2Z6MA

Crystal structure of human ferritin h8 as biotemplate for noble metal nanoparticle synthesis
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
172
structure length
172
Chain Sequence
TSQVRQNYDQDSEAAINRQINLELYASYVYLSMSYYFDRDDVALKNFAKYFLHQSHEERCHAEKLMKLQNQRGGRIFLQDIKKPDRDDWESGLNAMEAALQLEKNVNQSLLELHKLATDKNDPHLCDFIETHYLNCQVCAIKCLGDHVTNLRKMGAPESGLAEYLFDKHTLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferritin heavy chain
publication title Directing noble metal ion chemistry within a designed ferritin protein
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 75
structure length 172
sequence length 172
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 1.16.3.1: Ferroxidase.
pdb deposition date 2007-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 2z6mA00
4PG1A 3ISFA 4LYUA 2CN7A 2ZG8X 2ZURX 2CLUA 3PVRA 2BW1A 4XGSA 2FG8A 3IQ1A 3PWQA 2FKZA 2FZFA 3PVRB 2BJYA 2XJOA 2V2PA 4IWJA 5LG2A 3QD8A 1JI5A 2HR5A 3FI6A 4MUDA 4ML5A 1RCGA 5LS9A 1TKOA 1LB3A 2JD60 4RC6A 3TA8A 3SIDA 3R2SA 2YJKA 3RBCA 4RC6B 5K53A 2YJJA 3F32A 4LQHA 5K52A 4Z3BA 5GN8A 1HRSA 5GN8B 3KA9A 4ZMCA 3IS7A 4ZL5A 2ZG9X 1RCEA 2VXXA 1YUXA 2X170 3EZ0A 1XZ3A 3PW8C 4RC7A 5FFAA 4ITTA 1JREA 3AJOA 1UMNA 4RC7B 3A68A 5FFDA 1F33A 4QUWA 2OC5A 2BKCA 1EUMA 1LKPA 3F36A 2IY4A 5HQOA 2QQYA 3OGHA 4OYNA 4TOGA 1YUZA 3UOIA 1VELA 3MPSA 1BCFA 5CMRA 2ZA7A 2YW7A 5GU1X 3QVDA 3F39A 2UX1A 5FFCA 4IXKA 4AM5A 4ITWA 2HTNA 1J30A 4A25A 3U90A 4DYXA 3F37A 5J8WA 1AEWA 1NF4A 2Z5PA 4ZKHA 3E1JA 5D8OA 3E6RA 3R2MA 4DYYA 4ISPA 3GVYA 5HJHA 3FVBA 2RBDA 4AM4A 4PGKA 3H7GA 1JIGA 4ZKXA 3AJPA 1VLGA 1Z6OA 1XZ1A 1DPSA 1R03A 3WVVA 4TOAA 4MKUA 5FFBA 1S2ZA 5JKLG 3PW8A 4RC5A 4TW3A 2FHAA 3PWFA 5CZUA 4RC5B 4DZ0A 3RAVA 4TOFA 1TKPA 1UVHA 1NFVA 3BVLA 2Z6MA 2C2UA 5LG8A 3NOZX 3KX9A 4TO9A 3UNOA 3PZAA 3E1OA 4ETRA 3SHXA 4LQVA 3FSEA 4TOHA 3GE4A 1H96A 4DYUA 2ITBA 2V2NA 2V2OA 3AF8X 2CHIA 2Y3QA 3PVYA 1FHAA 5IX6A 4Y08A 4ZJKA 2W0OA 1VEQA 4EVCA 3WVWA 3PVYB 4XKTA 2V2IA 4EVDA 1JTSA 3HL1A 4CVPA 1SQ3A 3UOFA 5D8PA 4E6KA 2D5KA 4EVBA 1JKUA 4REUA 1Z4AA 2GYDA 3QHCA 4DE6A 3R2RA 1JI4A 3KXUA 1NF6A 1TJOA 1DVBA 2C2FA 4Z5SA 4ZKWA 1S3QA 3QZ3A 2V2MA 3VNXA 3AK9A 1GWGA 5J8SA 2CHPA 1TK6A 1IERA 4M35A 3AF7X 1Z6OM 5GU3X 3F34A 4M34A 3F33A 3KA3A 2CN6A 5GU2X 3BVFA 2JD80 3PVTA 3RE7A 2C2JA 3PVTB 4CVSA 3E1QA 3BVKA 4DI0A 5J93A 3BT5A 2WTLA 2Z90A 4TOCA 5HJFA 5J9VA 2XJNA 1ZS3A 4M33A 4LYXA 1DATA 2GYQA 2FFXJ 2IB0A 4PGIA 1O9IA 3Q4OA 3E1NA 3O7RA 4LPMA 4KVQA 1QGHA 3ISEA 1NNQA 3NP2X 1OTKA 4TOEA 2ZA6A 3IS8A 1LKOA 3KA8A 4DASA 4MN9A 4ZLWA 1JYBA 3KA6A 2GS4A 3BVIA 3KA4A 4TODA 3R2HA 5D8QA 5GU0X 3Q4QA 3WVUA 5E2DA 2ZG7X 4LPNA 3F35A 2V2RA 1VJXA 5E1UA 3AJQA 4ISMA 2C6RA 2XKQA 1ZUJA 3KWOA 1KRQA 2BK6A 1SOFA 3SE1A 5D8RA 1MFRA 2G4HA 1RCDA 2V15A 5CMQA 4KVRA 2PYBA 3ES3A 2FG4A 2V2SA 5GOUA 5C6FA 2Z5RA 3BVEA 1L8HA 2VZBA 2XJMA 1B71A 3OJ5A 2IU2A 3R2LA 2XGWA 4ERUA 4U3GA 3RD0A 4CY9A 3ERZA 3RGDA 3EGMA 5JACA 2JD70 3GHQA 1O9RA 2V2LA 1L8IA 2CEIA 4XKUA 2CIHA 2OH3A 4II4A 4ZL6A 5JKMA 1S30A 3A9QA 4KVSA 4LPJA 4MY7A 4II4B 1LKMA 1N1QA 4P18A 3Q4NA 5JKLA 1IESA 3E2CA 4XKSA 4MJYA 2VXIA 4CYBA 5ERJA 4IWKA 3QB9A 5D8YA 3O7SA 4CMYV 3HIUA 4CVRA 4CYAA 4CMYA 4CVTA 1BFRA 2ZA8A 4EVEA 3NP0X 3PWQC 2YW6A 3F38A 2CF7A 3SH6A 1JGCA 4TOBA 3E6SA 5FFEA 1QYBA 4ZTTA 5D8XA 5LBHA 4M32A 3PW1A 2F7NA 3BKNA 3R2OA 2WLAA 1BG7A 1RCIA 4AM2A 3PW1B 1JKVA 2QF9A 4R42A 4PG0A 3QHBA 5I4JA 3WNWA 2Z5QA 4LQNA 4DYZA 2FJCA 5ERKA 3R2KA 4RC8A 1MOJA 3E1LA 2WLUA 3E1PA 2FL0A 5JKMG 3AK8A 1RCCA 3AF9X 1YV1A 2CLBA 1RYTA 3EZUA 1VEIA 1F30A 5FEJA 3T9JA 4YKHA 2C41A 3Q4RA 3E1MA 5D8SA 5AXSA 4LQJA 2V2JA
chains in the Genus database with same CATH superfamily
4PG1A 3ISFA 4LYUA 2CN7A 2ZG8X 2ZURX 2CLUA 3PVRA 2BW1A 4XGSA 2FG8A 3IQ1A 3PWQA 2FKZA 2FZFA 3PVRB 2BJYA 2XJOA 2V2PA 4IWJA 5LG2A 3QD8A 1JI5A 2HR5A 3FI6A 4MUDA 4ML5A 2AR0A 1RCGA 5LS9A 1TKOA 1LB3A 2JD60 4RC6A 3TA8A 3SIDA 3R2SA 2YJKA 3RBCA 3DBYA 4RC6B 5K53A 2YJJA 3F32A 4LQHA 5K52A 4E40A 4Z3BA 5GN8A 3GGZA 1HRSA 5GN8B 3KA9A 3M6JA 4ZMCA 3IS7A 4ZL5A 2ZG9X 1RCEA 2VXXA 1YUXA 2X170 3EZ0A 3GGYA 1XZ3A 3PW8C 4RC7A 5FFAA 4ITTA 1JREA 3AJOA 1UMNA 3V3KB 4RC7B 3A68A 3C1YA 5FFDA 1F33A 4QUWA 2OC5A 2BKCA 1EUMA 1LKPA 3F36A 3KHKA 2IY4A 5HQOA 2QQYA 3OGHA 4OYNA 4TOGA 1YUZA 3UOIA 1VELA 3MPSA 1BCFA 5CMRA 2ZA7A 2YW7A 5GU1X 3QVDA 3F39A 2UX1A 5FFCA 4IXKA 4AM5A 4ITWA 2HTNA 1J30A 4A25A 3U90A 4DYXA 3VV9A 3F37A 5J8WA 1AEWA 1NF4A 2Z5PA 4ZKHA 3E1JA 5D8OA 3E6RA 3R2MA 4DYYA 4ISPA 3GVYA 5HJHA 3FVBA 2RBDA 4AM4A 4PGKA 3H7GA 1JIGA 4ZKXA 3AJPA 1VLGA 1Z6OA 4WJG4 1XZ1A 1DPSA 1R03A 3WVVA 4TOAA 4MKUA 5FFBA 1S2ZA 5JKLG 3PW8A 4RC5A 4TW3A 2FHAA 3PWFA 5CZUA 4RC5B 4DZ0A 3RAVA 4TOFA 1TKPA 4YXMA 1UVHA 1NFVA 3BVLA 2Z6MA 2C2UA 5LG8A 3NOZX 3KX9A 4TO9A 3UNOA 3PZAA 3E1OA 4ETRA 3SHXA 4LQVA 3FSEA 2V8UA 4TOHA 3GE4A 2N02A 1H96A 4DYUA 2ITBA 2V2NA 2V2OA 3AF8X 4X0JA 4YXJA 5JDOA 2CHIA 2Y3QA 3PVYA 1FHAA 5JDOB 5IX6A 4Y08A 4ZJKA 2W0OA 1VEQA 4EVCA 3WVWA 3PVYB 4XKTA 2V2IA 4EVDA 1JTSA 3HL1A 4CVPA 1SQ3A 3UOFA 3C21A 5D8PA 4E6KA 2D5KA 4EVBA 1JKUA 4REUA 1Z4AA 2GYDA 2WWXB 3QHCA 4DE6A 3R2RA 1JI4A 3KXUA 1NF6A 1TJOA 1DVBA 2C2FA 4Z5SA 4ZKWA 2Y44A 1S3QA 3QZ3A 2V2MA 3VNXA 3AK9A 1GWGA 5J8SA 2CHPA 3D19A 1TK6A 1IERA 4M35A 3AF7X 1Z6OM 5GU3X 3F34A 2V8TA 3JZAB 4M34A 3F33A 3N6OA 3KA3A 3VVAA 2CN6A 5GU2X 3BVFA 2JD80 3PVTA 3RE7A 2C2JA 3PVTB 4CVSA 3E1QA 3BVKA 3UFBA 4DI0A 5J93A 3BT5A 2WTLA 2Z90A 4TOCA 5HJFA 5J9VA 2XJNA 1ZS3A 4M33A 4LYXA 1DATA 2GYQA 2FFXJ 2IB0A 4PGIA 4KXRB 1O9IA 3Q4OA 3E1NA 4W4KB 3O7RA 4LPMA 4KVQA 1QGHA 3ISEA 1NNQA 3NP2X 1OTKA 2OKCA 4TOEA 2ZA6A 3IS8A 1LKOA 3KA8A 4DASA 4MN9A 4ZLWA 1JYBA 3KA6A 2GS4A 3BVIA 3KA4A 4TODA 3R2HA 5D8QA 5GU0X 3Q4QA 3WVUA 5E2DA 2ZG7X 4LPNA 3F35A 2V2RA 1VJXA 5E1UA 3AJQA 4ISMA 2C6RA 2XKQA 1ZUJA 3KWOA 1KRQA 2BK6A 1SOFA 3LKDA 3SE1A 5D8RA 4W4LB 1MFRA 2G4HA 3FRSA 1RCDA 2V15A 5CMQA 4KVRA 2PYBA 3ES3A 2FG4A 2V2SA 5GOUA 5C6FA 2Z5RA 3BVEA 1L8HA 2VZBA 2XJMA 1B71A 3OJ5A 2IU2A 3R2LA 2XGWA 4ERUA 4U3GA 3RD0A 4CY9A 3ERZA 3RGDA 3EGMA 5JACA 2JD70 3C23A 3GHQA 1O9RA 2V2LA 1L8IA 2CEIA 4XKUA 2CIHA 2OH3A 3L0MA 4II4A 4ZL6A 5JKMA 1S30A 3A9QA 4KVSA 4LPJA 4MY7A 3FRRA 4II4B 1LKMA 1N1QA 3W54A 4P18A 3Q4NA 5JKLA 1IESA 3E2CA 4XKSA 4MJYA 2VXIA 3JZ9A 4CYBA 5ERJA 2G38B 4IWKA 3QB9A 5D8YA 3O7SA 4CMYV 4YVZA 3HIUA 4CVRA 4CYAA 4CMYA 4CVTA 1BFRA 2ZA8A 4EVEA 3NP0X 3PWQC 2YW6A 3F38A 2CF7A 3SH6A 1JGCA 3C1ZA 4TOBA 3E6SA 5FFEA 1QYBA 4ZTTA 5D8XA 5LBHA 4M32A 3PW1A 2F7NA 3BKNA 3R2OA 2WLAA 1BG7A 1RCIA 4AM2A 3PW1B 1JKVA 2QF9A 4PG0A 4R42A 3QHBA 2MGYA 5I4JA 3WNWA 2Z5QA 4LQNA 2CWLA 4DYZA 2FJCA 5ERKA 3R2KA 4RC8A 1MOJA 3E1LA 2WLUA 3E1PA 2FL0A 5JKMG 3AK8A 4MXPA 1RCCA 3AF9X 1YV1A 5HU6D 2CLBA 1RYTA 3EZUA 1VEIA 3KDQA 1F30A 5FEJA 3T9JA 4YKHA 2C41A 3Q4RA 3E1MA 5D8SA 5AXSA 4LQJA 2V2JA
chains in the Genus database with same CATH topology
4PG1A 3ISFA 4LYUA 2CN7A 2ZG8X 2ZURX 2CLUA 3PVRA 2BW1A 4XGSA 2FG8A 3IQ1A 3PWQA 2FKZA 2FZFA 3PVRB 2BJYA 2XJOA 2V2PA 4IWJA 5LG2A 3QD8A 1JI5A 2HR5A 3FI6A 4MUDA 4ML5A 2AR0A 1RCGA 5LS9A 1TKOA 1LB3A 2JD60 4RC6A 3TA8A 3SIDA 3R2SA 2YJKA 3RBCA 3DBYA 4RC6B 5K53A 2YJJA 3F32A 4LQHA 5K52A 4E40A 4Z3BA 5GN8A 3GGZA 1HRSA 5GN8B 3KA9A 3M6JA 4ZMCA 3IS7A 4ZL5A 2ZG9X 1RCEA 2VXXA 1YUXA 2X170 3EZ0A 3GGYA 1XZ3A 3PW8C 4RC7A 5FFAA 4ITTA 1JREA 3AJOA 1UMNA 3V3KB 4RC7B 3A68A 3C1YA 5FFDA 1F33A 4QUWA 2OC5A 2BKCA 1EUMA 1LKPA 3F36A 3KHKA 2IY4A 5HQOA 2QQYA 3OGHA 4OYNA 4TOGA 1YUZA 3UOIA 1VELA 3MPSA 1BCFA 5CMRA 2ZA7A 2YW7A 5GU1X 3QVDA 3F39A 2UX1A 5FFCA 4IXKA 4AM5A 4ITWA 2HTNA 1J30A 4A25A 3U90A 4DYXA 3VV9A 3F37A 5J8WA 1AEWA 1NF4A 2Z5PA 4ZKHA 3E1JA 5D8OA 3E6RA 3R2MA 4DYYA 4ISPA 3GVYA 5HJHA 3FVBA 2RBDA 4AM4A 4PGKA 3H7GA 1JIGA 4ZKXA 3AJPA 1VLGA 1Z6OA 4WJG4 1XZ1A 1DPSA 1R03A 3WVVA 4TOAA 4MKUA 5FFBA 1S2ZA 5JKLG 3PW8A 4RC5A 4TW3A 2FHAA 3PWFA 5CZUA 4RC5B 4DZ0A 3RAVA 4TOFA 1TKPA 4YXMA 1UVHA 1NFVA 3BVLA 2Z6MA 2C2UA 5LG8A 3NOZX 3KX9A 4TO9A 3UNOA 3PZAA 3E1OA 4ETRA 3SHXA 4LQVA 3FSEA 2V8UA 4TOHA 3GE4A 2N02A 1H96A 4DYUA 2ITBA 2V2NA 2V2OA 3AF8X 4X0JA 4YXJA 5JDOA 2CHIA 2Y3QA 3PVYA 1FHAA 5JDOB 5IX6A 4Y08A 4ZJKA 2W0OA 1VEQA 4EVCA 3WVWA 3PVYB 4XKTA 2V2IA 4EVDA 1JTSA 3HL1A 4CVPA 1SQ3A 3UOFA 3C21A 5D8PA 4E6KA 2D5KA 4EVBA 1JKUA 4REUA 1Z4AA 2GYDA 2WWXB 3QHCA 4DE6A 3R2RA 1JI4A 3KXUA 1NF6A 1TJOA 1DVBA 2C2FA 4Z5SA 4ZKWA 2Y44A 1S3QA 3QZ3A 2V2MA 3VNXA 3AK9A 1GWGA 5J8SA 2CHPA 3D19A 1TK6A 1IERA 4M35A 3AF7X 1Z6OM 5GU3X 3F34A 2V8TA 3JZAB 4M34A 3F33A 3N6OA 3KA3A 3VVAA 2CN6A 5GU2X 3BVFA 2JD80 3PVTA 3RE7A 2C2JA 3PVTB 4CVSA 3E1QA 3BVKA 3UFBA 4DI0A 5J93A 3BT5A 2WTLA 2Z90A 4TOCA 5HJFA 5J9VA 2XJNA 1ZS3A 4M33A 4LYXA 1DATA 2GYQA 2FFXJ 2IB0A 4PGIA 4KXRB 1O9IA 3Q4OA 3E1NA 4W4KB 3O7RA 4LPMA 4KVQA 1QGHA 3ISEA 1NNQA 3NP2X 1OTKA 2OKCA 4TOEA 2ZA6A 3IS8A 1LKOA 3KA8A 4DASA 4MN9A 4ZLWA 1JYBA 3KA6A 2GS4A 3BVIA 3KA4A 4TODA 3R2HA 5D8QA 5GU0X 3Q4QA 3WVUA 5E2DA 2ZG7X 4LPNA 3F35A 2V2RA 1VJXA 5E1UA 3AJQA 4ISMA 2C6RA 2XKQA 1ZUJA 3KWOA 1KRQA 2BK6A 1SOFA 3LKDA 3SE1A 5D8RA 4W4LB 1MFRA 2G4HA 3FRSA 1RCDA 2V15A 5CMQA 4KVRA 2PYBA 3ES3A 2FG4A 2V2SA 5GOUA 5C6FA 2Z5RA 3BVEA 1L8HA 2VZBA 2XJMA 1B71A 3OJ5A 2IU2A 3R2LA 2XGWA 4ERUA 4U3GA 3RD0A 4CY9A 3ERZA 3RGDA 3EGMA 5JACA 2JD70 3C23A 3GHQA 1O9RA 2V2LA 1L8IA 2CEIA 4XKUA 2CIHA 2OH3A 3L0MA 4II4A 4ZL6A 5JKMA 1S30A 3A9QA 4KVSA 4LPJA 4MY7A 3FRRA 4II4B 1LKMA 1N1QA 3W54A 4P18A 3Q4NA 5JKLA 1IESA 3E2CA 4XKSA 4MJYA 2VXIA 3JZ9A 4CYBA 5ERJA 2G38B 4IWKA 3QB9A 5D8YA 3O7SA 4CMYV 4YVZA 3HIUA 4CVRA 4CYAA 4CMYA 4CVTA 1BFRA 2ZA8A 4EVEA 3NP0X 3PWQC 2YW6A 3F38A 2CF7A 3SH6A 1JGCA 3C1ZA 4TOBA 3E6SA 5FFEA 1QYBA 4ZTTA 5D8XA 5LBHA 4M32A 3PW1A 2F7NA 3BKNA 3R2OA 2WLAA 1BG7A 1RCIA 4AM2A 3PW1B 1JKVA 2QF9A 4PG0A 4R42A 3QHBA 2MGYA 5I4JA 3WNWA 2Z5QA 4LQNA 2CWLA 4DYZA 2FJCA 5ERKA 3R2KA 4RC8A 1MOJA 3E1LA 2WLUA 3E1PA 2FL0A 5JKMG 3AK8A 4MXPA 1RCCA 3AF9X 1YV1A 5HU6D 2CLBA 1RYTA 3EZUA 1VEIA 3KDQA 1F30A 5FEJA 3T9JA 4YKHA 2C41A 3Q4RA 3E1MA 5D8SA 5AXSA 4LQJA 2V2JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PG1 A;  3ISF A;  4LYU A;  2CN7 A;  2ZG8 X;  2ZUR X;  2CLU A;  3PVR A;  2BW1 A;  4XGS A;  2FG8 A;  3IQ1 A;  3PWQ A;  2FKZ A;  2FZF A;  3PVR B;  2BJY A;  2XJO A;  2V2P A;  4IWJ A;  5LG2 A;  3QD8 A;  1JI5 A;  2HR5 A;  3FI6 A;  4MUD A;  4ML5 A;  1RCG A;  5LS9 A;  1TKO A;  1LB3 A;  2JD6 0;  4RC6 A;  3TA8 A;  3SID A;  3R2S A;  2YJK A;  3RBC A;  4RC6 B;  5K53 A;  2YJJ A;  3F32 A;  4LQH A;  5K52 A;  4Z3B A;  5GN8 A;  1HRS A;  5GN8 B;  3KA9 A;  4ZMC A;  3IS7 A;  4ZL5 A;  2ZG9 X;  1RCE A;  2VXX A;  1YUX A;  2X17 0;  3EZ0 A;  1XZ3 A;  3PW8 C;  4RC7 A;  5FFA A;  4ITT A;  1JRE A;  3AJO A;  1UMN A;  4RC7 B;  3A68 A;  5FFD A;  1F33 A;  4QUW A;  2OC5 A;  2BKC A;  1EUM A;  1LKP A;  3F36 A;  2IY4 A;  5HQO A;  2QQY A;  3OGH A;  4OYN A;  4TOG A;  1YUZ A;  3UOI A;  1VEL A;  3MPS A;  1BCF A;  5CMR A;  2ZA7 A;  2YW7 A;  5GU1 X;  3QVD A;  3F39 A;  2UX1 A;  5FFC A;  4IXK A;  4AM5 A;  4ITW A;  2HTN A;  1J30 A;  4A25 A;  3U90 A;  4DYX A;  3F37 A;  5J8W A;  1AEW A;  1NF4 A;  2Z5P A;  4ZKH A;  3E1J A;  5D8O A;  3E6R A;  3R2M A;  4DYY A;  4ISP A;  3GVY A;  5HJH A;  3FVB A;  2RBD A;  4AM4 A;  4PGK A;  3H7G A;  1JIG A;  4ZKX A;  3AJP A;  1VLG A;  1Z6O A;  1XZ1 A;  1DPS A;  1R03 A;  3WVV A;  4TOA A;  4MKU A;  5FFB A;  1S2Z A;  5JKL G;  3PW8 A;  4RC5 A;  4TW3 A;  2FHA A;  3PWF A;  5CZU A;  4RC5 B;  4DZ0 A;  3RAV A;  4TOF A;  1TKP A;  1UVH A;  1NFV A;  3BVL A;  2Z6M A;  2C2U A;  5LG8 A;  3NOZ X;  3KX9 A;  4TO9 A;  3UNO A;  3PZA A;  3E1O A;  4ETR A;  3SHX A;  4LQV A;  3FSE A;  4TOH A;  3GE4 A;  1H96 A;  4DYU A;  2ITB A;  2V2N A;  2V2O A;  3AF8 X;  2CHI A;  2Y3Q A;  3PVY A;  1FHA A;  5IX6 A;  4Y08 A;  4ZJK A;  2W0O A;  1VEQ A;  4EVC A;  3WVW A;  3PVY B;  4XKT A;  2V2I A;  4EVD A;  1JTS A;  3HL1 A;  4CVP A;  1SQ3 A;  3UOF A;  5D8P A;  4E6K A;  2D5K A;  4EVB A;  1JKU A;  4REU A;  1Z4A A;  2GYD A;  3QHC A;  4DE6 A;  3R2R A;  1JI4 A;  3KXU A;  1NF6 A;  1TJO A;  1DVB A;  2C2F A;  4Z5S A;  4ZKW A;  1S3Q A;  3QZ3 A;  2V2M A;  3VNX A;  3AK9 A;  1GWG A;  5J8S A;  2CHP A;  1TK6 A;  1IER A;  4M35 A;  3AF7 X;  1Z6O M;  5GU3 X;  3F34 A;  4M34 A;  3F33 A;  3KA3 A;  2CN6 A;  5GU2 X;  3BVF A;  2JD8 0;  3PVT A;  3RE7 A;  2C2J A;  3PVT B;  4CVS A;  3E1Q A;  3BVK A;  4DI0 A;  5J93 A;  3BT5 A;  2WTL A;  2Z90 A;  4TOC A;  5HJF A;  5J9V A;  2XJN A;  1ZS3 A;  4M33 A;  4LYX A;  1DAT A;  2GYQ A;  2FFX J;  2IB0 A;  4PGI A;  1O9I A;  3Q4O A;  3E1N A;  3O7R A;  4LPM A;  4KVQ A;  1QGH A;  3ISE A;  1NNQ A;  3NP2 X;  1OTK A;  4TOE A;  2ZA6 A;  3IS8 A;  1LKO A;  3KA8 A;  4DAS A;  4MN9 A;  4ZLW A;  1JYB A;  3KA6 A;  2GS4 A;  3BVI A;  3KA4 A;  4TOD A;  3R2H A;  5D8Q A;  5GU0 X;  3Q4Q A;  3WVU A;  5E2D A;  2ZG7 X;  4LPN A;  3F35 A;  2V2R A;  1VJX A;  5E1U A;  3AJQ A;  4ISM A;  2C6R A;  2XKQ A;  1ZUJ A;  3KWO A;  1KRQ A;  2BK6 A;  1SOF A;  3SE1 A;  5D8R A;  1MFR A;  2G4H A;  1RCD A;  2V15 A;  5CMQ A;  4KVR A;  2PYB A;  3ES3 A;  2FG4 A;  2V2S A;  5GOU A;  5C6F A;  2Z5R A;  3BVE A;  1L8H A;  2VZB A;  2XJM A;  1B71 A;  3OJ5 A;  2IU2 A;  3R2L A;  2XGW A;  4ERU A;  4U3G A;  3RD0 A;  4CY9 A;  3ERZ A;  3RGD A;  3EGM A;  5JAC A;  2JD7 0;  3GHQ A;  1O9R A;  2V2L A;  1L8I A;  2CEI A;  4XKU A;  2CIH A;  2OH3 A;  4II4 A;  4ZL6 A;  5JKM A;  1S30 A;  3A9Q A;  4KVS A;  4LPJ A;  4MY7 A;  4II4 B;  1LKM A;  1N1Q A;  4P18 A;  3Q4N A;  5JKL A;  1IES A;  3E2C A;  4XKS A;  4MJY A;  2VXI A;  4CYB A;  5ERJ A;  4IWK A;  3QB9 A;  5D8Y A;  3O7S A;  4CMY V;  3HIU A;  4CVR A;  4CYA A;  4CMY A;  4CVT A;  1BFR A;  2ZA8 A;  4EVE A;  3NP0 X;  3PWQ C;  2YW6 A;  3F38 A;  2CF7 A;  3SH6 A;  1JGC A;  4TOB A;  3E6S A;  5FFE A;  1QYB A;  4ZTT A;  5D8X A;  5LBH A;  4M32 A;  3PW1 A;  2F7N A;  3BKN A;  3R2O A;  2WLA A;  1BG7 A;  1RCI A;  4AM2 A;  3PW1 B;  1JKV A;  2QF9 A;  4R42 A;  4PG0 A;  3QHB A;  5I4J A;  3WNW A;  2Z5Q A;  4LQN A;  4DYZ A;  2FJC A;  5ERK A;  3R2K A;  4RC8 A;  1MOJ A;  3E1L A;  2WLU A;  3E1P A;  2FL0 A;  5JKM G;  3AK8 A;  1RCC A;  3AF9 X;  1YV1 A;  2CLB A;  1RYT A;  3EZU A;  1VEI A;  1F30 A;  5FEJ A;  3T9J A;  4YKH A;  2C41 A;  3Q4R A;  3E1M A;  5D8S A;  5AXS A;  4LQJ A;  2V2J A; 
#chains in the Genus database with same CATH topology
 4PG1 A;  3ISF A;  4LYU A;  2CN7 A;  2ZG8 X;  2ZUR X;  2CLU A;  3PVR A;  2BW1 A;  4XGS A;  2FG8 A;  3IQ1 A;  3PWQ A;  2FKZ A;  2FZF A;  3PVR B;  2BJY A;  2XJO A;  2V2P A;  4IWJ A;  5LG2 A;  3QD8 A;  1JI5 A;  2HR5 A;  3FI6 A;  4MUD A;  4ML5 A;  2AR0 A;  1RCG A;  5LS9 A;  1TKO A;  1LB3 A;  2JD6 0;  4RC6 A;  3TA8 A;  3SID A;  3R2S A;  2YJK A;  3RBC A;  3DBY A;  4RC6 B;  5K53 A;  2YJJ A;  3F32 A;  4LQH A;  5K52 A;  4E40 A;  4Z3B A;  5GN8 A;  3GGZ A;  1HRS A;  5GN8 B;  3KA9 A;  3M6J A;  4ZMC A;  3IS7 A;  4ZL5 A;  2ZG9 X;  1RCE A;  2VXX A;  1YUX A;  2X17 0;  3EZ0 A;  3GGY A;  1XZ3 A;  3PW8 C;  4RC7 A;  5FFA A;  4ITT A;  1JRE A;  3AJO A;  1UMN A;  3V3K B;  4RC7 B;  3A68 A;  3C1Y A;  5FFD A;  1F33 A;  4QUW A;  2OC5 A;  2BKC A;  1EUM A;  1LKP A;  3F36 A;  3KHK A;  2IY4 A;  5HQO A;  2QQY A;  3OGH A;  4OYN A;  4TOG A;  1YUZ A;  3UOI A;  1VEL A;  3MPS A;  1BCF A;  5CMR A;  2ZA7 A;  2YW7 A;  5GU1 X;  3QVD A;  3F39 A;  2UX1 A;  5FFC A;  4IXK A;  4AM5 A;  4ITW A;  2HTN A;  1J30 A;  4A25 A;  3U90 A;  4DYX A;  3VV9 A;  3F37 A;  5J8W A;  1AEW A;  1NF4 A;  2Z5P A;  4ZKH A;  3E1J A;  5D8O A;  3E6R A;  3R2M A;  4DYY A;  4ISP A;  3GVY A;  5HJH A;  3FVB A;  2RBD A;  4AM4 A;  4PGK A;  3H7G A;  1JIG A;  4ZKX A;  3AJP A;  1VLG A;  1Z6O A;  4WJG 4;  1XZ1 A;  1DPS A;  1R03 A;  3WVV A;  4TOA A;  4MKU A;  5FFB A;  1S2Z A;  5JKL G;  3PW8 A;  4RC5 A;  4TW3 A;  2FHA A;  3PWF A;  5CZU A;  4RC5 B;  4DZ0 A;  3RAV A;  4TOF A;  1TKP A;  4YXM A;  1UVH A;  1NFV A;  3BVL A;  2Z6M A;  2C2U A;  5LG8 A;  3NOZ X;  3KX9 A;  4TO9 A;  3UNO A;  3PZA A;  3E1O A;  4ETR A;  3SHX A;  4LQV A;  3FSE A;  2V8U A;  4TOH A;  3GE4 A;  2N02 A;  1H96 A;  4DYU A;  2ITB A;  2V2N A;  2V2O A;  3AF8 X;  4X0J A;  4YXJ A;  5JDO A;  2CHI A;  2Y3Q A;  3PVY A;  1FHA A;  5JDO B;  5IX6 A;  4Y08 A;  4ZJK A;  2W0O A;  1VEQ A;  4EVC A;  3WVW A;  3PVY B;  4XKT A;  2V2I A;  4EVD A;  1JTS A;  3HL1 A;  4CVP A;  1SQ3 A;  3UOF A;  3C21 A;  5D8P A;  4E6K A;  2D5K A;  4EVB A;  1JKU A;  4REU A;  1Z4A A;  2GYD A;  2WWX B;  3QHC A;  4DE6 A;  3R2R A;  1JI4 A;  3KXU A;  1NF6 A;  1TJO A;  1DVB A;  2C2F A;  4Z5S A;  4ZKW A;  2Y44 A;  1S3Q A;  3QZ3 A;  2V2M A;  3VNX A;  3AK9 A;  1GWG A;  5J8S A;  2CHP A;  3D19 A;  1TK6 A;  1IER A;  4M35 A;  3AF7 X;  1Z6O M;  5GU3 X;  3F34 A;  2V8T A;  3JZA B;  4M34 A;  3F33 A;  3N6O A;  3KA3 A;  3VVA A;  2CN6 A;  5GU2 X;  3BVF A;  2JD8 0;  3PVT A;  3RE7 A;  2C2J A;  3PVT B;  4CVS A;  3E1Q A;  3BVK A;  3UFB A;  4DI0 A;  5J93 A;  3BT5 A;  2WTL A;  2Z90 A;  4TOC A;  5HJF A;  5J9V A;  2XJN A;  1ZS3 A;  4M33 A;  4LYX A;  1DAT A;  2GYQ A;  2FFX J;  2IB0 A;  4PGI A;  4KXR B;  1O9I A;  3Q4O A;  3E1N A;  4W4K B;  3O7R A;  4LPM A;  4KVQ A;  1QGH A;  3ISE A;  1NNQ A;  3NP2 X;  1OTK A;  2OKC A;  4TOE A;  2ZA6 A;  3IS8 A;  1LKO A;  3KA8 A;  4DAS A;  4MN9 A;  4ZLW A;  1JYB A;  3KA6 A;  2GS4 A;  3BVI A;  3KA4 A;  4TOD A;  3R2H A;  5D8Q A;  5GU0 X;  3Q4Q A;  3WVU A;  5E2D A;  2ZG7 X;  4LPN A;  3F35 A;  2V2R A;  1VJX A;  5E1U A;  3AJQ A;  4ISM A;  2C6R A;  2XKQ A;  1ZUJ A;  3KWO A;  1KRQ A;  2BK6 A;  1SOF A;  3LKD A;  3SE1 A;  5D8R A;  4W4L B;  1MFR A;  2G4H A;  3FRS A;  1RCD A;  2V15 A;  5CMQ A;  4KVR A;  2PYB A;  3ES3 A;  2FG4 A;  2V2S A;  5GOU A;  5C6F A;  2Z5R A;  3BVE A;  1L8H A;  2VZB A;  2XJM A;  1B71 A;  3OJ5 A;  2IU2 A;  3R2L A;  2XGW A;  4ERU A;  4U3G A;  3RD0 A;  4CY9 A;  3ERZ A;  3RGD A;  3EGM A;  5JAC A;  2JD7 0;  3C23 A;  3GHQ A;  1O9R A;  2V2L A;  1L8I A;  2CEI A;  4XKU A;  2CIH A;  2OH3 A;  3L0M A;  4II4 A;  4ZL6 A;  5JKM A;  1S30 A;  3A9Q A;  4KVS A;  4LPJ A;  4MY7 A;  3FRR A;  4II4 B;  1LKM A;  1N1Q A;  3W54 A;  4P18 A;  3Q4N A;  5JKL A;  1IES A;  3E2C A;  4XKS A;  4MJY A;  2VXI A;  3JZ9 A;  4CYB A;  5ERJ A;  2G38 B;  4IWK A;  3QB9 A;  5D8Y A;  3O7S A;  4CMY V;  4YVZ A;  3HIU A;  4CVR A;  4CYA A;  4CMY A;  4CVT A;  1BFR A;  2ZA8 A;  4EVE A;  3NP0 X;  3PWQ C;  2YW6 A;  3F38 A;  2CF7 A;  3SH6 A;  1JGC A;  3C1Z A;  4TOB A;  3E6S A;  5FFE A;  1QYB A;  4ZTT A;  5D8X A;  5LBH A;  4M32 A;  3PW1 A;  2F7N A;  3BKN A;  3R2O A;  2WLA A;  1BG7 A;  1RCI A;  4AM2 A;  3PW1 B;  1JKV A;  2QF9 A;  4PG0 A;  4R42 A;  3QHB A;  2MGY A;  5I4J A;  3WNW A;  2Z5Q A;  4LQN A;  2CWL A;  4DYZ A;  2FJC A;  5ERK A;  3R2K A;  4RC8 A;  1MOJ A;  3E1L A;  2WLU A;  3E1P A;  2FL0 A;  5JKM G;  3AK8 A;  4MXP A;  1RCC A;  3AF9 X;  1YV1 A;  5HU6 D;  2CLB A;  1RYT A;  3EZU A;  1VEI A;  3KDQ A;  1F30 A;  5FEJ A;  3T9J A;  4YKH A;  2C41 A;  3Q4R A;  3E1M A;  5D8S A;  5AXS A;  4LQJ A;  2V2J A; 
#chains in the Genus database with same CATH homology
 4PG1 A;  3ISF A;  4LYU A;  2CN7 A;  2ZG8 X;  2ZUR X;  2CLU A;  3PVR A;  2BW1 A;  4XGS A;  2FG8 A;  3IQ1 A;  3PWQ A;  2FKZ A;  2FZF A;  3PVR B;  2BJY A;  2XJO A;  2V2P A;  4IWJ A;  5LG2 A;  3QD8 A;  1JI5 A;  2HR5 A;  3FI6 A;  4MUD A;  4ML5 A;  2AR0 A;  1RCG A;  5LS9 A;  1TKO A;  1LB3 A;  2JD6 0;  4RC6 A;  3TA8 A;  3SID A;  3R2S A;  2YJK A;  3RBC A;  3DBY A;  4RC6 B;  5K53 A;  2YJJ A;  3F32 A;  4LQH A;  5K52 A;  4E40 A;  4Z3B A;  5GN8 A;  3GGZ A;  1HRS A;  5GN8 B;  3KA9 A;  3M6J A;  4ZMC A;  3IS7 A;  4ZL5 A;  2ZG9 X;  1RCE A;  2VXX A;  1YUX A;  2X17 0;  3EZ0 A;  3GGY A;  1XZ3 A;  3PW8 C;  4RC7 A;  5FFA A;  4ITT A;  1JRE A;  3AJO A;  1UMN A;  3V3K B;  4RC7 B;  3A68 A;  3C1Y A;  5FFD A;  1F33 A;  4QUW A;  2OC5 A;  2BKC A;  1EUM A;  1LKP A;  3F36 A;  3KHK A;  2IY4 A;  5HQO A;  2QQY A;  3OGH A;  4OYN A;  4TOG A;  1YUZ A;  3UOI A;  1VEL A;  3MPS A;  1BCF A;  5CMR A;  2ZA7 A;  2YW7 A;  5GU1 X;  3QVD A;  3F39 A;  2UX1 A;  5FFC A;  4IXK A;  4AM5 A;  4ITW A;  2HTN A;  1J30 A;  4A25 A;  3U90 A;  4DYX A;  3VV9 A;  3F37 A;  5J8W A;  1AEW A;  1NF4 A;  2Z5P A;  4ZKH A;  3E1J A;  5D8O A;  3E6R A;  3R2M A;  4DYY A;  4ISP A;  3GVY A;  5HJH A;  3FVB A;  2RBD A;  4AM4 A;  4PGK A;  3H7G A;  1JIG A;  4ZKX A;  3AJP A;  1VLG A;  1Z6O A;  4WJG 4;  1XZ1 A;  1DPS A;  1R03 A;  3WVV A;  4TOA A;  4MKU A;  5FFB A;  1S2Z A;  5JKL G;  3PW8 A;  4RC5 A;  4TW3 A;  2FHA A;  3PWF A;  5CZU A;  4RC5 B;  4DZ0 A;  3RAV A;  4TOF A;  1TKP A;  4YXM A;  1UVH A;  1NFV A;  3BVL A;  2Z6M A;  2C2U A;  5LG8 A;  3NOZ X;  3KX9 A;  4TO9 A;  3UNO A;  3PZA A;  3E1O A;  4ETR A;  3SHX A;  4LQV A;  3FSE A;  2V8U A;  4TOH A;  3GE4 A;  2N02 A;  1H96 A;  4DYU A;  2ITB A;  2V2N A;  2V2O A;  3AF8 X;  4X0J A;  4YXJ A;  5JDO A;  2CHI A;  2Y3Q A;  3PVY A;  1FHA A;  5JDO B;  5IX6 A;  4Y08 A;  4ZJK A;  2W0O A;  1VEQ A;  4EVC A;  3WVW A;  3PVY B;  4XKT A;  2V2I A;  4EVD A;  1JTS A;  3HL1 A;  4CVP A;  1SQ3 A;  3UOF A;  3C21 A;  5D8P A;  4E6K A;  2D5K A;  4EVB A;  1JKU A;  4REU A;  1Z4A A;  2GYD A;  2WWX B;  3QHC A;  4DE6 A;  3R2R A;  1JI4 A;  3KXU A;  1NF6 A;  1TJO A;  1DVB A;  2C2F A;  4Z5S A;  4ZKW A;  2Y44 A;  1S3Q A;  3QZ3 A;  2V2M A;  3VNX A;  3AK9 A;  1GWG A;  5J8S A;  2CHP A;  3D19 A;  1TK6 A;  1IER A;  4M35 A;  3AF7 X;  1Z6O M;  5GU3 X;  3F34 A;  2V8T A;  3JZA B;  4M34 A;  3F33 A;  3N6O A;  3KA3 A;  3VVA A;  2CN6 A;  5GU2 X;  3BVF A;  2JD8 0;  3PVT A;  3RE7 A;  2C2J A;  3PVT B;  4CVS A;  3E1Q A;  3BVK A;  3UFB A;  4DI0 A;  5J93 A;  3BT5 A;  2WTL A;  2Z90 A;  4TOC A;  5HJF A;  5J9V A;  2XJN A;  1ZS3 A;  4M33 A;  4LYX A;  1DAT A;  2GYQ A;  2FFX J;  2IB0 A;  4PGI A;  4KXR B;  1O9I A;  3Q4O A;  3E1N A;  4W4K B;  3O7R A;  4LPM A;  4KVQ A;  1QGH A;  3ISE A;  1NNQ A;  3NP2 X;  1OTK A;  2OKC A;  4TOE A;  2ZA6 A;  3IS8 A;  1LKO A;  3KA8 A;  4DAS A;  4MN9 A;  4ZLW A;  1JYB A;  3KA6 A;  2GS4 A;  3BVI A;  3KA4 A;  4TOD A;  3R2H A;  5D8Q A;  5GU0 X;  3Q4Q A;  3WVU A;  5E2D A;  2ZG7 X;  4LPN A;  3F35 A;  2V2R A;  1VJX A;  5E1U A;  3AJQ A;  4ISM A;  2C6R A;  2XKQ A;  1ZUJ A;  3KWO A;  1KRQ A;  2BK6 A;  1SOF A;  3LKD A;  3SE1 A;  5D8R A;  4W4L B;  1MFR A;  2G4H A;  3FRS A;  1RCD A;  2V15 A;  5CMQ A;  4KVR A;  2PYB A;  3ES3 A;  2FG4 A;  2V2S A;  5GOU A;  5C6F A;  2Z5R A;  3BVE A;  1L8H A;  2VZB A;  2XJM A;  1B71 A;  3OJ5 A;  2IU2 A;  3R2L A;  2XGW A;  4ERU A;  4U3G A;  3RD0 A;  4CY9 A;  3ERZ A;  3RGD A;  3EGM A;  5JAC A;  2JD7 0;  3C23 A;  3GHQ A;  1O9R A;  2V2L A;  1L8I A;  2CEI A;  4XKU A;  2CIH A;  2OH3 A;  3L0M A;  4II4 A;  4ZL6 A;  5JKM A;  1S30 A;  3A9Q A;  4KVS A;  4LPJ A;  4MY7 A;  3FRR A;  4II4 B;  1LKM A;  1N1Q A;  3W54 A;  4P18 A;  3Q4N A;  5JKL A;  1IES A;  3E2C A;  4XKS A;  4MJY A;  2VXI A;  3JZ9 A;  4CYB A;  5ERJ A;  2G38 B;  4IWK A;  3QB9 A;  5D8Y A;  3O7S A;  4CMY V;  4YVZ A;  3HIU A;  4CVR A;  4CYA A;  4CMY A;  4CVT A;  1BFR A;  2ZA8 A;  4EVE A;  3NP0 X;  3PWQ C;  2YW6 A;  3F38 A;  2CF7 A;  3SH6 A;  1JGC A;  3C1Z A;  4TOB A;  3E6S A;  5FFE A;  1QYB A;  4ZTT A;  5D8X A;  5LBH A;  4M32 A;  3PW1 A;  2F7N A;  3BKN A;  3R2O A;  2WLA A;  1BG7 A;  1RCI A;  4AM2 A;  3PW1 B;  1JKV A;  2QF9 A;  4PG0 A;  4R42 A;  3QHB A;  2MGY A;  5I4J A;  3WNW A;  2Z5Q A;  4LQN A;  2CWL A;  4DYZ A;  2FJC A;  5ERK A;  3R2K A;  4RC8 A;  1MOJ A;  3E1L A;  2WLU A;  3E1P A;  2FL0 A;  5JKM G;  3AK8 A;  4MXP A;  1RCC A;  3AF9 X;  1YV1 A;  5HU6 D;  2CLB A;  1RYT A;  3EZU A;  1VEI A;  3KDQ A;  1F30 A;  5FEJ A;  3T9J A;  4YKH A;  2C41 A;  3Q4R A;  3E1M A;  5D8S A;  5AXS A;  4LQJ A;  2V2J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...