2Z6MA

Crystal structure of human ferritin h8 as biotemplate for noble metal nanoparticle synthesis
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
172
structure length
172
Chain Sequence
TSQVRQNYDQDSEAAINRQINLELYASYVYLSMSYYFDRDDVALKNFAKYFLHQSHEERCHAEKLMKLQNQRGGRIFLQDIKKPDRDDWESGLNAMEAALQLEKNVNQSLLELHKLATDKNDPHLCDFIETHYLNCQVCAIKCLGDHVTNLRKMGAPESGLAEYLFDKHTLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Directing noble metal ion chemistry within a designed ferritin protein
pubmed doi rcsb
molecule keywords Ferritin heavy chain
molecule tags Oxidoreductase
source organism Homo sapiens
total genus 75
structure length 172
sequence length 172
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 1.16.3.1: Ferroxidase.
pdb deposition date 2007-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 2z6mA00
4ZL6A 4ERUA 2C2FA 5D8YA 1S30A 3MPSA 4TOHA 4CYAA 5E2DA 1JI5A 3UOIA 2RBDA 4LQNA 2OH3A 1SQ3A 2FKZA 1ZS3A 3F38A 2GYQA 1LKOA 2CN6A 2FG8A 4MY7A 3UOFA 5D8OA 2ZA7A 3UNOA 3QVDA 4ML5A 4TOCA 2ZG7X 3AK8A 3KA4A 2C2UA 1F33A 1UMNA 4TOEA 4CVPA 2C2JA 2ZG8X 4ZJKA 4II4B 4CMYV 4DYYA 4IWKA 1JKVA 1DATA 3RGDA 3F37A 4M35A 4PG1A 4XKUA 2HTNA 3GHQA 3R2MA 2GYDA 3NP2X 4LYXA 3AF8X 5D8QA 4OYNA 4M34A 4CY9A 2VXXA 1HRSA 3WNWA 4ZKXA 2HR5A 2Z5RA 5CMQA 4ZKWA 2V2LA 3E1NA 4EVBA 4M33A 3Q4RA 1TKPA 3O7RA 4DI0A 4CVTA 1N1QA 1JGCA 3E1JA 4XKSA 4CVRA 4IXKA 5GN8A 5HJHA 3PW1B 4PGKA 5GU1X 3RBCA 3WVWA 1VEIA 3HL1A 1Z6OM 2BW1A 1RCEA 3O7SA 2XGWA 3E6SA 3AK9A 3ISFA 5JKMA 1XZ3A 4EVDA 3ES3A 2IU2A 2F7NA 3NP0X 3PVYA 1MFRA 4LYUA 2C41A 4XGSA 1Z4AA 1NFVA 3EZ0A 1JIGA 4RC5B 1VELA 2PYBA 3AJQA 2JD60 2Y3QA 4P18A 4CMYA 1JREA 2CLUA 3E6RA 3WVVA 1QYBA 4ISMA 3RD0A 4AM2A 3SHXA 2YJJA 4TO9A 1Z6OA 3PVRB 3F39A 4RC6A 3AJOA 3R2SA 4XKTA 5AXSA 5GOUA 4AM4A 3SIDA 2YW6A 2XJOA 4Y08A 5K53A 2CF7A 5D8PA 1J30A 1OTKA 4A25A 3OJ5A 5CZUA 4LQVA 3ISEA 1NNQA 4RC7B 2ITBA 3KXUA 4PG0A 4ZTTA 5JKMG 3AF7X 4U3GA 4REUA 5J8WA 5I4JA 4CVSA 5J8SA 3QZ3A 4AM5A 5LBHA 3PWFA 5FFDA 4ISPA 3E1OA 2CEIA 2CHIA 3QB9A 1O9RA 2YW7A 3PWQC 4M32A 3E1LA 2XJNA 5FFBA 5FFAA 2FL0A 2V2SA 5GU2X 5CMRA 1NF4A 1JI4A 1VJXA 2QF9A 4DZ0A 4PGIA 1BG7A 4EVEA 2V2IA 1RCGA 2WLAA 1JKUA 2Z90A 4TODA 3U90A 4LQHA 3KA9A 4TOGA 2D5KA 3E1PA 3BVIA 3A68A 5K52A 3QD8A 2CLBA 2XJMA 2Z5PA 3E1QA 1S3QA 1TKOA 3F36A 4II4A 3VNXA 1DPSA 1F30A 1GWGA 4ZLWA 2Z5QA 2ZURX 1FHAA 3F33A 3BT5A 1L8HA 4LPJA 4R42A 2ZG9X 4TOBA 2IB0A 1H96A 3PVTA 3BVFA 5E1UA 4Z5SA 1IESA 1VLGA 2XKQA 1JYBA 2G4HA 3KA8A 1TK6A 1L8IA 5LG8A 2WTLA 3A9QA 4EVCA 3RE7A 1AEWA 1YUZA 1BFRA 5GU0X 4KVRA 5J93A 3BVEA 2CIHA 2CHPA 4KVSA 4TW3A 3WVUA 4ZMCA 5JKLA 4DASA 3QHBA 2QQYA 3IS7A 3F34A 4TOAA 3E2CA 3OGHA 3FSEA 2FJCA 3PW1A 4DYXA 1LKPA 2V15A 5FEJA 1RCDA 3HIUA 1XZ1A 3R2HA 1YUXA 2ZA6A 4LQJA 3GVYA 1YV1A 2V2NA 4RC8A 3BKNA 4DE6A 1JTSA 3GE4A 3PWQA 4MKUA 5ERJA 2FG4A 4ZKHA 1BCFA 5C6FA 3ERZA 4QUWA 3FI6A 4RC5A 1RYTA 1B71A 2FHAA 3QHCA 3KX9A 4TOFA 3SE1A 4E6KA 2FZFA 2BKCA 5GN8B 4DYZA 3IS8A 5ERKA 1ZUJA 5D8RA 4Z3BA 1RCCA 4MJYA 1RCIA 3PVRA 5JKLG 3H7GA 5HJFA 3E1MA 3F35A 1DVBA 1IERA 2V2MA 2BJYA 3EGMA 2V2RA 3FVBA 2Z6MA 3KA6A 3KWOA 3PVTB 3KA3A 4LPNA 1LKMA 3PVYB 3NOZX 3R2OA 5LS9A 2WLUA 5J9VA 2X170 3BVLA 3F32A 4RC7A 1R03A 1UVHA 2VZBA 3PW8A 1SOFA 3R2LA 4MUDA 3AJPA 2YJKA 2GS4A 1S2ZA 2CN7A 5JACA 4ITTA 5D8SA 3R2KA 1NF6A 2V2OA 2BK6A 2C6RA 1TJOA 2JD80 3TA8A 3PW8C 2IY4A 4RC6B 2VXIA 3Q4NA 4DYUA 2OC5A 5LG2A 5IX6A 3Q4QA 3RAVA 2ZA8A 2V2JA 3IQ1A 4IWJA 2W0OA 2UX1A 2JD70 5GU3X 3R2RA 3T9JA 4ZL5A 5FFCA 1EUMA 4YKHA 5FFEA 4ITWA 2V2PA 5HQOA 4LPMA 1KRQA 4MN9A 1LB3A 1MOJA 3EZUA 3PZAA 3Q4OA 1QGHA 3SH6A 1O9IA 3AF9X 2FFXJ 4CYBA 4KVQA 4ETRA 1VEQA 3BVKA 5D8XA
chains in the Genus database with same CATH superfamily
4ZL6A 4ERUA 2C2FA 5D8YA 1S30A 3KHKA 3MPSA 4TOHA 4CYAA 5E2DA 1JI5A 3UOIA 2RBDA 3VVAA 2OH3A 4LQNA 1SQ3A 2FKZA 1ZS3A 3F38A 2GYQA 1LKOA 2CN6A 2FG8A 4YXMA 4MY7A 3UOFA 3C23A 5D8OA 2ZA7A 3UNOA 3QVDA 3L0MA 4ML5A 3GGYA 4TOCA 2ZG7X 4W4KB 3AK8A 3KA4A 2C2UA 1F33A 1UMNA 4TOEA 4X0JA 4CVPA 2C2JA 2ZG8X 4ZJKA 4II4B 4CMYV 4DYYA 4IWKA 1JKVA 1DATA 3RGDA 2AR0A 3F37A 4M35A 4PG1A 3N6OA 4XKUA 2HTNA 3GHQA 3R2MA 2GYDA 3NP2X 4LYXA 3AF8X 5D8QA 4OYNA 4M34A 4CY9A 2VXXA 1HRSA 3WNWA 4ZKXA 2HR5A 2Z5RA 5CMQA 4ZKWA 2V2LA 3E1NA 4EVBA 4M33A 3Q4RA 1TKPA 3O7RA 4WJG4 4DI0A 4CVTA 1N1QA 1JGCA 3E1JA 4XKSA 4CVRA 4IXKA 3KDQA 5GN8A 5HJHA 3PW1B 4PGKA 5GU1X 3RBCA 3WVWA 1VEIA 3HL1A 1Z6OM 2BW1A 1RCEA 3O7SA 2XGWA 3E6SA 3AK9A 3ISFA 5JKMA 1XZ3A 4EVDA 3ES3A 2IU2A 2F7NA 3NP0X 3PVYA 1MFRA 4LYUA 2C41A 4XGSA 1Z4AA 1NFVA 3EZ0A 1JIGA 4RC5B 1VELA 2PYBA 3AJQA 2JD60 3C21A 2Y3QA 4P18A 4CMYA 1JREA 2CLUA 3E6RA 3WVVA 1QYBA 4ISMA 3RD0A 4AM2A 5JDOB 3SHXA 2YJJA 4TO9A 1Z6OA 3PVRB 3F39A 3LKDA 4RC6A 3AJOA 3R2SA 4XKTA 5AXSA 5GOUA 4AM4A 3SIDA 2YW6A 2XJOA 4Y08A 5K53A 2CF7A 5D8PA 1J30A 1OTKA 4A25A 3OJ5A 5CZUA 3M6JA 4LQVA 3ISEA 1NNQA 4RC7B 2ITBA 3KXUA 4PG0A 4ZTTA 5JKMG 3AF7X 4U3GA 4REUA 5J8WA 5I4JA 4CVSA 5J8SA 3QZ3A 4AM5A 5LBHA 3PWFA 5FFDA 4ISPA 3E1OA 2CEIA 2CHIA 3QB9A 3VV9A 1O9RA 2YW7A 3PWQC 4M32A 3E1LA 2XJNA 4W4LB 5FFBA 2Y44A 2N02A 5FFAA 2FL0A 2V2SA 5GU2X 5CMRA 1NF4A 1JI4A 1VJXA 2QF9A 4DZ0A 4PGIA 1BG7A 4EVEA 2V2IA 1RCGA 2WLAA 1JKUA 2Z90A 4TODA 3U90A 4LQHA 3KA9A 4TOGA 2D5KA 3E1PA 3JZAB 3BVIA 3A68A 3W54A 5K52A 4YVZA 3QD8A 2CLBA 2XJMA 2Z5PA 4KXRB 3E1QA 1S3QA 1TKOA 3F36A 4II4A 3VNXA 3JZ9A 1DPSA 1F30A 1GWGA 4ZLWA 2Z5QA 2ZURX 1FHAA 3F33A 3BT5A 1L8HA 4LPJA 4R42A 2ZG9X 4TOBA 2IB0A 1H96A 3PVTA 2MGYA 3BVFA 5E1UA 4Z5SA 1IESA 1VLGA 2XKQA 1JYBA 2G4HA 3KA8A 1TK6A 1L8IA 5LG8A 2WTLA 3A9QA 4EVCA 3RE7A 1AEWA 1YUZA 1BFRA 5GU0X 4KVRA 5J93A 3BVEA 2CIHA 2CHPA 4KVSA 4TW3A 3WVUA 4ZMCA 5JKLA 4DASA 3QHBA 3C1ZA 4YXJA 2QQYA 3IS7A 3F34A 4TOAA 3E2CA 3OGHA 3FSEA 3FRSA 2FJCA 3PW1A 4DYXA 1LKPA 2V15A 5FEJA 1RCDA 3HIUA 1XZ1A 3R2HA 1YUXA 2ZA6A 4LQJA 3GVYA 1YV1A 2V2NA 4RC8A 3BKNA 4DE6A 2G38B 1JTSA 3GE4A 3PWQA 4MKUA 5ERJA 2FG4A 4ZKHA 1BCFA 5C6FA 3ERZA 3FI6A 4QUWA 4RC5A 3D19A 4MXPA 1RYTA 1B71A 2FHAA 2OKCA 3C1YA 3QHCA 3KX9A 4TOFA 2V8TA 3SE1A 4E6KA 2FZFA 2BKCA 5GN8B 4DYZA 3IS8A 5ERKA 1ZUJA 5D8RA 4Z3BA 5JDOA 1RCCA 4MJYA 1RCIA 3PVRA 5JKLG 3H7GA 5HJFA 3E1MA 3F35A 1DVBA 1IERA 2V2MA 2BJYA 3EGMA 2V2RA 3FVBA 2Z6MA 3KA6A 3KWOA 3PVTB 3KA3A 4LPNA 1LKMA 3PVYB 3NOZX 3R2OA 5LS9A 2WLUA 5J9VA 2X170 3BVLA 3F32A 4E40A 4RC7A 1R03A 1UVHA 2VZBA 3PW8A 1SOFA 3R2LA 4MUDA 3AJPA 2CWLA 2YJKA 2GS4A 1S2ZA 3DBYA 2CN7A 5JACA 4ITTA 5D8SA 3R2KA 1NF6A 2V2OA 2BK6A 2C6RA 1TJOA 2JD80 3TA8A 3PW8C 2IY4A 4RC6B 2VXIA 3Q4NA 3FRRA 4DYUA 2OC5A 5LG2A 5IX6A 3Q4QA 3RAVA 2ZA8A 2V2JA 3IQ1A 4IWJA 2W0OA 5HU6D 2UX1A 2JD70 5GU3X 3GGZA 3R2RA 3T9JA 4ZL5A 5FFCA 1EUMA 4YKHA 5FFEA 4ITWA 3V3KB 2V2PA 3UFBA 5HQOA 4LPMA 1KRQA 4MN9A 1LB3A 1MOJA 3EZUA 3PZAA 3Q4OA 1QGHA 3SH6A 1O9IA 3AF9X 2V8UA 2FFXJ 4CYBA 4KVQA 4ETRA 1VEQA 2WWXB 3BVKA 5D8XA
chains in the Genus database with same CATH topology
4ZL6A 4ERUA 2C2FA 5D8YA 1S30A 3KHKA 3MPSA 4TOHA 4CYAA 5E2DA 1JI5A 3UOIA 2RBDA 3VVAA 2OH3A 4LQNA 1SQ3A 2FKZA 1ZS3A 3F38A 2GYQA 1LKOA 2CN6A 2FG8A 4YXMA 4MY7A 3UOFA 3C23A 5D8OA 2ZA7A 3UNOA 3QVDA 3L0MA 4ML5A 3GGYA 4TOCA 2ZG7X 4W4KB 3AK8A 3KA4A 2C2UA 1F33A 1UMNA 4TOEA 4X0JA 4CVPA 2C2JA 2ZG8X 4ZJKA 4II4B 4CMYV 4DYYA 4IWKA 1JKVA 1DATA 3RGDA 2AR0A 3F37A 4M35A 4PG1A 3N6OA 4XKUA 2HTNA 3GHQA 3R2MA 2GYDA 3NP2X 4LYXA 3AF8X 5D8QA 4OYNA 4M34A 4CY9A 2VXXA 1HRSA 3WNWA 4ZKXA 2HR5A 2Z5RA 5CMQA 4ZKWA 2V2LA 3E1NA 4EVBA 4M33A 3Q4RA 1TKPA 3O7RA 4WJG4 4DI0A 4CVTA 1N1QA 1JGCA 3E1JA 4XKSA 4CVRA 4IXKA 3KDQA 5GN8A 5HJHA 3PW1B 4PGKA 5GU1X 3RBCA 3WVWA 1VEIA 3HL1A 1Z6OM 2BW1A 1RCEA 3O7SA 2XGWA 3E6SA 3AK9A 3ISFA 5JKMA 1XZ3A 4EVDA 3ES3A 2IU2A 2F7NA 3NP0X 3PVYA 1MFRA 4LYUA 2C41A 4XGSA 1Z4AA 1NFVA 3EZ0A 1JIGA 4RC5B 1VELA 2PYBA 3AJQA 2JD60 3C21A 2Y3QA 4P18A 4CMYA 1JREA 2CLUA 3E6RA 3WVVA 1QYBA 4ISMA 3RD0A 4AM2A 5JDOB 3SHXA 2YJJA 4TO9A 1Z6OA 3PVRB 3F39A 3LKDA 4RC6A 3AJOA 3R2SA 4XKTA 5AXSA 5GOUA 4AM4A 3SIDA 2YW6A 2XJOA 4Y08A 5K53A 2CF7A 5D8PA 1J30A 1OTKA 4A25A 3OJ5A 5CZUA 3M6JA 4LQVA 3ISEA 1NNQA 4RC7B 2ITBA 3KXUA 4PG0A 4ZTTA 5JKMG 3AF7X 4U3GA 4REUA 5J8WA 5I4JA 4CVSA 5J8SA 3QZ3A 4AM5A 5LBHA 3PWFA 5FFDA 4ISPA 3E1OA 2CEIA 2CHIA 3QB9A 3VV9A 1O9RA 2YW7A 3PWQC 4M32A 3E1LA 2XJNA 4W4LB 5FFBA 2Y44A 2N02A 5FFAA 2FL0A 2V2SA 5GU2X 5CMRA 1NF4A 1JI4A 1VJXA 2QF9A 4DZ0A 4PGIA 1BG7A 4EVEA 2V2IA 1RCGA 2WLAA 1JKUA 2Z90A 4TODA 3U90A 4LQHA 3KA9A 4TOGA 2D5KA 3E1PA 3JZAB 3BVIA 3A68A 3W54A 5K52A 4YVZA 3QD8A 2CLBA 2XJMA 2Z5PA 4KXRB 3E1QA 1S3QA 1TKOA 3F36A 4II4A 3VNXA 3JZ9A 1DPSA 1F30A 1GWGA 4ZLWA 2Z5QA 2ZURX 1FHAA 3F33A 3BT5A 1L8HA 4LPJA 4R42A 2ZG9X 4TOBA 2IB0A 1H96A 3PVTA 2MGYA 3BVFA 5E1UA 4Z5SA 1IESA 1VLGA 2XKQA 1JYBA 2G4HA 3KA8A 1TK6A 1L8IA 5LG8A 2WTLA 3A9QA 4EVCA 3RE7A 1AEWA 1YUZA 1BFRA 5GU0X 4KVRA 5J93A 3BVEA 2CIHA 2CHPA 4KVSA 4TW3A 3WVUA 4ZMCA 5JKLA 4DASA 3QHBA 3C1ZA 4YXJA 2QQYA 3IS7A 3F34A 4TOAA 3E2CA 3OGHA 3FSEA 3FRSA 2FJCA 3PW1A 4DYXA 1LKPA 2V15A 5FEJA 1RCDA 3HIUA 1XZ1A 3R2HA 1YUXA 2ZA6A 4LQJA 3GVYA 1YV1A 2V2NA 4RC8A 3BKNA 4DE6A 2G38B 1JTSA 3GE4A 3PWQA 4MKUA 5ERJA 2FG4A 4ZKHA 1BCFA 5C6FA 3ERZA 3FI6A 4QUWA 4RC5A 3D19A 4MXPA 1RYTA 1B71A 2FHAA 2OKCA 3C1YA 3QHCA 3KX9A 4TOFA 2V8TA 3SE1A 4E6KA 2FZFA 2BKCA 5GN8B 4DYZA 3IS8A 5ERKA 1ZUJA 5D8RA 4Z3BA 5JDOA 1RCCA 4MJYA 1RCIA 3PVRA 5JKLG 3H7GA 5HJFA 3E1MA 3F35A 1DVBA 1IERA 2V2MA 2BJYA 3EGMA 2V2RA 3FVBA 2Z6MA 3KA6A 3KWOA 3PVTB 3KA3A 4LPNA 1LKMA 3PVYB 3NOZX 3R2OA 5LS9A 2WLUA 5J9VA 2X170 3BVLA 3F32A 4E40A 4RC7A 1R03A 1UVHA 2VZBA 3PW8A 1SOFA 3R2LA 4MUDA 3AJPA 2CWLA 2YJKA 2GS4A 1S2ZA 3DBYA 2CN7A 5JACA 4ITTA 5D8SA 3R2KA 1NF6A 2V2OA 2BK6A 2C6RA 1TJOA 2JD80 3TA8A 3PW8C 2IY4A 4RC6B 2VXIA 3Q4NA 3FRRA 4DYUA 2OC5A 5LG2A 5IX6A 3Q4QA 3RAVA 2ZA8A 2V2JA 3IQ1A 4IWJA 2W0OA 5HU6D 2UX1A 2JD70 5GU3X 3GGZA 3R2RA 3T9JA 4ZL5A 5FFCA 1EUMA 4YKHA 5FFEA 4ITWA 3V3KB 2V2PA 3UFBA 5HQOA 4LPMA 1KRQA 4MN9A 1LB3A 1MOJA 3EZUA 3PZAA 3Q4OA 1QGHA 3SH6A 1O9IA 3AF9X 2V8UA 2FFXJ 4CYBA 4KVQA 4ETRA 1VEQA 2WWXB 3BVKA 5D8XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZL6 A;  4ERU A;  2C2F A;  5D8Y A;  1S30 A;  3MPS A;  4TOH A;  4CYA A;  5E2D A;  1JI5 A;  3UOI A;  2RBD A;  4LQN A;  2OH3 A;  1SQ3 A;  2FKZ A;  1ZS3 A;  3F38 A;  2GYQ A;  1LKO A;  2CN6 A;  2FG8 A;  4MY7 A;  3UOF A;  5D8O A;  2ZA7 A;  3UNO A;  3QVD A;  4ML5 A;  4TOC A;  2ZG7 X;  3AK8 A;  3KA4 A;  2C2U A;  1F33 A;  1UMN A;  4TOE A;  4CVP A;  2C2J A;  2ZG8 X;  4ZJK A;  4II4 B;  4CMY V;  4DYY A;  4IWK A;  1JKV A;  1DAT A;  3RGD A;  3F37 A;  4M35 A;  4PG1 A;  4XKU A;  2HTN A;  3GHQ A;  3R2M A;  2GYD A;  3NP2 X;  4LYX A;  3AF8 X;  5D8Q A;  4OYN A;  4M34 A;  4CY9 A;  2VXX A;  1HRS A;  3WNW A;  4ZKX A;  2HR5 A;  2Z5R A;  5CMQ A;  4ZKW A;  2V2L A;  3E1N A;  4EVB A;  4M33 A;  3Q4R A;  1TKP A;  3O7R A;  4DI0 A;  4CVT A;  1N1Q A;  1JGC A;  3E1J A;  4XKS A;  4CVR A;  4IXK A;  5GN8 A;  5HJH A;  3PW1 B;  4PGK A;  5GU1 X;  3RBC A;  3WVW A;  1VEI A;  3HL1 A;  1Z6O M;  2BW1 A;  1RCE A;  3O7S A;  2XGW A;  3E6S A;  3AK9 A;  3ISF A;  5JKM A;  1XZ3 A;  4EVD A;  3ES3 A;  2IU2 A;  2F7N A;  3NP0 X;  3PVY A;  1MFR A;  4LYU A;  2C41 A;  4XGS A;  1Z4A A;  1NFV A;  3EZ0 A;  1JIG A;  4RC5 B;  1VEL A;  2PYB A;  3AJQ A;  2JD6 0;  2Y3Q A;  4P18 A;  4CMY A;  1JRE A;  2CLU A;  3E6R A;  3WVV A;  1QYB A;  4ISM A;  3RD0 A;  4AM2 A;  3SHX A;  2YJJ A;  4TO9 A;  1Z6O A;  3PVR B;  3F39 A;  4RC6 A;  3AJO A;  3R2S A;  4XKT A;  5AXS A;  5GOU A;  4AM4 A;  3SID A;  2YW6 A;  2XJO A;  4Y08 A;  5K53 A;  2CF7 A;  5D8P A;  1J30 A;  1OTK A;  4A25 A;  3OJ5 A;  5CZU A;  4LQV A;  3ISE A;  1NNQ A;  4RC7 B;  2ITB A;  3KXU A;  4PG0 A;  4ZTT A;  5JKM G;  3AF7 X;  4U3G A;  4REU A;  5J8W A;  5I4J A;  4CVS A;  5J8S A;  3QZ3 A;  4AM5 A;  5LBH A;  3PWF A;  5FFD A;  4ISP A;  3E1O A;  2CEI A;  2CHI A;  3QB9 A;  1O9R A;  2YW7 A;  3PWQ C;  4M32 A;  3E1L A;  2XJN A;  5FFB A;  5FFA A;  2FL0 A;  2V2S A;  5GU2 X;  5CMR A;  1NF4 A;  1JI4 A;  1VJX A;  2QF9 A;  4DZ0 A;  4PGI A;  1BG7 A;  4EVE A;  2V2I A;  1RCG A;  2WLA A;  1JKU A;  2Z90 A;  4TOD A;  3U90 A;  4LQH A;  3KA9 A;  4TOG A;  2D5K A;  3E1P A;  3BVI A;  3A68 A;  5K52 A;  3QD8 A;  2CLB A;  2XJM A;  2Z5P A;  3E1Q A;  1S3Q A;  1TKO A;  3F36 A;  4II4 A;  3VNX A;  1DPS A;  1F30 A;  1GWG A;  4ZLW A;  2Z5Q A;  2ZUR X;  1FHA A;  3F33 A;  3BT5 A;  1L8H A;  4LPJ A;  4R42 A;  2ZG9 X;  4TOB A;  2IB0 A;  1H96 A;  3PVT A;  3BVF A;  5E1U A;  4Z5S A;  1IES A;  1VLG A;  2XKQ A;  1JYB A;  2G4H A;  3KA8 A;  1TK6 A;  1L8I A;  5LG8 A;  2WTL A;  3A9Q A;  4EVC A;  3RE7 A;  1AEW A;  1YUZ A;  1BFR A;  5GU0 X;  4KVR A;  5J93 A;  3BVE A;  2CIH A;  2CHP A;  4KVS A;  4TW3 A;  3WVU A;  4ZMC A;  5JKL A;  4DAS A;  3QHB A;  2QQY A;  3IS7 A;  3F34 A;  4TOA A;  3E2C A;  3OGH A;  3FSE A;  2FJC A;  3PW1 A;  4DYX A;  1LKP A;  2V15 A;  5FEJ A;  1RCD A;  3HIU A;  1XZ1 A;  3R2H A;  1YUX A;  2ZA6 A;  4LQJ A;  3GVY A;  1YV1 A;  2V2N A;  4RC8 A;  3BKN A;  4DE6 A;  1JTS A;  3GE4 A;  3PWQ A;  4MKU A;  5ERJ A;  2FG4 A;  4ZKH A;  1BCF A;  5C6F A;  3ERZ A;  4QUW A;  3FI6 A;  4RC5 A;  1RYT A;  1B71 A;  2FHA A;  3QHC A;  3KX9 A;  4TOF A;  3SE1 A;  4E6K A;  2FZF A;  2BKC A;  5GN8 B;  4DYZ A;  3IS8 A;  5ERK A;  1ZUJ A;  5D8R A;  4Z3B A;  1RCC A;  4MJY A;  1RCI A;  3PVR A;  5JKL G;  3H7G A;  5HJF A;  3E1M A;  3F35 A;  1DVB A;  1IER A;  2V2M A;  2BJY A;  3EGM A;  2V2R A;  3FVB A;  2Z6M A;  3KA6 A;  3KWO A;  3PVT B;  3KA3 A;  4LPN A;  1LKM A;  3PVY B;  3NOZ X;  3R2O A;  5LS9 A;  2WLU A;  5J9V A;  2X17 0;  3BVL A;  3F32 A;  4RC7 A;  1R03 A;  1UVH A;  2VZB A;  3PW8 A;  1SOF A;  3R2L A;  4MUD A;  3AJP A;  2YJK A;  2GS4 A;  1S2Z A;  2CN7 A;  5JAC A;  4ITT A;  5D8S A;  3R2K A;  1NF6 A;  2V2O A;  2BK6 A;  2C6R A;  1TJO A;  2JD8 0;  3TA8 A;  3PW8 C;  2IY4 A;  4RC6 B;  2VXI A;  3Q4N A;  4DYU A;  2OC5 A;  5LG2 A;  5IX6 A;  3Q4Q A;  3RAV A;  2ZA8 A;  2V2J A;  3IQ1 A;  4IWJ A;  2W0O A;  2UX1 A;  2JD7 0;  5GU3 X;  3R2R A;  3T9J A;  4ZL5 A;  5FFC A;  1EUM A;  4YKH A;  5FFE A;  4ITW A;  2V2P A;  5HQO A;  4LPM A;  1KRQ A;  4MN9 A;  1LB3 A;  1MOJ A;  3EZU A;  3PZA A;  3Q4O A;  1QGH A;  3SH6 A;  1O9I A;  3AF9 X;  2FFX J;  4CYB A;  4KVQ A;  4ETR A;  1VEQ A;  3BVK A;  5D8X A; 
#chains in the Genus database with same CATH topology
 4ZL6 A;  4ERU A;  2C2F A;  5D8Y A;  1S30 A;  3KHK A;  3MPS A;  4TOH A;  4CYA A;  5E2D A;  1JI5 A;  3UOI A;  2RBD A;  3VVA A;  2OH3 A;  4LQN A;  1SQ3 A;  2FKZ A;  1ZS3 A;  3F38 A;  2GYQ A;  1LKO A;  2CN6 A;  2FG8 A;  4YXM A;  4MY7 A;  3UOF A;  3C23 A;  5D8O A;  2ZA7 A;  3UNO A;  3QVD A;  3L0M A;  4ML5 A;  3GGY A;  4TOC A;  2ZG7 X;  4W4K B;  3AK8 A;  3KA4 A;  2C2U A;  1F33 A;  1UMN A;  4TOE A;  4X0J A;  4CVP A;  2C2J A;  2ZG8 X;  4ZJK A;  4II4 B;  4CMY V;  4DYY A;  4IWK A;  1JKV A;  1DAT A;  3RGD A;  2AR0 A;  3F37 A;  4M35 A;  4PG1 A;  3N6O A;  4XKU A;  2HTN A;  3GHQ A;  3R2M A;  2GYD A;  3NP2 X;  4LYX A;  3AF8 X;  5D8Q A;  4OYN A;  4M34 A;  4CY9 A;  2VXX A;  1HRS A;  3WNW A;  4ZKX A;  2HR5 A;  2Z5R A;  5CMQ A;  4ZKW A;  2V2L A;  3E1N A;  4EVB A;  4M33 A;  3Q4R A;  1TKP A;  3O7R A;  4WJG 4;  4DI0 A;  4CVT A;  1N1Q A;  1JGC A;  3E1J A;  4XKS A;  4CVR A;  4IXK A;  3KDQ A;  5GN8 A;  5HJH A;  3PW1 B;  4PGK A;  5GU1 X;  3RBC A;  3WVW A;  1VEI A;  3HL1 A;  1Z6O M;  2BW1 A;  1RCE A;  3O7S A;  2XGW A;  3E6S A;  3AK9 A;  3ISF A;  5JKM A;  1XZ3 A;  4EVD A;  3ES3 A;  2IU2 A;  2F7N A;  3NP0 X;  3PVY A;  1MFR A;  4LYU A;  2C41 A;  4XGS A;  1Z4A A;  1NFV A;  3EZ0 A;  1JIG A;  4RC5 B;  1VEL A;  2PYB A;  3AJQ A;  2JD6 0;  3C21 A;  2Y3Q A;  4P18 A;  4CMY A;  1JRE A;  2CLU A;  3E6R A;  3WVV A;  1QYB A;  4ISM A;  3RD0 A;  4AM2 A;  5JDO B;  3SHX A;  2YJJ A;  4TO9 A;  1Z6O A;  3PVR B;  3F39 A;  3LKD A;  4RC6 A;  3AJO A;  3R2S A;  4XKT A;  5AXS A;  5GOU A;  4AM4 A;  3SID A;  2YW6 A;  2XJO A;  4Y08 A;  5K53 A;  2CF7 A;  5D8P A;  1J30 A;  1OTK A;  4A25 A;  3OJ5 A;  5CZU A;  3M6J A;  4LQV A;  3ISE A;  1NNQ A;  4RC7 B;  2ITB A;  3KXU A;  4PG0 A;  4ZTT A;  5JKM G;  3AF7 X;  4U3G A;  4REU A;  5J8W A;  5I4J A;  4CVS A;  5J8S A;  3QZ3 A;  4AM5 A;  5LBH A;  3PWF A;  5FFD A;  4ISP A;  3E1O A;  2CEI A;  2CHI A;  3QB9 A;  3VV9 A;  1O9R A;  2YW7 A;  3PWQ C;  4M32 A;  3E1L A;  2XJN A;  4W4L B;  5FFB A;  2Y44 A;  2N02 A;  5FFA A;  2FL0 A;  2V2S A;  5GU2 X;  5CMR A;  1NF4 A;  1JI4 A;  1VJX A;  2QF9 A;  4DZ0 A;  4PGI A;  1BG7 A;  4EVE A;  2V2I A;  1RCG A;  2WLA A;  1JKU A;  2Z90 A;  4TOD A;  3U90 A;  4LQH A;  3KA9 A;  4TOG A;  2D5K A;  3E1P A;  3JZA B;  3BVI A;  3A68 A;  3W54 A;  5K52 A;  4YVZ A;  3QD8 A;  2CLB A;  2XJM A;  2Z5P A;  4KXR B;  3E1Q A;  1S3Q A;  1TKO A;  3F36 A;  4II4 A;  3VNX A;  3JZ9 A;  1DPS A;  1F30 A;  1GWG A;  4ZLW A;  2Z5Q A;  2ZUR X;  1FHA A;  3F33 A;  3BT5 A;  1L8H A;  4LPJ A;  4R42 A;  2ZG9 X;  4TOB A;  2IB0 A;  1H96 A;  3PVT A;  2MGY A;  3BVF A;  5E1U A;  4Z5S A;  1IES A;  1VLG A;  2XKQ A;  1JYB A;  2G4H A;  3KA8 A;  1TK6 A;  1L8I A;  5LG8 A;  2WTL A;  3A9Q A;  4EVC A;  3RE7 A;  1AEW A;  1YUZ A;  1BFR A;  5GU0 X;  4KVR A;  5J93 A;  3BVE A;  2CIH A;  2CHP A;  4KVS A;  4TW3 A;  3WVU A;  4ZMC A;  5JKL A;  4DAS A;  3QHB A;  3C1Z A;  4YXJ A;  2QQY A;  3IS7 A;  3F34 A;  4TOA A;  3E2C A;  3OGH A;  3FSE A;  3FRS A;  2FJC A;  3PW1 A;  4DYX A;  1LKP A;  2V15 A;  5FEJ A;  1RCD A;  3HIU A;  1XZ1 A;  3R2H A;  1YUX A;  2ZA6 A;  4LQJ A;  3GVY A;  1YV1 A;  2V2N A;  4RC8 A;  3BKN A;  4DE6 A;  2G38 B;  1JTS A;  3GE4 A;  3PWQ A;  4MKU A;  5ERJ A;  2FG4 A;  4ZKH A;  1BCF A;  5C6F A;  3ERZ A;  3FI6 A;  4QUW A;  4RC5 A;  3D19 A;  4MXP A;  1RYT A;  1B71 A;  2FHA A;  2OKC A;  3C1Y A;  3QHC A;  3KX9 A;  4TOF A;  2V8T A;  3SE1 A;  4E6K A;  2FZF A;  2BKC A;  5GN8 B;  4DYZ A;  3IS8 A;  5ERK A;  1ZUJ A;  5D8R A;  4Z3B A;  5JDO A;  1RCC A;  4MJY A;  1RCI A;  3PVR A;  5JKL G;  3H7G A;  5HJF A;  3E1M A;  3F35 A;  1DVB A;  1IER A;  2V2M A;  2BJY A;  3EGM A;  2V2R A;  3FVB A;  2Z6M A;  3KA6 A;  3KWO A;  3PVT B;  3KA3 A;  4LPN A;  1LKM A;  3PVY B;  3NOZ X;  3R2O A;  5LS9 A;  2WLU A;  5J9V A;  2X17 0;  3BVL A;  3F32 A;  4E40 A;  4RC7 A;  1R03 A;  1UVH A;  2VZB A;  3PW8 A;  1SOF A;  3R2L A;  4MUD A;  3AJP A;  2CWL A;  2YJK A;  2GS4 A;  1S2Z A;  3DBY A;  2CN7 A;  5JAC A;  4ITT A;  5D8S A;  3R2K A;  1NF6 A;  2V2O A;  2BK6 A;  2C6R A;  1TJO A;  2JD8 0;  3TA8 A;  3PW8 C;  2IY4 A;  4RC6 B;  2VXI A;  3Q4N A;  3FRR A;  4DYU A;  2OC5 A;  5LG2 A;  5IX6 A;  3Q4Q A;  3RAV A;  2ZA8 A;  2V2J A;  3IQ1 A;  4IWJ A;  2W0O A;  5HU6 D;  2UX1 A;  2JD7 0;  5GU3 X;  3GGZ A;  3R2R A;  3T9J A;  4ZL5 A;  5FFC A;  1EUM A;  4YKH A;  5FFE A;  4ITW A;  3V3K B;  2V2P A;  3UFB A;  5HQO A;  4LPM A;  1KRQ A;  4MN9 A;  1LB3 A;  1MOJ A;  3EZU A;  3PZA A;  3Q4O A;  1QGH A;  3SH6 A;  1O9I A;  3AF9 X;  2V8U A;  2FFX J;  4CYB A;  4KVQ A;  4ETR A;  1VEQ A;  2WWX B;  3BVK A;  5D8X A; 
#chains in the Genus database with same CATH homology
 4ZL6 A;  4ERU A;  2C2F A;  5D8Y A;  1S30 A;  3KHK A;  3MPS A;  4TOH A;  4CYA A;  5E2D A;  1JI5 A;  3UOI A;  2RBD A;  3VVA A;  2OH3 A;  4LQN A;  1SQ3 A;  2FKZ A;  1ZS3 A;  3F38 A;  2GYQ A;  1LKO A;  2CN6 A;  2FG8 A;  4YXM A;  4MY7 A;  3UOF A;  3C23 A;  5D8O A;  2ZA7 A;  3UNO A;  3QVD A;  3L0M A;  4ML5 A;  3GGY A;  4TOC A;  2ZG7 X;  4W4K B;  3AK8 A;  3KA4 A;  2C2U A;  1F33 A;  1UMN A;  4TOE A;  4X0J A;  4CVP A;  2C2J A;  2ZG8 X;  4ZJK A;  4II4 B;  4CMY V;  4DYY A;  4IWK A;  1JKV A;  1DAT A;  3RGD A;  2AR0 A;  3F37 A;  4M35 A;  4PG1 A;  3N6O A;  4XKU A;  2HTN A;  3GHQ A;  3R2M A;  2GYD A;  3NP2 X;  4LYX A;  3AF8 X;  5D8Q A;  4OYN A;  4M34 A;  4CY9 A;  2VXX A;  1HRS A;  3WNW A;  4ZKX A;  2HR5 A;  2Z5R A;  5CMQ A;  4ZKW A;  2V2L A;  3E1N A;  4EVB A;  4M33 A;  3Q4R A;  1TKP A;  3O7R A;  4WJG 4;  4DI0 A;  4CVT A;  1N1Q A;  1JGC A;  3E1J A;  4XKS A;  4CVR A;  4IXK A;  3KDQ A;  5GN8 A;  5HJH A;  3PW1 B;  4PGK A;  5GU1 X;  3RBC A;  3WVW A;  1VEI A;  3HL1 A;  1Z6O M;  2BW1 A;  1RCE A;  3O7S A;  2XGW A;  3E6S A;  3AK9 A;  3ISF A;  5JKM A;  1XZ3 A;  4EVD A;  3ES3 A;  2IU2 A;  2F7N A;  3NP0 X;  3PVY A;  1MFR A;  4LYU A;  2C41 A;  4XGS A;  1Z4A A;  1NFV A;  3EZ0 A;  1JIG A;  4RC5 B;  1VEL A;  2PYB A;  3AJQ A;  2JD6 0;  3C21 A;  2Y3Q A;  4P18 A;  4CMY A;  1JRE A;  2CLU A;  3E6R A;  3WVV A;  1QYB A;  4ISM A;  3RD0 A;  4AM2 A;  5JDO B;  3SHX A;  2YJJ A;  4TO9 A;  1Z6O A;  3PVR B;  3F39 A;  3LKD A;  4RC6 A;  3AJO A;  3R2S A;  4XKT A;  5AXS A;  5GOU A;  4AM4 A;  3SID A;  2YW6 A;  2XJO A;  4Y08 A;  5K53 A;  2CF7 A;  5D8P A;  1J30 A;  1OTK A;  4A25 A;  3OJ5 A;  5CZU A;  3M6J A;  4LQV A;  3ISE A;  1NNQ A;  4RC7 B;  2ITB A;  3KXU A;  4PG0 A;  4ZTT A;  5JKM G;  3AF7 X;  4U3G A;  4REU A;  5J8W A;  5I4J A;  4CVS A;  5J8S A;  3QZ3 A;  4AM5 A;  5LBH A;  3PWF A;  5FFD A;  4ISP A;  3E1O A;  2CEI A;  2CHI A;  3QB9 A;  3VV9 A;  1O9R A;  2YW7 A;  3PWQ C;  4M32 A;  3E1L A;  2XJN A;  4W4L B;  5FFB A;  2Y44 A;  2N02 A;  5FFA A;  2FL0 A;  2V2S A;  5GU2 X;  5CMR A;  1NF4 A;  1JI4 A;  1VJX A;  2QF9 A;  4DZ0 A;  4PGI A;  1BG7 A;  4EVE A;  2V2I A;  1RCG A;  2WLA A;  1JKU A;  2Z90 A;  4TOD A;  3U90 A;  4LQH A;  3KA9 A;  4TOG A;  2D5K A;  3E1P A;  3JZA B;  3BVI A;  3A68 A;  3W54 A;  5K52 A;  4YVZ A;  3QD8 A;  2CLB A;  2XJM A;  2Z5P A;  4KXR B;  3E1Q A;  1S3Q A;  1TKO A;  3F36 A;  4II4 A;  3VNX A;  3JZ9 A;  1DPS A;  1F30 A;  1GWG A;  4ZLW A;  2Z5Q A;  2ZUR X;  1FHA A;  3F33 A;  3BT5 A;  1L8H A;  4LPJ A;  4R42 A;  2ZG9 X;  4TOB A;  2IB0 A;  1H96 A;  3PVT A;  2MGY A;  3BVF A;  5E1U A;  4Z5S A;  1IES A;  1VLG A;  2XKQ A;  1JYB A;  2G4H A;  3KA8 A;  1TK6 A;  1L8I A;  5LG8 A;  2WTL A;  3A9Q A;  4EVC A;  3RE7 A;  1AEW A;  1YUZ A;  1BFR A;  5GU0 X;  4KVR A;  5J93 A;  3BVE A;  2CIH A;  2CHP A;  4KVS A;  4TW3 A;  3WVU A;  4ZMC A;  5JKL A;  4DAS A;  3QHB A;  3C1Z A;  4YXJ A;  2QQY A;  3IS7 A;  3F34 A;  4TOA A;  3E2C A;  3OGH A;  3FSE A;  3FRS A;  2FJC A;  3PW1 A;  4DYX A;  1LKP A;  2V15 A;  5FEJ A;  1RCD A;  3HIU A;  1XZ1 A;  3R2H A;  1YUX A;  2ZA6 A;  4LQJ A;  3GVY A;  1YV1 A;  2V2N A;  4RC8 A;  3BKN A;  4DE6 A;  2G38 B;  1JTS A;  3GE4 A;  3PWQ A;  4MKU A;  5ERJ A;  2FG4 A;  4ZKH A;  1BCF A;  5C6F A;  3ERZ A;  3FI6 A;  4QUW A;  4RC5 A;  3D19 A;  4MXP A;  1RYT A;  1B71 A;  2FHA A;  2OKC A;  3C1Y A;  3QHC A;  3KX9 A;  4TOF A;  2V8T A;  3SE1 A;  4E6K A;  2FZF A;  2BKC A;  5GN8 B;  4DYZ A;  3IS8 A;  5ERK A;  1ZUJ A;  5D8R A;  4Z3B A;  5JDO A;  1RCC A;  4MJY A;  1RCI A;  3PVR A;  5JKL G;  3H7G A;  5HJF A;  3E1M A;  3F35 A;  1DVB A;  1IER A;  2V2M A;  2BJY A;  3EGM A;  2V2R A;  3FVB A;  2Z6M A;  3KA6 A;  3KWO A;  3PVT B;  3KA3 A;  4LPN A;  1LKM A;  3PVY B;  3NOZ X;  3R2O A;  5LS9 A;  2WLU A;  5J9V A;  2X17 0;  3BVL A;  3F32 A;  4E40 A;  4RC7 A;  1R03 A;  1UVH A;  2VZB A;  3PW8 A;  1SOF A;  3R2L A;  4MUD A;  3AJP A;  2CWL A;  2YJK A;  2GS4 A;  1S2Z A;  3DBY A;  2CN7 A;  5JAC A;  4ITT A;  5D8S A;  3R2K A;  1NF6 A;  2V2O A;  2BK6 A;  2C6R A;  1TJO A;  2JD8 0;  3TA8 A;  3PW8 C;  2IY4 A;  4RC6 B;  2VXI A;  3Q4N A;  3FRR A;  4DYU A;  2OC5 A;  5LG2 A;  5IX6 A;  3Q4Q A;  3RAV A;  2ZA8 A;  2V2J A;  3IQ1 A;  4IWJ A;  2W0O A;  5HU6 D;  2UX1 A;  2JD7 0;  5GU3 X;  3GGZ A;  3R2R A;  3T9J A;  4ZL5 A;  5FFC A;  1EUM A;  4YKH A;  5FFE A;  4ITW A;  3V3K B;  2V2P A;  3UFB A;  5HQO A;  4LPM A;  1KRQ A;  4MN9 A;  1LB3 A;  1MOJ A;  3EZU A;  3PZA A;  3Q4O A;  1QGH A;  3SH6 A;  1O9I A;  3AF9 X;  2V8U A;  2FFX J;  4CYB A;  4KVQ A;  4ETR A;  1VEQ A;  2WWX B;  3BVK A;  5D8X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...