZ6A 4FDBA 1H95A 1XNQQ 3PSIA 5DLQE 4JI7Q 3HOVG 4UP7A 3CCVA 3S14H 5C0XG 3PUVA 3K0XA 4RMFA 3HOUH 3L7ZC 2Y0SE 1EIYB 2OQ0A 1X3FA 2F4VQ 3F2CA 4YHHQ 2ZJPA 3TEHB 1UEBA 2Z6KA 3J7ZC 3CMAA 2RCNA 1EWIA 4K0KQ 4DAYB 4A93G 1E7ZA 2UXCL 4LUZA 1Q12A 2KCTA 3NENA 2VQEL 4A3BH 3OTOL 3KYHC 4JI8Q 2Q2UA 4LF5Q 3KFUA 2D0PA 1XPRA 5M3MG 3HOXG 3L0OA 1JB7A 3AEVA 3PF5A 1VQ5A 2NVYH 1XNRQ 3NELA 4IFDJ 2AKWB 4GOPB 2VZAA 1VQ8A 5C44G 1EQQA 4DR6L 1SFOH 1I94Q 1VQOA 3GTMH 1FGUA 4UP9A 2WAQG 3PO3H 2K5NA 1PH3A 2BH2A 4A3KG 3AQQA 1HNXL 3CAMA 1IBLL 3KLWA 2R92G 1CUKA 1G291 3K80C 3RR5A 1C0AA 1U5KA 1KHIA 1Q82C 3IRBA 3PO2H 5IYDG 4PZ8A 2UU9Q 5H1SE 4JYAL 4BA2I 2IX1A 2KBNA 2Z0SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KF6 A;  1J5E Q;  1TWH H;  1S3O A;  1EYG A;  1I3Q H;  2WB1 G;  3GTG H;  3ERS X;  1N32 L;  1HZB A;  1PYS B;  1ASZ A;  4JI2 L;  4NXN Q;  1CKN A;  4H02 A;  4JOI C;  1VQ4 A;  1JJ2 A;  2JA7 G;  5HGQ A;  1KRS A;  4IPC A;  2JA8 H;  1QZH A;  1GO3 E;  3GTJ H;  1PH2 A;  1M90 C;  4P74 A;  2PQA A;  4HIM A;  1WOC A;  1EFW A;  4JI1 Q;  1A62 A;  1WCM H;  2R92 H;  3CC7 A;  2YTY A;  1HR0 Q;  4JI6 L;  3HOY G;  3H0G G;  2XGT A;  4DV5 Q;  4LF9 L;  1W3S A;  1LM0 A;  3ER0 A;  5C44 H;  4HJ7 A;  1IBM L;  2XTI A;  1PHJ A;  4DK3 C;  3HKZ G;  4DV6 L;  4DR1 Q;  1Q46 A;  3AFQ A;  4ALP A;  3T1H Q;  1Q7Y C;  4OO1 I;  3PO3 G;  3PGZ A;  4BA1 I;  4GNX C;  3CCE A;  1RL2 A;  3HOV H;  2MO1 A;  4GKK Q;  3J81 c;  3SGI A;  3NBH B;  5IP7 G;  1P16 A;  3PUZ A;  5GAE C;  3I4M G;  2MNA A;  2VQF L;  2UXD L;  4JI5 Q;  2JQO A;  1Q1E A;  1TXY A;  4LUV A;  1KD1 C;  1KAW A;  3GTO H;  3PCO B;  2QGQ A;  1ASY A;  2LSS A;  3M9B A;  5K36 G;  4GN5 A;  3D31 A;  2QEX A;  3M4Q A;  3A5Z B;  5C3E H;  5C4J H;  4AIM A;  1PH4 A;  2B29 A;  2YYZ A;  4DR5 L;  3HKS A;  1YJ9 A;  1LTL A;  3GTP H;  3U58 A;  4PG3 A;  3RZD H;  4BY7 G;  1JJG A;  3H3V I;  3T1Y L;  4A93 H;  4LF7 L;  5IYB H;  3S2H H;  2HQL A;  4BXX G;  1B70 B;  1D8L A;  2GVA A;  1TWA H;  4B3M Q;  4LF8 Q;  2HHH Q;  5LMN L;  2IY5 B;  1UWV A;  4IOC A;  4X64 Q;  5IP7 H;  4GNX A;  1VQP A;  1XMO Q;  1N34 Q;  2RHS B;  2Y0S G;  1K8G A;  3KF6 B;  2YU9 H;  1PH7 A;  2YTV A;  1VQJ A;  5LMN W;  4AQY Q;  1X3G A;  2AHO B;  2L15 A;  2ZTE A;  3WWV A;  2JEA I;  3S1Q H;  1VQE A;  1SRU A;  4DV4 L;  2DGY A;  1Y1V H;  1PH1 A;  3W1G A;  2IX0 A;  1SMX A;  1T9H A;  2F3I A;  4P75 A;  3UDI A;  3CCM A;  1HZA A;  4DV2 Q;  1XMQ Q;  2KHJ A;  3CC2 A;  2ATW A;  3M3Y H;  5M3F G;  1HNZ Q;  1M1K C;  4LFB L;  3DM3 A;  4P71 A;  2R93 H;  2AMC B;  1HJP A;  4JBJ A;  5EAY A;  4NB3 A;  1YNX A;  4MTN A;  2V1C C;  3BZK A;  1O7I A;  5C3E G;  4JI3 Q;  4NPS A;  2Q2T A;  5IWA Q;  1PH6 A;  3M4O H;  5IYC G;  5JJK A;  3J81 j;  4X66 L;  4YY3 L;  4PZ7 A;  1EIF A;  4QY7 A;  4LFC L;  4B3S L;  1HH2 P;  2JE6 I;  1I5F A;  4LFA L;  1JT8 A;  4TVA B;  2UXB Q;  4YCW A;  2GN5 A;  1YBY A;  5JJL A;  2DUD A;  3KF8 B;  1UE6 A;  2ZM6 L;  4DV7 Q;  2E2J H;  2PQA B;  1YHB A;  4C3I H;  1IBK Q;  1FVI A;  3CQZ H;  4LF4 L;  4DV3 Q;  4OON A;  4C3J H;  3NEM A;  3GDE A;  5AJ3 L;  1N36 L;  1GM5 A;  1MJE A;  1VQB A;  4O0A A;  4JBK A;  1L2F A;  4DR4 Q;  4EX5 A;  5LMU Q;  1S40 A;  1VQD A;  2VUM G;  3PF4 A;  3TS2 A;  1Z47 A;  2BA0 A;  1PV4 A;  2R7Z G;  4L5R C;  2MFI A;  2BA1 A;  3RLN A;  3CCS A;  2UUA L;  4L5S A;  4DV1 L;  4B3R Q;  2A19 A;  4DV0 L;  2A8V A;  1YJW A;  4LF6 Q;  4DR2 Q;  4JV5 Q;  4NXM Q;  3S24 A;  2AWO A;  3CCU A;  4X62 Q;  4BBR H;  3HOX H;  3S1N H;  3KDF A;  1BBW A;  5BR8 Q;  1KXL A;  4IOA A;  5C4X G;  3S2D H;  2D62 A;  4P72 A;  4JG2 A;  2PMZ E;  4KHP L;  3I56 A;  2UUC L;  4A3B G;  1YHA A;  1PH5 A;  4JCV E;  3RZO H;  1IZ6 A;  1E3P A;  2CKZ B;  3G4S A;  1N8R C;  1BVS A;  3E0E A;  2RHQ B;  2E5L L;  4BXX H;  1K0R A;  5IP9 H;  4KI0 A;  1YHQ A;  4JBW A;  4MNO A;  1L1O B;  2K4K A;  1IL2 A;  4HIO A;  1JJC B;  3AFP A;  1HNW Q;  3JAM c;  2UUC Q;  4IFD I;  1QUQ B;  3M7N A;  4AYB G;  1PFS A;  4OXP A;  4HJ5 A;  4P73 A;  1Y1W H;  1OTC A;  3PO2 G;  4A3G H;  2K75 A;  3KOJ A;  2R7Z H;  5BR8 L;  3EIV A;  3GD7 A;  3HOZ G;  3KJO A;  4X62 L;  1L1O A;  2R7D A;  3J81 i;  1IYJ B;  3PUY A;  3HOW G;  4NXM L;  2Q2I A;  3CXC A;  4BBS H;  4DR2 L;  2VY3 A;  4HID A;  4GKJ Q;  3CPW A;  4DUZ Q;  4DV0 Q;  1YIT A;  4B3R L;  3PUW A;  1S72 A;  2UUA Q;  1X56 A;  2RF4 A;  1UE5 A;  3RLO A;  4LNQ A;  2WB1 E;  1VQF A;  2D0O A;  4YWL A;  3GTK H;  4DR4 L;  5FLX c;  4DV3 L;  4JBM A;  2JA8 G;  4GLA C;  2E2H H;  1HR0 W;  4GLX A;  2CWA A;  3E9H A;  4DV7 L;  4YCU A;  4BBR G;  2NZH A;  2PNH A;  3I7F A;  4HJ8 A;  3RNU A;  2ALY B;  1XJV A;  1UE7 A;  3G71 A;  3OW2 A;  2UXB L;  1A8V A;  1WFQ A;  5ELN A;  5M3M H;  3H3V H;  4PMW A;  4LFC Q;  1VQN A;  4OX9 Q;  1K8A C;  4X6A H;  2K14 A;  5JEA J;  1E22 A;  4GS3 A;  4YY3 Q;  1YIJ A;  2WFW A;  1KQS A;  4B3T L;  4MZ9 A;  1GD7 A;  4C3H H;  3ULL A;  3W1B A;  4BY1 G;  5IP9 G;  1BBU A;  3ZJY C;  2JA6 H;  4WJ3 M;  1E1O A;  1L1O C;  2NVT H;  1WJJ A;  1PVO A;  1VQA A;  4QJF A;  3RN5 A;  4B3T Q;  4UY8 C;  1W2B A;  4OX9 L;  2I5H A;  2N3S A;  1HNZ L;  1MJC A;  4KHZ A;  4DV2 L;  1XMQ L;  3HOW H;  1G6P A;  1GVP A;  4XTC S;  2PI2 A;  2N8N A;  4A3J G;  4O2D A;  4DV4 Q;  4GOP A;  1OXX K;  3UE0 A;  3D0F A;  3GTQ H;  1YI2 A;  4A3D H;  4OO1 G;  2E2I H;  2N78 A;  4GLV B;  2A1A A;  2R6G A;  3KJP A;  1R9T H;  1CSP A;  4BY7 H;  1SRO A;  2NVQ H;  1TWG H;  1XMO L;  4R4I A;  1KRT A;  3FHW A;  4DUZ L;  1NJI C;  4GKJ L;  4AYB E;  4A3F H;  1YEZ A;  2B63 G;  1JE5 A;  3BU2 A;  4L5T A;  3STB C;  4LF8 L;  1IXR A;  3AYH B;  3I55 A;  1MIU A;  4LF7 Q;  3CP0 A;  5IT9 c;  3PIP A;  1GKH A;  1RIP A;  3OYY A;  4GN3 B;  4OWX B;  1HNW L;  2I5M X;  3GTL H;  2K5H A;  1Q86 C;  2H5X A;  4XIG S;  2VS1 A;  4KLK A;  2E5L Q;  4A3L H;  4TQU S;  3J7A 5;  2JEB I;  3MXN B;  3TS0 A;  1K9M C;  5FLM G;  3CD6 A;  1VQC A;  2ZJR A;  4KHP Q;  1VQK A;  2LXK A;  1A0I A;  4IJL A;  3UDX A;  1LUZ A;  2EQS A;  4AH6 A;  2VQF Q;  1KIX A;  4QQB X;  2OTJ A;  3M85 A;  3G6E A;  1X3E A;  4L5Q A;  2ZTC A;  1QZG A;  4GKK L;  2HT1 A;  2NN6 I;  3EN2 A;  4JV5 L;  4A3F G;  4LF6 L;  2IT1 A;  2FXQ A;  1VQL A;  3T1H L;  1E1T A;  3TRZ A;  4DV1 Q;  1K73 C;  1CKO A;  4DKA C;  4DV5 L;  1EUJ A;  5LMU L;  1J6Q A;  2K50 A;  1X54 A;  1Q81 C;  1N9W A;  1N36 Q;  5M5Y H;  5AJ3 Q;  2B63 H;  3TRE A;  3HKZ E;  4LF4 Q;  1AE2 A;  1KL9 A;  3K7U C;  1CKM A;  3U4Z A;  1B8A A;  2QA4 A;  1PH9 A;  1IBK L;  5M5X H;  4UP8 A;  1X55 A;  1EQR A;  2ZM6 Q;  2ID0 A;  2YV5 A;  2JA9 A;  3CW2 C;  4LFA Q;  4RG1 A;  1NTG A;  4B3S Q;  4IFD G;  4R4T A;  4GN4 B;  3KDF B;  2OQK A;  4X66 Q;  5IYD H;  1QVC A;  3FKI H;  1N32 Q;  3UE1 A;  5IWA L;  1VQ9 A;  4APV A;  3F2B A;  3G48 A;  5IY0 A;  4A3K H;  4JI3 L;  2IHE A;  5FLM H;  1J5E L;  3UDF A;  4POG A;  4QIW E;  2VUM H;  2MO0 A;  4JYA Q;  3B6Y A;  4A3D G;  2MQH A;  2N49 A;  1OXU A;  2CQO A;  5IE8 A;  3HFZ B;  5M3F H;  4A3E H;  4LFB Q;  5GAG C;  2R7F A;  4GNX B;  1NE3 A;  3LGJ A;  4OWT B;  4A3J H;  1VS0 A;  3CCJ A;  1V1Q A;  1I6H H;  1Y1V G;  3U4V A;  1I94 L;  4DAM A;  5JJI A;  4AQY L;  3M4P A;  3FP9 A;  1Q8K A;  2BH8 A;  2ES2 A;  4DK6 C;  2ASB A;  3PV0 A;  2JK8 A;  1Y1W G;  1C7Y A;  1Q1B A;  1XNR L;  3BZC A;  1N34 L;  4A3G G;  4X64 L;  3A5U A;  3CCL A;  1B7Y B;  2Z6K C;  5LMN Q;  1NMG A;  1G51 A;  5GAH C;  1QVG A;  2HHH L;  2F52 A;  4B3M L;  5HY6 A;  2VQE Q;  1OXT A;  3ULP A;  1UE1 A;  5IYC H;  5C0X J;  1VQG A;  3RN2 A;  4OWW B;  1Y14 B;  4K0K L;  2NVX H;  2GVB A;  3T1Y Q;  2OWO A;  2UXC Q;  3K7A H;  4LUO A;  4HJ9 A;  3JAM i;  3W5O A;  1A63 A;  2B3G A;  4DR5 Q;  4A3E G;  1AE3 A;  1OXS C;  2PI2 E;  4A3M H;  2K5V A;  4A3L G;  1LYL A;  3S1M H;  2WP8 J;  2KEN A;  4JI7 L;  1XTD A;  1QVF A;  2NN6 G;  1DGS A;  3J80 c;  4QGU A;  4JI5 L;  2UXD Q;  1TWF H;  2E8G A;  4Y7N H;  4QL5 A;  3F1Z A;  3DLL A;  2CCZ A;  3VDY A;  3STB D;  1FJG Q;  3CF5 A;  1N33 L;  4YCV A;  4A4I A;  2JA6 G;  3PIO A;  1XPO A;  1SR3 A;  2HIX A;  3K8A A;  3BJU A;  4DR1 L;  3CCR A;  3A74 A;  4DV6 Q;  1EOV A;  5ELO A;  1I50 H;  5C4X H;  1IBM Q;  4LF9 Q;  1CKN B;  1SE8 A;  3K81 C;  5IYB G;  1PA6 A;  3CC4 A;  2JA7 H;  4IPD A;  4JI6 Q;  3HOY H;  1HR0 L;  3J80 i;  3UDG A;  2KHI A;  5E7N A;  4GOP C;  4BY1 H;  4A3C H;  4JI1 L;  1VQ7 A;  4X65 Q;  1AH9 A;  3HOZ H;  2CFM A;  4A3M G;  3H15 A;  1FL0 A;  3FKI G;  4JOI A;  4DR3 Q;  2CWP A;  1XPU A;  3I2Z A;  2JA5 H;  5GAD C;  3RLF A;  2YTX A;  1SN8 A;  3A0J A;  3H0G H;  1HZ9 A;  1HZC A;  1QUQ A;  4NXN L;  2K52 A;  5GRO A;  4JI2 Q;  5FJ8 H;  3L2P A;  1KC8 C;  4R1J A;  4LWC A;  1Z9F A;  1K83 H;  4YWK A;  1X6O A;  4R4O A;  3TQY A;  4A75 A;  3S1R H;  2UUB Q;  4DUY Q;  1X65 A;  1V43 A;  1C9O A;  4JI0 L;  4LW1 A;  4EQ5 A;  4JC0 A;  4DR7 L;  4ME3 A;  2UU9 L;  1MKH A;  4JI4 L;  3EBE A;  2Q2H A;  4C2M H;  3S17 H;  5JEA G;  4HJA A;  1YJN A;  3PUX A;  2I0Q A;  3Q8D A;  4J15 A;  1HNX Q;  1WI5 A;  1IBL Q;  5J3B A;  2IHF A;  1CSQ A;  2C35 B;  2NZO A;  4YWM A;  1VQI A;  1L0W A;  5C0X I;  1OXV A;  1NMF A;  2AWN A;  4DR6 Q;  3I4O A;  3CME A;  1SLJ A;  1VCI A;  1YVC A;  2ZTD A;  1WYD A;  4R4Q A;  4POF A;  3E9I A;  4UPA A;  4JI4 Q;  4A3C G;  1JMC A;  1PYB A;  4DR7 Q;  1NBW A;  5M5W H;  4A3I H;  4JI0 Q;  1D7Q A;  4IPH A;  4DUY L;  3CPF A;  2UUB L;  2OTL A;  2EXD A;  4HIK A;  3MEF A;  4LF5 L;  4JI8 L;  3OTO Q;  4R4C A;  1V9P A;  4A76 A;  4IJH A;  1BKB A;  3HOU G;  2JJQ A;  5FJ8 G;  4YHH L;  3JC6 6;  2WAQ E;  4DPG A;  1K3R A;  2F4V L;  2VL6 A;  1E24 A;  1PH8 A;  3F2D A;  2ZJQ A;  2LXJ A;  1VQH A;  3ICE A;  4DR3 L;  1X9N A;  3U50 C;  4X65 L;  1XNQ L;  2HIV A;  1WCM G;  3S15 H;  2KCM A;  4PZ6 A;  3CCQ A;  2R93 G;  3I4N H;  2OCE A;  1VQM A;  2EIF A;  4IO9 A;  3GO5 A;  4A3I G;  3I4N G;  1TWC H;  2VNU D;  3S16 H;  1NY4 A;  4DNI A;  2VW9 A;  4WJ4 A;  4BBS G;  1P8L A;  3ULJ A;  1FJG L;  1N33 Q;  5GQO A;  1VQ6 A;  2I5L X;  2JA5 G;  4Y52 H;  3F8T A;  1U0L A;  4IPG A;  3I4M H;  1YZ6 A;  4FDB A;  1H95 A;  1XNQ Q;  3PSI A;  5DLQ E;  4JI7 Q;  3HOV G;  4UP7 A;  3CCV A;  3S14 H;  5C0X G;  3PUV A;  3K0X A;  4RMF A;  3HOU H;  3L7Z C;  2Y0S E;  1EIY B;  2OQ0 A;  1X3F A;  2F4V Q;  3F2C A;  4YHH Q;  2ZJP A;  3TEH B;  1UEB A;  2Z6K A;  3J7Z C;  3CMA A;  2RCN A;  1EWI A;  4K0K Q;  4DAY B;  4A93 G;  1E7Z A;  2UXC L;  4LUZ A;  1Q12 A;  2KCT A;  3NEN A;  2VQE L;  4A3B H;  3OTO L;  3KYH C;  4JI8 Q;  2Q2U A;  4LF5 Q;  3KFU A;  2D0P A;  1XPR A;  5M3M G;  3HOX G;  3L0O A;  1JB7 A;  3AEV A;  3PF5 A;  1VQ5 A;  2NVY H;  1XNR Q;  3NEL A;  4IFD J;  2AKW B;  4GOP B;  2VZA A;  1VQ8 A;  5C44 G;  1EQQ A;  4DR6 L;  1SFO H;  1I94 Q;  1VQO A;  3GTM H;  1FGU A;  4UP9 A;  2WAQ G;  3PO3 H;  2K5N A;  1PH3 A;  2BH2 A;  4A3K G;  3AQQ A;  1HNX L;  3CAM A;  1IBL L;  3KLW A;  2R92 G;  1CUK A;  1G29 1;  3K80 C;  3RR5 A;  1C0A A;  1U5K A;  1KHI A;  1Q82 C;  3IRB A;  3PO2 H;  5IYD G;  4PZ8 A;  2UU9 Q;  5H1S E;  4JYA L;  4BA2 I;  2IX1 A;  2KBN A;  2Z0S A; 
#chains in the Genus database with same CATH topology
 4ZKB B;  1EYA A;  3KF6 A;  3GTG B;  1KLU D;  1ZXT A;  1LTT D;  1STA A;  1TWH H;  3AB9 A;  4KN7 C;  5FLX L;  2KCC A;  4ILW A;  2BDN A;  4HN7 A;  4NXN Q;  4OEL B;  1HPC A;  2CW0 D;  2JA8 H;  4FNF A;  1QZH A;  3GTJ H;  2MGS A;  1M90 C;  2F3V A;  5M3F B;  2PQA A;  4IUV A;  1EFW A;  3GTJ B;  3P75 A;  4IUQ A;  1EFI D;  2R92 H;  2YTY A;  4DV5 Q;  1IBM L;  1LM0 A;  4DK3 C;  3HKZ G;  3AFQ A;  4ALP A;  1QNK A;  4Z9C B;  3HOV H;  3R93 A;  2HD3 A;  2MJ8 A;  3A56 A;  1SNP A;  2EYF A;  3NBI A;  3OW7 A;  3GTO B;  4KTA A;  4JI5 Q;  2B63 B;  1Q1E A;  2B2U A;  4FXG C;  1EY0 A;  1ASY A;  3M4Q A;  1AN8 A;  2QKI C;  3A5Z B;  2A5H A;  1BO0 A;  5C4J H;  3ND8 A;  1PH4 A;  4RGT A;  1ESF A;  2B29 A;  2YYZ A;  5ELB A;  1B9N A;  4DR5 L;  4G7H C;  3Q0A A;  2PPB C;  3RZD H;  4DU9 A;  1B2T A;  4M1U B;  2E76 C;  4A93 H;  2EY6 A;  3SK4 A;  1TVX A;  5G3L D;  1N34 Q;  2QDL A;  3DXJ C;  1XWE A;  5LMN W;  4KY5 A;  1SMX A;  3CCM A;  4EQO A;  1HZA A;  5I6W A;  3S15 H;  2ATW A;  1HNZ Q;  4P71 A;  1BR9 A;  1HJP A;  1UUP A;  5EAY A;  2V1C C;  3C46 A;  1QWY A;  2Q2T A;  2XRS D;  3TN2 A;  5JJK A;  3FDT A;  4YY3 L;  1ET6 A;  2RQX A;  1EIF A;  4QY7 A;  1HH2 P;  1JT8 A;  1WTX A;  2UXB Q;  4CBV A;  2DUD A;  3TP8 A;  2ZM6 L;  1EEF D;  3CQZ H;  4JBK A;  3NEM A;  1L2F A;  3PF4 A;  2VUM G;  2CW0 C;  3T13 A;  2MFI A;  3CCS A;  2UUA L;  2A8V A;  3SVM A;  1H9S A;  3MWY W;  4LF6 Q;  2JN4 A;  3S24 A;  3IAY A;  4HED A;  3HOX H;  3HKZ B;  3KDF A;  1ENF A;  1KXL A;  1HTP A;  3S2D H;  1SYE A;  5C4X G;  2D62 A;  4P72 A;  1SJH D;  2QIL A;  2M2L A;  1PH5 A;  4JCV E;  2F0N A;  1E3P A;  1MBY A;  1SDF A;  2CKZ B;  2F0P A;  1N8R C;  2QCP X;  2E5L L;  2RHQ B;  1K0R A;  1YHQ A;  1WD1 A;  3KLS X;  1L1O B;  4HIO A;  1JJC B;  2N88 A;  4IFD I;  3M7N A;  4OXP A;  2KQ3 A;  3FPU B;  1IYJ B;  5IGG A;  3HOW G;  4BBS H;  3H91 A;  4V19 0;  1FGB D;  5IGC A;  1YIT A;  1X32 A;  4J6H A;  2UUA Q;  3M7G A;  2LMC B;  1VQF A;  3W2D A;  3TME A;  4YWL A;  3HOU B;  1PFM A;  1ONL A;  1GUG A;  5I6Y A;  1ILP A;  2CWA A;  3S14 B;  2NZH A;  4CDE C;  1G6Z A;  5EKL A;  2IX3 A;  2EJF C;  4PMW A;  4A3I B;  4LFC Q;  2EYM A;  3WDN A;  1K8A C;  5JEA J;  1NR2 A;  5JJZ A;  2IJ0 A;  1JWM D;  1GD7 A;  3W1B A;  1BBU A;  1L1O C;  1STY A;  1PVO A;  1ICF B;  1EOT A;  4QJF A;  1GXD C;  2MP1 A;  2I5H A;  1PRT D;  2BE5 C;  3IL8 A;  3ONA B;  5K36 H;  1NAP A;  4H44 C;  2EVB A;  1EYC A;  3D0F A;  2Q8T A;  4OO1 G;  1XTC D;  3KJP A;  3NK9 A;  2EYJ A;  4BY7 H;  1G8Z D;  3X3N A;  1HCZ A;  1MSH A;  1NJI C;  4GKJ L;  1BCP D;  4AYB E;  4FXK C;  3BU2 A;  3AYH B;  1I3Q B;  3FMC A;  4YIJ A;  3TZU A;  1GKH A;  4GN3 B;  4OWX B;  5C4H A;  1YNJ D;  1HNW L;  4K2L A;  2XN9 C;  1Q86 C;  4XIG S;  2WAC A;  2JEB I;  3TS0 A;  5EPL A;  3UDX A;  4H0L C;  2JYO A;  2EQS A;  2XWB B;  1TY0 A;  2OTJ A;  3M85 A;  1A15 A;  4DA2 A;  4LAA A;  1QZG A;  5JPM C;  1JB3 A;  2NN6 I;  4Q5V A;  4JV5 L;  2FXQ A;  3TRZ A;  1CKO A;  2ZXO A;  2DN8 A;  2WB1 B;  5IGF A;  1ESR A;  2F0J A;  4IQZ A;  2KEC A;  2B63 H;  1PH9 A;  1CKM A;  3U4Z A;  2QA4 A;  1SNM A;  2ZM6 Q;  1EY9 A;  5NUC A;  1Y1V B;  1D2B A;  4R4T A;  4RFB A;  1QVC A;  4APV A;  3G48 A;  3D4R A;  3V96 A;  2B2V C;  2F1M A;  1SNC A;  4LFB Q;  2NVX B;  2R7F A;  4GNX B;  4OWT B;  3CCJ A;  3QWN A;  1Y1V G;  4GZY C;  5JJI A;  1I6V C;  3OWE B;  3M4P A;  4KHV A;  2BH8 A;  4IUR A;  1LT6 D;  2JK8 A;  5DEH A;  4A3G G;  1Q1B A;  1B7Y B;  1O7Y A;  2Z6K C;  4RHS A;  2F52 A;  5HY6 A;  3LWE A;  1OXT A;  5C0X J;  1SBB B;  1V1P A;  4OWW B;  4K0K L;  2NVX H;  5DAU A;  4HJ9 A;  3BZD B;  1MD2 D;  1CZW A;  4A3E G;  1AE3 A;  2PI2 E;  3GV6 A;  2K5V A;  1LYL A;  5C5M A;  1XTD A;  1QVF A;  3K5M A;  1DGS A;  1E0B A;  1S5E D;  4QGU A;  4JI5 L;  2UXD Q;  1TWF H;  1TWC B;  1WTV A;  2KOL A;  2CCZ A;  3STB D;  1FJG Q;  2RKS A;  1N33 L;  2XIW A;  3K8A A;  3BJU A;  3I4L A;  2SOB A;  1EOV A;  3BDO A;  1IBM Q;  5IYB G;  4IPD A;  3J80 i;  3T4A C;  4A3C H;  4JI1 L;  1AH9 A;  4RA8 A;  1EU3 A;  3I4M B;  3Q24 A;  3I2Z A;  1SE4 A;  5GAD C;  3RLF A;  2E2H B;  2YTX A;  1TWG B;  3H3V C;  4NXN L;  2K52 A;  5FJ8 H;  5M3M B;  4CJ0 B;  3MXP A;  2A6H D;  4K6D A;  2LS0 1;  4YWK A;  4R4O A;  3TQY A;  3S1R H;  1I50 B;  2I07 B;  5I2Y A;  1X65 A;  4LW1 A;  4EQ5 A;  1HTL D;  2UU9 L;  1MKH A;  1B53 A;  4P2C B;  4U67 3;  5JEA G;  1LTI D;  2I0Q A;  3NE5 B;  2L55 A;  4J15 A;  4ZAI A;  2IHF A;  2C35 B;  1CQV A;  4YWM A;  1VQI A;  5E3F A;  1T5X D;  1L0W A;  5C0X I;  2WIN B;  2K33 A;  3CME A;  2IPK D;  2ZXR A;  2RVL A;  4QB4 A;  1YVC A;  5DNF A;  4R4Q A;  5J39 A;  1CA6 A;  1PYB A;  1X3P A;  3MEF A;  4LF5 L;  2NVY B;  4IJH A;  2K04 A;  2EXZ A;  3MZ5 A;  3HOU G;  2JJQ A;  5FJ8 G;  3IFT A;  5BN3 A;  4BBR B;  1BUV T;  4HAE A;  3F2D A;  3AU7 A;  2LXJ A;  1MGS A;  4X65 L;  1XNQ L;  2ENB A;  3SE0 A;  1I4G A;  3S1R B;  3OIP A;  3EJI A;  2VNU D;  3S16 H;  4XYQ A;  4BBS G;  1P8L A;  4ODG A;  2I5L X;  2JA5 G;  1U0L A;  3GTM B;  4CJ1 B;  4A3D B;  3S14 H;  1FYC A;  3CU7 A;  3CCV A;  3VR3 A;  3HOU H;  2PMZ B;  3VYT A;  4PMB A;  2OQ0 A;  1DD2 A;  2ZJP A;  4YHH Q;  1UEB A;  4PNY A;  2RCN A;  1EWI A;  2UXC L;  4LUZ A;  1Q12 A;  2KCT A;  3NEN A;  5CV6 A;  3P20 A;  3PIO 3;  2B2T C;  2MUY A;  1CHP D;  1TWA B;  1S5B D;  1SSO A;  4GOP B;  3HOX B;  1SMY D;  3GTM H;  3PO3 H;  4A3K G;  3AQQ A;  1HNX L;  3CAM A;  1IBL L;  3KLW A;  3K80 C;  2LY7 A;  1M4V A;  3IRB A;  2QDB A;  5L37 A;  1SYC A;  5CC4 A;  4JYA L;  4BA2 I;  1QCB D;  1J5E Q;  3NSW A;  1S3O A;  2JA7 B;  1EYG A;  4OO1 H;  3GTG H;  1EIH A;  2MHV A;  1F2Y A;  1I6H B;  1K83 B;  1CKN A;  4H02 A;  1VQ4 A;  1JJ2 A;  1GOZ A;  1KRS A;  4IPC A;  3CQZ B;  2B2Y A;  2GA4 B;  4N8X 1;  4C3I G;  4HIM A;  2K1B A;  1WCM H;  1WTH A;  3HZX A;  3T53 B;  4IAL A;  4LF9 L;  1W3S A;  3D4W A;  3ER0 A;  4B9X A;  3GTP B;  2XTI A;  2EOT A;  4DR1 Q;  1Q7Y C;  5EGT A;  3T1H Q;  3NWT A;  3PO3 G;  1K0S A;  4OIJ A;  4FF1 A;  3NBH B;  5ELD A;  1P16 A;  4L63 B;  3CRL C;  1KD1 C;  1KAW A;  2QGQ A;  3F2U A;  3M9B A;  4GN5 A;  2QEX A;  4C1N K;  1V8Q A;  2RSO A;  5C3E H;  5KGU A;  1SFO B;  3HGB A;  1HRJ A;  3HKS A;  3FRP B;  1KLG D;  4BY7 G;  2NWG A;  3NQT A;  2HQL A;  1B70 B;  2XNA C;  1D8L A;  4B3M Q;  3M4O B;  4RWS C;  3WOF A;  1UWV A;  4IOC A;  3N6R A;  5IP7 H;  4ZLT F;  1K8G A;  2RHS B;  2X69 A;  2VB2 X;  5IGD A;  1IL8 A;  1IYU A;  1F2M A;  2EYL A;  1VQJ A;  5ELC A;  4AQY Q;  2ZTE A;  3WWV A;  3S1Q H;  1RKN A;  4XQN A;  4DV4 L;  5C4Z A;  2IX0 A;  4P75 A;  1T9H A;  1VF7 A;  1LT3 D;  2F3I A;  3RUZ A;  3UDI A;  1XXG A;  1ILQ A;  4JBJ A;  4C56 C;  1F9R A;  4NB3 A;  5BN5 A;  1YNX A;  1SYD A;  3BZK A;  1R9T B;  4JI3 Q;  2F0W A;  1PH6 A;  5EKI A;  1PTO D;  2B8G A;  1TU2 B;  4B3S L;  1TII D;  4TKO B;  1S5C D;  4TVA B;  4YCW A;  1SXT A;  2E2J H;  5CV4 A;  4OON A;  1N36 L;  1GM5 A;  4DR4 Q;  1DOL A;  1LLR D;  1VQB A;  2M00 A;  2MPM A;  1S40 A;  3OIQ A;  4IUU A;  1Z47 A;  4J1M A;  2CQA A;  4L5R C;  2Z6B A;  3RLN A;  1CI3 M;  3I73 A;  4B3R Q;  4DV1 L;  4DV0 L;  3H6M A;  4DR2 Q;  2A69 C;  2NN6 H;  3FEW X;  5BR8 Q;  2DY7 A;  2F0M A;  4JG2 A;  5IIF A;  2UUC L;  3NTK A;  1YHA A;  2Y0S B;  5D14 A;  2F0I A;  3G4S A;  3P1H A;  1DYQ A;  1NNX A;  3E0E A;  4BXX H;  4Q0F A;  1F77 A;  1F2L A;  1CT1 D;  2O2L D;  4KI0 A;  4DAY A;  2K4K A;  2BCO A;  1WTP A;  1GUW A;  1PFS A;  4HJ5 A;  1BQQ T;  4P73 A;  5COR A;  4A3G H;  1MI2 A;  3EIV A;  3GD7 A;  3KJO A;  1L1O A;  1TKW B;  4NXM L;  2BOS A;  2C9O A;  3NXW A;  4DR2 L;  4R8I A;  5K5P A;  4DUZ Q;  1Y8O B;  4DV0 Q;  1S72 A;  1DOM A;  2H1E A;  2RF4 A;  2L12 A;  2EJM A;  4PMC A;  3CRK C;  4DR4 L;  4DV3 L;  4GLX A;  1NUC A;  1H9S B;  3RNU A;  4HJ8 A;  1XJV A;  2ALY B;  2K03 A;  3G71 A;  4X6A H;  2K14 A;  5IT9 L;  4B3T L;  3SXH A;  2NZ1 D;  4ZK9 B;  3ZJY C;  1A3U A;  2KA7 A;  1WJJ A;  4HSV A;  1VQA A;  4B3T Q;  1W2B A;  4OX9 L;  4DGZ A;  4KHZ A;  4TRD A;  1G6P A;  4XTC S;  3J81 L;  4A3J G;  2HCC A;  1Y1W B;  1OXX K;  3UE0 A;  1PZJ D;  1T5E A;  4Y7N B;  4GLV B;  2R6G A;  4G4K A;  1CSP A;  3DUZ A;  3JAM L;  2NVQ H;  1KRT A;  3FHW A;  4BY7 B;  1YEZ A;  1JE5 A;  4L5T A;  1EY5 A;  4IUN A;  1IXR A;  3TSS A;  1MIU A;  3A8J E;  4LF7 Q;  3CP0 A;  1WTQ A;  5IT9 c;  3PIP A;  1RIP A;  3OYY A;  2EYH A;  4RKL A;  3GTL H;  2K5H A;  3S9W A;  2VB3 X;  3LNN A;  3MA2 B;  3DWP A;  3CD6 A;  2ZJR A;  2LXK A;  1LAB A;  1LUZ A;  4AH6 A;  4H7B A;  3G6E A;  4L5Q A;  2FIN B;  2ZTC A;  2F0V A;  3T1H L;  4DV1 Q;  3CHB D;  4A3M B;  1FNU A;  1EL0 A;  1EQV A;  1EUJ A;  5LMU L;  2K50 A;  4PV1 C;  1PMR A;  5M5Y H;  4LF4 Q;  3JAM E;  3K7U C;  1KL9 A;  3M3Y B;  2AQ3 B;  4X3T A;  1X55 A;  4G57 A;  2ID0 A;  1EU4 A;  2YV5 A;  2JA9 A;  3CW2 C;  4KJN A;  4LFA Q;  3VR2 A;  2V4D A;  4B3S Q;  4IFD G;  1TS3 A;  4X66 Q;  5IYD H;  3UE1 A;  3F2B A;  1EY8 A;  5IY0 A;  4JI3 L;  4POG A;  1J5E L;  1C4Q A;  5JOB A;  2VUM H;  4A3J B;  1HUM A;  4JYA Q;  4WOR A;  2N49 A;  1OXU A;  5IE8 A;  3BVM A;  3HFZ B;  5M3F H;  4A3E H;  3EQL C;  3LGJ A;  4A3J H;  1VS0 A;  5D3I B;  2A68 D;  4DAM A;  4KV6 A;  5KNB A;  1E2Z A;  2BE5 D;  1B3Q A;  1Q8K A;  2ASB A;  3PV0 A;  2CHB D;  1XNR L;  1V1P B;  4F88 A;  3SK8 A;  4N8F A;  1NMG A;  2FFK B;  2HHH L;  4R9W A;  2XVS A;  1UE1 A;  3IKJ A;  1VQG A;  5CV8 A;  3RN2 A;  1GUT A;  3DHQ A;  2OWO A;  2R61 A;  2UXC Q;  3K7A H;  2WII B;  3QOL A;  5I9P A;  1PRT B;  4A3M H;  1DZ1 A;  4A3L G;  4DAV A;  3S1M H;  3K5N A;  3GTK B;  3S16 B;  2E8G A;  3C3L A;  3F1Z A;  4DN4 M;  3PIO A;  1XPO A;  2A6H C;  1ZYR D;  1SNQ A;  4DR1 L;  4X3K A;  3A74 A;  5KEE A;  2KED A;  1GJX A;  5C4X H;  4LF9 Q;  2B8F A;  2K32 A;  2Z4I A;  1LV9 A;  3HOY H;  3U9S A;  4JI6 Q;  1HFN A;  1HR0 L;  4IFD H;  1EYD A;  3I72 A;  4GOP C;  3R2I A;  5M5X B;  3HOZ H;  1FL0 A;  1XPU A;  3H0G B;  2F0D A;  2B2W A;  2F0H A;  4CKB A;  3H0G H;  1HZ9 A;  1HZC A;  1UAP A;  3L2P A;  2OF1 A;  1Y8N B;  5T1I A;  2D2C C;  4LWC A;  1RDP D;  1STG A;  3KBX A;  1EIG A;  4BWG B;  1K83 H;  2AQ1 B;  5C4X B;  2QEJ C;  4RKB A;  3C2P A;  1V43 A;  4JI0 L;  4JC0 A;  4ME3 A;  2RA4 A;  4C2M H;  2Q2H A;  1ET9 A;  5A2Q L;  4HJA A;  3PUX A;  4QUF A;  1STB A;  5G3L F;  1WI5 A;  5J3B A;  1CSQ A;  5KND A;  2NZO A;  1QOH A;  1EY4 A;  5ISR A;  1OXV A;  1NMF A;  2B2U C;  2Z9H A;  3D6C A;  2ZTD A;  1Z7T A;  3E9I A;  4UPA A;  1JMC A;  4DR7 Q;  1D7Q A;  4DUY L;  2UUB L;  1L0X B;  5M5W B;  2TMP A;  1KDB A;  3KK7 A;  1V9P A;  2F0T A;  4K8J A;  1NR4 A;  1BKB A;  4YHH L;  3JC6 6;  2F4V L;  1K3R A;  1LTR D;  4QIW B;  3ICE A;  1PTO B;  4DR3 L;  1X9N A;  1BNZ A;  2HIV A;  2NTS A;  1PTO H;  2EY1 A;  1RTO A;  1WVL A;  4PZ6 A;  2A69 D;  4RCO A;  2R93 G;  3K58 A;  1SYB A;  4ME5 A;  4QF4 A;  2EIF A;  3CKI B;  3WOE A;  1CQF A;  3GO5 A;  3I4N G;  3I90 A;  1TWC H;  1TWF B;  5A2Q E;  2VW9 A;  1RD9 D;  4KKS A;  4Y52 H;  1I4P A;  4IPG A;  4TSS A;  2CH4 W;  3C1F A;  5IGE A;  3PSI A;  4JI7 Q;  2IW3 A;  3HOV G;  5FLX E;  2K5D A;  3K0X A;  1U4P A;  3BVG A;  1O7Z A;  3TEH B;  1EZ6 A;  1JC7 A;  2LFN A;  4K0K Q;  4DAY B;  4A3B H;  2NVT B;  4EVO A;  3OTO L;  4JI8 Q;  2Q2U A;  4LF5 Q;  1JR0 D;  4C3H B;  5M3M G;  3L0O A;  2NVY H;  3J80 E;  4EQN A;  4IFD J;  4DAP A;  5EQ0 A;  2VZA A;  3S1N B;  4I65 A;  5C44 G;  4FVM A;  1VQO A;  1I4R A;  1FGU A;  1M8A A;  4JVZ A;  2K5N A;  2BH2 A;  3KLS A;  5IOC A;  1G29 1;  3RR5 A;  1U5K A;  1TR5 A;  3I70 A;  5ELE A;  2IX1 A;  3KDF B;  3RMH A;  4NP5 A;  3NPP A;  2WB1 G;  1K28 A;  1CFM A;  3KLR A;  2JSO A;  1PYS B;  3E0J A;  1LTS D;  4KKT A;  1ASZ A;  4JI2 L;  1B4O A;  4JOI C;  4KD4 A;  3SDZ A;  2QW7 A;  5HGT A;  5FO9 B;  1GO3 E;  1R4Q B;  3LWU A;  1HFG A;  1IW7 C;  3MTS A;  4JI1 Q;  3I4N B;  1STN A;  3S1M B;  1AEX A;  1PDQ A;  3MXU A;  1DXM A;  4ID6 A;  5C44 H;  1PHJ A;  3I4N H;  1QJO A;  1Q46 A;  2P5Z X;  4RH6 A;  2HDL A;  2ZT9 C;  4BA1 I;  4DNT B;  4GNX C;  3CCE A;  1RL2 A;  4GKK Q;  5IP7 G;  1H9M A;  1SE3 A;  5GAE C;  1GUO A;  3I4M G;  2MNA A;  2VQF L;  2UXD L;  2JQO A;  1TXY A;  1FD7 D;  4LUV A;  5LL6 X;  1CA5 A;  3PCO B;  5C5L A;  4AYB B;  3TDQ A;  3SHL A;  1KAB A;  4AIM A;  4DFA A;  2B2Y C;  1LTL A;  3GTP H;  1C48 A;  4J8Q A;  3U58 A;  5JVG 3;  2R92 B;  3T1Y L;  5IYB H;  1F2Z A;  3S2H H;  2WKD A;  3T56 B;  2PZU A;  2G5D A;  3OWF A;  2DY8 A;  4LF8 Q;  2SNM A;  2E2D C;  3MFG A;  4ABN A;  2IY5 B;  4IZ8 A;  4DK1 A;  2X6L A;  4X64 Q;  3K5O A;  2NTT A;  4GNX A;  1XMO Q;  2Y0S G;  2YU9 H;  1PRT F;  1PTO C;  1PH7 A;  2YTV A;  4ZUI A;  2KVM A;  1A2T A;  1PRT C;  1PTO F;  2L15 A;  5A35 A;  4RHR A;  2EE1 A;  2DGY A;  3RD4 A;  2FMC A;  3CC2 A;  1FR3 A;  4DV2 Q;  1XMQ Q;  3MHB A;  3M3Y H;  4LFB L;  5M3F G;  2RDG A;  5EBD A;  4ZCK A;  1DOK A;  5IWA Q;  5J22 A;  4HCS A;  3A8K E;  4OIK A;  5IYC G;  2F0Q A;  3J81 j;  1MHW C;  2EPB A;  4N9P A;  4LFC L;  4C1N I;  2JE6 I;  1I5F A;  3J7A V;  2GN5 A;  1YBY A;  1IYV A;  1UE6 A;  3X3M A;  4DV7 Q;  2PQA B;  2ICI A;  2D5D A;  2KJX A;  1IBK Q;  5IGB A;  4C3J H;  5EKK A;  5AJ3 L;  3GDE A;  4CGY B;  4O0A A;  3QJY A;  3TS2 A;  2BA0 A;  4BBS B;  2R7Z G;  5CV5 A;  2BA1 A;  1J9O A;  2IWH A;  2B2T A;  3K59 A;  4L5S A;  3M4Y A;  1TY2 A;  3KBG A;  4PQX A;  1YJW A;  4JV5 Q;  4E6I A;  1O80 A;  1D5X C;  4CKE A;  3CCU A;  4X62 Q;  1BBW A;  3T51 B;  4IOA A;  4CKC A;  4KHP L;  1RTN A;  4K8I A;  3RZO H;  1IZ6 A;  5CV7 A;  4KY6 A;  5C3W A;  5IP9 H;  1KTK A;  4CHT B;  1AZQ A;  1RCV D;  1HNW Q;  5CYU A;  4AYB G;  3OSO A;  5HUR A;  4A3K B;  1OTC A;  3HOZ G;  4X62 L;  2R7D A;  4LMQ D;  3PUY A;  4C3J G;  4UDU C;  1JOK A;  4GKJ Q;  3CPW A;  2PYK A;  2AUJ D;  1J8I A;  1MSG A;  1X56 A;  3BS1 A;  1B9M A;  2WB1 E;  1C8C A;  1JWU D;  2D0O A;  1K3B C;  4CDC C;  5JVH 3;  4JBM A;  1K8O A;  1HR0 W;  2BDO A;  3E9H A;  4DV7 L;  1D5Z C;  2PNH A;  3I7F A;  2Q8R E;  2UXB L;  1VMC A;  1WFQ A;  5C3E B;  3D8G A;  1VQN A;  2ZXP A;  2HDM A;  5CR3 A;  1AW7 A;  4YY3 Q;  1YIJ A;  2B39 A;  3A8I E;  3ULL A;  4C3H H;  4DF7 A;  4ZRZ A;  5IP9 G;  4WJ3 M;  1E1O A;  2NVT H;  3S17 B;  2K7V A;  3RN5 A;  4UY8 C;  4C3I B;  1HNZ L;  1MJC A;  3PMF A;  4DV2 L;  1XMQ L;  4KK7 A;  3HOW H;  1GVP A;  1LT5 D;  1PZK D;  4NMZ A;  4O2D A;  1OO9 B;  3GTQ H;  1YI2 A;  3GP7 A;  3IFD A;  2E2I H;  4O1N A;  2A1A A;  4B08 A;  1PZI D;  5CBA E;  1SRO A;  1TWG H;  2TSS A;  1XMO L;  4R4I A;  4IUT A;  4A3F H;  1KNE A;  3PQI A;  2B63 G;  1STE A;  1E2W A;  4LK1 C;  4LF8 L;  3I55 A;  4HTH A;  4O42 A;  1LAC A;  3E5S A;  4KJO A;  2AQ2 B;  2H5X A;  2YU9 B;  1CHQ D;  2VS1 A;  4KLK A;  4RAU C;  2E5L Q;  1PFN A;  3MXN B;  5FLM G;  3A54 A;  3SK6 A;  4QCL A;  1VQC A;  4KHP Q;  1VQK A;  2E2J B;  4C3J B;  4IJL A;  1VF5 C;  2Z8L A;  2VQF Q;  4QQB X;  3QO2 A;  1TS5 A;  1X3E A;  4GKK L;  4ZQ3 A;  1XX8 A;  2HT1 A;  3EN2 A;  3HEJ A;  4LF6 L;  2IT1 A;  3OHX C;  4BY1 B;  4DKA C;  4A3E B;  1CTM A;  4DV5 L;  4JW0 A;  2F4I A;  3MAQ A;  3VR6 A;  1J6Q A;  2I46 A;  2JA5 B;  5AJ3 Q;  4U68 A;  3HKZ E;  3TRE A;  1IBK L;  1B8A A;  2A68 C;  2RCF A;  4RG1 A;  1NTG A;  2OQK A;  3MXN A;  1TS2 A;  3NWS A;  3FKI H;  2J0T D;  5IWA L;  3E6Z X;  2R7Z B;  2AUK A;  3GV3 A;  2IHE A;  3U9O A;  5FLM H;  2CH4 A;  3N52 A;  5DM6 3;  4F7X A;  5KIX A;  2Q8I B;  2MQH A;  4RGO S;  1STH A;  2CQO A;  3V2T A;  2DJF C;  4KN4 C;  2F0S A;  1V1Q A;  3NHH A;  2K01 A;  4LJZ C;  4MTK A;  1QE6 A;  2CVR A;  2D9U A;  3FP9 A;  2HUG A;  5JEA H;  3I91 A;  2JXM B;  1Y1W G;  1N34 L;  5IT9 E;  1F9S A;  4X64 L;  3A5U A;  5GAH C;  1G51 A;  2J4X A;  3QIA A;  5C6A A;  1QVG A;  2PO4 A;  3ULP A;  3AMU A;  5KRU A;  1Y14 B;  2GVB A;  1A3V A;  3V05 A;  3T1Y Q;  3W5O A;  1Q8I A;  2B3G A;  4ULL A;  4DR5 Q;  1OXS C;  4XT1 B;  3URY A;  2PZW A;  4XXE A;  3RZD B;  2WP8 J;  4JI7 L;  2ICE C;  4UHV A;  3FKI B;  3BDC A;  2NN6 G;  2NVQ B;  4ZKC B;  5C3X A;  1W6J A;  3FPP A;  3VYU A;  4Y7N H;  1BOS A;  2L0C A;  1KNA A;  4OL7 A;  3CF5 A;  3BDL A;  4A4I A;  2JA6 G;  2R93 B;  4K14 A;  1SR3 A;  1QG7 A;  3VA5 A;  3CCR A;  4OGQ C;  5TSS A;  1I50 H;  1CKN B;  1EQT A;  1HA5 A;  1SE8 A;  3HRZ C;  3K81 C;  3DEO A;  1D6E C;  3UDG A;  2KHI A;  1D1K A;  3FVQ A;  5E7N A;  3VA7 A;  4BY1 H;  1VQ7 A;  1QNU A;  3GQB A;  4A3M G;  3MEH A;  3FKI G;  4DR3 Q;  4JOI A;  2CWP A;  2O5J C;  1O7L A;  2JA5 H;  4RCN A;  1SN8 A;  4K5W A;  1QUQ A;  5KYI A;  3ZYY X;  4JI2 Q;  1Z6H A;  2VUM B;  4FF3 A;  1I4X A;  3I3C A;  4R1J A;  1X6O A;  4A75 A;  1KDC A;  2UUB Q;  1GHK A;  4DUY Q;  1I4H A;  1C9O A;  4DR7 L;  2EYO A;  4DK0 A;  5D3D A;  4DXF A;  1YJN A;  5F2D A;  1KDA A;  1SAP A;  2DNC A;  1Q90 A;  2AWN A;  4DR6 Q;  2F0O A;  3I4O A;  4N9T A;  3J7A F;  2FMM A;  1K8M A;  1VCI A;  5I4D A;  4JI4 Q;  1KAA A;  4A3C G;  1HXY D;  3OOC A;  1NBW A;  4JI0 Q;  4A3I H;  3K5L A;  4IPH A;  2E2I B;  1QIL A;  3CPF A;  1ICW A;  2OTL A;  4JI8 L;  2OT2 A;  3OTO Q;  1TQO A;  3A7A B;  4A76 A;  5D65 A;  3HOW B;  1B1Z A;  2RSN A;  4RGN A;  4MIU A;  3GTQ B;  1WTO A;  1PH8 A;  3GTL B;  3U50 C;  4MHE A;  1WCM G;  1YNJ C;  2KHS A;  5EPJ A;  3CCQ A;  1GHJ A;  2OCE A;  3MC0 B;  4NDX A;  1XYI A;  4I7A A;  1B44 D;  3Q22 A;  2NBF A;  3OMG A;  3F8T A;  3ERQ A;  5IOD A;  3TP7 A;  1H95 A;  4HCE A;  5DLQ E;  4UP7 A;  3A7L A;  3PUV A;  2QF7 A;  4RMF A;  3L7Z C;  1X3Q A;  1BCP B;  2Y0S E;  4X3S A;  3KF8 A;  1EIY B;  2F4V Q;  2H4O A;  3F2C A;  1S5F D;  2Z6K A;  4XT3 B;  3CMA A;  3G6J B;  1E7Z A;  2VQE L;  1ENC A;  4WRD A;  3KYH C;  4C2M B;  4V0B A;  1XPR A;  3HOX G;  1U4R A;  5JPN C;  3AEV A;  3OPO A;  3PF5 A;  1XNR Q;  3NEL A;  2AKW B;  2G9H D;  4FYD A;  3E3X A;  2K5Q A;  1HQR D;  3ND9 A;  5AFW A;  4K6L A;  2DJG C;  1EQQ A;  1SFO H;  1I94 Q;  2HQE A;  3RZO B;  2R92 G;  2EY5 A;  1CUK A;  1PYW D;  4CDF C;  1TT2 A;  1KHI A;  1NSN S;  5IYD G;  4IN3 A;  4PZ8 A;  5H1S E;  3QB3 A;  2Z0S A;  1I3Q H;  3ERS X;  1I4Q A;  1HZB A;  1N32 L;  3K0Y A;  1S5D D;  3OMC A;  2JA7 G;  5HGQ A;  3HS0 C;  3LX0 A;  1WCM B;  3H09 A;  1WTW A;  5J1Z A;  4F87 A;  1PH2 A;  4P74 A;  4G7Z C;  1WOC A;  1A62 A;  3CC7 A;  1HR0 Q;  4JI6 L;  3HOY G;  2A74 C;  3H0G G;  2XGT A;  2KEE A;  4HJ7 A;  3UI2 A;  1II3 A;  4DV6 L;  4OO1 I;  2PQE A;  3PGZ A;  5I9O A;  2MO1 A;  4A3B B;  3J81 c;  3K7A B;  3SGI A;  2K5W A;  3PUZ A;  4DNR B;  2XRQ D;  3C1E A;  5M5Y B;  3VYR A;  3GTO H;  2C5C A;  2LSS A;  1LO5 D;  5K36 G;  3D31 A;  4KY7 A;  3EA6 A;  4X3U A;  1JCK B;  1CK1 A;  2E75 C;  3BYY B;  2WKC A;  4H13 C;  4PG3 A;  4NW2 A;  3H3V I;  1S4Z A;  4LF7 L;  1JIC A;  4BXX G;  2GVA A;  1TWA H;  4K5X A;  3BYT B;  4HSP A;  5LMN L;  2HHH Q;  3S2H B;  1EWH A;  1VQP A;  2JA8 B;  5CBE E;  3KF6 B;  5I2X A;  3NBH A;  3J80 L;  1EY7 A;  1X3G A;  2AHO B;  2JEA I;  1VQE A;  4EGV A;  1SRU A;  2O5I C;  1PH1 A;  1Y1V H;  3W1G A;  3S1Q B;  1G91 A;  3Q23 A;  2KHJ A;  5C44 B;  1M1K C;  3DM3 A;  2R93 H;  2AMC B;  2JA6 B;  4A3F B;  1F9P A;  1DCZ A;  4MTN A;  2WV6 D;  5FK9 C;  5FO7 B;  4OEM B;  1A3T A;  1O7I A;  5C3E G;  1HHV A;  3S2D B;  1HQM C;  1VMP A;  3QR8 A;  1BCP C;  4I7Z C;  4NPS A;  3M4O H;  2EY2 A;  4X66 L;  1TS4 A;  4PZ7 A;  3DWA A;  2F0U A;  2O4X A;  1WTR A;  3DM1 A;  1ROD A;  4LFA L;  3A55 A;  1PXU A;  5JJL A;  3KF8 B;  3R2T A;  1YHB A;  4C3I H;  1FVI A;  4LF4 L;  3QG1 A;  4DV3 Q;  1VDZ A;  5KYL A;  1MJE A;  4EX5 A;  5LMU Q;  2F3W A;  1VQD A;  5E4W C;  5E1F A;  1PV4 A;  5FO8 B;  1A2U A;  2EYP A;  2A19 A;  1G2T A;  2EDG A;  3EVQ A;  1W6K A;  4NXM Q;  2AWO A;  4BBR H;  3S1N H;  1DJR D;  1YNN C;  2SEB D;  1U4M A;  2F0E A;  4M8A A;  4S3S A;  2PMZ E;  1LTG D;  4ZUJ A;  3I56 A;  4A3B G;  3K57 A;  1IW7 D;  5JAV A;  1BVS A;  1CZG A;  4XQQ A;  3TZD A;  1U4L A;  3HOZ B;  4JBW A;  4MNO A;  1IL2 A;  2E74 C;  3AFP A;  4XYO A;  3JAM c;  2UUC Q;  1QUQ B;  1ZYR C;  1Y1W H;  3PO2 G;  2K75 A;  3KOJ A;  2R7Z H;  5BR8 L;  4XDX A;  3T16 A;  2A73 B;  4QMG A;  3J81 i;  3QOJ A;  2EZV A;  2KUM A;  2Q2I A;  3CXC A;  2VY3 A;  1YNN D;  4HID A;  2SDF A;  5CMD A;  4B3R L;  3PUW A;  1UE5 A;  3RLO A;  4LNQ A;  2NB0 A;  2R3Z A;  2L11 A;  3GTK H;  1AP0 A;  5FLX c;  2JA8 G;  3TP5 A;  4GLA C;  2E2H H;  5DM7 3;  1YJ9 A;  4YCU A;  4BBR G;  4FO2 A;  1UE7 A;  3OW2 A;  3K6O A;  1A8V A;  4FXD A;  5ELN A;  5M3M H;  5C4J B;  3H3V H;  4OX9 Q;  1E22 A;  3W3A A;  1QB5 D;  4GS3 A;  2WFW A;  1O78 A;  2PW7 A;  1KQS A;  1AFP A;  1GUN A;  4MZ9 A;  1B50 A;  2JA6 H;  4BY1 G;  3BG3 A;  1IHZ A;  1SND A;  1JOQ A;  3HOV B;  2N3S A;  2NUC A;  5CV9 A;  1RF2 D;  2PI2 A;  2N8N A;  4DV4 Q;  1BCP F;  4A3G B;  4GOP A;  1IKM A;  4A3D H;  2N78 A;  1JQY D;  2Z4H A;  2M9V A;  1R9T H;  3MXG A;  1WD0 A;  1BDO A;  4OHJ A;  5FOB B;  3BVZ A;  4DUZ L;  1UEA B;  1UNS A;  2L5T A;  3STB C;  3NTH A;  1D5M C;  1ZKO A;  5FKA C;  1DON A;  3O13 A;  2RDF A;  1H9J A;  2PZT A;  3I8Z A;  2I5M X;  3NUC A;  2JP1 A;  3PO2 B;  4A3L H;  2RBM A;  4TQU S;  3J7A 5;  1K9M C;  1Y69 U;  1HA6 A;  1BXT A;  4NKL A;  1A0I A;  3KUP A;  1LTA D;  1KIX A;  1RJT A;  2PW5 A;  4UAI A;  3NTI A;  1B3A A;  2LKV A;  3SK5 A;  1HUN A;  3R8B A;  1Q3L A;  4A3F G;  3J81 E;  1VQL A;  1E1T A;  3PIP 3;  1K73 C;  2A6E D;  4DXG A;  1CM9 A;  3R3O A;  4F8M A;  3H94 A;  1SNO A;  1X54 A;  1Q81 C;  1BF4 A;  1N9W A;  1N36 Q;  1LT4 D;  1AE2 A;  5T1G A;  2IL8 A;  2RDH A;  5M5X H;  4UP8 A;  2OEO A;  1EQR A;  1H9K A;  4FP5 D;  1SEB D;  2F0K A;  4GN4 B;  5KNC A;  5BN4 A;  1RHP A;  1N32 Q;  3D3R A;  1VQ9 A;  3L9A X;  4A3K H;  2A6E C;  3UDF A;  4QIW E;  2MO0 A;  1SJE D;  2PCF B;  4L6T B;  3B6Y A;  3NP8 A;  4A3D G;  5GAG C;  1NE3 A;  2Z1C A;  4KMU C;  1I6H H;  4JK1 C;  3U4V A;  1I94 L;  4AQY L;  2XSC A;  3D4D A;  5EBC A;  2ES2 A;  2L1B A;  4DK6 C;  4XQJ A;  5EJW A;  1C7Y A;  3BZC A;  3CCL A;  5LMN Q;  1JE4 A;  2K6A A;  4B3M L;  2VQE Q;  4FF4 A;  3VYS A;  5IYC H;  3ITP A;  5CGK A;  1U9R A;  2VXW A;  1PLF A;  2F0G A;  1SYF A;  4LUO A;  3JAM i;  1A63 A;  2KCN A;  2FHT A;  2K28 A;  1EZ8 A;  5COY A;  4WFN 3;  2KEN A;  1ENA A;  3J80 c;  4K2K A;  4MN3 A;  1BBX C;  4QL5 A;  3DLL A;  3VDY A;  5E4X A;  4WJW A;  4YCV A;  1JOO A;  2EJG C;  2HIX A;  3SEB A;  4KKU A;  4DV6 Q;  1F9Q A;  5ELO A;  1JWS D;  3EFX D;  1TWH B;  3CC4 A;  1PA6 A;  2JA7 H;  3VR5 A;  2OXP A;  1FNV A;  4X65 Q;  1H9R A;  2CFM A;  1SE2 A;  3H15 A;  2DNE A;  1IKL A;  2N55 A;  5ELF A;  3A0J A;  3PO3 B;  3G7L A;  5GRO A;  5M9O A;  1KC8 C;  3P7J A;  1LTB D;  1Z9F A;  3TBI B;  1SMY C;  3MFY A;  2F0L A;  4JI4 L;  3EBE A;  3S17 H;  4ZYS A;  4K5V A;  3Q8D A;  1HNX Q;  1IBL Q;  1JOR A;  3J7Y W;  3MVV A;  1SLJ A;  3DWQ A;  1L0Y B;  1WYD A;  4POF A;  5EPK A;  3DEP A;  2G9D A;  2WAQ B;  1SYG A;  5M5W H;  2B2W C;  4C3H G;  4B9W A;  2EXD A;  4HIK A;  2J7Z A;  4R4C A;  3TP6 A;  4HR7 B;  1G2S A;  2SNS A;  2WAQ E;  4DPG A;  4KD3 A;  2F0F A;  2VL6 A;  1E24 A;  2ZJQ A;  1DM0 B;  1VQH A;  3VR4 A;  1FNW A;  4IUP A;  3Q6S A;  2KCM A;  1VQM A;  3SR1 A;  2F03 A;  2L4N A;  4IO9 A;  4A3I G;  4JPB W;  1ML0 D;  2B2V A;  4WJ4 A;  1NY4 A;  4DNI A;  2PNR C;  4EQP A;  1D1I A;  1FJG L;  3ULJ A;  1N33 Q;  5GQO A;  1VQ6 A;  3DMU A;  2FJ2 A;  4FF2 A;  3NQI A;  1ZEQ X;  1A6X A;  3L3O C;  3I4M H;  1E2V A;  1EEI D;  1YZ6 A;  3ERO A;  3HP3 A;  4FDB A;  5LL6 S;  4CDD C;  1XNQ Q;  3S15 B;  1PFB A;  5C0X G;  2XWJ B;  4QUC A;  3HOY B;  4R8N A;  1X3F A;  3D6W A;  4L8J A;  3J7Z C;  2X6G A;  4A93 G;  4RGM A;  1EWC A;  2NYZ D;  3KFU A;  2D0P A;  1EY6 A;  3HG9 A;  4CJ2 C;  2L9H A;  1JB7 A;  1Y8P B;  4BS9 A;  1VQ5 A;  1NCV A;  1VQ8 A;  4HMI A;  1R4P B;  2HCI A;  1AZP A;  4DR6 L;  4G7O C;  4UP9 A;  1GUS A;  2WAQ G;  1PH3 A;  1C0A A;  1V1O A;  4A93 B;  1Q82 C;  3PO2 H;  2UU9 Q;  2K05 A;  4HMJ A;  2KBN A;  5C0X H;  1JJG A;  5LHY 1; 
#chains in the Genus database with same CATH homology
 3KF6 A;  1J5E Q;  1TWH H;  1S3O A;  1EYG A;  1I3Q H;  2WB1 G;  3GTG H;  3ERS X;  1N32 L;  1HZB A;  1PYS B;  1ASZ A;  4JI2 L;  4NXN Q;  1CKN A;  4H02 A;  4JOI C;  1VQ4 A;  1JJ2 A;  2JA7 G;  5HGQ A;  1KRS A;  4IPC A;  2JA8 H;  1QZH A;  1GO3 E;  3GTJ H;  1PH2 A;  1M90 C;  4P74 A;  2PQA A;  4HIM A;  1WOC A;  1EFW A;  4JI1 Q;  1A62 A;  1WCM H;  2R92 H;  3CC7 A;  2YTY A;  1HR0 Q;  4JI6 L;  3HOY G;  3H0G G;  2XGT A;  4DV5 Q;  4LF9 L;  1W3S A;  1LM0 A;  3ER0 A;  5C44 H;  4HJ7 A;  1IBM L;  2XTI A;  1PHJ A;  4DK3 C;  3HKZ G;  4DV6 L;  4DR1 Q;  1Q46 A;  3AFQ A;  4ALP A;  3T1H Q;  1Q7Y C;  4OO1 I;  3PO3 G;  3PGZ A;  4BA1 I;  4GNX C;  3CCE A;  1RL2 A;  3HOV H;  2MO1 A;  4GKK Q;  3J81 c;  3SGI A;  3NBH B;  5IP7 G;  1P16 A;  3PUZ A;  5GAE C;  3I4M G;  2MNA A;  2VQF L;  2UXD L;  4JI5 Q;  2JQO A;  1Q1E A;  1TXY A;  4LUV A;  1KD1 C;  1KAW A;  3GTO H;  3PCO B;  2QGQ A;  1ASY A;  2LSS A;  3M9B A;  5K36 G;  4GN5 A;  3D31 A;  2QEX A;  3M4Q A;  3A5Z B;  5C3E H;  5C4J H;  4AIM A;  1PH4 A;  2B29 A;  2YYZ A;  4DR5 L;  3HKS A;  1YJ9 A;  1LTL A;  3GTP H;  3U58 A;  4PG3 A;  3RZD H;  4BY7 G;  1JJG A;  3H3V I;  3T1Y L;  4A93 H;  4LF7 L;  5IYB H;  3S2H H;  2HQL A;  4BXX G;  1B70 B;  1D8L A;  2GVA A;  1TWA H;  4B3M Q;  4LF8 Q;  2HHH Q;  5LMN L;  2IY5 B;  1UWV A;  4IOC A;  4X64 Q;  5IP7 H;  4GNX A;  1VQP A;  1XMO Q;  1N34 Q;  2RHS B;  2Y0S G;  1K8G A;  3KF6 B;  2YU9 H;  1PH7 A;  2YTV A;  1VQJ A;  5LMN W;  4AQY Q;  1X3G A;  2AHO B;  2L15 A;  2ZTE A;  3WWV A;  2JEA I;  3S1Q H;  1VQE A;  1SRU A;  4DV4 L;  2DGY A;  1Y1V H;  1PH1 A;  3W1G A;  2IX0 A;  1SMX A;  1T9H A;  2F3I A;  4P75 A;  3UDI A;  3CCM A;  1HZA A;  4DV2 Q;  1XMQ Q;  2KHJ A;  3CC2 A;  2ATW A;  3M3Y H;  5M3F G;  1HNZ Q;  1M1K C;  4LFB L;  3DM3 A;  4P71 A;  2R93 H;  2AMC B;  1HJP A;  4JBJ A;  5EAY A;  4NB3 A;  1YNX A;  4MTN A;  2V1C C;  3BZK A;  1O7I A;  5C3E G;  4JI3 Q;  4NPS A;  2Q2T A;  5IWA Q;  1PH6 A;  3M4O H;  5IYC G;  5JJK A;  3J81 j;  4X66 L;  4YY3 L;  4PZ7 A;  1EIF A;  4QY7 A;  4LFC L;  4B3S L;  1HH2 P;  2JE6 I;  1I5F A;  4LFA L;  1JT8 A;  4TVA B;  2UXB Q;  4YCW A;  2GN5 A;  1YBY A;  5JJL A;  2DUD A;  3KF8 B;  1UE6 A;  2ZM6 L;  4DV7 Q;  2E2J H;  2PQA B;  1YHB A;  4C3I H;  1IBK Q;  1FVI A;  3CQZ H;  4LF4 L;  4DV3 Q;  4OON A;  4C3J H;  3NEM A;  3GDE A;  5AJ3 L;  1N36 L;  1GM5 A;  1MJE A;  1VQB A;  4O0A A;  4JBK A;  1L2F A;  4DR4 Q;  4EX5 A;  5LMU Q;  1S40 A;  1VQD A;  2VUM G;  3PF4 A;  3TS2 A;  1Z47 A;  2BA0 A;  1PV4 A;  2R7Z G;  4L5R C;  2MFI A;  2BA1 A;  3RLN A;  3CCS A;  2UUA L;  4L5S A;  4DV1 L;  4B3R Q;  2A19 A;  4DV0 L;  2A8V A;  1YJW A;  4LF6 Q;  4DR2 Q;  4JV5 Q;  4NXM Q;  3S24 A;  2AWO A;  3CCU A;  4X62 Q;  4BBR H;  3HOX H;  3S1N H;  3KDF A;  1BBW A;  5BR8 Q;  1KXL A;  4IOA A;  5C4X G;  3S2D H;  2D62 A;  4P72 A;  4JG2 A;  2PMZ E;  4KHP L;  3I56 A;  2UUC L;  4A3B G;  1YHA A;  1PH5 A;  4JCV E;  3RZO H;  1IZ6 A;  1E3P A;  2CKZ B;  3G4S A;  1N8R C;  1BVS A;  3E0E A;  2RHQ B;  2E5L L;  4BXX H;  1K0R A;  5IP9 H;  4KI0 A;  1YHQ A;  4JBW A;  4MNO A;  1L1O B;  2K4K A;  1IL2 A;  4HIO A;  1JJC B;  3AFP A;  1HNW Q;  3JAM c;  2UUC Q;  4IFD I;  1QUQ B;  3M7N A;  4AYB G;  1PFS A;  4OXP A;  4HJ5 A;  4P73 A;  1Y1W H;  1OTC A;  3PO2 G;  4A3G H;  2K75 A;  3KOJ A;  2R7Z H;  5BR8 L;  3EIV A;  3GD7 A;  3HOZ G;  3KJO A;  4X62 L;  1L1O A;  2R7D A;  3J81 i;  1IYJ B;  3PUY A;  3HOW G;  4NXM L;  2Q2I A;  3CXC A;  4BBS H;  4DR2 L;  2VY3 A;  4HID A;  4GKJ Q;  3CPW A;  4DUZ Q;  4DV0 Q;  1YIT A;  4B3R L;  3PUW A;  1S72 A;  2UUA Q;  1X56 A;  2RF4 A;  1UE5 A;  3RLO A;  4LNQ A;  2WB1 E;  1VQF A;  2D0O A;  4YWL A;  3GTK H;  4DR4 L;  5FLX c;  4DV3 L;  4JBM A;  2JA8 G;  4GLA C;  2E2H H;  1HR0 W;  4GLX A;  2CWA A;  3E9H A;  4DV7 L;  4YCU A;  4BBR G;  2NZH A;  2PNH A;  3I7F A;  4HJ8 A;  3RNU A;  2ALY B;  1XJV A;  1UE7 A;  3G71 A;  3OW2 A;  2UXB L;  1A8V A;  1WFQ A;  5ELN A;  5M3M H;  3H3V H;  4PMW A;  4LFC Q;  1VQN A;  4OX9 Q;  1K8A C;  4X6A H;  2K14 A;  5JEA J;  1E22 A;  4GS3 A;  4YY3 Q;  1YIJ A;  2WFW A;  1KQS A;  4B3T L;  4MZ9 A;  1GD7 A;  4C3H H;  3ULL A;  3W1B A;  4BY1 G;  5IP9 G;  1BBU A;  3ZJY C;  2JA6 H;  4WJ3 M;  1E1O A;  1L1O C;  2NVT H;  1WJJ A;  1PVO A;  1VQA A;  4QJF A;  3RN5 A;  4B3T Q;  4UY8 C;  1W2B A;  4OX9 L;  2I5H A;  2N3S A;  1HNZ L;  1MJC A;  4KHZ A;  4DV2 L;  1XMQ L;  3HOW H;  1G6P A;  1GVP A;  4XTC S;  2PI2 A;  2N8N A;  4A3J G;  4O2D A;  4DV4 Q;  4GOP A;  1OXX K;  3UE0 A;  3D0F A;  3GTQ H;  1YI2 A;  4A3D H;  4OO1 G;  2E2I H;  2N78 A;  4GLV B;  2A1A A;  2R6G A;  3KJP A;  1R9T H;  1CSP A;  4BY7 H;  1SRO A;  2NVQ H;  1TWG H;  1XMO L;  4R4I A;  1KRT A;  3FHW A;  4DUZ L;  1NJI C;  4GKJ L;  4AYB E;  4A3F H;  1YEZ A;  2B63 G;  1JE5 A;  3BU2 A;  4L5T A;  3STB C;  4LF8 L;  1IXR A;  3AYH B;  3I55 A;  1MIU A;  4LF7 Q;  3CP0 A;  5IT9 c;  3PIP A;  1GKH A;  1RIP A;  3OYY A;  4GN3 B;  4OWX B;  1HNW L;  2I5M X;  3GTL H;  2K5H A;  1Q86 C;  2H5X A;  4XIG S;  2VS1 A;  4KLK A;  2E5L Q;  4A3L H;  4TQU S;  3J7A 5;  2JEB I;  3MXN B;  3TS0 A;  1K9M C;  5FLM G;  3CD6 A;  1VQC A;  2ZJR A;  4KHP Q;  1VQK A;  2LXK A;  1A0I A;  4IJL A;  3UDX A;  1LUZ A;  2EQS A;  4AH6 A;  2VQF Q;  1KIX A;  4QQB X;  2OTJ A;  3M85 A;  3G6E A;  1X3E A;  4L5Q A;  2ZTC A;  1QZG A;  4GKK L;  2HT1 A;  2NN6 I;  3EN2 A;  4JV5 L;  4A3F G;  4LF6 L;  2IT1 A;  2FXQ A;  1VQL A;  3T1H L;  1E1T A;  3TRZ A;  4DV1 Q;  1K73 C;  1CKO A;  4DKA C;  4DV5 L;  1EUJ A;  5LMU L;  1J6Q A;  2K50 A;  1X54 A;  1Q81 C;  1N9W A;  1N36 Q;  5M5Y H;  5AJ3 Q;  2B63 H;  3TRE A;  3HKZ E;  4LF4 Q;  1AE2 A;  1KL9 A;  3K7U C;  1CKM A;  3U4Z A;  1B8A A;  2QA4 A;  1PH9 A;  1IBK L;  5M5X H;  4UP8 A;  1X55 A;  1EQR A;  2ZM6 Q;  2ID0 A;  2YV5 A;  2JA9 A;  3CW2 C;  4LFA Q;  4RG1 A;  1NTG A;  4B3S Q;  4IFD G;  4R4T A;  4GN4 B;  3KDF B;  2OQK A;  4X66 Q;  5IYD H;  1QVC A;  3FKI H;  1N32 Q;  3UE1 A;  5IWA L;  1VQ9 A;  4APV A;  3F2B A;  3G48 A;  5IY0 A;  4A3K H;  4JI3 L;  2IHE A;  5FLM H;  1J5E L;  3UDF A;  4POG A;  4QIW E;  2VUM H;  2MO0 A;  4JYA Q;  3B6Y A;  4A3D G;  2MQH A;  2N49 A;  1OXU A;  2CQO A;  5IE8 A;  3HFZ B;  5M3F H;  4A3E H;  4LFB Q;  5GAG C;  2R7F A;  4GNX B;  1NE3 A;  3LGJ A;  4OWT B;  4A3J H;  1VS0 A;  3CCJ A;  1V1Q A;  1I6H H;  1Y1V G;  3U4V A;  1I94 L;  4DAM A;  5JJI A;  4AQY L;  3M4P A;  3FP9 A;  1Q8K A;  2BH8 A;  2ES2 A;  4DK6 C;  2ASB A;  3PV0 A;  2JK8 A;  1Y1W G;  1C7Y A;  1Q1B A;  1XNR L;  3BZC A;  1N34 L;  4A3G G;  4X64 L;  3A5U A;  3CCL A;  1B7Y B;  2Z6K C;  5LMN Q;  1NMG A;  1G51 A;  5GAH C;  1QVG A;  2HHH L;  2F52 A;  4B3M L;  5HY6 A;  2VQE Q;  1OXT A;  3ULP A;  1UE1 A;  5IYC H;  5C0X J;  1VQG A;  3RN2 A;  4OWW B;  1Y14 B;  4K0K L;  2NVX H;  2GVB A;  3T1Y Q;  2OWO A;  2UXC Q;  3K7A H;  4LUO A;  4HJ9 A;  3JAM i;  3W5O A;  1A63 A;  2B3G A;  4DR5 Q;  4A3E G;  1AE3 A;  1OXS C;  2PI2 E;  4A3M H;  2K5V A;  4A3L G;  1LYL A;  3S1M H;  2WP8 J;  2KEN A;  4JI7 L;  1XTD A;  1QVF A;  2NN6 G;  1DGS A;  3J80 c;  4QGU A;  4JI5 L;  2UXD Q;  1TWF H;  2E8G A;  4Y7N H;  4QL5 A;  3F1Z A;  3DLL A;  2CCZ A;  3VDY A;  3STB D;  1FJG Q;  3CF5 A;  1N33 L;  4YCV A;  4A4I A;  2JA6 G;  3PIO A;  1XPO A;  1SR3 A;  2HIX A;  3K8A A;  3BJU A;  4DR1 L;  3CCR A;  3A74 A;  4DV6 Q;  1EOV A;  5ELO A;  1I50 H;  5C4X H;  1IBM Q;  4LF9 Q;  1CKN B;  1SE8 A;  3K81 C;  5IYB G;  1PA6 A;  3CC4 A;  2JA7 H;  4IPD A;  4JI6 Q;  3HOY H;  1HR0 L;  3J80 i;  3UDG A;  2KHI A;  5E7N A;  4GOP C;  4BY1 H;  4A3C H;  4JI1 L;  1VQ7 A;  4X65 Q;  1AH9 A;  3HOZ H;  2CFM A;  4A3M G;  3H15 A;  1FL0 A;  3FKI G;  4JOI A;  4DR3 Q;  2CWP A;  1XPU A;  3I2Z A;  2JA5 H;  5GAD C;  3RLF A;  2YTX A;  1SN8 A;  3A0J A;  3H0G H;  1HZ9 A;  1HZC A;  1QUQ A;  4NXN L;  2K52 A;  5GRO A;  4JI2 Q;  5FJ8 H;  3L2P A;  1KC8 C;  4R1J A;  4LWC A;  1Z9F A;  1K83 H;  4YWK A;  1X6O A;  4R4O A;  3TQY A;  4A75 A;  3S1R H;  2UUB Q;  4DUY Q;  1X65 A;  1V43 A;  1C9O A;  4JI0 L;  4LW1 A;  4EQ5 A;  4JC0 A;  4DR7 L;  4ME3 A;  2UU9 L;  1MKH A;  4JI4 L;  3EBE A;  2Q2H A;  4C2M H;  3S17 H;  5JEA G;  4HJA A;  1YJN A;  3PUX A;  2I0Q A;  3Q8D A;  4J15 A;  1HNX Q;  1WI5 A;  1IBL Q;  5J3B A;  2IHF A;  1CSQ A;  2C35 B;  2NZO A;  4YWM A;  1VQI A;  1L0W A;  5C0X I;  1OXV A;  1NMF A;  2AWN A;  4DR6 Q;  3I4O A;  3CME A;  1SLJ A;  1VCI A;  1YVC A;  2ZTD A;  1WYD A;  4R4Q A;  4POF A;  3E9I A;  4UPA A;  4JI4 Q;  4A3C G;  1JMC A;  1PYB A;  4DR7 Q;  1NBW A;  5M5W H;  4A3I H;  4JI0 Q;  1D7Q A;  4IPH A;  4DUY L;  3CPF A;  2UUB L;  2OTL A;  2EXD A;  4HIK A;  3MEF A;  4LF5 L;  4JI8 L;  3OTO Q;  4R4C A;  1V9P A;  4A76 A;  4IJH A;  1BKB A;  3HOU G;  2JJQ A;  5FJ8 G;  4YHH L;  3JC6 6;  2WAQ E;  4DPG A;  1K3R A;  2F4V L;  2VL6 A;  1E24 A;  1PH8 A;  3F2D A;  2ZJQ A;  2LXJ A;  1VQH A;  3ICE A;  4DR3 L;  1X9N A;  3U50 C;  4X65 L;  1XNQ L;  2HIV A;  1WCM G;  3S15 H;  2KCM A;  4PZ6 A;  3CCQ A;  2R93 G;  3I4N H;  2OCE A;  1VQM A;  2EIF A;  4IO9 A;  3GO5 A;  4A3I G;  3I4N G;  1TWC H;  2VNU D;  3S16 H;  1NY4 A;  4DNI A;  2VW9 A;  4WJ4 A;  4BBS G;  1P8L A;  3ULJ A;  1FJG L;  1N33 Q;  5GQO A;  1VQ6 A;  2I5L X;  2JA5 G;  4Y52 H;  3F8T A;  1U0L A;  4IPG A;  3I4M H;  1YZ6 A;  4FDB A;  1H95 A;  1XNQ Q;  3PSI A;  5DLQ E;  4JI7 Q;  3HOV G;  4UP7 A;  3CCV A;  3S14 H;  5C0X G;  3PUV A;  3K0X A;  4RMF A;  3HOU H;  3L7Z C;  2Y0S E;  1EIY B;  2OQ0 A;  1X3F A;  2F4V Q;  3F2C A;  4YHH Q;  2ZJP A;  3TEH B;  1UEB A;  2Z6K A;  3J7Z C;  3CMA A;  2RCN A;  1EWI A;  4K0K Q;  4DAY B;  4A93 G;  1E7Z A;  2UXC L;  4LUZ A;  1Q12 A;  2KCT A;  3NEN A;  2VQE L;  4A3B H;  3OTO L;  3KYH C;  4JI8 Q;  2Q2U A;  4LF5 Q;  3KFU A;  2D0P A;  1XPR A;  5M3M G;  3HOX G;  3L0O A;  1JB7 A;  3AEV A;  3PF5 A;  1VQ5 A;  2NVY H;  1XNR Q;  3NEL A;  4IFD J;  2AKW B;  4GOP B;  2VZA A;  1VQ8 A;  5C44 G;  1EQQ A;  4DR6 L;  1SFO H;  1I94 Q;  1VQO A;  3GTM H;  1FGU A;  4UP9 A;  2WAQ G;  3PO3 H;  2K5N A;  1PH3 A;  2BH2 A;  4A3K G;  3AQQ A;  1HNX L;  3CAM A;  1IBL L;  3KLW A;  2R92 G;  1CUK A;  1G29 1;  3K80 C;  3RR5 A;  1C0A A;  1U5K A;  1KHI A;  1Q82 C;  3IRB A;  3PO2 H;  5IYD G;  4PZ8 A;  2UU9 Q;  5H1S E;  4JYA L;  4BA2 I;  2IX1 A;  2KBN A;  2Z0S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...