2Z77A

X-ray crystal structure of rv0760c from mycobacterium tuberculosis in complex with estradiol-17beta-hemisuccinate
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
133
structure length
133
Chain Sequence
b'QSPALIASQSSWRCVQAHDREGWLALMADDVVIEDPIGKSVTNPDGSGIKGKEAVGAFFDTHIAANRLTVTCEETFPSSSPDEIAHILVLHSEFDGGFTSEVRGVFTYRVNKAGLITNMRGYWNLDMMTFGNQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative steroid isomerase
publication title Crystal structure of Mycobacterium tuberculosis Rv0760c at 1.50 A resolution, a structural homolog of Delta(5)-3-ketosteroid isomerase.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Isomerase
total genus 37
structure length 133
sequence length 133
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02136 NTF2 Nuclear transport factor 2 (NTF2) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2z77A00
1ISKA 1JB5A 7STDA 1O7MB 4HVNA 1OHSA 3RGAA 2BMOB 2INXA 4XDWA 2XR8B 1E3VA 4MJDA 5DREA 4XM4A 4STDA 3EF8A 4HM5B 2A15A 4I4KA 1W01A 3F9SA 3MHEA 2Z7AA 4WYKA 3T8UA 4L8OA 1OGZA 1W00A 4GB5A 5CF1A 1STDA 3F7XA 3G0KA 3OWYA 1BUQA 1HKXA 1EG9B 3S5CA 4K1VA 1GS3A 3F40A 3B8LA 3NBRA 3KKGA 1WQLB 2QIYA 3CPOA 3DZLA 5HGRA 1S5AA 3CU3A 3STDA 4FCJA 2UX0A 3GZXB 2YFLB 1E97A 3FF0A 4HM7B 2CKFB 3MG2A 3IPTA 1ASKA 4HM1B 1OHOA 4J9AA 5AIIA 3SOAA 2GBWB 4HZ9B 1OCVA 5AIHA 2PZVA 4HJLB 3JUOA 1DMQA 3JUNA 3BLZA 3WMDA 2XRXB 5CF2A 1Q42A 3FLJA 3FF2A 5JPUA 1E3RA 3B7CA 5IEOA 2F86B 3K7CA 3A76A 4H3UA 1DMNA 5IG5A 3NM2A 3B4PA 2HMMB 4WYKB 4RZMA 1IDPA 5D82A 3HX8A 3FZWA 2OWPA 3G8ZA 4XBTA 3G16A 3HZPA 3B4OA 5TGNA 2JQ5A 2BMRB 4IIAA 4HM8B 4FCMA 4LMIA 1TUHA 4R1KA 3OV4A 1OUNA 1JN5B 5CK6A 5AIFA 3UNLA 4Q53A 5CXOA 1O7NB 4R9LA 1OF5A 5IG4A 4WWUC 2XSOB 4PEJA 3F8XA 2W2CA 4N3VA 2I9WA 1JB4A 1W6YA 3RGRA 1SJWA 1QJGA 1W02A 1Q40A 2HMLB 3GRDA 3EN1B 5JPPA 4J8TA 3MSOA 4K1UA 5FW5A 2YFJB 2GXFA 1ZX2A 2GEXA 2HMJB 3FGYA 1O7PB 3GZRA 1ULIB 3KE7A 3NHXA 3FH1A 4HM2B 5KP1A 1A2KA 3I0YA 2HMNB 3GZYB 3EBTA 3OWSA 3EX9A 5IG0A 3FSDA 3DMCA 4ORLA 2B1XB 4LEHA 1NDOB 1OPYA 5D81A 1JKGA 3D9RA 3F8HA 1DMMA 3CNXA 3EHCA 5KP3A 1Z1SA 3NXJA 4X2OA 3ECFA 2GBXB 1NWWA 4HZBB 1GY6A 1OHPA 1C7HA 5BVBA 2K54A 4L8PA 2QGUA 1EA2A 4OVMA 3E99A 3EQQB 3CNMA 4XDVA 1OH0A 1ZO2A 2RFRA 2RCDA 1O7GB 1QMAA 2IMJA 3H3HA 3JUMA 3EJVA 1OF5B 4HM0B 3EBYA 8CHOA 2CHCA 3NV0A 1UUVB 2Z76A 1O7WB 5IEPA 3MYTA 1VZZA 3EC9A 3MKIA 4CDLA 4OUQA 1GY5A 1ULJB 4KVHA 1TP6A 3UJMA 5D83A 4R9KA 2YFIB 1Q40B 3LYGA 2GEYA 3KSPA 4HM6B 3ER7A 5IENA 3ROBA 5AIGA 5KP4A 2RGQA 4HKVB 6STDA 4HM4B 3EN8A 3VSYA 4XB5A 2HMOB 3MG3A 3Q90A 5IERA 5AEUB 3DM8A 3DUKA 3M8CA 1NU3A 3OWUA 1OGXA 2BNGA 4XBXA 1GY7A 2R4IA 1JN5A 3SEDA 3F7SA 1JKGB 4L7KA 3JUQA 2HMKB 2Z77A 3K0ZA 5STDA 4HM3B 2BMQB 3BB9A 1JB2A 3NUVA 5IF6A 3VGNA 5DRVA 4WP5A 1K41A 1UUWB 5BXQA 5IG3A 5CLKA 3LZAA 4U13A 4LGQA 4XBYA 3SOYA 1O7HB 3GZBA 4X2HA 1AR0A 5AEWB 2F99A 5AI1A 3GWRA 1U5OA 2XSHB 3H51A 3MG1A 3NV0B 3FKAA 1GYBA 3OX9A 3KZTA 5EVHA 3DXOA 2B24B 3T8NA 3F14A 2STDA 3HK4A 2F98A 3JUPA 3OXAA 5G2GA 1CQSA
chains in the Genus database with same CATH superfamily
1ISKA 1JB5A 1RGHA 1DETA 1DVCA 7STDA 1O7MB 4HVNA 1OHSA 1KC84 4FMDA 1ROVA 2CFGA 1Q814 1RN1A 1RNTA 1WTHA 2E2UA 5RNTA 3RGAA 3EB8A 2BMOB 1BOXA 3LXUX 2INXA 3WOFB 3Q1CA 1UCJA 2WGOA 2XR8B 4XDWA 4DKIA 3DH2A 1BVIA 1JBSA 1E3VA 6GSPA 1DVDA 4MJDA 1YJN3 1F8NA 1GOUA 4N6TA 5DREA 4XM4A 1I2EA 4FMAA 3EF8A 4NREA 4STDA 2HOHA 1I2FA 4FCZA 4HM5B 2A15A 4I4KA 1LRAA 1N9EA 1RGEA 1W01A 4N6NB 2O3OA 1PU4A 1AVKA 3D5GA 2KF4A 3F9SA 3MHEA 4BL2A 1VQ83 4EBGA 2V1LA 2Z7AA 1K9M4 4WYKA 3T8UA 1I0VA 2KF5A 4L8OA 2CG1A 3ALAA 1OGZA 2ML5A 3MWZA 3N54B 3NQZA 9RNTA 1K8A4 1IQ8A 2P0MA 3V99A 1QALA 4FR9A 1YJ93 1W00A 1DYUA 1I0XA 4GB5A 5CF1A 1B2XA 1Q7Y4 1KD14 1IQYA 5EEOA 1STDA 3F7XA 3G0KA 3CC43 3OWYA 4KT3B 1BUQA 1RCLA 1HKXA 4BL3A 1EG9B 3G713 1LNIA 5BXQA 2RBIA 3S5CA 4CJNA 2Q07A 4N6UA 3DGNA 4K1VA 2W03A 1GS3A 2XGLA 2ZDJA 1TJDA 2MC8A 3GAXA 2K3DA 2XH9A 3F40A 3G6E3 3B8LA 3NBRA 2O9UX 2Y73A 3KKGA 1MOLA 1WQLB 4TX4A 3AGNA 2QIYA 3CPOA 3DZLA 2JDIH 1VQ93 1CYVA 2ZL8A 3LTCA 4HOHA 5HGRA 1S5AA 3CU3A 1FGOA 3T0UA 4JF8A 1BRJA 3QK9A 3STDA 3WHOA 1T2IA 4FCJA 1BRNL 5FGOA 3X3YA 2CX0A 2F5MA 2GU3A 5M1AA 3CCS3 2UX0A 2WOHA 2WO0A 3GZXB 1QAFA 1T2HA 2CWTA 2P09A 2YFLB 1RMSA 2BO9B 1E97A 3N8BA 1BUJA 3FF0A 1NO3A 1C54A 2W56B 1D6YA 4HM7B 1BAOA 3DGYA 2CKFB 4CCVA 3CCV3 3CMA3 1FZUA 1I3FA 7RNTA 3D4AA 3EE1A 3MG2A 3IPTA 1ASKA 4HM1B 1Q7HA 1UUGB 4WFOA 3WODG 3CCE3 1TFKA 1OHOA 4J9AA 1MWRA 5AIIA 1Y4KA 3AMOB 1B2MA 2AAEA 2F5WA 2M7OA 3SOAA 2GBWB 4HZ9B 1OCVA 3LT8A 5AIHA 1X1XA 2PZVA 4LSOA 5EQLA 2GU1A 4EW5A 4HJLB 1M904 3CME3 3LTDA 5JBSA 3JUOA 1Q824 2QA43 5IG3A 2KAAA 5LC6A 1DMQA 1SQWA 3JUNA 1R4CA 3BLZA 4O8SA 1UGHI 3WMDA 3CC73 2XRXB 1WMNA 3FG1A 5CF2A 5GSPA 4HBRA 3SX1A 2E2VA 2XFTA 1GMQA 1JNQA 1GOVA 2RSXA 1GOYA 1I70A 2CFDA 5I97A 1Q42A 3FLJA 1BNFA 3FF2A 5JPUA 1SIHA 1B2UA 1E3RA 1SIIA 1IV9A 1NJI4 2GSPA 8RNTA 1WMOA 3B7CA 2CIUA 5IEOA 1SARA 3HIGA 1FUTA 3X40A 2ZHXB 3WDGB 3V98A 2F86B 2CG0A 3K7CA 2W6JH 4BU4A 1J2BA 1PYLA 3V92A 1T5YA 3A76A 1AV4A 2OQEC 1YNVX 1DMNA 1FGTA 4H3UA 4IPBA 1YJW3 1IQXA 3DGMA 5IG5A 5ELUA 5KP3A 1X1YA 1GD3A 2IYJA 2C10A 3NM2A 3B4PA 2D1WA 2HMMB 4WYKB 1FGMA 1RTUA 4GHOA 2CFKA 2KXGA 2QEX3 4RZMA 1IDPA 5D82A 2FXTA 1BSBA 3HX8A 3FZWA 4BTXA 2OWPA 3G8ZA 1RGCA 3N9HA 2CFWA 3IMAB 2PNCA 4EXRA 4XBTA 3BU4A 3G16A 1EKMA 3HZPA 3LTAA 1AVLA 1RCKA 2OOVA 3BIRA 3B4OA 5TGNA 2H0GA 2JQ5A 2BT3A 3A5EA 1BRSA 3LMLA 3S28A 1X1UA 4KFFA 2YX9A 1EQKA 1FA3A 3I553 4RBNA 1CEWI 1N8QA 1ROAA 3AHWA 2BMRB 1QVF2 4CPKA 4BTWA 4IIAA 2XEPA 4ILFA 4MMZB 1BNRA 4HM8B 2LQVA 1BSAA 3KSED 2Z6BA 4FCMA 4LMIA 3ZG0A 1TUHA 4R1KA 3OV4A 1OUNA 1A67A 1JN5B 5CK6A 1YIJ3 4R80A 5AIFA 1VQ43 2W9PA 4FMCA 1VQO3 4O3VA 1BNJA 1STFI 3UNLA 6RNTA 3URPA 4Q53A 5CXOA 1O7NB 1IU7A 1FGRA 4HYZA 4R9LA 3FG4A 1OF5A 1LOXA 1W2ZA 2L1SA 3X3ZA 4AEQA 5IG4A 1MNLA 4WWUC 1U8CB 2KF6A 2XSOB 1UCKA 1TTOA 3CCJ3 1NB5I 3BNDA 4HAAA 4PEJA 3F8XA 2W2CA 5ELJA 4RNYA 1MWTA 2UGIA 4N3VA 4QWTA 3NX0A 3LT9A 4NPBA 1YIT3 1VQK3 2C4BA 2I9WA 3BNEA 1AQZA 1BNEA 1JB4A 1RRHA 1W6YA 2CC3A 1JV2B 3RGRA 5IW9A 3OW22 1SJWA 1QJGA 3LOYA 1LOVA 5A0OB 1MGRA 2W04A 5G2GA 1V74A 1W02A 2IY2A 1BNSA 3VF1A 1A90A 2FNQA 2KF3A 1G96A 1Q40A 1TRQA 2HMLB 3GRDA 1M1K4 1N5HA 3EN1B 1K28A 1PY3A 2IA7A 1W6CA 4J8TA 3MSOA 4K1UA 4N6OB 3WA2X 5HOHA 5JPPA 5FW5A 2W0QA 1IK3A 2BIRA 2CX1A 2H0HA 2YFJB 2GXFA 1LOWA 1ZX2A 1M9GA 1N9JA 3UB1A 1AY7A 1LQMB 2GEXA 2HMJB 3FGYA 3MPHA 1O7PB 1WMPA 2IUJA 3GZRA 3HIIA 1BRIA 1ULIB 3KE7A 1RHLA 1QVG2 3SYUA 3NHXA 3FH1A 3S29A 3NM7A 1RGAA 3Q3FA 4HM2B 1GMPA 2E2TA 1VQ53 5KP1A 3WOEB 2F56A 1A2KA 1ZGXA 1TIJA 1UI7A 3I0YA 3J7Yd 2HMNB 3GZYB 3AHSA 3D5IA 3EBTA 3OWSA 4BIRA 3EX9A 4I5QA 3FSDA 3FG3A 5IG0A 1RN4A 3DMCA 1RSNA 1B21A 4ORLA 4J5GA 2B1XB 1B3SA 4IT7A 4GSPA 4LEHA 1KWIA 3WR2A 1D6UA 1NDOB 1OPYA 5D81A 1JKGA 1PFPA 1KQS2 2OTJ3 3D9RA 3RNTA 3F8HA 1DMMA 2K0MA 3CNXA 3EHCA 3KIIA 1RGLA 4MMYB 4EC6A 1HYFA 2Y74A 1B2SA 1Z1SA 4H61A 3NXJA 2FGTA 2CWVA 3PCSA 4MEIA 4O2HA 3ECFA 4X2OA 2GBXB 1NWWA 3IJEB 1UCLA 2KCDA 1GY6A 4HZBB 5G1KA 4AKZA 4EV5A 4R4KA 1OHPA 1L5GB 3UL5A 1C7HA 1JBTA 4K90B 5BVBA 2K54A 3BNCA 4L8PA 4N6MA 1N8R4 2BHMA 4EV2A 3CCM3 1LXEA 1FYSA 2QGUA 1JRQA 3L0RA 1EA2A 1VQM3 4OVMA 3WA3A 3E99A 3D3LA 3EQQB 2C11A 3CNMA 1IVXA 3NQYA 1FUSA 3DGLA 3PXMA 4XDVA 1WNHA 3RDEA 1VQ63 1OH0A 1ZO2A 4EYCA 1BNIA 2RFRA 4MMXB 1A2PA 2RCDA 3UL6A 3G4S3 1VQQA 1O7GB 1QMAA 1I2GA 1BIRA 4GL6A 2IMJA 1I8VA 1YGEA 3H3HA 3PS8A 1RKYA 5M18A 3JUMA 1OACA 1VQL3 1RRLA 1K734 4RNTA 3EJVA 1OF5B 4HM0B 1US1A 1VQ73 3EBYA 2H0IA 1IT7A 1HU9A 2OCTA 3NBBA 3QRDA 8CHOA 1X1WA 2AADA 2CHCA 2W9QA 4KFDA 3NV0A 1UUVB 1I3IA 7GSPA 1BGSA 3CXC2 1TFOA 1Q9EA 1VQP3 2Z76A 3CCR3 1O7WB 1A2VA 3LTBA 1IVVA 3U97A 1IVUA 2P38A 2CK3H 2CWUA 3MYTA 5IEPA 1VZZA 1BSCA 3EC9A 3MKIA 4CDLA 3D79A 1LOYA 4OUQA 1GY5A 1ULJB 1S723 4KVHA 1BANA 2CFLA 1TP6A 1M1XB 3UJMA 1Q864 5D83A 1TU5A 4R9KA 1RDSA 2OQEA 2YFIB 1G02A 1CH0A 4J5KA 1Q40B 1LVNA 3ZFZA 1FW7A 1MWSA 1T3BA 1BRKA 3Q2PA 5LC7A 3AGOA 3LYGA 2GEYA 3KSPA 3ZG5A 1IYYA 1YGWA 4HM6B 1JZOA 1W7CA 3GSPA 1QAKA 3ER7A 2SARA 1RGGA 5IENA 5G1LA 4JRFA 2CW9A 2UUGC 3ROBA 5AIGA 5KP4A 3PGBA 2RGQA 4HKVB 6STDA 4HM4B 1YVBI 3EN8A 1IV7A 4KZ1A 3SVAA 3VSYA 1GMRA 1RN7A 2SBLA 2P0XA 4XB5A 1B27A 2HMOB 3DY5A 3MG3A 3Q90A 1UGIA 5IERA 3KCHA 4G1MB 4RNZA 3KN4A 5AEUB 3DM8A 1UCIA 3FCSB 2WGQA 2XF3A 4OK0A 3DUKA 3S27A 3K5TA 3M8CA 3CCL3 1YVSA 1NU3A 1RLSA 3OWUA 3I563 1OGXA 2BNGA 3S67A 1W6GA 4XBXA 1EEJA 1GY7A 2WOFA 2OTL3 2R4IA 1JN5A 3SEDA 1N5PA 3F7SA 1JKGB 1RNBA 1RGFA 5AYRB 1ZS7A 1BRGA 3O8YA 3JVCA 4L7KA 1V58A 1UI8A 3DGOA 3K63A 1GD4A 3JUQA 3TDGA 3CC23 2HMKB 4WHAA 1B2ZA 2Z77A 2CH9A 3K0ZA 3LH4A 5STDA 1W2B2 4HM3B 1EUIC 2BMQB 1RGKA 1JZDA 1NNVA 2KRTA 2XGNA 2ZA4A 3BB9A 1JB2A 1SPUA 3NUVA 5BIRA 5IF6A 3VGNA 2ML6A 3CPW2 5DRVA 4WP5A 1BSEA 1K41A 1UUWB 3PZWA 5CLKA 2BU4A 2IUKA 4ZM8A 3LZAA 3SXXA 1GSPA 4U13A 4LYLB 1D6ZA 2XFSA 3BNBA 3PCRA 4LGQA 1JBRA 4XBYA 1YHQ3 3SOYA 1O7HB 3GZBA 3PYJA 4X2HA 1AR0A 1BNGA 1G0TA 4NHFA 4O02B 5AEWB 2OOVC 1BSDA 1UW1A 2F99A 3KFQC 3CCU3 4BTYA 1UDII 2MF7A 1HZ1A 2P05A 1W5ZA 3NBJA 5AI1A 1MWUA 3K9MC 3GWRA 3HI7A 1CYUA 1U5OA 1VQN3 2XSHB 2W56A 3H51A 2RNTA 3MG1A 1B20A 3NV0B 4AKYA 3FKAA 1DE3A 1KSIA 4N6V0 1TRPA 1LNHA 1R4YA 3U1WA 1NB3I 1GYBA 4KFEA 1FGQA 1W4NA 1V57A 1RJOA 3KZTA 3AMOA 3OX9A 3HOHA 3X42A 3CD63 1BU4A 4FMBA 5EVHA 5M19A 3DXOA 1IVWA 2B24B 2L4VA 5AYSC 3X41A 1MGWA 2LYXA 3T8NA 4K61A 3F14A 4LZIA 5BU4A 2STDA 3X3XA 3CCQ3 1LQGC 2F4YA 2J8XB 3HK4A 1YI23 1BRHA 4N6LA 2D42A 1FUWA 3SLUA 2F98A 3JUPA 3OXAA 2R41A 1IT8A 1CQSA 1JJ22
chains in the Genus database with same CATH topology
1ISKA 1JB5A 1DVCA 7STDA 1O7MB 4HVNA 1OHSA 1KC84 4FMDA 1ROVA 2CFGA 1Q814 1WTHA 2E2UA 3RGAA 3EB8A 2BMOB 3WOFB 3LXUX 2INXA 3Q1CA 2WGOA 4XDWA 2XR8B 1E3VA 1DVDA 4MJDA 1YJN3 1F8NA 4N6TA 5DREA 4XM4A 4FMAA 3EF8A 4NREA 4STDA 4FCZA 4HM5B 2A15A 4I4KA 1W01A 1N9EA 4N6NB 2O3OA 1PU4A 1AVKA 3F9SA 3MHEA 1VQ83 4EBGA 2V1LA 2Z7AA 1K9M4 4WYKA 3T8UA 4L8OA 2CG1A 3ALAA 1OGZA 2ML5A 3MWZA 3N54B 3NQZA 1K8A4 1IQ8A 2P0MA 3V99A 1QALA 4FR9A 1YJ93 1W00A 1DYUA 4GB5A 5CF1A 1Q7Y4 1KD14 1IQYA 5EEOA 1STDA 3F7XA 3G0KA 3CC43 3OWYA 1BUQA 1HKXA 1EG9B 3S5CA 2Q07A 4N6UA 3DGNA 4K1VA 2W03A 1GS3A 2XGLA 2ZDJA 2MC8A 3GAXA 2XH9A 3F40A 3G6E3 3B8LA 3NBRA 2O9UX 2Y73A 3KKGA 1MOLA 1WQLB 4TX4A 2QIYA 3CPOA 3DZLA 2JDIH 1VQ93 1CYVA 2ZL8A 3LTCA 5HGRA 1S5AA 3CU3A 1FGOA 3T0UA 4JF8A 3QK9A 3STDA 4FCJA 5FGOA 3X3YA 2GU3A 3CCS3 2UX0A 2WOHA 2WO0A 3GZXB 1QAFA 2YFLB 2CWTA 2P09A 2BO9B 3N8BA 1E97A 3FF0A 1NO3A 2W56B 1D6YA 4HM7B 2CKFB 4CCVA 3CCV3 3CMA3 3EE1A 3CCE3 3MG2A 3IPTA 1ASKA 4HM1B 4WFOA 3WODG 1TFKA 1OHOA 4J9AA 5AIIA 1Y4KA 3AMOB 2M7OA 3SOAA 2GBWB 4HZ9B 1OCVA 3LT8A 5AIHA 2PZVA 1J2BA 4LSOA 5EQLA 2GU1A 4HJLB 1M904 3CME3 3LTDA 5JBSA 3JUOA 1Q824 2QA43 5LC6A 1DMQA 1SQWA 3JUNA 1R4CA 3BLZA 4O8SA 3WMDA 3CC73 2XRXB 1WMNA 3FG1A 5CF2A 4HBRA 3SX1A 2E2VA 2XFTA 1JNQA 2RSXA 2CFDA 5I97A 1Q42A 3FLJA 3FF2A 5JPUA 1SIHA 1E3RA 1SIIA 1IV9A 1NJI4 1WMOA 3B7CA 2CIUA 5IEOA 3HIGA 3X40A 3WDGB 3V98A 2F86B 2CG0A 3K7CA 2W6JH 3V92A 1T5YA 3A76A 1AV4A 2OQEC 4H3UA 1DMNA 1FGTA 4IPBA 1YJW3 1IQXA 3DGMA 5IG5A 5ELUA 1GD3A 2C10A 3NM2A 3B4PA 2D1WA 2HMMB 4WYKB 1FGMA 2CFKA 2KXGA 2QEX3 4RZMA 1IDPA 5D82A 2FXTA 3HX8A 3FZWA 4BTXA 2OWPA 3G8ZA 3N9HA 2CFWA 3IMAB 2PNCA 4EXRA 4XBTA 3G16A 1EKMA 3HZPA 3LTAA 1AVLA 2OOVA 3B4OA 5TGNA 2JQ5A 3LMLA 2BT3A 3S28A 1FA3A 4KFFA 2YX9A 1EQKA 3I553 4RBNA 1CEWI 1N8QA 1ROAA 2BMRB 1QVF2 4BTWA 4IIAA 2XEPA 4MMZB 4HM8B 2LQVA 3KSED 2Z6BA 4FCMA 4LMIA 1TUHA 4R1KA 3OV4A 1OUNA 1A67A 1JN5B 5CK6A 1YIJ3 4R80A 5AIFA 1VQ43 2W9PA 4FMCA 1VQO3 4O3VA 1STFI 3UNLA 4Q53A 5CXOA 1O7NB 1IU7A 1FGRA 4HYZA 4R9LA 3FG4A 1OF5A 1LOXA 1W2ZA 3X3ZA 4AEQA 5IG4A 1MNLA 4WWUC 1U8CB 2XSOB 1NB5I 3CCJ3 3BNDA 4PEJA 3F8XA 2W2CA 5ELJA 4RNYA 4N3VA 4QWTA 3NX0A 3LT9A 1YIT3 1VQK3 2I9WA 3BNEA 1JB4A 1RRHA 1W6YA 2CC3A 1JV2B 3RGRA 5IW9A 3OW22 1SJWA 1QJGA 3LOYA 5A0OB 2W04A 1V74A 1W02A 3VF1A 1A90A 2FNQA 1Q40A 1G96A 2HMLB 3GRDA 1M1K4 1N5HA 3EN1B 1K28A 2IA7A 4N6OB 1W6CA 4J8TA 3MSOA 4K1UA 5JPPA 3WA2X 5FW5A 2W0QA 1IK3A 2YFJB 2GXFA 1ZX2A 1M9GA 1N9JA 3UB1A 2GEXA 2HMJB 3FGYA 3MPHA 1O7PB 1WMPA 2IUJA 3GZRA 3HIIA 1ULIB 3KE7A 1QVG2 3NHXA 3FH1A 3S29A 3NM7A 4HM2B 2E2TA 1VQ53 5KP1A 3WOEB 1A2KA 1TIJA 1UI7A 3I0YA 3J7Yd 2HMNB 3GZYB 3EBTA 3OWSA 3EX9A 5IG0A 3FSDA 3FG3A 3DMCA 4ORLA 2B1XB 4IT7A 4LEHA 1KWIA 1D6UA 1NDOB 1OPYA 5D81A 1JKGA 1PFPA 1KQS2 2OTJ3 3D9RA 3F8HA 1DMMA 2K0MA 3CNXA 3EHCA 3KIIA 4MMYB 4EC6A 2Y74A 4H61A 1Z1SA 4MEIA 5KP3A 3NXJA 2FGTA 2CWVA 3PCSA 4O2HA 4X2OA 3ECFA 2GBXB 1NWWA 3IJEB 4HZBB 2KCDA 1GY6A 4AKZA 4EV5A 4R4KA 1OHPA 1L5GB 3UL5A 1C7HA 4K90B 5BVBA 2K54A 3BNCA 4L8PA 4N6MA 1N8R4 2BHMA 4EV2A 3CCM3 1LXEA 2QGUA 1JRQA 3L0RA 1EA2A 1VQM3 4OVMA 3WA3A 3E99A 3D3LA 3EQQB 2C11A 3CNMA 1IVXA 3NQYA 3PXMA 3DGLA 4XDVA 1WNHA 3RDEA 1VQ63 1OH0A 1ZO2A 4EYCA 2RFRA 4MMXB 2RCDA 3UL6A 3G4S3 1O7GB 1QMAA 4GL6A 2IMJA 1YGEA 3H3HA 3PS8A 1RKYA 3JUMA 1OACA 1VQL3 1RRLA 1K734 3EJVA 1OF5B 4HM0B 1US1A 1VQ73 3EBYA 1IT7A 1HU9A 2OCTA 3NBBA 3QRDA 8CHOA 2CHCA 2W9QA 4KFDA 3NV0A 1UUVB 3CXC2 1TFOA 1VQP3 2Z76A 3CCR3 1O7WB 1A2VA 3LTBA 1IVVA 3U97A 1IVUA 2P38A 2CK3H 2CWUA 3MYTA 5IEPA 1VZZA 3EC9A 3MKIA 4CDLA 4OUQA 1GY5A 1ULJB 1S723 4KVHA 2CFLA 1TP6A 1M1XB 3UJMA 1Q864 5D83A 1TU5A 4R9KA 2OQEA 2YFIB 1Q40B 1LVNA 3Q2PA 5LC7A 3LYGA 2GEYA 3KSPA 4HM6B 1W7CA 1QAKA 3ER7A 5IENA 4JRFA 2CW9A 3ROBA 5AIGA 5KP4A 3PGBA 2RGQA 4HKVB 6STDA 4HM4B 1YVBI 3EN8A 1IV7A 4KZ1A 3SVAA 3VSYA 1RN7A 2SBLA 2P0XA 4XB5A 2HMOB 3DY5A 3MG3A 3Q90A 5IERA 4G1MB 4RNZA 3KN4A 5AEUB 3DM8A 3FCSB 4OK0A 2WGQA 2XF3A 3S27A 3DUKA 3K5TA 3M8CA 3CCL3 1NU3A 3OWUA 3I563 1OGXA 2BNGA 3S67A 1W6GA 4XBXA 1GY7A 2WOFA 2OTL3 2R4IA 1JN5A 3SEDA 1N5PA 3F7SA 1JKGB 5AYRB 3O8YA 3JVCA 4L7KA 1UI8A 3DGOA 3K63A 1GD4A 3JUQA 3TDGA 3CC23 2HMKB 4WHAA 2Z77A 2CH9A 3K0ZA 3LH4A 5STDA 1W2B2 4HM3B 2BMQB 3BB9A 2XGNA 2KRTA 1JB2A 1SPUA 3NUVA 5IF6A 3VGNA 2ML6A 3CPW2 5DRVA 4WP5A 1K41A 1UUWB 3PZWA 4ZM8A 5CLKA 2IUKA 5BXQA 5IG3A 3LZAA 3SXXA 3G713 4U13A 1D6ZA 2XFSA 3BNBA 3PCRA 4LGQA 4XBYA 1YHQ3 3SOYA 1O7HB 3GZBA 3PYJA 4X2HA 1AR0A 5AEWB 4NHFA 4O02B 2OOVC 1UW1A 2F99A 3KFQC 3CCU3 4BTYA 2MF7A 2P05A 1W5ZA 3NBJA 5AI1A 3K9MC 1CYUA 3GWRA 3HI7A 1U5OA 1VQN3 2XSHB 2W56A 3H51A 3MG1A 3NV0B 4AKYA 3FKAA 1KSIA 4N6V0 1LNHA 3U1WA 1NB3I 1GYBA 4KFEA 1FGQA 1W4NA 3OX9A 1RJOA 3KZTA 3AMOA 3X42A 3CD63 4FMBA 5EVHA 3DXOA 1IVWA 2B24B 2L4VA 5AYSC 3X41A 2LYXA 3T8NA 4K61A 3F14A 4LZIA 2STDA 3X3XA 3CCQ3 3HK4A 1YI23 1FUWA 4N6LA 2D42A 3SLUA 2F98A 3JUPA 3OXAA 5G2GA 1IT8A 1CQSA 1JJ22
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ISK A;  1JB5 A;  7STD A;  1O7M B;  4HVN A;  1OHS A;  3RGA A;  2BMO B;  2INX A;  4XDW A;  2XR8 B;  1E3V A;  4MJD A;  5DRE A;  4XM4 A;  4STD A;  3EF8 A;  4HM5 B;  2A15 A;  4I4K A;  1W01 A;  3F9S A;  3MHE A;  2Z7A A;  4WYK A;  3T8U A;  4L8O A;  1OGZ A;  1W00 A;  4GB5 A;  5CF1 A;  1STD A;  3F7X A;  3G0K A;  3OWY A;  1BUQ A;  1HKX A;  1EG9 B;  3S5C A;  4K1V A;  1GS3 A;  3F40 A;  3B8L A;  3NBR A;  3KKG A;  1WQL B;  2QIY A;  3CPO A;  3DZL A;  5HGR A;  1S5A A;  3CU3 A;  3STD A;  4FCJ A;  2UX0 A;  3GZX B;  2YFL B;  1E97 A;  3FF0 A;  4HM7 B;  2CKF B;  3MG2 A;  3IPT A;  1ASK A;  4HM1 B;  1OHO A;  4J9A A;  5AII A;  3SOA A;  2GBW B;  4HZ9 B;  1OCV A;  5AIH A;  2PZV A;  4HJL B;  3JUO A;  1DMQ A;  3JUN A;  3BLZ A;  3WMD A;  2XRX B;  5CF2 A;  1Q42 A;  3FLJ A;  3FF2 A;  5JPU A;  1E3R A;  3B7C A;  5IEO A;  2F86 B;  3K7C A;  3A76 A;  4H3U A;  1DMN A;  5IG5 A;  3NM2 A;  3B4P A;  2HMM B;  4WYK B;  4RZM A;  1IDP A;  5D82 A;  3HX8 A;  3FZW A;  2OWP A;  3G8Z A;  4XBT A;  3G16 A;  3HZP A;  3B4O A;  5TGN A;  2JQ5 A;  2BMR B;  4IIA A;  4HM8 B;  4FCM A;  4LMI A;  1TUH A;  4R1K A;  3OV4 A;  1OUN A;  1JN5 B;  5CK6 A;  5AIF A;  3UNL A;  4Q53 A;  5CXO A;  1O7N B;  4R9L A;  1OF5 A;  5IG4 A;  4WWU C;  2XSO B;  4PEJ A;  3F8X A;  2W2C A;  4N3V A;  2I9W A;  1JB4 A;  1W6Y A;  3RGR A;  1SJW A;  1QJG A;  1W02 A;  1Q40 A;  2HML B;  3GRD A;  3EN1 B;  5JPP A;  4J8T A;  3MSO A;  4K1U A;  5FW5 A;  2YFJ B;  2GXF A;  1ZX2 A;  2GEX A;  2HMJ B;  3FGY A;  1O7P B;  3GZR A;  1ULI B;  3KE7 A;  3NHX A;  3FH1 A;  4HM2 B;  5KP1 A;  1A2K A;  3I0Y A;  2HMN B;  3GZY B;  3EBT A;  3OWS A;  3EX9 A;  5IG0 A;  3FSD A;  3DMC A;  4ORL A;  2B1X B;  4LEH A;  1NDO B;  1OPY A;  5D81 A;  1JKG A;  3D9R A;  3F8H A;  1DMM A;  3CNX A;  3EHC A;  5KP3 A;  1Z1S A;  3NXJ A;  4X2O A;  3ECF A;  2GBX B;  1NWW A;  4HZB B;  1GY6 A;  1OHP A;  1C7H A;  5BVB A;  2K54 A;  4L8P A;  2QGU A;  1EA2 A;  4OVM A;  3E99 A;  3EQQ B;  3CNM A;  4XDV A;  1OH0 A;  1ZO2 A;  2RFR A;  2RCD A;  1O7G B;  1QMA A;  2IMJ A;  3H3H A;  3JUM A;  3EJV A;  1OF5 B;  4HM0 B;  3EBY A;  8CHO A;  2CHC A;  3NV0 A;  1UUV B;  2Z76 A;  1O7W B;  5IEP A;  3MYT A;  1VZZ A;  3EC9 A;  3MKI A;  4CDL A;  4OUQ A;  1GY5 A;  1ULJ B;  4KVH A;  1TP6 A;  3UJM A;  5D83 A;  4R9K A;  2YFI B;  1Q40 B;  3LYG A;  2GEY A;  3KSP A;  4HM6 B;  3ER7 A;  5IEN A;  3ROB A;  5AIG A;  5KP4 A;  2RGQ A;  4HKV B;  6STD A;  4HM4 B;  3EN8 A;  3VSY A;  4XB5 A;  2HMO B;  3MG3 A;  3Q90 A;  5IER A;  5AEU B;  3DM8 A;  3DUK A;  3M8C A;  1NU3 A;  3OWU A;  1OGX A;  2BNG A;  4XBX A;  1GY7 A;  2R4I A;  1JN5 A;  3SED A;  3F7S A;  1JKG B;  4L7K A;  3JUQ A;  2HMK B;  2Z77 A;  3K0Z A;  5STD A;  4HM3 B;  2BMQ B;  3BB9 A;  1JB2 A;  3NUV A;  5IF6 A;  3VGN A;  5DRV A;  4WP5 A;  1K41 A;  1UUW B;  5BXQ A;  5IG3 A;  5CLK A;  3LZA A;  4U13 A;  4LGQ A;  4XBY A;  3SOY A;  1O7H B;  3GZB A;  4X2H A;  1AR0 A;  5AEW B;  2F99 A;  5AI1 A;  3GWR A;  1U5O A;  2XSH B;  3H51 A;  3MG1 A;  3NV0 B;  3FKA A;  1GYB A;  3OX9 A;  3KZT A;  5EVH A;  3DXO A;  2B24 B;  3T8N A;  3F14 A;  2STD A;  3HK4 A;  2F98 A;  3JUP A;  3OXA A;  5G2G A;  1CQS A; 
#chains in the Genus database with same CATH topology
 1ISK A;  1JB5 A;  1RGH A;  1DET A;  1DVC A;  7STD A;  1O7M B;  4HVN A;  1OHS A;  1KC8 4;  4FMD A;  1ROV A;  2CFG A;  1Q81 4;  1RN1 A;  1RNT A;  1WTH A;  2E2U A;  5RNT A;  3RGA A;  3EB8 A;  2BMO B;  1BOX A;  3LXU X;  2INX A;  3WOF B;  3Q1C A;  1UCJ A;  2WGO A;  2XR8 B;  4XDW A;  4DKI A;  3DH2 A;  1BVI A;  1JBS A;  1E3V A;  6GSP A;  1DVD A;  4MJD A;  1YJN 3;  1F8N A;  1GOU A;  4N6T A;  5DRE A;  4XM4 A;  1I2E A;  4FMA A;  3EF8 A;  4NRE A;  4STD A;  2HOH A;  1I2F A;  4FCZ A;  4HM5 B;  2A15 A;  4I4K A;  1LRA A;  1N9E A;  1RGE A;  1W01 A;  4N6N B;  2O3O A;  1PU4 A;  1AVK A;  3D5G A;  2KF4 A;  3F9S A;  3MHE A;  4BL2 A;  1VQ8 3;  4EBG A;  2V1L A;  2Z7A A;  1K9M 4;  4WYK A;  3T8U A;  1I0V A;  2KF5 A;  4L8O A;  2CG1 A;  3ALA A;  1OGZ A;  2ML5 A;  3MWZ A;  3N54 B;  3NQZ A;  9RNT A;  1K8A 4;  1IQ8 A;  2P0M A;  3V99 A;  1QAL A;  4FR9 A;  1YJ9 3;  1W00 A;  1DYU A;  1I0X A;  4GB5 A;  5CF1 A;  1B2X A;  1Q7Y 4;  1KD1 4;  1IQY A;  5EEO A;  1STD A;  3F7X A;  3G0K A;  3CC4 3;  3OWY A;  4KT3 B;  1BUQ A;  1RCL A;  1HKX A;  4BL3 A;  1EG9 B;  3G71 3;  1LNI A;  5BXQ A;  2RBI A;  3S5C A;  4CJN A;  2Q07 A;  4N6U A;  3DGN A;  4K1V A;  2W03 A;  1GS3 A;  2XGL A;  2ZDJ A;  1TJD A;  2MC8 A;  3GAX A;  2K3D A;  2XH9 A;  3F40 A;  3G6E 3;  3B8L A;  3NBR A;  2O9U X;  2Y73 A;  3KKG A;  1MOL A;  1WQL B;  4TX4 A;  3AGN A;  2QIY A;  3CPO A;  3DZL A;  2JDI H;  1VQ9 3;  1CYV A;  2ZL8 A;  3LTC A;  4HOH A;  5HGR A;  1S5A A;  3CU3 A;  1FGO A;  3T0U A;  4JF8 A;  1BRJ A;  3QK9 A;  3STD A;  3WHO A;  1T2I A;  4FCJ A;  1BRN L;  5FGO A;  3X3Y A;  2CX0 A;  2F5M A;  2GU3 A;  5M1A A;  3CCS 3;  2UX0 A;  2WOH A;  2WO0 A;  3GZX B;  1QAF A;  1T2H A;  2CWT A;  2P09 A;  2YFL B;  1RMS A;  2BO9 B;  1E97 A;  3N8B A;  1BUJ A;  3FF0 A;  1NO3 A;  1C54 A;  2W56 B;  1D6Y A;  4HM7 B;  1BAO A;  3DGY A;  2CKF B;  4CCV A;  3CCV 3;  3CMA 3;  1FZU A;  1I3F A;  7RNT A;  3D4A A;  3EE1 A;  3MG2 A;  3IPT A;  1ASK A;  4HM1 B;  1Q7H A;  1UUG B;  4WFO A;  3WOD G;  3CCE 3;  1TFK A;  1OHO A;  4J9A A;  1MWR A;  5AII A;  1Y4K A;  3AMO B;  1B2M A;  2AAE A;  2F5W A;  2M7O A;  3SOA A;  2GBW B;  4HZ9 B;  1OCV A;  3LT8 A;  5AIH A;  1X1X A;  2PZV A;  4LSO A;  5EQL A;  2GU1 A;  4EW5 A;  4HJL B;  1M90 4;  3CME 3;  3LTD A;  5JBS A;  3JUO A;  1Q82 4;  2QA4 3;  5IG3 A;  2KAA A;  5LC6 A;  1DMQ A;  1SQW A;  3JUN A;  1R4C A;  3BLZ A;  4O8S A;  1UGH I;  3WMD A;  3CC7 3;  2XRX B;  1WMN A;  3FG1 A;  5CF2 A;  5GSP A;  4HBR A;  3SX1 A;  2E2V A;  2XFT A;  1GMQ A;  1JNQ A;  1GOV A;  2RSX A;  1GOY A;  1I70 A;  2CFD A;  5I97 A;  1Q42 A;  3FLJ A;  1BNF A;  3FF2 A;  5JPU A;  1SIH A;  1B2U A;  1E3R A;  1SII A;  1IV9 A;  1NJI 4;  2GSP A;  8RNT A;  1WMO A;  3B7C A;  2CIU A;  5IEO A;  1SAR A;  3HIG A;  1FUT A;  3X40 A;  2ZHX B;  3WDG B;  3V98 A;  2F86 B;  2CG0 A;  3K7C A;  2W6J H;  4BU4 A;  1J2B A;  1PYL A;  3V92 A;  1T5Y A;  3A76 A;  1AV4 A;  2OQE C;  1YNV X;  1DMN A;  1FGT A;  4H3U A;  4IPB A;  1YJW 3;  1IQX A;  3DGM A;  5IG5 A;  5ELU A;  5KP3 A;  1X1Y A;  1GD3 A;  2IYJ A;  2C10 A;  3NM2 A;  3B4P A;  2D1W A;  2HMM B;  4WYK B;  1FGM A;  1RTU A;  4GHO A;  2CFK A;  2KXG A;  2QEX 3;  4RZM A;  1IDP A;  5D82 A;  2FXT A;  1BSB A;  3HX8 A;  3FZW A;  4BTX A;  2OWP A;  3G8Z A;  1RGC A;  3N9H A;  2CFW A;  3IMA B;  2PNC A;  4EXR A;  4XBT A;  3BU4 A;  3G16 A;  1EKM A;  3HZP A;  3LTA A;  1AVL A;  1RCK A;  2OOV A;  3BIR A;  3B4O A;  5TGN A;  2H0G A;  2JQ5 A;  2BT3 A;  3A5E A;  1BRS A;  3LML A;  3S28 A;  1X1U A;  4KFF A;  2YX9 A;  1EQK A;  1FA3 A;  3I55 3;  4RBN A;  1CEW I;  1N8Q A;  1ROA A;  3AHW A;  2BMR B;  1QVF 2;  4CPK A;  4BTW A;  4IIA A;  2XEP A;  4ILF A;  4MMZ B;  1BNR A;  4HM8 B;  2LQV A;  1BSA A;  3KSE D;  2Z6B A;  4FCM A;  4LMI A;  3ZG0 A;  1TUH A;  4R1K A;  3OV4 A;  1OUN A;  1A67 A;  1JN5 B;  5CK6 A;  1YIJ 3;  4R80 A;  5AIF A;  1VQ4 3;  2W9P A;  4FMC A;  1VQO 3;  4O3V A;  1BNJ A;  1STF I;  3UNL A;  6RNT A;  3URP A;  4Q53 A;  5CXO A;  1O7N B;  1IU7 A;  1FGR A;  4HYZ A;  4R9L A;  3FG4 A;  1OF5 A;  1LOX A;  1W2Z A;  2L1S A;  3X3Z A;  4AEQ A;  5IG4 A;  1MNL A;  4WWU C;  1U8C B;  2KF6 A;  2XSO B;  1UCK A;  1TTO A;  3CCJ 3;  1NB5 I;  3BND A;  4HAA A;  4PEJ A;  3F8X A;  2W2C A;  5ELJ A;  4RNY A;  1MWT A;  2UGI A;  4N3V A;  4QWT A;  3NX0 A;  3LT9 A;  4NPB A;  1YIT 3;  1VQK 3;  2C4B A;  2I9W A;  3BNE A;  1AQZ A;  1BNE A;  1JB4 A;  1RRH A;  1W6Y A;  2CC3 A;  1JV2 B;  3RGR A;  5IW9 A;  3OW2 2;  1SJW A;  1QJG A;  3LOY A;  1LOV A;  5A0O B;  1MGR A;  2W04 A;  5G2G A;  1V74 A;  1W02 A;  2IY2 A;  1BNS A;  3VF1 A;  1A90 A;  2FNQ A;  2KF3 A;  1G96 A;  1Q40 A;  1TRQ A;  2HML B;  3GRD A;  1M1K 4;  1N5H A;  3EN1 B;  1K28 A;  1PY3 A;  2IA7 A;  1W6C A;  4J8T A;  3MSO A;  4K1U A;  4N6O B;  3WA2 X;  5HOH A;  5JPP A;  5FW5 A;  2W0Q A;  1IK3 A;  2BIR A;  2CX1 A;  2H0H A;  2YFJ B;  2GXF A;  1LOW A;  1ZX2 A;  1M9G A;  1N9J A;  3UB1 A;  1AY7 A;  1LQM B;  2GEX A;  2HMJ B;  3FGY A;  3MPH A;  1O7P B;  1WMP A;  2IUJ A;  3GZR A;  3HII A;  1BRI A;  1ULI B;  3KE7 A;  1RHL A;  1QVG 2;  3SYU A;  3NHX A;  3FH1 A;  3S29 A;  3NM7 A;  1RGA A;  3Q3F A;  4HM2 B;  1GMP A;  2E2T A;  1VQ5 3;  5KP1 A;  3WOE B;  2F56 A;  1A2K A;  1ZGX A;  1TIJ A;  1UI7 A;  3I0Y A;  3J7Y d;  2HMN B;  3GZY B;  3AHS A;  3D5I A;  3EBT A;  3OWS A;  4BIR A;  3EX9 A;  4I5Q A;  3FSD A;  3FG3 A;  5IG0 A;  1RN4 A;  3DMC A;  1RSN A;  1B21 A;  4ORL A;  4J5G A;  2B1X B;  1B3S A;  4IT7 A;  4GSP A;  4LEH A;  1KWI A;  3WR2 A;  1D6U A;  1NDO B;  1OPY A;  5D81 A;  1JKG A;  1PFP A;  1KQS 2;  2OTJ 3;  3D9R A;  3RNT A;  3F8H A;  1DMM A;  2K0M A;  3CNX A;  3EHC A;  3KII A;  1RGL A;  4MMY B;  4EC6 A;  1HYF A;  2Y74 A;  1B2S A;  1Z1S A;  4H61 A;  3NXJ A;  2FGT A;  2CWV A;  3PCS A;  4MEI A;  4O2H A;  3ECF A;  4X2O A;  2GBX B;  1NWW A;  3IJE B;  1UCL A;  2KCD A;  1GY6 A;  4HZB B;  5G1K A;  4AKZ A;  4EV5 A;  4R4K A;  1OHP A;  1L5G B;  3UL5 A;  1C7H A;  1JBT A;  4K90 B;  5BVB A;  2K54 A;  3BNC A;  4L8P A;  4N6M A;  1N8R 4;  2BHM A;  4EV2 A;  3CCM 3;  1LXE A;  1FYS A;  2QGU A;  1JRQ A;  3L0R A;  1EA2 A;  1VQM 3;  4OVM A;  3WA3 A;  3E99 A;  3D3L A;  3EQQ B;  2C11 A;  3CNM A;  1IVX A;  3NQY A;  1FUS A;  3DGL A;  3PXM A;  4XDV A;  1WNH A;  3RDE A;  1VQ6 3;  1OH0 A;  1ZO2 A;  4EYC A;  1BNI A;  2RFR A;  4MMX B;  1A2P A;  2RCD A;  3UL6 A;  3G4S 3;  1VQQ A;  1O7G B;  1QMA A;  1I2G A;  1BIR A;  4GL6 A;  2IMJ A;  1I8V A;  1YGE A;  3H3H A;  3PS8 A;  1RKY A;  5M18 A;  3JUM A;  1OAC A;  1VQL 3;  1RRL A;  1K73 4;  4RNT A;  3EJV A;  1OF5 B;  4HM0 B;  1US1 A;  1VQ7 3;  3EBY A;  2H0I A;  1IT7 A;  1HU9 A;  2OCT A;  3NBB A;  3QRD A;  8CHO A;  1X1W A;  2AAD A;  2CHC A;  2W9Q A;  4KFD A;  3NV0 A;  1UUV B;  1I3I A;  7GSP A;  1BGS A;  3CXC 2;  1TFO A;  1Q9E A;  1VQP 3;  2Z76 A;  3CCR 3;  1O7W B;  1A2V A;  3LTB A;  1IVV A;  3U97 A;  1IVU A;  2P38 A;  2CK3 H;  2CWU A;  3MYT A;  5IEP A;  1VZZ A;  1BSC A;  3EC9 A;  3MKI A;  4CDL A;  3D79 A;  1LOY A;  4OUQ A;  1GY5 A;  1ULJ B;  1S72 3;  4KVH A;  1BAN A;  2CFL A;  1TP6 A;  1M1X B;  3UJM A;  1Q86 4;  5D83 A;  1TU5 A;  4R9K A;  1RDS A;  2OQE A;  2YFI B;  1G02 A;  1CH0 A;  4J5K A;  1Q40 B;  1LVN A;  3ZFZ A;  1FW7 A;  1MWS A;  1T3B A;  1BRK A;  3Q2P A;  5LC7 A;  3AGO A;  3LYG A;  2GEY A;  3KSP A;  3ZG5 A;  1IYY A;  1YGW A;  4HM6 B;  1JZO A;  1W7C A;  3GSP A;  1QAK A;  3ER7 A;  2SAR A;  1RGG A;  5IEN A;  5G1L A;  4JRF A;  2CW9 A;  2UUG C;  3ROB A;  5AIG A;  5KP4 A;  3PGB A;  2RGQ A;  4HKV B;  6STD A;  4HM4 B;  1YVB I;  3EN8 A;  1IV7 A;  4KZ1 A;  3SVA A;  3VSY A;  1GMR A;  1RN7 A;  2SBL A;  2P0X A;  4XB5 A;  1B27 A;  2HMO B;  3DY5 A;  3MG3 A;  3Q90 A;  1UGI A;  5IER A;  3KCH A;  4G1M B;  4RNZ A;  3KN4 A;  5AEU B;  3DM8 A;  1UCI A;  3FCS B;  2WGQ A;  2XF3 A;  4OK0 A;  3DUK A;  3S27 A;  3K5T A;  3M8C A;  3CCL 3;  1YVS A;  1NU3 A;  1RLS A;  3OWU A;  3I56 3;  1OGX A;  2BNG A;  3S67 A;  1W6G A;  4XBX A;  1EEJ A;  1GY7 A;  2WOF A;  2OTL 3;  2R4I A;  1JN5 A;  3SED A;  1N5P A;  3F7S A;  1JKG B;  1RNB A;  1RGF A;  5AYR B;  1ZS7 A;  1BRG A;  3O8Y A;  3JVC A;  4L7K A;  1V58 A;  1UI8 A;  3DGO A;  3K63 A;  1GD4 A;  3JUQ A;  3TDG A;  3CC2 3;  2HMK B;  4WHA A;  1B2Z A;  2Z77 A;  2CH9 A;  3K0Z A;  3LH4 A;  5STD A;  1W2B 2;  4HM3 B;  1EUI C;  2BMQ B;  1RGK A;  1JZD A;  1NNV A;  2KRT A;  2XGN A;  2ZA4 A;  3BB9 A;  1JB2 A;  1SPU A;  3NUV A;  5BIR A;  5IF6 A;  3VGN A;  2ML6 A;  3CPW 2;  5DRV A;  4WP5 A;  1BSE A;  1K41 A;  1UUW B;  3PZW A;  5CLK A;  2BU4 A;  2IUK A;  4ZM8 A;  3LZA A;  3SXX A;  1GSP A;  4U13 A;  4LYL B;  1D6Z A;  2XFS A;  3BNB A;  3PCR A;  4LGQ A;  1JBR A;  4XBY A;  1YHQ 3;  3SOY A;  1O7H B;  3GZB A;  3PYJ A;  4X2H A;  1AR0 A;  1BNG A;  1G0T A;  4NHF A;  4O02 B;  5AEW B;  2OOV C;  1BSD A;  1UW1 A;  2F99 A;  3KFQ C;  3CCU 3;  4BTY A;  1UDI I;  2MF7 A;  1HZ1 A;  2P05 A;  1W5Z A;  3NBJ A;  5AI1 A;  1MWU A;  3K9M C;  3GWR A;  3HI7 A;  1CYU A;  1U5O A;  1VQN 3;  2XSH B;  2W56 A;  3H51 A;  2RNT A;  3MG1 A;  1B20 A;  3NV0 B;  4AKY A;  3FKA A;  1DE3 A;  1KSI A;  4N6V 0;  1TRP A;  1LNH A;  1R4Y A;  3U1W A;  1NB3 I;  1GYB A;  4KFE A;  1FGQ A;  1W4N A;  1V57 A;  1RJO A;  3KZT A;  3AMO A;  3OX9 A;  3HOH A;  3X42 A;  3CD6 3;  1BU4 A;  4FMB A;  5EVH A;  5M19 A;  3DXO A;  1IVW A;  2B24 B;  2L4V A;  5AYS C;  3X41 A;  1MGW A;  2LYX A;  3T8N A;  4K61 A;  3F14 A;  4LZI A;  5BU4 A;  2STD A;  3X3X A;  3CCQ 3;  1LQG C;  2F4Y A;  2J8X B;  3HK4 A;  1YI2 3;  1BRH A;  4N6L A;  2D42 A;  1FUW A;  3SLU A;  2F98 A;  3JUP A;  3OXA A;  2R41 A;  1IT8 A;  1CQS A;  1JJ2 2; 
#chains in the Genus database with same CATH homology
 1ISK A;  1JB5 A;  1DVC A;  7STD A;  1O7M B;  4HVN A;  1OHS A;  1KC8 4;  4FMD A;  1ROV A;  2CFG A;  1Q81 4;  1WTH A;  2E2U A;  3RGA A;  3EB8 A;  2BMO B;  3WOF B;  3LXU X;  2INX A;  3Q1C A;  2WGO A;  4XDW A;  2XR8 B;  1E3V A;  1DVD A;  4MJD A;  1YJN 3;  1F8N A;  4N6T A;  5DRE A;  4XM4 A;  4FMA A;  3EF8 A;  4NRE A;  4STD A;  4FCZ A;  4HM5 B;  2A15 A;  4I4K A;  1W01 A;  1N9E A;  4N6N B;  2O3O A;  1PU4 A;  1AVK A;  3F9S A;  3MHE A;  1VQ8 3;  4EBG A;  2V1L A;  2Z7A A;  1K9M 4;  4WYK A;  3T8U A;  4L8O A;  2CG1 A;  3ALA A;  1OGZ A;  2ML5 A;  3MWZ A;  3N54 B;  3NQZ A;  1K8A 4;  1IQ8 A;  2P0M A;  3V99 A;  1QAL A;  4FR9 A;  1YJ9 3;  1W00 A;  1DYU A;  4GB5 A;  5CF1 A;  1Q7Y 4;  1KD1 4;  1IQY A;  5EEO A;  1STD A;  3F7X A;  3G0K A;  3CC4 3;  3OWY A;  1BUQ A;  1HKX A;  1EG9 B;  3S5C A;  2Q07 A;  4N6U A;  3DGN A;  4K1V A;  2W03 A;  1GS3 A;  2XGL A;  2ZDJ A;  2MC8 A;  3GAX A;  2XH9 A;  3F40 A;  3G6E 3;  3B8L A;  3NBR A;  2O9U X;  2Y73 A;  3KKG A;  1MOL A;  1WQL B;  4TX4 A;  2QIY A;  3CPO A;  3DZL A;  2JDI H;  1VQ9 3;  1CYV A;  2ZL8 A;  3LTC A;  5HGR A;  1S5A A;  3CU3 A;  1FGO A;  3T0U A;  4JF8 A;  3QK9 A;  3STD A;  4FCJ A;  5FGO A;  3X3Y A;  2GU3 A;  3CCS 3;  2UX0 A;  2WOH A;  2WO0 A;  3GZX B;  1QAF A;  2YFL B;  2CWT A;  2P09 A;  2BO9 B;  3N8B A;  1E97 A;  3FF0 A;  1NO3 A;  2W56 B;  1D6Y A;  4HM7 B;  2CKF B;  4CCV A;  3CCV 3;  3CMA 3;  3EE1 A;  3CCE 3;  3MG2 A;  3IPT A;  1ASK A;  4HM1 B;  4WFO A;  3WOD G;  1TFK A;  1OHO A;  4J9A A;  5AII A;  1Y4K A;  3AMO B;  2M7O A;  3SOA A;  2GBW B;  4HZ9 B;  1OCV A;  3LT8 A;  5AIH A;  2PZV A;  1J2B A;  4LSO A;  5EQL A;  2GU1 A;  4HJL B;  1M90 4;  3CME 3;  3LTD A;  5JBS A;  3JUO A;  1Q82 4;  2QA4 3;  5LC6 A;  1DMQ A;  1SQW A;  3JUN A;  1R4C A;  3BLZ A;  4O8S A;  3WMD A;  3CC7 3;  2XRX B;  1WMN A;  3FG1 A;  5CF2 A;  4HBR A;  3SX1 A;  2E2V A;  2XFT A;  1JNQ A;  2RSX A;  2CFD A;  5I97 A;  1Q42 A;  3FLJ A;  3FF2 A;  5JPU A;  1SIH A;  1E3R A;  1SII A;  1IV9 A;  1NJI 4;  1WMO A;  3B7C A;  2CIU A;  5IEO A;  3HIG A;  3X40 A;  3WDG B;  3V98 A;  2F86 B;  2CG0 A;  3K7C A;  2W6J H;  3V92 A;  1T5Y A;  3A76 A;  1AV4 A;  2OQE C;  4H3U A;  1DMN A;  1FGT A;  4IPB A;  1YJW 3;  1IQX A;  3DGM A;  5IG5 A;  5ELU A;  1GD3 A;  2C10 A;  3NM2 A;  3B4P A;  2D1W A;  2HMM B;  4WYK B;  1FGM A;  2CFK A;  2KXG A;  2QEX 3;  4RZM A;  1IDP A;  5D82 A;  2FXT A;  3HX8 A;  3FZW A;  4BTX A;  2OWP A;  3G8Z A;  3N9H A;  2CFW A;  3IMA B;  2PNC A;  4EXR A;  4XBT A;  3G16 A;  1EKM A;  3HZP A;  3LTA A;  1AVL A;  2OOV A;  3B4O A;  5TGN A;  2JQ5 A;  3LML A;  2BT3 A;  3S28 A;  1FA3 A;  4KFF A;  2YX9 A;  1EQK A;  3I55 3;  4RBN A;  1CEW I;  1N8Q A;  1ROA A;  2BMR B;  1QVF 2;  4BTW A;  4IIA A;  2XEP A;  4MMZ B;  4HM8 B;  2LQV A;  3KSE D;  2Z6B A;  4FCM A;  4LMI A;  1TUH A;  4R1K A;  3OV4 A;  1OUN A;  1A67 A;  1JN5 B;  5CK6 A;  1YIJ 3;  4R80 A;  5AIF A;  1VQ4 3;  2W9P A;  4FMC A;  1VQO 3;  4O3V A;  1STF I;  3UNL A;  4Q53 A;  5CXO A;  1O7N B;  1IU7 A;  1FGR A;  4HYZ A;  4R9L A;  3FG4 A;  1OF5 A;  1LOX A;  1W2Z A;  3X3Z A;  4AEQ A;  5IG4 A;  1MNL A;  4WWU C;  1U8C B;  2XSO B;  1NB5 I;  3CCJ 3;  3BND A;  4PEJ A;  3F8X A;  2W2C A;  5ELJ A;  4RNY A;  4N3V A;  4QWT A;  3NX0 A;  3LT9 A;  1YIT 3;  1VQK 3;  2I9W A;  3BNE A;  1JB4 A;  1RRH A;  1W6Y A;  2CC3 A;  1JV2 B;  3RGR A;  5IW9 A;  3OW2 2;  1SJW A;  1QJG A;  3LOY A;  5A0O B;  2W04 A;  1V74 A;  1W02 A;  3VF1 A;  1A90 A;  2FNQ A;  1Q40 A;  1G96 A;  2HML B;  3GRD A;  1M1K 4;  1N5H A;  3EN1 B;  1K28 A;  2IA7 A;  4N6O B;  1W6C A;  4J8T A;  3MSO A;  4K1U A;  5JPP A;  3WA2 X;  5FW5 A;  2W0Q A;  1IK3 A;  2YFJ B;  2GXF A;  1ZX2 A;  1M9G A;  1N9J A;  3UB1 A;  2GEX A;  2HMJ B;  3FGY A;  3MPH A;  1O7P B;  1WMP A;  2IUJ A;  3GZR A;  3HII A;  1ULI B;  3KE7 A;  1QVG 2;  3NHX A;  3FH1 A;  3S29 A;  3NM7 A;  4HM2 B;  2E2T A;  1VQ5 3;  5KP1 A;  3WOE B;  1A2K A;  1TIJ A;  1UI7 A;  3I0Y A;  3J7Y d;  2HMN B;  3GZY B;  3EBT A;  3OWS A;  3EX9 A;  5IG0 A;  3FSD A;  3FG3 A;  3DMC A;  4ORL A;  2B1X B;  4IT7 A;  4LEH A;  1KWI A;  1D6U A;  1NDO B;  1OPY A;  5D81 A;  1JKG A;  1PFP A;  1KQS 2;  2OTJ 3;  3D9R A;  3F8H A;  1DMM A;  2K0M A;  3CNX A;  3EHC A;  3KII A;  4MMY B;  4EC6 A;  2Y74 A;  4H61 A;  1Z1S A;  4MEI A;  5KP3 A;  3NXJ A;  2FGT A;  2CWV A;  3PCS A;  4O2H A;  4X2O A;  3ECF A;  2GBX B;  1NWW A;  3IJE B;  4HZB B;  2KCD A;  1GY6 A;  4AKZ A;  4EV5 A;  4R4K A;  1OHP A;  1L5G B;  3UL5 A;  1C7H A;  4K90 B;  5BVB A;  2K54 A;  3BNC A;  4L8P A;  4N6M A;  1N8R 4;  2BHM A;  4EV2 A;  3CCM 3;  1LXE A;  2QGU A;  1JRQ A;  3L0R A;  1EA2 A;  1VQM 3;  4OVM A;  3WA3 A;  3E99 A;  3D3L A;  3EQQ B;  2C11 A;  3CNM A;  1IVX A;  3NQY A;  3PXM A;  3DGL A;  4XDV A;  1WNH A;  3RDE A;  1VQ6 3;  1OH0 A;  1ZO2 A;  4EYC A;  2RFR A;  4MMX B;  2RCD A;  3UL6 A;  3G4S 3;  1O7G B;  1QMA A;  4GL6 A;  2IMJ A;  1YGE A;  3H3H A;  3PS8 A;  1RKY A;  3JUM A;  1OAC A;  1VQL 3;  1RRL A;  1K73 4;  3EJV A;  1OF5 B;  4HM0 B;  1US1 A;  1VQ7 3;  3EBY A;  1IT7 A;  1HU9 A;  2OCT A;  3NBB A;  3QRD A;  8CHO A;  2CHC A;  2W9Q A;  4KFD A;  3NV0 A;  1UUV B;  3CXC 2;  1TFO A;  1VQP 3;  2Z76 A;  3CCR 3;  1O7W B;  1A2V A;  3LTB A;  1IVV A;  3U97 A;  1IVU A;  2P38 A;  2CK3 H;  2CWU A;  3MYT A;  5IEP A;  1VZZ A;  3EC9 A;  3MKI A;  4CDL A;  4OUQ A;  1GY5 A;  1ULJ B;  1S72 3;  4KVH A;  2CFL A;  1TP6 A;  1M1X B;  3UJM A;  1Q86 4;  5D83 A;  1TU5 A;  4R9K A;  2OQE A;  2YFI B;  1Q40 B;  1LVN A;  3Q2P A;  5LC7 A;  3LYG A;  2GEY A;  3KSP A;  4HM6 B;  1W7C A;  1QAK A;  3ER7 A;  5IEN A;  4JRF A;  2CW9 A;  3ROB A;  5AIG A;  5KP4 A;  3PGB A;  2RGQ A;  4HKV B;  6STD A;  4HM4 B;  1YVB I;  3EN8 A;  1IV7 A;  4KZ1 A;  3SVA A;  3VSY A;  1RN7 A;  2SBL A;  2P0X A;  4XB5 A;  2HMO B;  3DY5 A;  3MG3 A;  3Q90 A;  5IER A;  4G1M B;  4RNZ A;  3KN4 A;  5AEU B;  3DM8 A;  3FCS B;  4OK0 A;  2WGQ A;  2XF3 A;  3S27 A;  3DUK A;  3K5T A;  3M8C A;  3CCL 3;  1NU3 A;  3OWU A;  3I56 3;  1OGX A;  2BNG A;  3S67 A;  1W6G A;  4XBX A;  1GY7 A;  2WOF A;  2OTL 3;  2R4I A;  1JN5 A;  3SED A;  1N5P A;  3F7S A;  1JKG B;  5AYR B;  3O8Y A;  3JVC A;  4L7K A;  1UI8 A;  3DGO A;  3K63 A;  1GD4 A;  3JUQ A;  3TDG A;  3CC2 3;  2HMK B;  4WHA A;  2Z77 A;  2CH9 A;  3K0Z A;  3LH4 A;  5STD A;  1W2B 2;  4HM3 B;  2BMQ B;  3BB9 A;  2XGN A;  2KRT A;  1JB2 A;  1SPU A;  3NUV A;  5IF6 A;  3VGN A;  2ML6 A;  3CPW 2;  5DRV A;  4WP5 A;  1K41 A;  1UUW B;  3PZW A;  4ZM8 A;  5CLK A;  2IUK A;  5BXQ A;  5IG3 A;  3LZA A;  3SXX A;  3G71 3;  4U13 A;  1D6Z A;  2XFS A;  3BNB A;  3PCR A;  4LGQ A;  4XBY A;  1YHQ 3;  3SOY A;  1O7H B;  3GZB A;  3PYJ A;  4X2H A;  1AR0 A;  5AEW B;  4NHF A;  4O02 B;  2OOV C;  1UW1 A;  2F99 A;  3KFQ C;  3CCU 3;  4BTY A;  2MF7 A;  2P05 A;  1W5Z A;  3NBJ A;  5AI1 A;  3K9M C;  1CYU A;  3GWR A;  3HI7 A;  1U5O A;  1VQN 3;  2XSH B;  2W56 A;  3H51 A;  3MG1 A;  3NV0 B;  4AKY A;  3FKA A;  1KSI A;  4N6V 0;  1LNH A;  3U1W A;  1NB3 I;  1GYB A;  4KFE A;  1FGQ A;  1W4N A;  3OX9 A;  1RJO A;  3KZT A;  3AMO A;  3X42 A;  3CD6 3;  4FMB A;  5EVH A;  3DXO A;  1IVW A;  2B24 B;  2L4V A;  5AYS C;  3X41 A;  2LYX A;  3T8N A;  4K61 A;  3F14 A;  4LZI A;  2STD A;  3X3X A;  3CCQ 3;  3HK4 A;  1YI2 3;  1FUW A;  4N6L A;  2D42 A;  3SLU A;  2F98 A;  3JUP A;  3OXA A;  5G2G A;  1IT8 A;  1CQS A;  1JJ2 2; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...