2Z7JA

Structural insights into de multifunctional vp3 protein of birnaviruses:gold derivative
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
125
structure length
125
Chain Sequence
AQREKDTRISKKMETMGIYFATPEWVALNGHRGPSPGQLKYWQNTREIPDPNEDYLDYVHAEKSRLASEEQILRAATSIYGAPGQAEPPQAFIDEVAKVYEINHGRGPNQEQMKDLLLTAMEMKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into the multifunctional protein VP3 of birnaviruses.
pubmed doi rcsb
source organism Infectious bursal disease virus
molecule tags Viral protein
molecule keywords Capsid assembly protein VP3
total genus 44
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2007-08-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.880 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2z7jA02
1.10.150.620 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2z7jA01
2Z7JA 2R18A
chains in the Genus database with same CATH superfamily
5IIIA 5CP2A 1Y88A 2DF4B 1ZQ9A 4A8EA 2R4EA 4F72A 1KRPA 3ZC7B 3V7JA 2QSFX 1ZQRA 4PPXA 4FW9A 4UAUA 5T14A 2IHMA 5CJ7A 3CF6E 2V1CA 2HOQA 5DG9A 1DGGA 2HVIA 4IBKA 5J29A 2I7NA 3QU4A 2UXBM 2LVPC 2CE7A 2FMSA 8ICRA 5TZVA 1JXLA 2LWXA 4NRVA 3E2EA 4EEYA 3QEBZ 5KT2A 4UB5A 1ZQDA 4PHDA 3OJSA 3GIJA 1KKXA 2EAMA 2JZ0A 3QEAZ 1S0MA 4F4KA 4J9KA 2BR0A 3DA1A 3AL0B 4Q44A 5JUMA 4F5PA 4GXJA 3B7QA 3GDXA 2LMRA 1SXDA 4IL6U 2KD1A 2LKYA 2CV1A 3H8WA 5AKYA 1L3SA 4DQIA 1N61A 2HCFA 1GJSA 9ICVA 3PMNA 3E9SA 2KHQA 1YSYA 2K6BA 2F1IA 5ALZA 5KFKA 7ICOA 4Y2TA 2HW3A 3A98B 3BBZA 5E6JA 2B21A 1NJGA 2X4AA 4DV1M 4DV6M 1WIVA 7ICPA 2C5RA 2QB0A 4D81A 4RQ3A 1XSNA 2L09A 4YMMA 5ITQA 2W8LA 2K0BX 3FRHA 1X42A 2F1JA 4I2BA 4P4PA 3SHGB 4FS1A 1J5EM 2E5LM 1ZYQA 1OFHA 2F3NA 4RNOA 4L4UA 2XICA 4J9QA 2HSZA 2HBJA 2D7EA 4ELVA 3N7PD 2W43A 1NKCA 2F4VM 1J2NA 1UM8A 4QNMA 2F5NA 5ALKA 3IV6A 1NK6A 5EP2A 2X8AA 2IOFK 8ICYA 2LBOA 4FD2A 1L2CA 4KLHA 4ECSA 4GC6A 1NKBA 2XY7A 1SV4A 3PVXA 1EXNA 4IRCA 2VJ4A 4RQ6A 3C21A 3THVA 5AI8A 2VA2A 1G71A 4KTQA 1IY2A 4JN6A 2YN4A 8ICMA 3HU2A 2DHYA 3RB6A 1ZQBA 4MHVA 5AICA 3SASA 5ALNA 5ITUA 1IN4A 4B3SM 5ALPA 5J2AA 2PI4A 4O3MA 4Z6YA 5AI5A 3NVVA 3V6KA 1SXJD 4WJ3B 4AZFA 2WF7A 1M6YA 5KFUA 2F1HA 2OHFA 4Q45A 1RQLA 1Z00B 2ES6A 3FUWA 2CN1A 2G8LA 3QU9A 3T5JA 2ZJ5A 4B9TA 3BOSA 4OD0A 5ALLA 4M04A 2BHNA 2L2DA 3NBIA 1RPLA 2HCBA 3FUTA 5DB8A 1QVRA 4IBIA 2CWBA 3I4VA 2ISOA 2ZAOA 1FEZA 2NQ8C 4G4RA 1ZD5A 3DV9A 4DLEA 4IBDA 2HI0A 4RF1A 4DO9A 3PW7A 2XC9A 1MSWD 3GLHE 3RJKA 4JI4M 1JIHA 4DFJA 1XXHA 2WSFF 3QNMA 2ZAMA 2J6SA 4OJ6A 2DXIA 3TAQA 3TL4X 1TAUA 9ICXA 4BWMA 2X49A 3UM9A 3Q8LA 4DWIA 3QYEA 1XS9D 5C0YA 4FE3A 4C8MA 2G08A 4PCZA 1F4IA 1TGUA 3LVVA 3JPSA 1XNSA 3GV5B 2ALZA 2ZIWA 5AM4A 4QOZC 1JR3E 4NL9C 2HL7A 4KO8A 2H3VA 3C23A 5L1KA 1KBUA 4MEXA 2H5XA 1IM2A 1U9LA 4F4WA 1N32M 2F44A 3MBYA 3RB3A 4NXZA 2DHRA 1WHCA 5J0YA 5DQIA 2OM6A 2R18A 3SBJA 5FSWA 2XSZD 1R5LA 3PVSA 2Y20A 4JI5M 4RNMA 4B9VA 4C8NA 3U6SA 4IC9A 4DF4A 4IBEA 2DGZA 2OPFA 4DR6M 2XGPA 1QUSA 4DV2M 5KFDA 4DFKA 3KKAC 2LYHA 2O5RA 4A3VB 4ECQA 4GH9A 5EP4A 2Q0ZX 2BCSA 3BDPA 3AQEA 5HP4A 5HNKA 4HL4A 2BQ3A 3I76A 2IHNA 2K4EA 2ASDA 3B89A 3SYKA 3W68A 4UBCA 4FWDA 3PR5B 1Q3UA 4S12A 1NNJA 4BB9A 2DZOB 1YLAA 4DBGB 4OO1J 2WB1F 2ZXIA 2VF7A 2D7GA 3A0BU 5AKHA 5B5EU 4FZLA 3KFUG 3CP8A 3WKAA 4LVSA 1PJSA 1DV0A 4KLNA 1N33M 4AW4A 4NOOB 1ZQLA 4I2FA 2HDOA 8CATA 2W3RA 1SZPA 1NJYA 3WKEA 3C5GA 3T5HA 2DQNB 4PHPA 2JMGA 4F4ZA 4DCCA 2WAQF 7ICMA 2W9BB 3B0YA 2DI0A 4XUSA 2KW0A 5B66U 1NJXA 3WHLA 1GO5A 2K47A 4UARA 4CNQA 2K60A 1ZQNA 2RLTA 4R65A 4MH0E 2CP8A 1NI3A 2P66A 1L6NA 4K4HA 4JB3A 2B6GA 3GLGA 3EIHA 3Q8GA 4DL2A 4PJ0U 2XF3A 2Y0SC 2K9DA 4FWGA 2JZBB 3QUQA 2DAMA 2KEBA 2DUYA 4KLQA 7ICRA 1FFVA 4F5NA 2G5IB 3G6XA 2M0NA 5L9XA 3JPOA 1S0VA 1XSLA 4DSIA 4EEKA 2B3TA 2AGQA 7ICQA 3GLIB 1QQ6A 5EE3A 4R8UA 1S0OA 2IOFA 3NRWA 3U26A 4NL9A 3WK9A 1RYUA 3HPOA 3RR7A 1NJFA 8ICHA 2KSOB 5KQDA 4C8LA 4O9MA 1MU5A 5G5HA 4DEZA 2J5YA 1ZQCA 3PW5A 1NKEA 1BGXT 1MX0A 4ICAA 1OXJA 2PI5A 5LMUM 2Y9UA 2E1FA 1PRBA 3RJGA 3IRUA 2MH8A 3D2NA 3FKEA 1HR0M 2BCRA 1VEKA 4RQNA 5K4LA 1DGHB 1N78A 1GVNA 4LJ7A 4J9MA 2BPGA 2CV0A 1TTEA 2KN7A 1DGBA 2ZUCA 1SGGA 1YZ7A 2ZIWB 2JEGA 2H3ZA 5DDYA 3I1YA 1L8LA 3M6KA 2AJQA 2K8AA 3TANA 3QUBA 1S76D 5FTMA 3IHQB 4RF0A 2RRDA 2YMPA 4KMUA 4M9XA 5J2JA 4OJ5A 2JY5A 4QZEA 3PNVA 3M7GA 4Y2VA 3ZD8A 3MGVA 4ECYA 2N35A 8ICTA 9ICPA 3AJIB 2R62A 1TE2A 5KFOA 4Z6EA 4GHAA 2LVAA 3J7BA 3TQSA 1Z5AA 1L1ZA 2DAGA 5AI6A 2F8KA 1WG8A 2CUZA 5KFBA 2BCVA 1T7PA 3UXPA 4ZOHC 4ECXA 3RFWA 2P6RA 3T1HM 3MFIA 3DDHA 1QLNA 1WCLA 3QU7A 3L25A 1WUDA 5EWGA 2YQZA 1HQYE 4DOAA 3J81S 4DSLA 1K3WA 5AM3A 4KHPM 3QWLA 3H40A 8ICLA 3RRHA 4YHHM 2HHVA 2VANA 4U6PA 1E94E 2JRZA 2YNMD 3U5ZA 5F9LA 4C4SA 5DBAA 4L15A 3U6PA 1S5LU 9ICQA 1Z3EB 2KZUA 4I2IA 3LQRA 1IBKM 4RQ1A 2QBYB 7ICTA 2KXEA 1C1KA 4GXIA 4M47A 4R71A 2E3TA 1ZETA 3GQCA 5L1IA 3MABA 4GKJM 4ED7A 1RU3A 1EFUB 3N97B 1NY6A 3L3FX 4I8OA 3KHRA 3H4DA 2C2DA 3KOZE 4F8RA 2KJ8A 1OFIA 4LF7M 5FTLA 3BQ2A 4IQWA 4O3OA 1L3UA 5LMNM 4NLNA 3THGA 3U60A 1PVRA 1J97A 2OXOA 3RFAA 4B9NA 1HUZA 2JH1A 2XY6A 4WURA 3U61A 2CFOA 3AMZA 7ICEA 1ZQYA 5ALIA 1A77A 2DWQA 1UA1A 1QYRA 4D82A 2HMXA 4M6WA 1W5SA 1HJPA 1JN3A 1KFTA 4PHEA 2HHXA 3EIEA 2FLNA 5AK5A 1ZOLA 2F5OA 2JV3A 4X66M 3U60B 3QXGA 2LTUA 2WF9A 2PFOA 2J7OA 3TADC 4YR3A 2RGOA 4NSRA 1ZD2P 3ETLA 1ZQMA 1JR3D 2CXYA 4DS4A 3SAVA 1LTMA 3LVWA 3C58A 4C7YA 4JWNA 2JY6B 5IT9S 5DKWA 2QBYA 4USAA 4XA5A 4KLTA 5H37D 3VC8A 2XEPA 3BXWA 1FJGM 2O25A 5KFMA 4B9UA 2MU2A 3M0EA 1IXRA 4TUQA 1TDHA 1KDHA 1WGNA 2KZMA 3M6ZA 2W9MA 1D0KA 4LF6M 2XFTA 5KFRA 2XVTA 7ICGA 5G5GA 3M9OB 3RH5A 4B9SA 3PNYA 3UK6A 3ZCBB 5GKNA 2YMLA 2KIWA 8ICKA 1L5UA 9ICUA 1SXJB 4KLLA 3LQQA 5ALGA 1TDZA 3UMBA 1NHWC 4Y2UA 2HKJA 5KPZA 2YFQA 3B9PA 2EDUA 2C98A 3ORYA 9ICSA 3WKCA 4KLFA 4Q43A 1BPZA 1V92A 5ITXE 1RXWA 1D8YA 1R2ZA 2EO2A 3PSFA 1D9FA 3KP0E 1SXJE 4I2DA 2DWMA 1IXSB 5ALSA 5J2EA 1PK1A 1GO3F 1PK1B 4MM3B 4BXOB 1SL2A 2DNAA 1KFDA 4Q7JA 2R65A 4JI6M 1AROP 4FBUA 3TQ1A 4X65M 3E58A 4L8RC 3B9JA 2KJ5A 3V6HA 3VDPA 1XXHB 4J9LA 4DV7M 4K4GA 4M9LA 4NXNM 3MJ5A 1JALA 4PDGA 1URJA 3KDSE 4TQSA 4QJFB 1NK0A 1IN5A 1OTRA 3T5LA 3D8BA 1HT2E 4KX5A 1J7KA 4LZJA 2Q2EB 3KKAA 4PZOA 3RH4A 4EELA 2YR0A 5EP3A 1SB3C 3MMPA 5HMMA 1IY1A 2H3QA 3SV4A 3JAMS 3KVWA 3U6QA 3KOOA 3O0FA 2KNZA 1ED1A 1CI4A 5KAIU 3GLIE 3SI8A 4ANRA 4EX6A 5ALQA 2ZIXA 4QZBA 3FYCA 4G6ZA 2CV2A 1SIJA 1KW4A 2LVOC 4RQ8A 4IIWA 1E9SA 4DF8A 2EA0A 5AKEA 2OQ4A 4GHLA 3J2PB 3DEEA 4HLQA 5F3WA 3JPTA 4TUPA 4DUYM 2W9CB 2LVNC 4JI2M 2BQRA 5AK4A 4RQ7A 2W04A 1NJWA 4RKUF 1IBMM 2JP7A 2QLTA 2G5HB 3F2CA 4QNLA 5L8RF 4KN4A 3L5KA 4UAWA 2LYBA 3AU2A 2ZBKB 5KT6A 3RAQA 5IZ7D 1G41A 1PJQA 3U61B 2VDBB 4DLGA 3GPXA 5J0TA 4RU9A 2FOIC 1RXVA 4PZNA 2XO7A 3F92A 1WGLA 3FTFA 4P2HA 4IBFA 2QKQA 2FH0A 4G9BA 9ICLA 3SMVA 4KODA 4DV0M 2YQEA 2XSZA 1WWUA 5AM2A 4F91B 1QZMA 4IBGA 2JA2A 3HJ8A 4ELUA 2XH9A 3GQ4A 4E0DA 3ZDDA 3LMMA 3BQTA 1SV0C 2Z4SA 4ED2A 3M1YA 3HWTA 3RJFA 5J0SA 4F50A 1F5SA 4YMNA 4AG6A 2OOAA 1Z5BA 2G5GX 5J2IA 3PW2A 4YMOA 4FCVA 3RR8A 3N4MB 4B08A 1ZQXA 1N5XA 2EUCA 3KD3A 3OPXA 5AI0A 5CEHA 5BR8M 2CHVA 3UMMA 3AKZA 3E0FA 2EAOA 1IM4A 2WHEA 3KTQA 1NK8A 4PDIA 3D2SA 3SYZA 2D6FC 5KFGA 2DVWB 4ECUA 3IHPA 9ICIA 2KTQA 3F5AA 2BNKA 2ZTCA 3CGWA 1N62A 1Q46A 3LDAA 4CE6A 1JB0F 2L7HA 4QZIA 3C29A 4M0WA 3QU2A 2BQUA 1U4BA 1TH3A 5J0XA 2UU9M 3A0HU 3V7LA 3E4RA 3NS1A 3Q8MA 2JY7A 3GPPA 1IV8A 4AYBF 1GLNA 4C0ZA 1LB2B 2QARB 2IOHA 4DR3M 3MGIA 4CF5A 2JXNA 4OW0A 2RP5A 1MN8A 4HYKA 3PX0A 2HHUA 2W82A 2L7IA 4U7CA 3H0LB 3N7RC 4FFDA 3ZDCA 5FP0A 2WF8A 3M8RA 2KMDA 1NNLA 3N7SC 2WTFA 1DGHA 3CRXA 2JEFA 4AG5A 8ICJA 3VKHA 3U6CA 3ZDAA 9ICCA 2O6KA 9ICHA 4LJXA 5EXSA 5DYIA 3C5FA 3AM9A 1ZQQA 4B7HA 4OVZB 4OVZA 2ZUDA 4IQVA 8ICPA 1MQ2A 2QCUA 2VA8A 2XIDA 5BPCA 3TI0A 2I5HA 4DS5A 2QZ4A 8ICWA 3C2LA 1JR3A 1OAOC 2K8BB 1X9XA 5KT7A 5ALRA 2WF5A 2KK0A 4LY6A 4J9NA 3GILA 3OTOM 3PXGA 2QNJA 2MJ5B 4P4OA 3AU6A 3PX4A 4ECVA 2C9CA 2OCEA 4FCTA 3SHFA 2HBKA 3KOYE 4B7FA 2FNAA 1Q02A 2K8CB 5J0QA 3KHLA 1WCNA 3BS5B 2KNAA 2E8OA 3HHYA 3IDWA 4NLKA 4LG2A 1IG6A 7ICKA 1HT1E 1AQ6A 9ICEA 2KZSA 3KW6A 4Y2QA 5ALJA 3T3FA 1SXJC 4LF8M 3KHGA 2BWBA 3WK4A 2HVHA 4JI7M 1ZQEA 4JK1A 5EJCA 4F2LA 4YVZA 5KFVA 1ZJNA 4RNNA 1HUOA 1G4AE 4DQPA 2WB1C 4JV0A 1H38A 2G07A 2A19A 2W9BA 2HOIA 3M9MB 4UAVA 3WK6A 3KSXA 4RQ5A 3V7KA 1XO0A 2KZZA 5FTKA 4UASA 2R8GA 2P6UA 1LKYB 4K4IA 5CHGA 4M9GA 3HHZA 3SD7A 1SWWA 4KMOB 2AHMA 3OTQA 1ZQKA 5E79U 2QB0B 1OJLA 1XNQM 2OEHA 1PJJA 2KIVA 3SQIA 1WYGA 1IY0A 4IR1A 5DQGA 5FTNA 4QWBA 3HHWA 4KLEA 2D7HA 4MFFA 4XBOA 4GC7A 4ECZA 5DBBA 2KICA 1O08A 4IRDA 5EXXA 3GLHA 5ALOA 1ZQHA 8ICNA 2E5SA 2E8NA 4DFMA 3NVZA 4GC9A 1EIJA 1X9MA 1D0MA 1J09A 1A76A 2DZLA 4FVMA 2ZUBA 5L1LA 2W7OA 5J2CA 2AGOA 5AKXA 4ECWA 4QWEA 4LGYA 1ZQZA 1ZQPA 4PT5A 3SARA 2R8KA 5J0PA 4PD2A 4UB4A 2FPLA 3WU2U 3D2QA 2C96A 4R63A 3MR3A 1Z59A 3HY5A 3FYHA 1AIPC 1T94A 1K1SA 1CEZA 2LBCA 2KRKA 4CF4A 1TK5A 3FYDA 1B43A 3R8FA 1C7YA 2ZTEA 5KFNA 1TF0B 4B6JA 4JYAM 3L26A 2JHDA 4L16A 2GH1A 3WKDA 3Q8PB 2W9CA 2G06A 2NRWA 4B7GA 3SAGA 2XZUA 1PGYA 2DL0A 2ZG6A 2N1RA 4YXMA 3GRVA 1OIZA 1WJ7A 5EXPA 1RM6C 2WAQC 4UB6U 2GOLA 4C4RA 4FZMA 3ISCA 1IQPA 2MA1A 3KZIU 3C1YA 1HNZM 2KFZA 1ZMUA 1QCKA 5J8YA 3QYBA 3PY8A 1NK9A 2QQ8A 4AP9A 5C5JA 3U6MA 1ORYB 4G3OA 4ITQA 2QENA 4XK8F 5ALYA 3G6YA 5KL1B 9ICTA 1OW5A 5KFXA 3NRZA 3L29A 5C18A 1ZAEA 5J0WA 4YG2A 3Q8SB 3GQ3A 2XCPA 4F5RA 3KS8A 2BDUA 1KFVA 3RRGA 3EYZA 4FO6A 3T15A 2DKZA 5DQHA 2EKFA 2W7PA 2A1JB 4I2CA 4BJQA 5HHHA 3PO4A 5EE0A 3SC3A 1X2IA 2JXJA 3GPYA 1BPBA 4RQ0A 3MR2A 4M2YA 1D0LA 4P4MA 4F92B 2UXDM 5ALHA 4RUCA 2XFSA 3CF0A 1B4FA 2KP7A 4Q8EA 1F44A 3GZFA 4LFAM 3H4BA 2R46A 1ZQAA 4JMUA 1V9PA 3F2BA 5AKLA 4YP3A 4GITA 1JRPA 3VDUA 1BPXA 3DOAA 4F71A 1T6OA 2C99A 3BZCA 5JRTA 3UJNA 5EOZA 4F93B 2H3FA 1SZHA 4ACOA 2FPKA 3OSPA 1NK7A 3NBXX 2K4PA 9ICKA 8ICIA 3FE3A 5ALTA 4EBEA 4LGMA 3MFHA 2QP9X 1X37A 3Q8KA 5KQ8A 2CHGA 3GP1A 2KRUA 3HW8A 3T38A 3JPQA 1NJZA 1XC8A 2E1EA 2ZIVA 3K1ZA 2C22A 3MGHA 8ICOA 2BJVA 1NY5A 1KSPA 2FMQA 1DO0A 1Q8KA 5EE9A 3H7IA 3LCVB 4BX9C 1MN3A 2KG5A 3H0MB 2HHTA 1RZTA 1SWVA 1N63A 5AM5A 5CA7A 3ED5A 2ZANA 4DSFA 4I28A 1TAQA 3GIKA 3IM1A 1QSYA 4MB7A 2LHTA 4QW8A 1PVQA 2BPCA 4QW9A 1E9RA 2OOBA 2W11A 4F5QA 2P5TA 1A5TA 3I4YA 4OJPA 4B3TM 4DQRA 1T8EA 2PFPA 5KPRA 4LFCM 1ZV1A 1HIWA 1MA7A 1L7OA 2I9GA 4CRXA 1OUQA 5ITRA 1FNNA 4P17A 1W5TA 3RAXA 4Z6FA 2W3SA 3KXEC 1PJIA 1NSFA 4C4TA 9ICFA 3VLFB 1L1TA 2MSNA 4XRHA 5TISU 2KVCA 1PK3A 5F9NA 3RGPA 5AKZA 1X9SA 1AUAA 1FFUA 3RB4A 3ZI4A 3E46A 3SZ2A 1NNUC 4EYIB 3M8SA 3HKZF 1J2MA 9ICMA 2KFNA 1HNWM 2H1RA 2ZIUA 2UUBM 1F0MA 2EAPA 4JI1M 1JMSA 3D6JA 4GXKA 3PO5A 5J2GA 2AQ4A 4PH5A 3F53A 2DZNB 1JUDA 4DR2M 1E32A 5J0RA 1GL6A 5J2KA 2V9WA 3HX0A 2LH0A 2JWSA 3SMSA 9ICNA 3T1YM 1NV9A 5KG7A 1KYIA 2F5PA 3AL0C 4QWDA 5F3XB 3Q8XA 1VG5A 1WWVA 1KL9A 2XGQA 5DLFA 3ZQJA 3RGSA 4AKGA 5ALXA 4ECRA 2JZ1A 1UA0A 4DFDA 5KFEA 2UUAM 5GTHU 2VF8A 4NLBA 3FDSA 4RPXA 4FBTA 1QSSA 2VA3A 1LVHA 3GQ5A 1PUZA 2NYVA 1TAMA 4F4XA 3AEVA 3BQ1A 5D46A 4P0PB 4CGYB 1L7MA 5AIAA 3AOEA 2OO9A 3RTVA 2LXEA 1QAOA 3TACB 2R0IA 1T3TA 2W03A 2HAKA 1V38A 3HKZC 3SATA 5BOLA 3TFRA 3UPQA 2BDPA 1I4WA 4I27A 4DR1M 5DLGA 1U48A 1ZJMA 1YUBA 2K89A 2ZJ8A 2NRXA 1YT3A 4CDGA 4CHTB 4ECTA 2JH7A 3F2DA 3NWLA 3T5KA 2K4IA 3JPNA 1QQ7A 2PXIA 1GABA 7ICFA 2Z7JA 4RQMA 1L7NA 1ZQUA 3W0LB 3NVWA 1DGFA 1N77A 5IREB 2WFAA 3FD9A 2R4JA 4W5WA 5DB6A 5DDMA 1UHUA 3L2AA 2R6FA 1Z19A 3KHHA 2KJ9A 4CIZA 4QWCA 4IJFA 4F3OA 3MK6A 4I81A 3RB0A 2NRTA 4QZCA 4TQRA 3K9OA 3KS4A 4JWMA 3CTWB 3BQ7A 4LZZA 1UQVA 5CRXA 1IIPA 2D3DA 2Y1IA 4NLGA 2R45A 2F2AB 3OSNA 3WK7A 4DV5M 2L5YA 4OJLA 2RDJA 4B3RM 4NWIA 8ICUA 2C28A 2LVQD 3OHAA 5KPTA 2ATLA 3PX6A 4LF5M 1K82A 2HWJA 4I2EA 1MQ3A 5KFIA 2HHSA 9ICWA 4NY8A 3KSJA 2NRVA 2DWZB 5EE1A 3MDCA 1O03A 3T6PA 3FUVA 3TARA 4WW0A 3WKBA 4KLIA 5KT3A 3G6VA 4YQWA 4GFJA 2V6ZM 4UB2A 2Y0TA 3I51A 2NO4A 4ELTA 5AKGA 3J7AS 1NOMA 3TADA 3FRIA 4NRWA 1QZEA 2ESEA 2KKVA 3SMPA 4KLJA 2KHHA 2IA6A 5J2FA 4EZ9A 2DWNA 4MGZE 2ZTDA 5JU5A 1VJ5A 4YR2A 4ED8A 3GLGB 1NK4A 4I4LA 1L7PA 4X64M 5AKJA 4NLZA 1QQWA 2JNHA 4BUGA 2C9OA 2DFLA 7ICUA 1V33A 9ICRA 3GLFA 2G3QA 3ILKA 2HHWA 1N2XA 2O01F 3OHBA 1BVSA 1XO1A 4NM1A 3K4GA 2VKQA 4DSJA 4ZPXA 1ZRMA 4NM2A 4P0QB 1X6JA 1GJTA 1K1QA 4LZDA 4UBBA 4LCBA 4DQSA 2Y0SF 2DAIA 3SAUA 5KFJA 3QZ7A 3J80S 4C7ZA 3ZDBA 4DOCA 4QHTA 4OX9M 3SENA 1QQ5A 3GV7B 4DFPA 2FMPA 4QZHA 1DK2A 4PGYA 4MEYA 4IQUA 2C2EA 3K1JA 2PKEA 5J2HA 4BWJA 5JTIA 1CUKA 1GL7A 1V34A 3RJHA 3SV3A 4O3RA 8ICSA 4O3QA 1KEJA 2HHHM 3U5ZB 3EW9A 2HBLA 5KFZA 4Y2SA 1KLNA 3A42A 3D8LA 2I7PA 3QZ8A 2ZJAA 5AI9A 2F77X 4GLXA 1Z6TA 4JV1A 1BNPA 1IN8A 1S3SA 5H2FU 3RJEA 2E8MA 1ZMVA 2ASJA 1ZRNA 5BPVA 4DR5M 5AKKA 3QE9Y 2A3VA 4B9MA 1IBLM 1TVAA 1D9DA 1T3NA 3MC1A 5KFAA 5DBCA 1I94M 4RT3A 1COOA 5ALVA 4R7GA 2JY8A 1U45A 3PZPA 3ALRA 3UQ0A 4QZ8A 1S9FA 3SAHA 3N28A 3LWMA 4GIPA 4G3IA 9ICBA 3GFKB 2AXTU 1XU4A 4TURA 5ITXA 2HBMA 1V97A 3MHVC 3VK7A 4I2GA 5CWRA 3RE8A 1X40A 4QIWC 3MR6A 4JV2A 4UATA 1N56A 3R9XB 4RQ2A 1VEJA 3W67A 3TFSA 1XHBA 2AGPA 1ZQOA 5EXTA 1YE9A 1KN5A 2F76X 3PFIA 4PL2A 1NVMA 3SFZA 3LK9A 4G4QA 3GRUA 5J2DA 3RBDA 1JXEA 1SV0A 1QANA 3GRRA 4JI0M 3ZD9A 1V85A 4L78A 1Y8GA 4REZA 4UB1A 4EYHB 3CYMA 4C8OA 4CJ6A 2C2RA 5KG3A 4BDPA 3HKPA 1L3TA 4UAYA 4KLGA 1UT8A 2KEYA 2FDRA 3QUTA 7ICLA 4RPYA 2JEJA 3UXNA 3FTDA 1SXJA 5EP1A 4HAIA 4Y2XA 4YD1A 2Z4RA 3PNCA 3SYLA 2KNVA 3J27B 4GMQA 2UUCM 3EWAA 4P0PA 7ICJA 4JXJA 3SEIA 2RRUA 3FM9A 3HRDD 4MF8A 5KT5A 2MROB 4DQQA 1NZPA 2EZYA 5D4BA 9ICJA 1N60A 2EH9A 2GO7A 4RT2A 3V6JA 5DG7A 5DGAA 2BPFA 4Z6CA 2FS1A 4R8UB 1NO1A 5DFLA 3ISBA 2R8IA 3E21A 2NO5A 2JGAA 2MGWA 3QUCA 4O3NA 5J0UA 2FE8A 3H8JA 7ICNA 2PFNA 4MGYE 2JR5A 1KFSA 4LJ8A 4D80A 5ALDA 2Z8YM 1PVPA 1EE8A 1IXRC 5KTQA 4MFAA 1XSPA 7ICHA 5ALEA 4YR0A 1SKRA 3GLGE 2EZZA 5KFQA 5AI4A 3KOWE 4B3MM 4XQ8A 2QPAA 1MJGM 3RBEA 5BOMA 2L4EA 5E26A 2FE9A 2JZBA 2BJWA 8ICGA 4R66A 1TKDA 1RQNA 7ICVA 5DB7A 2AHOB 3LYSA 3TPZA 5IILA 8ICEA 3K1RB 3PR4A 1G59A 1B22A 3NTUA 1WR1B 3K75D 3DZDA 1TR8A 2E8PA 2FLPA 1H6UA 2UXCM 3H0RB 4EENA 2WSCF 4QZGA 4M6WB 4DV3M 4DL7A 1IN6A 2ASLA 2DENA 3JPRA 1XWIA 2I1QA 2BKEA 5GTIU 4M9HA 3UGJA 3GIIA 4DV4M 1G3IA 3EPGA 3UZUA 3HU1A 4M0DA 2YY6A 2M5ZA 5IIKA 5KG4A 3HT3A 2XGNA 4O5KA 1D8LA 2KKPA 2KV2A 3B74A 3GU3A 3J81j 3HJEA 4M9SA 4OCZA 4AKHA 1LV5A 4QZ9A 3EZ5A 2CRUA 4DL6A 3TWKA 3C2MA 1OKSA 3FUUA 5J8YC 3HU3A 2ISPA 4J9SA 2DKLA 1P3QQ 3UMCA 1XWLA 3FTCA 2ZIXB 2BCUA 2DBYA 1ZQWA 3DFZA 4RPZA 1S10A 1S0NA 5CR0A 3PSIA 4IBJA 3KFUF 5AK6A 8ICAA 3FAHA 2ZIVB 4L6V6 5KG5A 4LF9M 1IFYA 3GRYA 4EBDA 2FFJA 4ZH4A 1VDLA 4YCXA 3BQ0A 2KE7A 4BBAA 4M0AA 1BPDA 2ZM6M 4NSOB 5IIMA 2BGWA 1KSFX 1JI7A 3AQFA 4G4OA 3SAWA 4RZRA 9ICAA 1SL0A 5HR7A 8ICQA 2RQ5A 1C20A 3GPUA 1QSLA 5AHXA 1A6SA 3H8SA 1R6BX 4KLOA 2LI6A 3VCBA 1S8OA 2ODGA 2A5YB 3U6EA 1Z5CA 1X9WA 1UPHA 1Z1BA 1SKWA 3V76A 1VQ1A 4KLUA 3W0FA 3IECA 3H8MA 5KG2A 5KFSA 3JR5A 4LF4M 3NGDA 3A45A 1TK0A 3HZJA 3GIMA 3PV8A 3OGUA 4IRKA 1QAQA 2XY5A 1IXSA 3ONNA 1ZD3A 4NV0A 4OJOA 4ED0A 4DUZM 5KL8B 2KHVA 3QX7A 4NJ8A 4QWAA 1U49A 3OJUA 2LM4A 4DL3A 2Y0QA 2AH5A 3WHKA 4LRSA 8ICXA 1XC9A 3U6DA 2XLJA 3I04M 4IR9A 3AUOA 2AU0A 4F2SA 3ETRA 4LRTA 2J6UA 4LJAA 3T79A 1FIQA 3M7DA 2PFQA 2LHGA 2A1JA 4FZNA 2I6XA 1N36M 2BCQA 1TK8A 2BZFA 2EKKA 1PJTA 4RNAA 2K4HA 1DXSA 2CEAA 2P35A 2R8HA 4FWHA 3I01M 5C1BA 4QZDA 1Q39A 4EBCA 2GLEA 3KBBA 3C2KA 2L4FA 2R8JA 2M60A 3NUQA 2OH2A 2Y1JA 2UVUA 4UB8U 2V4QA 1ZQVA 2WZJA 4AI6A 3IP4B 2ZXHA 1UFZA 4KN7A 7ICIA 4ED3A 1X66A 2DPIA 1ZQSA 5J2BA 4DL4A 1ZQJA 4PGXA 4X62M 2YTUA 2R44A 3QAUA 9ICOA 1KTQA 5EWEA 3WK5A 1DRGA 1U47A 4I29A 3C9PA 8ICVA 2ZIUB 5A0LA 2EJSA 4KITB 2V4RA 1T43A 1ZQ1C 4MGKE 4JV5M 1NHGC 4P16A 4UB3A 1L8OA 3EUB2 1SXEA 2W9AA 3AOGA 3HX3A 1HQCA 3GLFB 2GNOA 4DSKA 2ERCA 3LW5F 4DR4M 5HR6A 4M9JA 2Y21A 1ZMWA 5JI3E 5D49A 3LWLA 1VLBA 2RHFA 3Q8RB 5L1MA 2H3IA 4YN4A 5ALMA 2KNJA 1DGSA 1QDRA 2IBKA 4Y2RA 8ICZA 5FTJA 1FO4A 5DGBA 2APLA 2YMMA 2JUJA 4BLCA 4KX3A 2VQFM 3HILA 5KFTA 1R2YA 2QB1A 2DAKA 1D8BA 2EQYA 4DR7M 4Y28F 3IG5A 3UQ2A 2RDIA 3TWMA 3F5EA 1TH2A 2RKOA 1BPEA 4BGDA 1SL1A 5ITTA 4CISA 2GQFA 4KLSA 1Z1VA 4LJ5A 3PMLA 3QU5A 5AIBA 1JQJC 3AOEC 4R3DA 4TUSA 1LKYA 1WXQA 4Y2JA 4M9ZA 4MGHA 3BS7A 3Q8QB 4JUZA 3M9NB 1VDVA 5KFWA 2UVVA 1XB2B 1L3VA 4C8KA 1CRXA 3L28A 2G09A 4CGZA 2DKXA 1YZ6A 4B9LA 4NXMM 4KT0F 4QZAA 4O5CA 1LV7A 1IXZA 1TV9A 3U6LA 2DPJA 3ICXA 3TE6A 2GWSA 3BS5A 1VDDA 4AYBC 3VK8A 4ED6A 1ZQIA 4JI8M 2J7NA 2CPRA 3JPPA 2AQ0A 3AV0A 3H4MA 4LJ4A 1ECWA 4K0KM 4QHSA 1NZBA 1ZQFA 5A2QS 5AKIA 4Y2YA 4DOBA 4MGIE 5KFYA 3PW4A 5CB1A 4AQYM 3RF9A 2HOFA 3K92A 4IBCA 5ITYA 1Q3BA 5KT4A 1QUTA 4GIBA 1UCVA 4IS7A 1OIPA 3LCUA 3HP6A 2YB1A 4O3PA 4F2RA 1SG9A 5AM1A 5DNYA 2YX8A 4QIWF 3C28A 4IJEA 2KA6B 4QZFA 5FLXS 3I28A 2VQEM 4RUAA 3HJQA 2MRLA 3VKGA 3AFHA 3CW2C 4Z6DA 5KFCA 5DB9A 1XMOM 3UXOA 4HEOA 4XGIA 1BPYA 1QH9A 3ZDEA 4Q8FA 3TKAA 3PSTA 1G8PA 2OYYA 1GKIA 5ALFA 2KSOA 5ALUA 5L1JA 4LFBM 5JI2E 5AM0A 2QHOB 2VIXA 8ICFA 2DWLA 4II7A 2F5QA 1N34M 3GLIA 4FS2A 1DGJA 1KQQA 4MFCA 4JI3M 3C3DA 4J9RA 1NK5A 3V72A 4YY3M 3IG8A 1S97A 1PZNA 3C1ZA 1R4GA 1DK3A 2QARA 2FLLA 3GV8B 2VJ5A 2LNHC 1JROA 4EX7A 1RDFA 1A0PA 9ICGA 2F8LA 2KDLA 2YMQA 3TWLA 4US9A 1Q3VA 1COKA 4Y2PA 3R9KA 5KG1A 4J9OA 5DG8A 2Z3XA 4FCWA 3GLFE 5HMLA 2MAXA 2DAEA 1QAMA 1XMQM 3IN5A 4GKKM 3WK8A 2PMZC 4EIWA 5IWAM 4US8A 2WSEF 5KO3A 1XNRM 4P0QA 4LZGA 1L2BA 2LPEA 4KLMA 4IBBA 5IIOA 3BZKA 2RGHA 4EZ6A 4O5EA 4NL4H 4Z8XA 2UVWA 4F1IA 1L8QA 5HHIA 4O0IA 1SKSA 2LM1A 3AN1A 4IQTA 5ALWA 4WP2A 4C80A 3B7NA 3U6OA 3VFDA 1NV8A 3HGIA 2JEIA 3L27A 2A1AA 1T3QA 2CHQA 4QOSA 4GEWA 1RYRA 5IIJA 4PGQA 3GO8A 1N75A 3M6AA 4NLCA 2MUTA 2PMZF 3GLHB 5J0OA 1HNXM 1N5WA 4J9PA 3B7ZA 4R64A 2MUTB 2B0CA 4RQ4A 5KFPA 2KVSA 2BWEA 2F5SA 3A46A 1RYSA 1K5OA 3KP1E 1HEKA 4I2HA 3RJIA 2J6TA 4I5SA 4LJ9A 1OAIA 3HWSA 5KG6A 5IINA 2G0AA 4UAZA 4CCHA 3MDAA 2D8CA 2KZ3A 1QTMA 1BNOA 5EWFA 4DL5A 4KLDA 4GRIA 3C3EA 2EANA 2MR9A 3CNHA 1DO2A 3ISDA 2W8KA 4QNRA 4YFKA 4OU7A 2M9NA 1ZQGA 2LHCA 2XZFA 4TUWA 1ZD4A 1TFRA 8ICCA 2FI1A 4F4YA 3SAFA 2UVRA 8ICBA 1Z4OA 5KFLA 3HJSA 1L2DA 2Y9TA 2VIIA 4MF2A 4PL1A 3CF2A 3ZH9B 1RG6A 1R7RA 5KAFU 2W54A 3KZXA 4M9NA 1PM5A 1B0XA 2FJ6A 1ZQTA 5KG0A 2NV3A 3TAPA 4UN2B 3FTEA 3PW0A 1QDTA 3MR5A 2YB4A 4AKIA 1MC8A 3KOXE 2W55A 7ICSA 4NC6A 3S6JA 4PHAA 1Q3CA 4ED1A 1T4GA 1N48A 1X6IA 3FUXA 3H4JA 4I2AA 1P7DA 1JX4A 4G4NA 3RJJA 2Q4TA 4UQGA 2V1UA 3HHXA 3L4PA 3FC4A 4UW9A 4DSEA 3JR4A 3QYPA 1S77D 1VEGA 1DOQA 4YXJA 5DYGA 4F5OA 3NASA 3PSPA 5EQTA 1K3XA 3EPIA 3B0XA 5KFHA 2CRXA 3SR6A 3K2LA 2OWOA 2XCAA 1XXHE 4I2JA 1UT5A 2FPMA 4YD2A 4X5VA 4J03A 5KFFA 5KNIA 2LYAA 2EZXA 1Z00A 3NVYA 3RH6A 7CATA 2KOBA 1D2NA 1Z4NA 2NRZA 2XI9A 2HHQA 2L6OA 1IN7A 4O3SA 1TH4A 1OQYA 3K8ZA 2WF6A 4GC5A 2IMWP 3BJYA 5AK3A 3K9PA 4LJ6A 4BXOA 1ZXIA 3UMGA 4CF3A
chains in the Genus database with same CATH topology
3VDUA 2DF4B 1ZQ9A 3M0EA 4A8EA 3DOAA 2R4EA 1TDHA 3DFZA 3ZC7B 3M6ZA 2C99A 4FW9A 5T14A 3PSIA 3CF6E 4IBJA 2XFTA 4LF6M 2V1CA 3UJNA 2HOQA 2XVTA 3KFUF 1DGGA 2ZIVB 4IBKA 2I7NA 4LF9M 2H3FA 1SZHA 4ACOA 3GRYA 2FFJA 2UXBM 4BBAA 3PNYA 2CE7A 3UK6A 3ZCBB 5GKNA 2KIWA 4LGMA 2QP9X 1X37A 2ZM6M 4NSOB 5KQ8A 2LWXA 1KSFX 1SXJB 2CHGA 4NRVA 3AQFA 4G4OA 3GP1A 3SAWA 3LQQA 1TDZA 5HR7A 1NHWC 2KRUA 3T38A 3GPUA 3DA1A 1XC8A 1A6SA 2HKJA 5KPZA 1R6BX 3AL0B 2E1EA 2YFQA 3B9PA 2ZIVA 3K1ZA 2C98A 3VCBA 2BJVA 1NY5A 2A5YB 3U6EA 1DO0A 1Z5CA 1UPHA 1Z1BA 2KD1A 5ITXE 2LKYA 4BX9C 1R2ZA 2CV1A 2EO2A 3H0MB 3PSFA 3W0FA 3KP0E 1SXJE 2ZANA 2DWMA 3JR5A 1IXSB 4LF4M 3A45A 1GO3F 4MB7A 2LHTA 3E9SA 1PVQA 1QAQA 2KHQA 1E9RA 4MM3B 2P5TA 1YSYA 3I4YA 4OJPA 4B3TM 3ONNA 5KPRA 4LFCM 2R65A 4JI6M 4NV0A 1HIWA 4OJOA 1MA7A 3A98B 5E6JA 4DUZM 4CRXA 1NJGA 2X4AA 4DV1M 5KL8B 1OUQA 4X65M 5ITRA 4DV6M 4L8RC 2KHVA 2C5RA 1FNNA 2KJ5A 4D81A 1W5TA 2L09A 3VDPA 1XXHB 5ITQA 4DV7M 3KXEC 1PJIA 2Y0QA 1NSFA 3WHKA 4LRSA 3VLFB 1L1TA 4NXNM 3MJ5A 3SHGB 4PDGA 3U6DA 1URJA 3KDSE 2XLJA 1J5EM 2KVCA 2E5LM 3RGPA 1OFHA 4LRTA 4LJAA 3T79A 4L4UA 2XICA 3M7DA 1NNUC 1IN5A 4QJFB 4FZNA 3D8BA 3HKZF 1HT2E 1N36M 1J7KA 2HBJA 4KX5A 2D7EA 1HNWM 4LZJA 2Q2EB 4RNAA 3N7PD 2K4HA 2H1RA 2YR0A 2F4VM 5EP3A 1UM8A 2CEAA 4QNMA 2F5NA 2UUBM 2ZIUA 1IY1A 4OO1J 5EP2A 2H3QA 2X8AA 4JI1M 4FWHA 3JAMS 3KVWA 3U6QA 2LBOA 5C1BA 4FD2A 1Q39A 1L2CA 3O0FA 1ED1A 3F53A 2DZNB 2M60A 4DR2M 2VJ4A 3NUQA 2OH2A 1E32A 1GL6A 1IY2A 4JN6A 2LH0A 2ZIXA 3SMSA 3HU2A 3T1YM 1KYIA 3FYCA 4G6ZA 2CV2A 2F5PA 3AL0C 4AI6A 2ZXHA 3IP4B 3Q8XA 3SASA 5ITUA 1IN4A 4B3SM 4IIWA 1E9SA 3RGSA 4Z6YA 4AKGA 4O3MA 1SXJD 2EA0A 4WJ3B 2OQ4A 4GHLA 3J2PB 3DEEA 4AZFA 4X62M 2UUAM 3QAUA 4HLQA 5F3WA 4NLBA 4DUYM 3GQ5A 3FUWA 4JI2M 1DRGA 2CN1A 2W04A 2G8LA 1IBMM 1TAMA 2ZIUB 2G5HB 5A0LA 4CGYB 3F2CA 4P0PB 3AOEA 4QNLA 3BOSA 1ZQ1C 4MGKE 4JV5M 3NBIA 1NHGC 2HCBA 1QAOA 2LXEA 3FUTA 2LYBA 4P16A 1QVRA 1T3TA 4IBIA 2W03A 2ZBKB 5IZ7D 1G41A 3I4VA 3AOGA 2ZAOA 3HKZC 2NQ8C 4G4RA 1HQCA 3GLFB 3U61B 4IBDA 2ERCA 3SATA 4RF1A 4DR4M 5HR6A 1I4WA 2Y21A 3GPXA 5JI3E 4DR1M 2RHFA 2FOIC 1YUBA 2K89A 2H3IA 1YT3A 4CDGA 4CHTB 4JI4M 2KNJA 1XXHA 2JH7A 3F2DA 3FTFA 3NWLA 2K4IA 2ZAMA 4IBFA 2DXIA 4OJ6A 2Z7JA 3SMVA 4KODA 3TL4X 4DV0M 3W0LB 5FTJA 1DGFA 1N77A 2XSZA 5IREB 2X49A 3FD9A 4BLCA 2R4JA 4KX3A 2VQFM 4W5WA 5C0YA 1QZMA 4IBGA 2JA2A 3HJ8A 2G08A 4FE3A 2XH9A 3GQ4A 4PCZA 1R2YA 1D8BA 1TGUA 3LVVA 4DR7M 1XNSA 3IG5A 3LMMA 3TWMA 2Z4SA 3F5EA 3L2AA 1TH2A 2ZIWA 2RKOA 4QOZC 2HL7A 4KO8A 2H3VA 1Z19A 5ITTA 1KBUA 4CISA 4AG6A 2KJ9A 1Z5BA 4IJFA 2G5GX 4LJ5A 1IM2A 3MK6A 1JQJC 4FCVA 3AOEC 4I81A 4R3DA 1N32M 1WXQA 4B08A 4M9ZA 2DHRA 3KS4A 4MGHA 2EUCA 3OPXA 3CTWB 5BR8M 4LZZA 2CHVA 3UMMA 3AKZA 3E0FA 2OM6A 5CRXA 1IIPA 2R18A 3SBJA 5FSWA 2R45A 2XSZD 4PDIA 2F2AB 1CRXA 3D2SA 2D6FC 3PVSA 2DVWB 3L28A 2Y20A 4DV5M 4JI5M 2G09A 3F5AA 4CGZA 4OJLA 2BNKA 3U6SA 3C29A 4IC9A 4B3RM 2L7HA 4NWIA 4IBEA 4M0WA 4NXMM 2DGZA 5KPTA 2OPFA 4DR6M 4LF5M 1K82A 1TH3A 4DV2M 1LV7A 2UU9M 2O5RA 1IXZA 4A3VB 4GH9A 3E4RA 5EP4A 3U6LA 3ICXA 3GPPA 3KSJA 3AQEA 2DWZB 3TE6A 1VDDA 4HL4A 4AYBF 1GLNA 4C0ZA 4AYBC 2K4EA 3FUVA 3SYKA 4DR3M 3VK8A 4WW0A 4JI8M 4FWDA 2J7NA 4OW0A 2CPRA 1Q3UA 2RP5A 3AV0A 3H4MA 4S12A 4BB9A 2DZOB 4LJ4A 1NNJA 1ECWA 4K0KM 4QHSA 2WB1F 2V6ZM 4GFJA 2ZXIA 2W82A 1NZBA 2D7GA 2Y0TA 2L7IA 3I51A 4FZLA 3KFUG 3CP8A 4U7CA 5A2QS 3H0LB 3N7RC 4MGIE 3J7AS 4AQYM 3RF9A 2HOFA 3K92A 4IBCA 4KLNA 1N33M 5ITYA 1Q3BA 4AW4A 4NOOB 4NRWA 3N7SC 2KKVA 3SMPA 1DGHA 8CATA 2DWNA 4MGZE 3CRXA 4AG5A 3VKHA 2YB1A 3U6CA 3GLGB 4I4LA 2DQNB 5DNYA 4X64M 2JMGA 2YX8A 4QIWF 1QQWA 4IJEA 4BUGA 3C28A 2KA6B 2WAQF 2C9OA 5EXSA 3GLFA 5DYIA 5FLXS 3ILKA 2VQEM 2KW0A 4B7HA 4OVZB 4OVZA 3HJQA 3WHLA 3VKGA 3AFHA 2MRLA 2K47A 2QCUA 1XMOM 2VKQA 2XIDA 4XGIA 4ZPXA 4P0QB 4MH0E 3PSTA 1G8PA 2OYYA 1L6NA 1GKIA 4LCBA 3GLGA 3EIHA 2QZ4A 4LFBM 5JI2E 1JR3A 2Y0SF 3SAUA 2XF3A 2Y0SC 2K8BB 4FWGA 2VIXA 2KEBA 3J80S 2DWLA 4II7A 4QHTA 2F5QA 4LY6A 4OX9M 3OTOM 1N34M 3GLIA 2G5IB 2M0NA 4JI3M 3PXGA 3K1JA 1GL7A 2C9CA 4YY3M 3IG8A 4FCTA 3SHFA 2HBKA 3KOYE 4B7FA 3GLIB 2FNAA 2HHHM 2K8CB 3U5ZB 2VJ5A 2LNHC 2HBLA 1A0PA 2F8LA 3A42A 3HHYA 3TWLA 4LG2A 1Q3VA 3D8LA 3NRWA 2I7PA 1HT1E 2Z3XA 1NJFA 4FCWA 2KZSA 3KW6A 2F77X 5KQDA 1Z6TA 1IN8A 1MU5A 1QAMA 1S3SA 1XMQM 3IN5A 1SXJC 4LF8M 4GKKM 5BPVA 4EIWA 5IWAM 4DR5M 2PMZC 5KO3A 1XNRM 4JI7M 4P0QA 1IBLM 2A3VA 5EJCA 1L2BA 4ICAA 1MX0A 4IBBA 1G4AE 2RGHA 2WB1C 1I94M 2G07A 4R7GA 2HOIA 3KSXA 4NL4H 5LMUM 1XO0A 4Z8XA 5FTKA 3PZPA 2E1FA 1L8QA 3ALRA 3D2NA 3SAHA 4GIPA 3FKEA 3U6OA 3HHZA 3VFDA 1HR0M 3HGIA 4KMOB 1DGHB 1N78A 1GVNA 2AHMA 3L27A 5ITXA 4LJ7A 2CHQA 4QOSA 2HBMA 3MHVC 1OJLA 3VK7A 1XNQM 1PJJA 2CV0A 1DGBA 3SQIA 3RE8A 3GO8A 4QIWC 2ZIWB 3R9XB 1N75A 1IY0A 3M6AA 2H3ZA 4NLCA 3M6KA 2PMZF 5FTNA 3GLHB 3HHWA 1XHBA 2D7HA 1HNXM 2K8AA 4XBOA 5FTMA 5EXTA 1YE9A 4RF0A 2KICA 2RRDA 5EXXA 3GLHA 2F76X 3PFIA 4PL2A 4M9XA 1NVMA 4OJ5A 3SFZA 2E5SA 3PNVA 3M7GA 3GRUA 4GC9A 4G4QA 2F5SA 1J09A 3MGVA 4FVMA 3A46A 1QANA 3AJIB 3GRRA 4JI0M 2W7OA 2R62A 4L78A 3KP1E 1HEKA 4REZA 4LGYA 3CYMA 3TQSA 3J7BA 4I5SA 4LJ9A 1Z5AA 4GHAA 1L1ZA 4PT5A 3HWSA 3SARA 3HKPA 2G0AA 4PD2A 2CUZA 2KEYA 3D2QA 2C96A 1Z59A 4GRIA 3FTDA 1SXJA 5EP1A 3RFWA 2Z4RA 3T1HM 3SYLA 1T94A 1DO2A 3J27B 4GMQA 4QNRA 2KRKA 3L25A 1WUDA 2YQZA 4OU7A 3FYDA 2UUCM 2XZFA 3R8FA 1HQYE 4JXJA 3J81S 4TUWA 4P0PA 1K3WA 4JYAM 3L26A 2JHDA 4L16A 4KHPM 2GH1A 3QWLA 3SAFA 4YHHM 2G06A 4B7GA 2ZIXB 3HJSA 1L2DA 3SAGA 4U6PA 1E94E 2XZUA 2ZG6A 2YNMD 2N1RA 2VIIA 3GRVA 5EXPA 3U5ZA 4L15A 3U6PA 3CF2A 2WAQC 3ZH9B 4PL1A 2JGAA 1R7RA 2GOLA 3KZXA 2KZUA 4FZMA 2FE8A 1PM5A 3LQRA 1IBKM 1IQPA 2QBYB 2MA1A 4MGYE 2KXEA 1C1KA 4LJ8A 4D80A 2NV3A 1PVPA 1EE8A 1IXRC 3FTEA 1HNZM 2YB4A 4AKIA 4GKJM 3KOXE 1NY6A 3KOWE 1Q3CA 4I8OA 4B3MM 3L3FX 2QPAA 3KOZE 3U6MA 1ORYB 4ITQA 2KJ8A 2QENA 5E26A 5KL1B 2BJWA 1OFIA 3FUXA 4LF7M 5FTLA 1P7DA 3L29A 5LMNM 4G4NA 3THGA 5C18A 3U60A 3LYSA 1PVRA 1ZAEA 3TPZA 2Q4TA 2V1UA 2OXOA 3RFAA 3GQ3A 3KS8A 3HHXA 2BDUA 1G59A 1KFVA 2JH1A 3JR4A 4WURA 3U61A 3DZDA 2CFOA 3T15A 1H6UA 2UXCM 3H0RB 5DYGA 4DV3M 2W7PA 3PSPA 1QYRA 4D82A 5EQTA 4BJQA 1IN6A 2HMXA 1W5SA 1K3XA 1XWIA 3SC3A 3EIEA 3UGJA 2CRXA 3K2LA 4DV4M 1G3IA 3GPYA 2F5OA 4X66M 3U60B 3UZUA 3HU1A 4M0DA 2LYAA 2M5ZA 2UXDM 2XGNA 7CATA 2KOBA 1D2NA 2XFSA 3CF0A 2XI9A 2L6OA 1IN7A 2J7OA 1TH4A 2KKPA 2KV2A 2RGOA 4NSRA 3GU3A 1F44A 3K8ZA 1JR3D 3GZFA 4GC5A 4LFAM 3SAVA 4M9SA 3LVWA 4AKHA 3C58A 4LJ6A 2R46A 4JMUA 5IT9S 3TWKA 2QBYA 3FUUA 3HU3A 3F2BA 5H37D 3VC8A 2XEPA 1FJGM 4GITA 3FTCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z7J A;  2R18 A; 
#chains in the Genus database with same CATH topology
 5III A;  5CP2 A;  1Y88 A;  2DF4 B;  1ZQ9 A;  4A8E A;  2R4E A;  4F72 A;  1KRP A;  3ZC7 B;  3V7J A;  2QSF X;  1ZQR A;  4PPX A;  4FW9 A;  4UAU A;  5T14 A;  2IHM A;  5CJ7 A;  3CF6 E;  2V1C A;  2HOQ A;  5DG9 A;  1DGG A;  2HVI A;  4IBK A;  5J29 A;  2I7N A;  3QU4 A;  2UXB M;  2LVP C;  2CE7 A;  2FMS A;  8ICR A;  5TZV A;  1JXL A;  2LWX A;  4NRV A;  3E2E A;  4EEY A;  3QEB Z;  5KT2 A;  4UB5 A;  1ZQD A;  4PHD A;  3OJS A;  3GIJ A;  1KKX A;  2EAM A;  2JZ0 A;  3QEA Z;  1S0M A;  4F4K A;  4J9K A;  2BR0 A;  3DA1 A;  3AL0 B;  4Q44 A;  5JUM A;  4F5P A;  4GXJ A;  3B7Q A;  3GDX A;  2LMR A;  1SXD A;  4IL6 U;  2KD1 A;  2LKY A;  2CV1 A;  3H8W A;  5AKY A;  1L3S A;  4DQI A;  1N61 A;  2HCF A;  1GJS A;  9ICV A;  3PMN A;  3E9S A;  2KHQ A;  1YSY A;  2K6B A;  2F1I A;  5ALZ A;  5KFK A;  7ICO A;  4Y2T A;  2HW3 A;  3A98 B;  3BBZ A;  5E6J A;  2B21 A;  1NJG A;  2X4A A;  4DV1 M;  4DV6 M;  1WIV A;  7ICP A;  2C5R A;  2QB0 A;  4D81 A;  4RQ3 A;  1XSN A;  2L09 A;  4YMM A;  5ITQ A;  2W8L A;  2K0B X;  3FRH A;  1X42 A;  2F1J A;  4I2B A;  4P4P A;  3SHG B;  4FS1 A;  1J5E M;  2E5L M;  1ZYQ A;  1OFH A;  2F3N A;  4RNO A;  4L4U A;  2XIC A;  4J9Q A;  2HSZ A;  2HBJ A;  2D7E A;  4ELV A;  3N7P D;  2W43 A;  1NKC A;  2F4V M;  1J2N A;  1UM8 A;  4QNM A;  2F5N A;  5ALK A;  3IV6 A;  1NK6 A;  5EP2 A;  2X8A A;  2IOF K;  8ICY A;  2LBO A;  4FD2 A;  1L2C A;  4KLH A;  4ECS A;  4GC6 A;  1NKB A;  2XY7 A;  1SV4 A;  3PVX A;  1EXN A;  4IRC A;  2VJ4 A;  4RQ6 A;  3C21 A;  3THV A;  5AI8 A;  2VA2 A;  1G71 A;  4KTQ A;  1IY2 A;  4JN6 A;  2YN4 A;  8ICM A;  3HU2 A;  2DHY A;  3RB6 A;  1ZQB A;  4MHV A;  5AIC A;  3SAS A;  5ALN A;  5ITU A;  1IN4 A;  4B3S M;  5ALP A;  5J2A A;  2PI4 A;  4O3M A;  4Z6Y A;  5AI5 A;  3NVV A;  3V6K A;  1SXJ D;  4WJ3 B;  4AZF A;  2WF7 A;  1M6Y A;  5KFU A;  2F1H A;  2OHF A;  4Q45 A;  1RQL A;  1Z00 B;  2ES6 A;  3FUW A;  2CN1 A;  2G8L A;  3QU9 A;  3T5J A;  2ZJ5 A;  4B9T A;  3BOS A;  4OD0 A;  5ALL A;  4M04 A;  2BHN A;  2L2D A;  3NBI A;  1RPL A;  2HCB A;  3FUT A;  5DB8 A;  1QVR A;  4IBI A;  2CWB A;  3I4V A;  2ISO A;  2ZAO A;  1FEZ A;  2NQ8 C;  4G4R A;  1ZD5 A;  3DV9 A;  4DLE A;  4IBD A;  2HI0 A;  4RF1 A;  4DO9 A;  3PW7 A;  2XC9 A;  1MSW D;  3GLH E;  3RJK A;  4JI4 M;  1JIH A;  4DFJ A;  1XXH A;  2WSF F;  3QNM A;  2ZAM A;  2J6S A;  4OJ6 A;  2DXI A;  3TAQ A;  3TL4 X;  1TAU A;  9ICX A;  4BWM A;  2X49 A;  3UM9 A;  3Q8L A;  4DWI A;  3QYE A;  1XS9 D;  5C0Y A;  4FE3 A;  4C8M A;  2G08 A;  4PCZ A;  1F4I A;  1TGU A;  3LVV A;  3JPS A;  1XNS A;  3GV5 B;  2ALZ A;  2ZIW A;  5AM4 A;  4QOZ C;  1JR3 E;  4NL9 C;  2HL7 A;  4KO8 A;  2H3V A;  3C23 A;  5L1K A;  1KBU A;  4MEX A;  2H5X A;  1IM2 A;  1U9L A;  4F4W A;  1N32 M;  2F44 A;  3MBY A;  3RB3 A;  4NXZ A;  2DHR A;  1WHC A;  5J0Y A;  5DQI A;  2OM6 A;  2R18 A;  3SBJ A;  5FSW A;  2XSZ D;  1R5L A;  3PVS A;  2Y20 A;  4JI5 M;  4RNM A;  4B9V A;  4C8N A;  3U6S A;  4IC9 A;  4DF4 A;  4IBE A;  2DGZ A;  2OPF A;  4DR6 M;  2XGP A;  1QUS A;  4DV2 M;  5KFD A;  4DFK A;  3KKA C;  2LYH A;  2O5R A;  4A3V B;  4ECQ A;  4GH9 A;  5EP4 A;  2Q0Z X;  2BCS A;  3BDP A;  3AQE A;  5HP4 A;  5HNK A;  4HL4 A;  2BQ3 A;  3I76 A;  2IHN A;  2K4E A;  2ASD A;  3B89 A;  3SYK A;  3W68 A;  4UBC A;  4FWD A;  3PR5 B;  1Q3U A;  4S12 A;  1NNJ A;  4BB9 A;  2DZO B;  1YLA A;  4DBG B;  4OO1 J;  2WB1 F;  2ZXI A;  2VF7 A;  2D7G A;  3A0B U;  5AKH A;  5B5E U;  4FZL A;  3KFU G;  3CP8 A;  3WKA A;  4LVS A;  1PJS A;  1DV0 A;  4KLN A;  1N33 M;  4AW4 A;  4NOO B;  1ZQL A;  4I2F A;  2HDO A;  8CAT A;  2W3R A;  1SZP A;  1NJY A;  3WKE A;  3C5G A;  3T5H A;  2DQN B;  4PHP A;  2JMG A;  4F4Z A;  4DCC A;  2WAQ F;  7ICM A;  2W9B B;  3B0Y A;  2DI0 A;  4XUS A;  2KW0 A;  5B66 U;  1NJX A;  3WHL A;  1GO5 A;  2K47 A;  4UAR A;  4CNQ A;  2K60 A;  1ZQN A;  2RLT A;  4R65 A;  4MH0 E;  2CP8 A;  1NI3 A;  2P66 A;  1L6N A;  4K4H A;  4JB3 A;  2B6G A;  3GLG A;  3EIH A;  3Q8G A;  4DL2 A;  4PJ0 U;  2XF3 A;  2Y0S C;  2K9D A;  4FWG A;  2JZB B;  3QUQ A;  2DAM A;  2KEB A;  2DUY A;  4KLQ A;  7ICR A;  1FFV A;  4F5N A;  2G5I B;  3G6X A;  2M0N A;  5L9X A;  3JPO A;  1S0V A;  1XSL A;  4DSI A;  4EEK A;  2B3T A;  2AGQ A;  7ICQ A;  3GLI B;  1QQ6 A;  5EE3 A;  4R8U A;  1S0O A;  2IOF A;  3NRW A;  3U26 A;  4NL9 A;  3WK9 A;  1RYU A;  3HPO A;  3RR7 A;  1NJF A;  8ICH A;  2KSO B;  5KQD A;  4C8L A;  4O9M A;  1MU5 A;  5G5H A;  4DEZ A;  2J5Y A;  1ZQC A;  3PW5 A;  1NKE A;  1BGX T;  1MX0 A;  4ICA A;  1OXJ A;  2PI5 A;  5LMU M;  2Y9U A;  2E1F A;  1PRB A;  3RJG A;  3IRU A;  2MH8 A;  3D2N A;  3FKE A;  1HR0 M;  2BCR A;  1VEK A;  4RQN A;  5K4L A;  1DGH B;  1N78 A;  1GVN A;  4LJ7 A;  4J9M A;  2BPG A;  2CV0 A;  1TTE A;  2KN7 A;  1DGB A;  2ZUC A;  1SGG A;  1YZ7 A;  2ZIW B;  2JEG A;  2H3Z A;  5DDY A;  3I1Y A;  1L8L A;  3M6K A;  2AJQ A;  2K8A A;  3TAN A;  3QUB A;  1S76 D;  5FTM A;  3IHQ B;  4RF0 A;  2RRD A;  2YMP A;  4KMU A;  4M9X A;  5J2J A;  4OJ5 A;  2JY5 A;  4QZE A;  3PNV A;  3M7G A;  4Y2V A;  3ZD8 A;  3MGV A;  4ECY A;  2N35 A;  8ICT A;  9ICP A;  3AJI B;  2R62 A;  1TE2 A;  5KFO A;  4Z6E A;  4GHA A;  2LVA A;  3J7B A;  3TQS A;  1Z5A A;  1L1Z A;  2DAG A;  5AI6 A;  2F8K A;  1WG8 A;  2CUZ A;  5KFB A;  2BCV A;  1T7P A;  3UXP A;  4ZOH C;  4ECX A;  3RFW A;  2P6R A;  3T1H M;  3MFI A;  3DDH A;  1QLN A;  1WCL A;  3QU7 A;  3L25 A;  1WUD A;  5EWG A;  2YQZ A;  1HQY E;  4DOA A;  3J81 S;  4DSL A;  1K3W A;  5AM3 A;  4KHP M;  3QWL A;  3H40 A;  8ICL A;  3RRH A;  4YHH M;  2HHV A;  2VAN A;  4U6P A;  1E94 E;  2JRZ A;  2YNM D;  3U5Z A;  5F9L A;  4C4S A;  5DBA A;  4L15 A;  3U6P A;  1S5L U;  9ICQ A;  1Z3E B;  2KZU A;  4I2I A;  3LQR A;  1IBK M;  4RQ1 A;  2QBY B;  7ICT A;  2KXE A;  1C1K A;  4GXI A;  4M47 A;  4R71 A;  2E3T A;  1ZET A;  3GQC A;  5L1I A;  3MAB A;  4GKJ M;  4ED7 A;  1RU3 A;  1EFU B;  3N97 B;  1NY6 A;  3L3F X;  4I8O A;  3KHR A;  3H4D A;  2C2D A;  3KOZ E;  4F8R A;  2KJ8 A;  1OFI A;  4LF7 M;  5FTL A;  3BQ2 A;  4IQW A;  4O3O A;  1L3U A;  5LMN M;  4NLN A;  3THG A;  3U60 A;  1PVR A;  1J97 A;  2OXO A;  3RFA A;  4B9N A;  1HUZ A;  2JH1 A;  2XY6 A;  4WUR A;  3U61 A;  2CFO A;  3AMZ A;  7ICE A;  1ZQY A;  5ALI A;  1A77 A;  2DWQ A;  1UA1 A;  1QYR A;  4D82 A;  2HMX A;  4M6W A;  1W5S A;  1HJP A;  1JN3 A;  1KFT A;  4PHE A;  2HHX A;  3EIE A;  2FLN A;  5AK5 A;  1ZOL A;  2F5O A;  2JV3 A;  4X66 M;  3U60 B;  3QXG A;  2LTU A;  2WF9 A;  2PFO A;  2J7O A;  3TAD C;  4YR3 A;  2RGO A;  4NSR A;  1ZD2 P;  3ETL A;  1ZQM A;  1JR3 D;  2CXY A;  4DS4 A;  3SAV A;  1LTM A;  3LVW A;  3C58 A;  4C7Y A;  4JWN A;  2JY6 B;  5IT9 S;  5DKW A;  2QBY A;  4USA A;  4XA5 A;  4KLT A;  5H37 D;  3VC8 A;  2XEP A;  3BXW A;  1FJG M;  2O25 A;  5KFM A;  4B9U A;  2MU2 A;  3M0E A;  1IXR A;  4TUQ A;  1TDH A;  1KDH A;  1WGN A;  2KZM A;  3M6Z A;  2W9M A;  1D0K A;  4LF6 M;  2XFT A;  5KFR A;  2XVT A;  7ICG A;  5G5G A;  3M9O B;  3RH5 A;  4B9S A;  3PNY A;  3UK6 A;  3ZCB B;  5GKN A;  2YML A;  2KIW A;  8ICK A;  1L5U A;  9ICU A;  1SXJ B;  4KLL A;  3LQQ A;  5ALG A;  1TDZ A;  3UMB A;  1NHW C;  4Y2U A;  2HKJ A;  5KPZ A;  2YFQ A;  3B9P A;  2EDU A;  2C98 A;  3ORY A;  9ICS A;  3WKC A;  4KLF A;  4Q43 A;  1BPZ A;  1V92 A;  5ITX E;  1RXW A;  1D8Y A;  1R2Z A;  2EO2 A;  3PSF A;  1D9F A;  3KP0 E;  1SXJ E;  4I2D A;  2DWM A;  1IXS B;  5ALS A;  5J2E A;  1PK1 A;  1GO3 F;  1PK1 B;  4MM3 B;  4BXO B;  1SL2 A;  2DNA A;  1KFD A;  4Q7J A;  2R65 A;  4JI6 M;  1ARO P;  4FBU A;  3TQ1 A;  4X65 M;  3E58 A;  4L8R C;  3B9J A;  2KJ5 A;  3V6H A;  3VDP A;  1XXH B;  4J9L A;  4DV7 M;  4K4G A;  4M9L A;  4NXN M;  3MJ5 A;  1JAL A;  4PDG A;  1URJ A;  3KDS E;  4TQS A;  4QJF B;  1NK0 A;  1IN5 A;  1OTR A;  3T5L A;  3D8B A;  1HT2 E;  4KX5 A;  1J7K A;  4LZJ A;  2Q2E B;  3KKA A;  4PZO A;  3RH4 A;  4EEL A;  2YR0 A;  5EP3 A;  1SB3 C;  3MMP A;  5HMM A;  1IY1 A;  2H3Q A;  3SV4 A;  3JAM S;  3KVW A;  3U6Q A;  3KOO A;  3O0F A;  2KNZ A;  1ED1 A;  1CI4 A;  5KAI U;  3GLI E;  3SI8 A;  4ANR A;  4EX6 A;  5ALQ A;  2ZIX A;  4QZB A;  3FYC A;  4G6Z A;  2CV2 A;  1SIJ A;  1KW4 A;  2LVO C;  4RQ8 A;  4IIW A;  1E9S A;  4DF8 A;  2EA0 A;  5AKE A;  2OQ4 A;  4GHL A;  3J2P B;  3DEE A;  4HLQ A;  5F3W A;  3JPT A;  4TUP A;  4DUY M;  2W9C B;  2LVN C;  4JI2 M;  2BQR A;  5AK4 A;  4RQ7 A;  2W04 A;  1NJW A;  4RKU F;  1IBM M;  2JP7 A;  2QLT A;  2G5H B;  3F2C A;  4QNL A;  5L8R F;  4KN4 A;  3L5K A;  4UAW A;  2LYB A;  3AU2 A;  2ZBK B;  5KT6 A;  3RAQ A;  5IZ7 D;  1G41 A;  1PJQ A;  3U61 B;  2VDB B;  4DLG A;  3GPX A;  5J0T A;  4RU9 A;  2FOI C;  1RXV A;  4PZN A;  2XO7 A;  3F92 A;  1WGL A;  3FTF A;  4P2H A;  4IBF A;  2QKQ A;  2FH0 A;  4G9B A;  9ICL A;  3SMV A;  4KOD A;  4DV0 M;  2YQE A;  2XSZ A;  1WWU A;  5AM2 A;  4F91 B;  1QZM A;  4IBG A;  2JA2 A;  3HJ8 A;  4ELU A;  2XH9 A;  3GQ4 A;  4E0D A;  3ZDD A;  3LMM A;  3BQT A;  1SV0 C;  2Z4S A;  4ED2 A;  3M1Y A;  3HWT A;  3RJF A;  5J0S A;  4F50 A;  1F5S A;  4YMN A;  4AG6 A;  2OOA A;  1Z5B A;  2G5G X;  5J2I A;  3PW2 A;  4YMO A;  4FCV A;  3RR8 A;  3N4M B;  4B08 A;  1ZQX A;  1N5X A;  2EUC A;  3KD3 A;  3OPX A;  5AI0 A;  5CEH A;  5BR8 M;  2CHV A;  3UMM A;  3AKZ A;  3E0F A;  2EAO A;  1IM4 A;  2WHE A;  3KTQ A;  1NK8 A;  4PDI A;  3D2S A;  3SYZ A;  2D6F C;  5KFG A;  2DVW B;  4ECU A;  3IHP A;  9ICI A;  2KTQ A;  3F5A A;  2BNK A;  2ZTC A;  3CGW A;  1N62 A;  1Q46 A;  3LDA A;  4CE6 A;  1JB0 F;  2L7H A;  4QZI A;  3C29 A;  4M0W A;  3QU2 A;  2BQU A;  1U4B A;  1TH3 A;  5J0X A;  2UU9 M;  3A0H U;  3V7L A;  3E4R A;  3NS1 A;  3Q8M A;  2JY7 A;  3GPP A;  1IV8 A;  4AYB F;  1GLN A;  4C0Z A;  1LB2 B;  2QAR B;  2IOH A;  4DR3 M;  3MGI A;  4CF5 A;  2JXN A;  4OW0 A;  2RP5 A;  1MN8 A;  4HYK A;  3PX0 A;  2HHU A;  2W82 A;  2L7I A;  4U7C A;  3H0L B;  3N7R C;  4FFD A;  3ZDC A;  5FP0 A;  2WF8 A;  3M8R A;  2KMD A;  1NNL A;  3N7S C;  2WTF A;  1DGH A;  3CRX A;  2JEF A;  4AG5 A;  8ICJ A;  3VKH A;  3U6C A;  3ZDA A;  9ICC A;  2O6K A;  9ICH A;  4LJX A;  5EXS A;  5DYI A;  3C5F A;  3AM9 A;  1ZQQ A;  4B7H A;  4OVZ B;  4OVZ A;  2ZUD A;  4IQV A;  8ICP A;  1MQ2 A;  2QCU A;  2VA8 A;  2XID A;  5BPC A;  3TI0 A;  2I5H A;  4DS5 A;  2QZ4 A;  8ICW A;  3C2L A;  1JR3 A;  1OAO C;  2K8B B;  1X9X A;  5KT7 A;  5ALR A;  2WF5 A;  2KK0 A;  4LY6 A;  4J9N A;  3GIL A;  3OTO M;  3PXG A;  2QNJ A;  2MJ5 B;  4P4O A;  3AU6 A;  3PX4 A;  4ECV A;  2C9C A;  2OCE A;  4FCT A;  3SHF A;  2HBK A;  3KOY E;  4B7F A;  2FNA A;  1Q02 A;  2K8C B;  5J0Q A;  3KHL A;  1WCN A;  3BS5 B;  2KNA A;  2E8O A;  3HHY A;  3IDW A;  4NLK A;  4LG2 A;  1IG6 A;  7ICK A;  1HT1 E;  1AQ6 A;  9ICE A;  2KZS A;  3KW6 A;  4Y2Q A;  5ALJ A;  3T3F A;  1SXJ C;  4LF8 M;  3KHG A;  2BWB A;  3WK4 A;  2HVH A;  4JI7 M;  1ZQE A;  4JK1 A;  5EJC A;  4F2L A;  4YVZ A;  5KFV A;  1ZJN A;  4RNN A;  1HUO A;  1G4A E;  4DQP A;  2WB1 C;  4JV0 A;  1H38 A;  2G07 A;  2A19 A;  2W9B A;  2HOI A;  3M9M B;  4UAV A;  3WK6 A;  3KSX A;  4RQ5 A;  3V7K A;  1XO0 A;  2KZZ A;  5FTK A;  4UAS A;  2R8G A;  2P6U A;  1LKY B;  4K4I A;  5CHG A;  4M9G A;  3HHZ A;  3SD7 A;  1SWW A;  4KMO B;  2AHM A;  3OTQ A;  1ZQK A;  5E79 U;  2QB0 B;  1OJL A;  1XNQ M;  2OEH A;  1PJJ A;  2KIV A;  3SQI A;  1WYG A;  1IY0 A;  4IR1 A;  5DQG A;  5FTN A;  4QWB A;  3HHW A;  4KLE A;  2D7H A;  4MFF A;  4XBO A;  4GC7 A;  4ECZ A;  5DBB A;  2KIC A;  1O08 A;  4IRD A;  5EXX A;  3GLH A;  5ALO A;  1ZQH A;  8ICN A;  2E5S A;  2E8N A;  4DFM A;  3NVZ A;  4GC9 A;  1EIJ A;  1X9M A;  1D0M A;  1J09 A;  1A76 A;  2DZL A;  4FVM A;  2ZUB A;  5L1L A;  2W7O A;  5J2C A;  2AGO A;  5AKX A;  4ECW A;  4QWE A;  4LGY A;  1ZQZ A;  1ZQP A;  4PT5 A;  3SAR A;  2R8K A;  5J0P A;  4PD2 A;  4UB4 A;  2FPL A;  3WU2 U;  3D2Q A;  2C96 A;  4R63 A;  3MR3 A;  1Z59 A;  3HY5 A;  3FYH A;  1AIP C;  1T94 A;  1K1S A;  1CEZ A;  2LBC A;  2KRK A;  4CF4 A;  1TK5 A;  3FYD A;  1B43 A;  3R8F A;  1C7Y A;  2ZTE A;  5KFN A;  1TF0 B;  4B6J A;  4JYA M;  3L26 A;  2JHD A;  4L16 A;  2GH1 A;  3WKD A;  3Q8P B;  2W9C A;  2G06 A;  2NRW A;  4B7G A;  3SAG A;  2XZU A;  1PGY A;  2DL0 A;  2ZG6 A;  2N1R A;  4YXM A;  3GRV A;  1OIZ A;  1WJ7 A;  5EXP A;  1RM6 C;  2WAQ C;  4UB6 U;  2GOL A;  4C4R A;  4FZM A;  3ISC A;  1IQP A;  2MA1 A;  3KZI U;  3C1Y A;  1HNZ M;  2KFZ A;  1ZMU A;  1QCK A;  5J8Y A;  3QYB A;  3PY8 A;  1NK9 A;  2QQ8 A;  4AP9 A;  5C5J A;  3U6M A;  1ORY B;  4G3O A;  4ITQ A;  2QEN A;  4XK8 F;  5ALY A;  3G6Y A;  5KL1 B;  9ICT A;  1OW5 A;  5KFX A;  3NRZ A;  3L29 A;  5C18 A;  1ZAE A;  5J0W A;  4YG2 A;  3Q8S B;  3GQ3 A;  2XCP A;  4F5R A;  3KS8 A;  2BDU A;  1KFV A;  3RRG A;  3EYZ A;  4FO6 A;  3T15 A;  2DKZ A;  5DQH A;  2EKF A;  2W7P A;  2A1J B;  4I2C A;  4BJQ A;  5HHH A;  3PO4 A;  5EE0 A;  3SC3 A;  1X2I A;  2JXJ A;  3GPY A;  1BPB A;  4RQ0 A;  3MR2 A;  4M2Y A;  1D0L A;  4P4M A;  4F92 B;  2UXD M;  5ALH A;  4RUC A;  2XFS A;  3CF0 A;  1B4F A;  2KP7 A;  4Q8E A;  1F44 A;  3GZF A;  4LFA M;  3H4B A;  2R46 A;  1ZQA A;  4JMU A;  1V9P A;  3F2B A;  5AKL A;  4YP3 A;  4GIT A;  1JRP A;  3VDU A;  1BPX A;  3DOA A;  4F71 A;  1T6O A;  2C99 A;  3BZC A;  5JRT A;  3UJN A;  5EOZ A;  4F93 B;  2H3F A;  1SZH A;  4ACO A;  2FPK A;  3OSP A;  1NK7 A;  3NBX X;  2K4P A;  9ICK A;  8ICI A;  3FE3 A;  5ALT A;  4EBE A;  4LGM A;  3MFH A;  2QP9 X;  1X37 A;  3Q8K A;  5KQ8 A;  2CHG A;  3GP1 A;  2KRU A;  3HW8 A;  3T38 A;  3JPQ A;  1NJZ A;  1XC8 A;  2E1E A;  2ZIV A;  3K1Z A;  2C22 A;  3MGH A;  8ICO A;  2BJV A;  1NY5 A;  1KSP A;  2FMQ A;  1DO0 A;  1Q8K A;  5EE9 A;  3H7I A;  3LCV B;  4BX9 C;  1MN3 A;  2KG5 A;  3H0M B;  2HHT A;  1RZT A;  1SWV A;  1N63 A;  5AM5 A;  5CA7 A;  3ED5 A;  2ZAN A;  4DSF A;  4I28 A;  1TAQ A;  3GIK A;  3IM1 A;  1QSY A;  4MB7 A;  2LHT A;  4QW8 A;  1PVQ A;  2BPC A;  4QW9 A;  1E9R A;  2OOB A;  2W11 A;  4F5Q A;  2P5T A;  1A5T A;  3I4Y A;  4OJP A;  4B3T M;  4DQR A;  1T8E A;  2PFP A;  5KPR A;  4LFC M;  1ZV1 A;  1HIW A;  1MA7 A;  1L7O A;  2I9G A;  4CRX A;  1OUQ A;  5ITR A;  1FNN A;  4P17 A;  1W5T A;  3RAX A;  4Z6F A;  2W3S A;  3KXE C;  1PJI A;  1NSF A;  4C4T A;  9ICF A;  3VLF B;  1L1T A;  2MSN A;  4XRH A;  5TIS U;  2KVC A;  1PK3 A;  5F9N A;  3RGP A;  5AKZ A;  1X9S A;  1AUA A;  1FFU A;  3RB4 A;  3ZI4 A;  3E46 A;  3SZ2 A;  1NNU C;  4EYI B;  3M8S A;  3HKZ F;  1J2M A;  9ICM A;  2KFN A;  1HNW M;  2H1R A;  2ZIU A;  2UUB M;  1F0M A;  2EAP A;  4JI1 M;  1JMS A;  3D6J A;  4GXK A;  3PO5 A;  5J2G A;  2AQ4 A;  4PH5 A;  3F53 A;  2DZN B;  1JUD A;  4DR2 M;  1E32 A;  5J0R A;  1GL6 A;  5J2K A;  2V9W A;  3HX0 A;  2LH0 A;  2JWS A;  3SMS A;  9ICN A;  3T1Y M;  1NV9 A;  5KG7 A;  1KYI A;  2F5P A;  3AL0 C;  4QWD A;  5F3X B;  3Q8X A;  1VG5 A;  1WWV A;  1KL9 A;  2XGQ A;  5DLF A;  3ZQJ A;  3RGS A;  4AKG A;  5ALX A;  4ECR A;  2JZ1 A;  1UA0 A;  4DFD A;  5KFE A;  2UUA M;  5GTH U;  2VF8 A;  4NLB A;  3FDS A;  4RPX A;  4FBT A;  1QSS A;  2VA3 A;  1LVH A;  3GQ5 A;  1PUZ A;  2NYV A;  1TAM A;  4F4X A;  3AEV A;  3BQ1 A;  5D46 A;  4P0P B;  4CGY B;  1L7M A;  5AIA A;  3AOE A;  2OO9 A;  3RTV A;  2LXE A;  1QAO A;  3TAC B;  2R0I A;  1T3T A;  2W03 A;  2HAK A;  1V38 A;  3HKZ C;  3SAT A;  5BOL A;  3TFR A;  3UPQ A;  2BDP A;  1I4W A;  4I27 A;  4DR1 M;  5DLG A;  1U48 A;  1ZJM A;  1YUB A;  2K89 A;  2ZJ8 A;  2NRX A;  1YT3 A;  4CDG A;  4CHT B;  4ECT A;  2JH7 A;  3F2D A;  3NWL A;  3T5K A;  2K4I A;  3JPN A;  1QQ7 A;  2PXI A;  1GAB A;  7ICF A;  2Z7J A;  4RQM A;  1L7N A;  1ZQU A;  3W0L B;  3NVW A;  1DGF A;  1N77 A;  5IRE B;  2WFA A;  3FD9 A;  2R4J A;  4W5W A;  5DB6 A;  5DDM A;  1UHU A;  3L2A A;  2R6F A;  1Z19 A;  3KHH A;  2KJ9 A;  4CIZ A;  4QWC A;  4IJF A;  4F3O A;  3MK6 A;  4I81 A;  3RB0 A;  2NRT A;  4QZC A;  4TQR A;  3K9O A;  3KS4 A;  4JWM A;  3CTW B;  3BQ7 A;  4LZZ A;  1UQV A;  5CRX A;  1IIP A;  2D3D A;  2Y1I A;  4NLG A;  2R45 A;  2F2A B;  3OSN A;  3WK7 A;  4DV5 M;  2L5Y A;  4OJL A;  2RDJ A;  4B3R M;  4NWI A;  8ICU A;  2C28 A;  2LVQ D;  3OHA A;  5KPT A;  2ATL A;  3PX6 A;  4LF5 M;  1K82 A;  2HWJ A;  4I2E A;  1MQ3 A;  5KFI A;  2HHS A;  9ICW A;  4NY8 A;  3KSJ A;  2NRV A;  2DWZ B;  5EE1 A;  3MDC A;  1O03 A;  3T6P A;  3FUV A;  3TAR A;  4WW0 A;  3WKB A;  4KLI A;  5KT3 A;  3G6V A;  4YQW A;  4GFJ A;  2V6Z M;  4UB2 A;  2Y0T A;  3I51 A;  2NO4 A;  4ELT A;  5AKG A;  3J7A S;  1NOM A;  3TAD A;  3FRI A;  4NRW A;  1QZE A;  2ESE A;  2KKV A;  3SMP A;  4KLJ A;  2KHH A;  2IA6 A;  5J2F A;  4EZ9 A;  2DWN A;  4MGZ E;  2ZTD A;  5JU5 A;  1VJ5 A;  4YR2 A;  4ED8 A;  3GLG B;  1NK4 A;  4I4L A;  1L7P A;  4X64 M;  5AKJ A;  4NLZ A;  1QQW A;  2JNH A;  4BUG A;  2C9O A;  2DFL A;  7ICU A;  1V33 A;  9ICR A;  3GLF A;  2G3Q A;  3ILK A;  2HHW A;  1N2X A;  2O01 F;  3OHB A;  1BVS A;  1XO1 A;  4NM1 A;  3K4G A;  2VKQ A;  4DSJ A;  4ZPX A;  1ZRM A;  4NM2 A;  4P0Q B;  1X6J A;  1GJT A;  1K1Q A;  4LZD A;  4UBB A;  4LCB A;  4DQS A;  2Y0S F;  2DAI A;  3SAU A;  5KFJ A;  3QZ7 A;  3J80 S;  4C7Z A;  3ZDB A;  4DOC A;  4QHT A;  4OX9 M;  3SEN A;  1QQ5 A;  3GV7 B;  4DFP A;  2FMP A;  4QZH A;  1DK2 A;  4PGY A;  4MEY A;  4IQU A;  2C2E A;  3K1J A;  2PKE A;  5J2H A;  4BWJ A;  5JTI A;  1CUK A;  1GL7 A;  1V34 A;  3RJH A;  3SV3 A;  4O3R A;  8ICS A;  4O3Q A;  1KEJ A;  2HHH M;  3U5Z B;  3EW9 A;  2HBL A;  5KFZ A;  4Y2S A;  1KLN A;  3A42 A;  3D8L A;  2I7P A;  3QZ8 A;  2ZJA A;  5AI9 A;  2F77 X;  4GLX A;  1Z6T A;  4JV1 A;  1BNP A;  1IN8 A;  1S3S A;  5H2F U;  3RJE A;  2E8M A;  1ZMV A;  2ASJ A;  1ZRN A;  5BPV A;  4DR5 M;  5AKK A;  3QE9 Y;  2A3V A;  4B9M A;  1IBL M;  1TVA A;  1D9D A;  1T3N A;  3MC1 A;  5KFA A;  5DBC A;  1I94 M;  4RT3 A;  1COO A;  5ALV A;  4R7G A;  2JY8 A;  1U45 A;  3PZP A;  3ALR A;  3UQ0 A;  4QZ8 A;  1S9F A;  3SAH A;  3N28 A;  3LWM A;  4GIP A;  4G3I A;  9ICB A;  3GFK B;  2AXT U;  1XU4 A;  4TUR A;  5ITX A;  2HBM A;  1V97 A;  3MHV C;  3VK7 A;  4I2G A;  5CWR A;  3RE8 A;  1X40 A;  4QIW C;  3MR6 A;  4JV2 A;  4UAT A;  1N56 A;  3R9X B;  4RQ2 A;  1VEJ A;  3W67 A;  3TFS A;  1XHB A;  2AGP A;  1ZQO A;  5EXT A;  1YE9 A;  1KN5 A;  2F76 X;  3PFI A;  4PL2 A;  1NVM A;  3SFZ A;  3LK9 A;  4G4Q A;  3GRU A;  5J2D A;  3RBD A;  1JXE A;  1SV0 A;  1QAN A;  3GRR A;  4JI0 M;  3ZD9 A;  1V85 A;  4L78 A;  1Y8G A;  4REZ A;  4UB1 A;  4EYH B;  3CYM A;  4C8O A;  4CJ6 A;  2C2R A;  5KG3 A;  4BDP A;  3HKP A;  1L3T A;  4UAY A;  4KLG A;  1UT8 A;  2KEY A;  2FDR A;  3QUT A;  7ICL A;  4RPY A;  2JEJ A;  3UXN A;  3FTD A;  1SXJ A;  5EP1 A;  4HAI A;  4Y2X A;  4YD1 A;  2Z4R A;  3PNC A;  3SYL A;  2KNV A;  3J27 B;  4GMQ A;  2UUC M;  3EWA A;  4P0P A;  7ICJ A;  4JXJ A;  3SEI A;  2RRU A;  3FM9 A;  3HRD D;  4MF8 A;  5KT5 A;  2MRO B;  4DQQ A;  1NZP A;  2EZY A;  5D4B A;  9ICJ A;  1N60 A;  2EH9 A;  2GO7 A;  4RT2 A;  3V6J A;  5DG7 A;  5DGA A;  2BPF A;  4Z6C A;  2FS1 A;  4R8U B;  1NO1 A;  5DFL A;  3ISB A;  2R8I A;  3E21 A;  2NO5 A;  2JGA A;  2MGW A;  3QUC A;  4O3N A;  5J0U A;  2FE8 A;  3H8J A;  7ICN A;  2PFN A;  4MGY E;  2JR5 A;  1KFS A;  4LJ8 A;  4D80 A;  5ALD A;  2Z8Y M;  1PVP A;  1EE8 A;  1IXR C;  5KTQ A;  4MFA A;  1XSP A;  7ICH A;  5ALE A;  4YR0 A;  1SKR A;  3GLG E;  2EZZ A;  5KFQ A;  5AI4 A;  3KOW E;  4B3M M;  4XQ8 A;  2QPA A;  1MJG M;  3RBE A;  5BOM A;  2L4E A;  5E26 A;  2FE9 A;  2JZB A;  2BJW A;  8ICG A;  4R66 A;  1TKD A;  1RQN A;  7ICV A;  5DB7 A;  2AHO B;  3LYS A;  3TPZ A;  5IIL A;  8ICE A;  3K1R B;  3PR4 A;  1G59 A;  1B22 A;  3NTU A;  1WR1 B;  3K75 D;  3DZD A;  1TR8 A;  2E8P A;  2FLP A;  1H6U A;  2UXC M;  3H0R B;  4EEN A;  2WSC F;  4QZG A;  4M6W B;  4DV3 M;  4DL7 A;  1IN6 A;  2ASL A;  2DEN A;  3JPR A;  1XWI A;  2I1Q A;  2BKE A;  5GTI U;  4M9H A;  3UGJ A;  3GII A;  4DV4 M;  1G3I A;  3EPG A;  3UZU A;  3HU1 A;  4M0D A;  2YY6 A;  2M5Z A;  5IIK A;  5KG4 A;  3HT3 A;  2XGN A;  4O5K A;  1D8L A;  2KKP A;  2KV2 A;  3B74 A;  3GU3 A;  3J81 j;  3HJE A;  4M9S A;  4OCZ A;  4AKH A;  1LV5 A;  4QZ9 A;  3EZ5 A;  2CRU A;  4DL6 A;  3TWK A;  3C2M A;  1OKS A;  3FUU A;  5J8Y C;  3HU3 A;  2ISP A;  4J9S A;  2DKL A;  1P3Q Q;  3UMC A;  1XWL A;  3FTC A;  2ZIX B;  2BCU A;  2DBY A;  1ZQW A;  3DFZ A;  4RPZ A;  1S10 A;  1S0N A;  5CR0 A;  3PSI A;  4IBJ A;  3KFU F;  5AK6 A;  8ICA A;  3FAH A;  2ZIV B;  4L6V 6;  5KG5 A;  4LF9 M;  1IFY A;  3GRY A;  4EBD A;  2FFJ A;  4ZH4 A;  1VDL A;  4YCX A;  3BQ0 A;  2KE7 A;  4BBA A;  4M0A A;  1BPD A;  2ZM6 M;  4NSO B;  5IIM A;  2BGW A;  1KSF X;  1JI7 A;  3AQF A;  4G4O A;  3SAW A;  4RZR A;  9ICA A;  1SL0 A;  5HR7 A;  8ICQ A;  2RQ5 A;  1C20 A;  3GPU A;  1QSL A;  5AHX A;  1A6S A;  3H8S A;  1R6B X;  4KLO A;  2LI6 A;  3VCB A;  1S8O A;  2ODG A;  2A5Y B;  3U6E A;  1Z5C A;  1X9W A;  1UPH A;  1Z1B A;  1SKW A;  3V76 A;  1VQ1 A;  4KLU A;  3W0F A;  3IEC A;  3H8M A;  5KG2 A;  5KFS A;  3JR5 A;  4LF4 M;  3NGD A;  3A45 A;  1TK0 A;  3HZJ A;  3GIM A;  3PV8 A;  3OGU A;  4IRK A;  1QAQ A;  2XY5 A;  1IXS A;  3ONN A;  1ZD3 A;  4NV0 A;  4OJO A;  4ED0 A;  4DUZ M;  5KL8 B;  2KHV A;  3QX7 A;  4NJ8 A;  4QWA A;  1U49 A;  3OJU A;  2LM4 A;  4DL3 A;  2Y0Q A;  2AH5 A;  3WHK A;  4LRS A;  8ICX A;  1XC9 A;  3U6D A;  2XLJ A;  3I04 M;  4IR9 A;  3AUO A;  2AU0 A;  4F2S A;  3ETR A;  4LRT A;  2J6U A;  4LJA A;  3T79 A;  1FIQ A;  3M7D A;  2PFQ A;  2LHG A;  2A1J A;  4FZN A;  2I6X A;  1N36 M;  2BCQ A;  1TK8 A;  2BZF A;  2EKK A;  1PJT A;  4RNA A;  2K4H A;  1DXS A;  2CEA A;  2P35 A;  2R8H A;  4FWH A;  3I01 M;  5C1B A;  4QZD A;  1Q39 A;  4EBC A;  2GLE A;  3KBB A;  3C2K A;  2L4F A;  2R8J A;  2M60 A;  3NUQ A;  2OH2 A;  2Y1J A;  2UVU A;  4UB8 U;  2V4Q A;  1ZQV A;  2WZJ A;  4AI6 A;  3IP4 B;  2ZXH A;  1UFZ A;  4KN7 A;  7ICI A;  4ED3 A;  1X66 A;  2DPI A;  1ZQS A;  5J2B A;  4DL4 A;  1ZQJ A;  4PGX A;  4X62 M;  2YTU A;  2R44 A;  3QAU A;  9ICO A;  1KTQ A;  5EWE A;  3WK5 A;  1DRG A;  1U47 A;  4I29 A;  3C9P A;  8ICV A;  2ZIU B;  5A0L A;  2EJS A;  4KIT B;  2V4R A;  1T43 A;  1ZQ1 C;  4MGK E;  4JV5 M;  1NHG C;  4P16 A;  4UB3 A;  1L8O A;  3EUB 2;  1SXE A;  2W9A A;  3AOG A;  3HX3 A;  1HQC A;  3GLF B;  2GNO A;  4DSK A;  2ERC A;  3LW5 F;  4DR4 M;  5HR6 A;  4M9J A;  2Y21 A;  1ZMW A;  5JI3 E;  5D49 A;  3LWL A;  1VLB A;  2RHF A;  3Q8R B;  5L1M A;  2H3I A;  4YN4 A;  5ALM A;  2KNJ A;  1DGS A;  1QDR A;  2IBK A;  4Y2R A;  8ICZ A;  5FTJ A;  1FO4 A;  5DGB A;  2APL A;  2YMM A;  2JUJ A;  4BLC A;  4KX3 A;  2VQF M;  3HIL A;  5KFT A;  1R2Y A;  2QB1 A;  2DAK A;  1D8B A;  2EQY A;  4DR7 M;  4Y28 F;  3IG5 A;  3UQ2 A;  2RDI A;  3TWM A;  3F5E A;  1TH2 A;  2RKO A;  1BPE A;  4BGD A;  1SL1 A;  5ITT A;  4CIS A;  2GQF A;  4KLS A;  1Z1V A;  4LJ5 A;  3PML A;  3QU5 A;  5AIB A;  1JQJ C;  3AOE C;  4R3D A;  4TUS A;  1LKY A;  1WXQ A;  4Y2J A;  4M9Z A;  4MGH A;  3BS7 A;  3Q8Q B;  4JUZ A;  3M9N B;  1VDV A;  5KFW A;  2UVV A;  1XB2 B;  1L3V A;  4C8K A;  1CRX A;  3L28 A;  2G09 A;  4CGZ A;  2DKX A;  1YZ6 A;  4B9L A;  4NXM M;  4KT0 F;  4QZA A;  4O5C A;  1LV7 A;  1IXZ A;  1TV9 A;  3U6L A;  2DPJ A;  3ICX A;  3TE6 A;  2GWS A;  3BS5 A;  1VDD A;  4AYB C;  3VK8 A;  4ED6 A;  1ZQI A;  4JI8 M;  2J7N A;  2CPR A;  3JPP A;  2AQ0 A;  3AV0 A;  3H4M A;  4LJ4 A;  1ECW A;  4K0K M;  4QHS A;  1NZB A;  1ZQF A;  5A2Q S;  5AKI A;  4Y2Y A;  4DOB A;  4MGI E;  5KFY A;  3PW4 A;  5CB1 A;  4AQY M;  3RF9 A;  2HOF A;  3K92 A;  4IBC A;  5ITY A;  1Q3B A;  5KT4 A;  1QUT A;  4GIB A;  1UCV A;  4IS7 A;  1OIP A;  3LCU A;  3HP6 A;  2YB1 A;  4O3P A;  4F2R A;  1SG9 A;  5AM1 A;  5DNY A;  2YX8 A;  4QIW F;  3C28 A;  4IJE A;  2KA6 B;  4QZF A;  5FLX S;  3I28 A;  2VQE M;  4RUA A;  3HJQ A;  2MRL A;  3VKG A;  3AFH A;  3CW2 C;  4Z6D A;  5KFC A;  5DB9 A;  1XMO M;  3UXO A;  4HEO A;  4XGI A;  1BPY A;  1QH9 A;  3ZDE A;  4Q8F A;  3TKA A;  3PST A;  1G8P A;  2OYY A;  1GKI A;  5ALF A;  2KSO A;  5ALU A;  5L1J A;  4LFB M;  5JI2 E;  5AM0 A;  2QHO B;  2VIX A;  8ICF A;  2DWL A;  4II7 A;  2F5Q A;  1N34 M;  3GLI A;  4FS2 A;  1DGJ A;  1KQQ A;  4MFC A;  4JI3 M;  3C3D A;  4J9R A;  1NK5 A;  3V72 A;  4YY3 M;  3IG8 A;  1S97 A;  1PZN A;  3C1Z A;  1R4G A;  1DK3 A;  2QAR A;  2FLL A;  3GV8 B;  2VJ5 A;  2LNH C;  1JRO A;  4EX7 A;  1RDF A;  1A0P A;  9ICG A;  2F8L A;  2KDL A;  2YMQ A;  3TWL A;  4US9 A;  1Q3V A;  1COK A;  4Y2P A;  3R9K A;  5KG1 A;  4J9O A;  5DG8 A;  2Z3X A;  4FCW A;  3GLF E;  5HML A;  2MAX A;  2DAE A;  1QAM A;  1XMQ M;  3IN5 A;  4GKK M;  3WK8 A;  2PMZ C;  4EIW A;  5IWA M;  4US8 A;  2WSE F;  5KO3 A;  1XNR M;  4P0Q A;  4LZG A;  1L2B A;  2LPE A;  4KLM A;  4IBB A;  5IIO A;  3BZK A;  2RGH A;  4EZ6 A;  4O5E A;  4NL4 H;  4Z8X A;  2UVW A;  4F1I A;  1L8Q A;  5HHI A;  4O0I A;  1SKS A;  2LM1 A;  3AN1 A;  4IQT A;  5ALW A;  4WP2 A;  4C80 A;  3B7N A;  3U6O A;  3VFD A;  1NV8 A;  3HGI A;  2JEI A;  3L27 A;  2A1A A;  1T3Q A;  2CHQ A;  4QOS A;  4GEW A;  1RYR A;  5IIJ A;  4PGQ A;  3GO8 A;  1N75 A;  3M6A A;  4NLC A;  2MUT A;  2PMZ F;  3GLH B;  5J0O A;  1HNX M;  1N5W A;  4J9P A;  3B7Z A;  4R64 A;  2MUT B;  2B0C A;  4RQ4 A;  5KFP A;  2KVS A;  2BWE A;  2F5S A;  3A46 A;  1RYS A;  1K5O A;  3KP1 E;  1HEK A;  4I2H A;  3RJI A;  2J6T A;  4I5S A;  4LJ9 A;  1OAI A;  3HWS A;  5KG6 A;  5IIN A;  2G0A A;  4UAZ A;  4CCH A;  3MDA A;  2D8C A;  2KZ3 A;  1QTM A;  1BNO A;  5EWF A;  4DL5 A;  4KLD A;  4GRI A;  3C3E A;  2EAN A;  2MR9 A;  3CNH A;  1DO2 A;  3ISD A;  2W8K A;  4QNR A;  4YFK A;  4OU7 A;  2M9N A;  1ZQG A;  2LHC A;  2XZF A;  4TUW A;  1ZD4 A;  1TFR A;  8ICC A;  2FI1 A;  4F4Y A;  3SAF A;  2UVR A;  8ICB A;  1Z4O A;  5KFL A;  3HJS A;  1L2D A;  2Y9T A;  2VII A;  4MF2 A;  4PL1 A;  3CF2 A;  3ZH9 B;  1RG6 A;  1R7R A;  5KAF U;  2W54 A;  3KZX A;  4M9N A;  1PM5 A;  1B0X A;  2FJ6 A;  1ZQT A;  5KG0 A;  2NV3 A;  3TAP A;  4UN2 B;  3FTE A;  3PW0 A;  1QDT A;  3MR5 A;  2YB4 A;  4AKI A;  1MC8 A;  3KOX E;  2W55 A;  7ICS A;  4NC6 A;  3S6J A;  4PHA A;  1Q3C A;  4ED1 A;  1T4G A;  1N48 A;  1X6I A;  3FUX A;  3H4J A;  4I2A A;  1P7D A;  1JX4 A;  4G4N A;  3RJJ A;  2Q4T A;  4UQG A;  2V1U A;  3HHX A;  3L4P A;  3FC4 A;  4UW9 A;  4DSE A;  3JR4 A;  3QYP A;  1S77 D;  1VEG A;  1DOQ A;  4YXJ A;  5DYG A;  4F5O A;  3NAS A;  3PSP A;  5EQT A;  1K3X A;  3EPI A;  3B0X A;  5KFH A;  2CRX A;  3SR6 A;  3K2L A;  2OWO A;  2XCA A;  1XXH E;  4I2J A;  1UT5 A;  2FPM A;  4YD2 A;  4X5V A;  4J03 A;  5KFF A;  5KNI A;  2LYA A;  2EZX A;  1Z00 A;  3NVY A;  3RH6 A;  7CAT A;  2KOB A;  1D2N A;  1Z4N A;  2NRZ A;  2XI9 A;  2HHQ A;  2L6O A;  1IN7 A;  4O3S A;  1TH4 A;  1OQY A;  3K8Z A;  2WF6 A;  4GC5 A;  2IMW P;  3BJY A;  5AK3 A;  3K9P A;  4LJ6 A;  4BXO A;  1ZXI A;  3UMG A;  4CF3 A; 
#chains in the Genus database with same CATH homology
 3VDU A;  2DF4 B;  1ZQ9 A;  3M0E A;  4A8E A;  3DOA A;  2R4E A;  1TDH A;  3DFZ A;  3ZC7 B;  3M6Z A;  2C99 A;  4FW9 A;  5T14 A;  3PSI A;  3CF6 E;  4IBJ A;  2XFT A;  4LF6 M;  2V1C A;  3UJN A;  2HOQ A;  2XVT A;  3KFU F;  1DGG A;  2ZIV B;  4IBK A;  2I7N A;  4LF9 M;  2H3F A;  1SZH A;  4ACO A;  3GRY A;  2FFJ A;  2UXB M;  4BBA A;  3PNY A;  2CE7 A;  3UK6 A;  3ZCB B;  5GKN A;  2KIW A;  4LGM A;  2QP9 X;  1X37 A;  2ZM6 M;  4NSO B;  5KQ8 A;  2LWX A;  1KSF X;  1SXJ B;  2CHG A;  4NRV A;  3AQF A;  4G4O A;  3GP1 A;  3SAW A;  3LQQ A;  1TDZ A;  5HR7 A;  1NHW C;  2KRU A;  3T38 A;  3GPU A;  3DA1 A;  1XC8 A;  1A6S A;  2HKJ A;  5KPZ A;  1R6B X;  3AL0 B;  2E1E A;  2YFQ A;  3B9P A;  2ZIV A;  3K1Z A;  2C98 A;  3VCB A;  2BJV A;  1NY5 A;  2A5Y B;  3U6E A;  1DO0 A;  1Z5C A;  1UPH A;  1Z1B A;  2KD1 A;  5ITX E;  2LKY A;  4BX9 C;  1R2Z A;  2CV1 A;  2EO2 A;  3H0M B;  3PSF A;  3W0F A;  3KP0 E;  1SXJ E;  2ZAN A;  2DWM A;  3JR5 A;  1IXS B;  4LF4 M;  3A45 A;  1GO3 F;  4MB7 A;  2LHT A;  3E9S A;  1PVQ A;  1QAQ A;  2KHQ A;  1E9R A;  4MM3 B;  2P5T A;  1YSY A;  3I4Y A;  4OJP A;  4B3T M;  3ONN A;  5KPR A;  4LFC M;  2R65 A;  4JI6 M;  4NV0 A;  1HIW A;  4OJO A;  1MA7 A;  3A98 B;  5E6J A;  4DUZ M;  4CRX A;  1NJG A;  2X4A A;  4DV1 M;  5KL8 B;  1OUQ A;  4X65 M;  5ITR A;  4DV6 M;  4L8R C;  2KHV A;  2C5R A;  1FNN A;  2KJ5 A;  4D81 A;  1W5T A;  2L09 A;  3VDP A;  1XXH B;  5ITQ A;  4DV7 M;  3KXE C;  1PJI A;  2Y0Q A;  1NSF A;  3WHK A;  4LRS A;  3VLF B;  1L1T A;  4NXN M;  3MJ5 A;  3SHG B;  4PDG A;  3U6D A;  1URJ A;  3KDS E;  2XLJ A;  1J5E M;  2KVC A;  2E5L M;  3RGP A;  1OFH A;  4LRT A;  4LJA A;  3T79 A;  4L4U A;  2XIC A;  3M7D A;  1NNU C;  1IN5 A;  4QJF B;  4FZN A;  3D8B A;  3HKZ F;  1HT2 E;  1N36 M;  1J7K A;  2HBJ A;  4KX5 A;  2D7E A;  1HNW M;  4LZJ A;  2Q2E B;  4RNA A;  3N7P D;  2K4H A;  2H1R A;  2YR0 A;  2F4V M;  5EP3 A;  1UM8 A;  2CEA A;  4QNM A;  2F5N A;  2UUB M;  2ZIU A;  1IY1 A;  4OO1 J;  5EP2 A;  2H3Q A;  2X8A A;  4JI1 M;  4FWH A;  3JAM S;  3KVW A;  3U6Q A;  2LBO A;  5C1B A;  4FD2 A;  1Q39 A;  1L2C A;  3O0F A;  1ED1 A;  3F53 A;  2DZN B;  2M60 A;  4DR2 M;  2VJ4 A;  3NUQ A;  2OH2 A;  1E32 A;  1GL6 A;  1IY2 A;  4JN6 A;  2LH0 A;  2ZIX A;  3SMS A;  3HU2 A;  3T1Y M;  1KYI A;  3FYC A;  4G6Z A;  2CV2 A;  2F5P A;  3AL0 C;  4AI6 A;  2ZXH A;  3IP4 B;  3Q8X A;  3SAS A;  5ITU A;  1IN4 A;  4B3S M;  4IIW A;  1E9S A;  3RGS A;  4Z6Y A;  4AKG A;  4O3M A;  1SXJ D;  2EA0 A;  4WJ3 B;  2OQ4 A;  4GHL A;  3J2P B;  3DEE A;  4AZF A;  4X62 M;  2UUA M;  3QAU A;  4HLQ A;  5F3W A;  4NLB A;  4DUY M;  3GQ5 A;  3FUW A;  4JI2 M;  1DRG A;  2CN1 A;  2W04 A;  2G8L A;  1IBM M;  1TAM A;  2ZIU B;  2G5H B;  5A0L A;  4CGY B;  3F2C A;  4P0P B;  3AOE A;  4QNL A;  3BOS A;  1ZQ1 C;  4MGK E;  4JV5 M;  3NBI A;  1NHG C;  2HCB A;  1QAO A;  2LXE A;  3FUT A;  2LYB A;  4P16 A;  1QVR A;  1T3T A;  4IBI A;  2W03 A;  2ZBK B;  5IZ7 D;  1G41 A;  3I4V A;  3AOG A;  2ZAO A;  3HKZ C;  2NQ8 C;  4G4R A;  1HQC A;  3GLF B;  3U61 B;  4IBD A;  2ERC A;  3SAT A;  4RF1 A;  4DR4 M;  5HR6 A;  1I4W A;  2Y21 A;  3GPX A;  5JI3 E;  4DR1 M;  2RHF A;  2FOI C;  1YUB A;  2K89 A;  2H3I A;  1YT3 A;  4CDG A;  4CHT B;  4JI4 M;  2KNJ A;  1XXH A;  2JH7 A;  3F2D A;  3FTF A;  3NWL A;  2K4I A;  2ZAM A;  4IBF A;  2DXI A;  4OJ6 A;  2Z7J A;  3SMV A;  4KOD A;  3TL4 X;  4DV0 M;  3W0L B;  5FTJ A;  1DGF A;  1N77 A;  2XSZ A;  5IRE B;  2X49 A;  3FD9 A;  4BLC A;  2R4J A;  4KX3 A;  2VQF M;  4W5W A;  5C0Y A;  1QZM A;  4IBG A;  2JA2 A;  3HJ8 A;  2G08 A;  4FE3 A;  2XH9 A;  3GQ4 A;  4PCZ A;  1R2Y A;  1D8B A;  1TGU A;  3LVV A;  4DR7 M;  1XNS A;  3IG5 A;  3LMM A;  3TWM A;  2Z4S A;  3F5E A;  3L2A A;  1TH2 A;  2ZIW A;  2RKO A;  4QOZ C;  2HL7 A;  4KO8 A;  2H3V A;  1Z19 A;  5ITT A;  1KBU A;  4CIS A;  4AG6 A;  2KJ9 A;  1Z5B A;  4IJF A;  2G5G X;  4LJ5 A;  1IM2 A;  3MK6 A;  1JQJ C;  4FCV A;  3AOE C;  4I81 A;  4R3D A;  1N32 M;  1WXQ A;  4B08 A;  4M9Z A;  2DHR A;  3KS4 A;  4MGH A;  2EUC A;  3OPX A;  3CTW B;  5BR8 M;  4LZZ A;  2CHV A;  3UMM A;  3AKZ A;  3E0F A;  2OM6 A;  5CRX A;  1IIP A;  2R18 A;  3SBJ A;  5FSW A;  2R45 A;  2XSZ D;  4PDI A;  2F2A B;  1CRX A;  3D2S A;  2D6F C;  3PVS A;  2DVW B;  3L28 A;  2Y20 A;  4DV5 M;  4JI5 M;  2G09 A;  3F5A A;  4CGZ A;  4OJL A;  2BNK A;  3U6S A;  3C29 A;  4IC9 A;  4B3R M;  2L7H A;  4NWI A;  4IBE A;  4M0W A;  4NXM M;  2DGZ A;  5KPT A;  2OPF A;  4DR6 M;  4LF5 M;  1K82 A;  1TH3 A;  4DV2 M;  1LV7 A;  2UU9 M;  2O5R A;  1IXZ A;  4A3V B;  4GH9 A;  3E4R A;  5EP4 A;  3U6L A;  3ICX A;  3GPP A;  3KSJ A;  3AQE A;  2DWZ B;  3TE6 A;  1VDD A;  4HL4 A;  4AYB F;  1GLN A;  4C0Z A;  4AYB C;  2K4E A;  3FUV A;  3SYK A;  4DR3 M;  3VK8 A;  4WW0 A;  4JI8 M;  4FWD A;  2J7N A;  4OW0 A;  2CPR A;  1Q3U A;  2RP5 A;  3AV0 A;  3H4M A;  4S12 A;  4BB9 A;  2DZO B;  4LJ4 A;  1NNJ A;  1ECW A;  4K0K M;  4QHS A;  2WB1 F;  2V6Z M;  4GFJ A;  2ZXI A;  2W82 A;  1NZB A;  2D7G A;  2Y0T A;  2L7I A;  3I51 A;  4FZL A;  3KFU G;  3CP8 A;  4U7C A;  5A2Q S;  3H0L B;  3N7R C;  4MGI E;  3J7A S;  4AQY M;  3RF9 A;  2HOF A;  3K92 A;  4IBC A;  4KLN A;  1N33 M;  5ITY A;  1Q3B A;  4AW4 A;  4NOO B;  4NRW A;  3N7S C;  2KKV A;  3SMP A;  1DGH A;  8CAT A;  2DWN A;  4MGZ E;  3CRX A;  4AG5 A;  3VKH A;  2YB1 A;  3U6C A;  3GLG B;  4I4L A;  2DQN B;  5DNY A;  4X64 M;  2JMG A;  2YX8 A;  4QIW F;  1QQW A;  4IJE A;  4BUG A;  3C28 A;  2KA6 B;  2WAQ F;  2C9O A;  5EXS A;  3GLF A;  5DYI A;  5FLX S;  3ILK A;  2VQE M;  2KW0 A;  4B7H A;  4OVZ B;  4OVZ A;  3HJQ A;  3WHL A;  3VKG A;  3AFH A;  2MRL A;  2K47 A;  2QCU A;  1XMO M;  2VKQ A;  2XID A;  4XGI A;  4ZPX A;  4P0Q B;  4MH0 E;  3PST A;  1G8P A;  2OYY A;  1L6N A;  1GKI A;  4LCB A;  3GLG A;  3EIH A;  2QZ4 A;  4LFB M;  5JI2 E;  1JR3 A;  2Y0S F;  3SAU A;  2XF3 A;  2Y0S C;  2K8B B;  4FWG A;  2VIX A;  2KEB A;  3J80 S;  2DWL A;  4II7 A;  4QHT A;  2F5Q A;  4LY6 A;  4OX9 M;  3OTO M;  1N34 M;  3GLI A;  2G5I B;  2M0N A;  4JI3 M;  3PXG A;  3K1J A;  1GL7 A;  2C9C A;  4YY3 M;  3IG8 A;  4FCT A;  3SHF A;  2HBK A;  3KOY E;  4B7F A;  3GLI B;  2FNA A;  2HHH M;  2K8C B;  3U5Z B;  2VJ5 A;  2LNH C;  2HBL A;  1A0P A;  2F8L A;  3A42 A;  3HHY A;  3TWL A;  4LG2 A;  1Q3V A;  3D8L A;  3NRW A;  2I7P A;  1HT1 E;  2Z3X A;  1NJF A;  4FCW A;  2KZS A;  3KW6 A;  2F77 X;  5KQD A;  1Z6T A;  1IN8 A;  1MU5 A;  1QAM A;  1S3S A;  1XMQ M;  3IN5 A;  1SXJ C;  4LF8 M;  4GKK M;  5BPV A;  4EIW A;  5IWA M;  4DR5 M;  2PMZ C;  5KO3 A;  1XNR M;  4JI7 M;  4P0Q A;  1IBL M;  2A3V A;  5EJC A;  1L2B A;  4ICA A;  1MX0 A;  4IBB A;  1G4A E;  2RGH A;  2WB1 C;  1I94 M;  2G07 A;  4R7G A;  2HOI A;  3KSX A;  4NL4 H;  5LMU M;  1XO0 A;  4Z8X A;  5FTK A;  3PZP A;  2E1F A;  1L8Q A;  3ALR A;  3D2N A;  3SAH A;  4GIP A;  3FKE A;  3U6O A;  3HHZ A;  3VFD A;  1HR0 M;  3HGI A;  4KMO B;  1DGH B;  1N78 A;  1GVN A;  2AHM A;  3L27 A;  5ITX A;  4LJ7 A;  2CHQ A;  4QOS A;  2HBM A;  3MHV C;  1OJL A;  3VK7 A;  1XNQ M;  1PJJ A;  2CV0 A;  1DGB A;  3SQI A;  3RE8 A;  3GO8 A;  4QIW C;  2ZIW B;  3R9X B;  1N75 A;  1IY0 A;  3M6A A;  2H3Z A;  4NLC A;  3M6K A;  2PMZ F;  5FTN A;  3GLH B;  3HHW A;  1XHB A;  2D7H A;  1HNX M;  2K8A A;  4XBO A;  5FTM A;  5EXT A;  1YE9 A;  4RF0 A;  2KIC A;  2RRD A;  5EXX A;  3GLH A;  2F76 X;  3PFI A;  4PL2 A;  4M9X A;  1NVM A;  4OJ5 A;  3SFZ A;  2E5S A;  3PNV A;  3M7G A;  3GRU A;  4GC9 A;  4G4Q A;  2F5S A;  1J09 A;  3MGV A;  4FVM A;  3A46 A;  1QAN A;  3AJI B;  3GRR A;  4JI0 M;  2W7O A;  2R62 A;  4L78 A;  3KP1 E;  1HEK A;  4REZ A;  4LGY A;  3CYM A;  3TQS A;  3J7B A;  4I5S A;  4LJ9 A;  1Z5A A;  4GHA A;  1L1Z A;  4PT5 A;  3HWS A;  3SAR A;  3HKP A;  2G0A A;  4PD2 A;  2CUZ A;  2KEY A;  3D2Q A;  2C96 A;  1Z59 A;  4GRI A;  3FTD A;  1SXJ A;  5EP1 A;  3RFW A;  2Z4R A;  3T1H M;  3SYL A;  1T94 A;  1DO2 A;  3J27 B;  4GMQ A;  4QNR A;  2KRK A;  3L25 A;  1WUD A;  2YQZ A;  4OU7 A;  3FYD A;  2UUC M;  2XZF A;  3R8F A;  1HQY E;  4JXJ A;  3J81 S;  4TUW A;  4P0P A;  1K3W A;  4JYA M;  3L26 A;  2JHD A;  4L16 A;  4KHP M;  2GH1 A;  3QWL A;  3SAF A;  4YHH M;  2G06 A;  4B7G A;  2ZIX B;  3HJS A;  1L2D A;  3SAG A;  4U6P A;  1E94 E;  2XZU A;  2ZG6 A;  2YNM D;  2N1R A;  2VII A;  3GRV A;  5EXP A;  3U5Z A;  4L15 A;  3U6P A;  3CF2 A;  2WAQ C;  3ZH9 B;  4PL1 A;  2JGA A;  1R7R A;  2GOL A;  3KZX A;  2KZU A;  4FZM A;  2FE8 A;  1PM5 A;  3LQR A;  1IBK M;  1IQP A;  2QBY B;  2MA1 A;  4MGY E;  2KXE A;  1C1K A;  4LJ8 A;  4D80 A;  2NV3 A;  1PVP A;  1EE8 A;  1IXR C;  3FTE A;  1HNZ M;  2YB4 A;  4AKI A;  4GKJ M;  3KOX E;  1NY6 A;  3KOW E;  1Q3C A;  4I8O A;  4B3M M;  3L3F X;  2QPA A;  3KOZ E;  3U6M A;  1ORY B;  4ITQ A;  2KJ8 A;  2QEN A;  5E26 A;  5KL1 B;  2BJW A;  1OFI A;  3FUX A;  4LF7 M;  5FTL A;  1P7D A;  3L29 A;  5LMN M;  4G4N A;  3THG A;  5C18 A;  3U60 A;  3LYS A;  1PVR A;  1ZAE A;  3TPZ A;  2Q4T A;  2V1U A;  2OXO A;  3RFA A;  3GQ3 A;  3KS8 A;  3HHX A;  2BDU A;  1G59 A;  1KFV A;  2JH1 A;  3JR4 A;  4WUR A;  3U61 A;  3DZD A;  2CFO A;  3T15 A;  1H6U A;  2UXC M;  3H0R B;  5DYG A;  4DV3 M;  2W7P A;  3PSP A;  1QYR A;  4D82 A;  5EQT A;  4BJQ A;  1IN6 A;  2HMX A;  1W5S A;  1K3X A;  1XWI A;  3SC3 A;  3EIE A;  3UGJ A;  2CRX A;  3K2L A;  4DV4 M;  1G3I A;  3GPY A;  2F5O A;  4X66 M;  3U60 B;  3UZU A;  3HU1 A;  4M0D A;  2LYA A;  2M5Z A;  2UXD M;  2XGN A;  7CAT A;  2KOB A;  1D2N A;  2XFS A;  3CF0 A;  2XI9 A;  2L6O A;  1IN7 A;  2J7O A;  1TH4 A;  2KKP A;  2KV2 A;  2RGO A;  4NSR A;  3GU3 A;  1F44 A;  3K8Z A;  1JR3 D;  3GZF A;  4GC5 A;  4LFA M;  3SAV A;  4M9S A;  3LVW A;  4AKH A;  3C58 A;  4LJ6 A;  2R46 A;  4JMU A;  5IT9 S;  3TWK A;  2QBY A;  3FUU A;  3HU3 A;  3F2B A;  5H37 D;  3VC8 A;  2XEP A;  1FJG M;  4GIT A;  3FTC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...