2Z7JA

Structural insights into de multifunctional vp3 protein of birnaviruses:gold derivative
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
125
structure length
125
Chain Sequence
AQREKDTRISKKMETMGIYFATPEWVALNGHRGPSPGQLKYWQNTREIPDPNEDYLDYVHAEKSRLASEEQILRAATSIYGAPGQAEPPQAFIDEVAKVYEINHGRGPNQEQMKDLLLTAMEMKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid assembly protein VP3
publication title Structural insights into the multifunctional protein VP3 of birnaviruses.
pubmed doi rcsb
source organism Infectious bursal disease virus
molecule tags Viral protein
total genus 44
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2007-08-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.880 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2z7jA02
1.10.150.620 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2z7jA01
2R18A 2Z7JA
chains in the Genus database with same CATH superfamily
3SENA 3C28A 3OSNA 1Y8GA 4F4KA 1JXLA 3NVWA 2UUAM 3RBEA 5F3XB 4NL4H 3SC3A 2MJ5B 4CE6A 5AK6A 5D4BA 1X6JA 2K8AA 1KEJA 2NRZA 1ZQSA 2ZBKB 1JQJC 2IBKA 4ELUA 3ZDAA 1HEKA 1S5LU 3AFHA 4LF4M 1W5TA 2WF9A 3RAXA 3QYBA 4CISA 4S12A 5AKKA 4IQVA 3JR4A 4I2BA 1PZNA 5AKYA 2JXNA 4PPXA 4M47A 3FUVA 4KX3A 4DBGB 4I2AA 1C7YA 4P0PA 2Y9UA 1ZQMA 5AKHA 3MFHA 1QTMA 2PFPA 2QBYA 1EE8A 4F5PA 1ZQKA 4Z6CA 1YT3A 4UN2B 4D80A 4CGYB 2ZIWB 1NJXA 3B74A 5AKLA 4GITA 1X9XA 1WYGA 4LRTA 2I1QA 2MU2A 1JXEA 4TQRA 2QHOB 4P4OA 4GIPA 3RH6A 2C2EA 4GXJA 4UARA 5ALRA 3KHLA 2RDJA 1ZQXA 2YMLA 4B9LA 4DLGA 2DZNB 1T8EA 2R18A 3KKAA 5J0XA 2KP7A 5L8RF 4HL4A 1N62A 3GLIE 3R9KA 1L1ZA 2JV3A 4MF2A 1VEGA 3LQRA 5IIJA 5KAIU 4I2GA 3T5LA 2RGOA 1D8LA 3QX7A 1XO1A 3SYZA 4EYIB 3RJIA 2H5XA 4EBDA 2NRTA 2EKFA 2X8AA 1WXQA 2DAEA 5J0PA 3GPYA 1T6OA 3W68A 2E5SA 2J5YA 1XWLA 3MHVC 3RGPA 2JY6B 4DF8A 4DR3M 3KZIU 1TK5A 2AU0A 1TK0A 5KFXA 3PMNA 2BCRA 3Q8MA 3KKAC 3A0BU 5KG7A 1H6UA 5GTHU 4QZ9A 1SV0A 4PHPA 2KVSA 3U6LA 4YMOA 4US8A 4I2HA 3KOXE 3J81j 3M7GA 2Z8YM 3UK6A 4DUYM 4C4TA 1L5UA 4DQIA 3WK5A 4DR2M 1SXJA 5KFWA 3HHZA 4PJ0U 4D81A 1ZQ9A 4IRDA 3WKAA 3PV8A 2N1RA 3M9NB 5L1IA 2EANA 4YXJA 1I94M 4DR5M 4LJ7A 4YY3M 2Z4SA 2W7OA 2KRUA 2KTQA 3H8WA 3SQIA 3RFAA 1S97A 5ALMA 1L2DA 1M6YA 3SAWA 3SR6A 4DCCA 1D9FA 1SV0C 2NV3A 2B3TA 3CW2C 4KLJA 1X6IA 4KN7A 5ALWA 4AP9A 1IG6A 2ZXHA 1K3WA 3R8FA 2HOIA 3HJSA 2YFQA 2C98A 2MR9A 4GC5A 4ECUA 5DLFA 1NJWA 1DV0A 2YN4A 4PGXA 1ZQLA 1SXJC 3AQFA 3UGJA 1ZQVA 1CUKA 3HJ8A 2PMZF 1ORYB 2HWJA 3U61B 5ALSA 1VDLA 4JI5M 2FE8A 1GJTA 1ZAEA 4EYHB 5AI5A 2F5NA 4B9VA 3SAHA 2C9CA 1L3VA 1VEKA 2K9DA 4ZOHC 9ICSA 3UQ2A 2LBCA 5F9LA 2BJVA 3Q8QB 2WF8A 4LRSA 4PL1A 5CP2A 8ICEA 2HBLA 4Y2RA 3NVZA 4UAUA 4Y2JA 3TL4X 1GO3F 2BZFA 5FP0A 5DQHA 4HEOA 2D3DA 3TAQA 2EAOA 1JIHA 5J2GA 4BXOB 4IBFA 5LMUM 1OJLA 2ASJA 4RNNA 1IN4A 1OAOC 2F5SA 2XEPA 4IBBA 4DOBA 2DAGA 4ECQA 4C8NA 5KG6A 4IJFA 2JA2A 1G8PA 5TZVA 3CGWA 3QYPA 2FLLA 2W54A 2J7OA 1J5EM 4PDIA 4NXNM 3GQ3A 2G3QA 4JMUA 2ERCA 2L6OA 5EE0A 4DV3M 3GV7B 3GV8B 2OOBA 2KV2A 5IILA 3AOEC 3T6PA 2CXYA 3NTUA 1L8LA 3RJHA 2CHQA 3QNMA 3H8SA 2L4FA 2H3QA 3OGUA 3K4GA 1L7PA 2F44A 1RU3A 3ZDBA 5KFBA 1NOMA 2YNMD 2DHRA 2CV0A 3QU2A 4C8OA 3RRGA 4F72A 7CATA 1S0NA 5AK5A 4EBCA 3L25A 3KS4A 3BZCA 1QAQA 5EE9A 2JZBA 4OX9M 1ZD2P 4R64A 1WG8A 2W9MA 1QSSA 1C20A 1XSLA 3SI8A 1N5XA 2G06A 4EELA 3B89A 3H40A 1BGXT 4I29A 3EIEA 4M6WA 1K3XA 3U6SA 1EXNA 2EO2A 5L1MA 5IIOA 4L8RC 5J0OA 5KFJA 1XSPA 2XZUA 5BR8M 1TR8A 3SMVA 2G0AA 7ICTA 4FCWA 5FLXS 3N7PD 4IBGA 1X42A 4IBKA 1DGGA 4BJQA 1DGBA 3QWLA 2VF7A 4MGHA 3T38A 2H3FA 3A46A 4X5VA 1FJGM 2JNHA 3Q8PB 4QWDA 4C80A 4ED2A 2OOAA 1TAMA 4ECYA 2R65A 3WU2U 1URJA 4II7A 4XBOA 4M9LA 4I2DA 4HYKA 1ZOLA 3QUQA 4QHTA 4CGZA 1WIVA 4DR7M 4LJ9A 4DUZM 3HX0A 1SL2A 2BCQA 2AXTU 2W11A 5KFAA 1T94A 3MK6A 2E3TA 5KFLA 1EIJA 1AROP 1UFZA 3ZCBB 3BS5A 4WJ3B 2FPLA 1A5TA 3TAPA 3GILA 1SXDA 5IIIA 4OCZA 1PK1A 1Z4NA 2IHNA 2V1UA 2DZLA 3SAGA 2ZG6A 8ICZA 4NWIA 3TFRA 2F8LA 1PUZA 2PI5A 3FDSA 4GRIA 3DDHA 1UT5A 1PJQA 2OPFA 4DSEA 4AKGA 3H4JA 4RT3A 3BZKA 2ODGA 4JWMA 1PM5A 3UM9A 2KRKA 4J9PA 4IQWA 4DR6M 3PW4A 3NWLA 4RPZA 3I01M 1RXVA 3VC8A 5BOMA 3NVYA 1PJSA 4JXJA 5ITXA 4QNMA 3PSTA 3QU7A 1SG9A 4YVZA 1YZ7A 9ICVA 2R0IA 2LYAA 1V92A 3ZI4A 1BVSA 3NBIA 2W3SA 7ICKA 4KX5A 3JPSA 4M9ZA 4KO8A 3DV9A 1OXJA 2QKQA 2R62A 4IR9A 3D6JA 1L3TA 2Y20A 7ICMA 3PO5A 4BLCA 2CV2A 4UAYA 8ICWA 3KOWE 1V34A 1X66A 1RPLA 2W82A 3QZ7A 2OM6A 2MH8A 2MSNA 2MRLA 1ZQPA 2YQEA 5HHHA 4KLGA 3EIHA 1WWVA 3NBXX 2BR0A 5L9XA 4KLTA 3SHFA 1U49A 1ZQZA 1U47A 4ITQA 1SKSA 2WB1C 2WZJA 2KVCA 4DSJA 1ZJMA 2DWMA 1IFYA 3TACB 5ALKA 4DFDA 4DV7M 2QENA 5FTNA 4DSKA 5EQTA 1KW4A 5FTKA 2V1CA 1N36M 4G6ZA 3MFIA 2CHGA 3FTEA 1WWUA 2D7EA 1YE9A 3F92A 4MFFA 1OW5A 3BXWA 1JROA 2K60A 3KW6A 2GNOA 1DGFA 3I4YA 4UBBA 1L8QA 5IREB 3LCUA 2LKYA 3CF6E 2W7PA 2KHHA 4RQ5A 2FLPA 1MSWD 1NK4A 1J2NA 2H3VA 2LM1A 2LHCA 2QPAA 1PVPA 3IRUA 3LYSA 5KFFA 1FFVA 2XY5A 7ICNA 3CRXA 2L7HA 3SMSA 1O08A 3ZDEA 4JB3A 4RQ0A 2BDPA 3BBZA 2XGQA 3M6ZA 9ICNA 1SKWA 1KSPA 4KODA 2KEYA 1IXSA 2F5PA 2W8KA 4F91B 5JU5A 3U6QA 1PRBA 3CNHA 3RH5A 5AM3A 4LGMA 2HHVA 4LF7M 2WAQF 2CWBA 1LB2B 4LJ6A 2XI9A 5EWFA 1KN5A 2AQ0A 3JPQA 2I9GA 2DFLA 4C7ZA 3QEAZ 1QQWA 3A45A 1L6NA 4JUZA 5DB6A 1AUAA 1QH9A 4F5OA 1Q3VA 3GLGA 2ZAMA 2QLTA 3PNVA 3V6HA 4RT2A 2ALZA 4BUGA 3I51A 1S76D 3RGSA 4FO6A 2W9CB 3RBDA 2LHTA 2IOHA 3THGA 4XQ8A 4JV0A 3ED5A 1ZD5A 3MC1A 7ICUA 4LZDA 3K1ZA 4AKHA 3RAQA 4LFAM 3NVVA 1IBLM 3PO4A 4E0DA 2AHMA 2LBOA 1B43A 3DFZA 2Y9TA 2A1JA 4WW0A 3MGHA 3TQSA 2OQ4A 2VJ4A 4B9MA 2HHSA 3GPUA 3K9OA 2VA8A 4GKKM 2K6BA 1MQ2A 8ICHA 1K82A 1G3IA 2W9CA 3KOYE 4ECTA 3BQTA 1V97A 4AG5A 2FMSA 3IHQB 4QZIA 4YR0A 4P0QA 2ATLA 4QZGA 4AQYM 1B0XA 1DK2A 1KL9A 3UQ0A 1E94E 1L7OA 3C21A 1ZQFA 2OYYA 3GRYA 1S0OA 4QHSA 4KLUA 2QARB 3OHAA 4NOOB 2GLEA 4KLFA 3GIIA 2CRXA 2WSFF 4MGYE 3IECA 2E8MA 5B66U 2ESEA 1GVNA 4F2SA 4LFCM 4QWBA 3TPZA 4DFPA 2C99A 3QU5A 2L5YA 5KG0A 4G3OA 4CJ6A 2QB0A 3BJYA 2CEAA 1L1TA 4JWNA 3H0LB 4NLCA 8ICBA 5EP2A 1GO5A 4YMMA 1D2NA 1WUDA 4RQ4A 5ALUA 5F9NA 8ICRA 2ZUDA 1ZQYA 3PFIA 4JV1A 5CR0A 1BPZA 5IT9S 5J2AA 3HHWA 2UVWA 4R3DA 2KA6B 7ICEA 5DG9A 3KFUG 4AKIA 2K8BB 2RHFA 7ICRA 2KIVA 4G3IA 1S0MA 1U45A 4J9KA 2XFSA 4OJ6A 4DV5M 8ICLA 5KNIA 4OJPA 1ZQEA 3QYEA 2IHMA 2QB1A 4J9NA 5ALNA 1SZHA 4DQQA 5J8YC 5J2EA 3FYDA 5ITYA 5ALOA 1XC8A 3U5ZB 4PZOA 2F5QA 4DL2A 2H3ZA 2KXEA 3A98B 4DR1M 5KQ8A 1L8OA 3IG5A 2HBKA 8ICSA 2DKZA 3I4VA 3EZ5A 4FD2A 1RYSA 3Q8XA 4NL9A 5J2CA 4LJ8A 9ICIA 1Z5CA 3QZ8A 4J9QA 5KG1A 4AYBC 4DV6M 5DG8A 4P0PB 1XMOM 1QZMA 4CIZA 1IN8A 2DKXA 3V7LA 2QBYB 3PX4A 2DXIA 3SV3A 3MR2A 5AKZA 2NQ8C 2HCFA 3EPGA 3C2LA 3U5ZA 1BPDA 2GO7A 4PCZA 3ZC7B 3GLHA 1D0LA 4MEXA 1A6SA 3HP6A 3GLFB 1T7PA 2FH0A 1NKBA 2BCSA 9ICFA 2W9BA 1NNJA 1PGYA 2IOFA 4AI6A 4DS4A 1VDDA 4IBDA 3KZXA 1G41A 3EW9A 3K75D 4NL9C 1S10A 1JR3A 7ICOA 4JV2A 5KL8B 4X62M 1K5OA 1MC8A 1QQ7A 4I2CA 1DOQA 4Z6YA 3RTVA 3N4MB 1UHUA 3U6CA 4FVMA 4B3TM 2FS1A 3TQ1A 3L27A 1XSNA 1A77A 2YQZA 3BQ1A 4B3SM 2B21A 4YMNA 1NKEA 9ICRA 1OQYA 4BBAA 3HJEA 2VDBB 2VQFM 2C2DA 2HSZA 4UB5A 3GLFA 4UB8U 4DV2M 3RRHA 1X9WA 4CNQA 4ECXA 1RYRA 1KTQA 3M0EA 1PJJA 4TUPA 5ALEA 3J2PB 2AGQA 2XH9A 2E1FA 1ZQRA 8ICIA 4O3NA 3SATA 1JUDA 4NLKA 3HY5A 1LKYB 4ZH4A 5DKWA 4RQ8A 2CHVA 3H4MA 2R8KA 3L28A 4I2JA 2MA1A 4J9MA 3HU2A 5ITRA 5ITXE 4F5RA 3PW7A 3KD3A 5KFZA 1KBUA 3F2CA 4Z6FA 5EP3A 1X9SA 5KG2A 4Y2UA 4QZEA 1SXJB 2ZIXA 4F5NA 3E2EA 3K8ZA 5E6JA 3U60B 4DFMA 1HUOA 3DEEA 1XXHB 9ICHA 2KNVA 1KDHA 4UW9A 3VDPA 3ALRA 1LKYA 2ZJ5A 8ICUA 4B08A 1O03A 1FIQA 3IV6A 5KPRA 4KT0F 2E5LM 1F0MA 5KFMA 1KFVA 1Z1BA 2G07A 5DB8A 2L2DA 1R2YA 2NYVA 3MDAA 1UCVA 4NSRA 4NLBA 3LCVB 5GTIU 3AL0C 1TDHA 1XWIA 4FW9A 1XNSA 4U6PA 1XB2B 3KSXA 3K9PA 5AI0A 2LVOC 5KT4A 1NY6A 2MROB 3U60A 2WF7A 3JPRA 4FBTA 1SL0A 3H4DA 1XXHA 2LHGA 3GPXA 3HKPA 3AN1A 5EXTA 2CPRA 2KZ3A 3GU3A 4Q8EA 1J09A 4DO9A 1KFTA 2I7PA 5C5JA 1C1KA 5ALXA 3MGIA 1NK9A 5DGAA 2F76X 3E9SA 3MMPA 4RNOA 3C5FA 4NLZA 4TQSA 3T1HM 3GIMA 2KEBA 2EZXA 2BDUA 3GRUA 3GDXA 3N97B 5KFPA 2J7NA 5ALGA 1DGHA 2EDUA 3B9PA 3V76A 4Y2VA 2DWZB 2PKEA 2ZJAA 1SV4A 4R63A 2XSZD 3K1RB 3D2QA 5KT3A 4GC9A 3WK8A 5ITQA 4ED6A 3B7NA 5KAFU 3KHRA 4KLSA 1L3SA 5ALVA 1IY2A 3CF0A 5TISU 7ICFA 5J2DA 4MM3B 2RP5A 4XK8F 3ONNA 3NRZA 3L29A 2W3RA 3O0FA 2JEIA 1EFUB 4EEYA 4I28A 4IC9A 1A0PA 5KFHA 2JEJA 1WJ7A 9ICCA 4EX6A 5KFDA 4EENA 4LVSA 1HUZA 3WKDA 3OTOM 5FSWA 2J6TA 3N7SC 2R46A 1FNNA 1TTEA 2JY7A 3HU1A 1ZQIA 2EZZA 5J0YA 1J2MA 1JI7A 1SIJA 4ED3A 1D0MA 2L09A 3AOEA 1B22A 5J0RA 1BPEA 4R65A 5KFEA 1Z6TA 2HVHA 2ISPA 3UZUA 3VLFB 4Y2XA 2E8PA 5J0SA 9ICXA 1XC9A 4C0ZA 1NI3A 3SEIA 4QOZC 1S0VA 4UQGA 1N48A 3M8SA 2R6FA 1PVQA 2PFNA 2YR0A 5EP4A 3SYKA 4YFKA 4QZBA 3KHGA 4LF5M 4K4GA 2HOQA 4B3MM 2JZBB 1V85A 4J9OA 4DOCA 1SZPA 2XZFA 2WF5A 4DSIA 5DQGA 9ICAA 3RB0A 5ALLA 3HPOA 4MF8A 3WKCA 1JRPA 4M6WB 4ED0A 3BS7A 1ZQUA 1G71A 3DZDA 3BOSA 5KT2A 3C3EA 1HNZM 3H8MA 3NGDA 2DWNA 4QW9A 7ICPA 2K0BX 8ICPA 4F4WA 2VQEM 2YY6A 3NRWA 3C1ZA 1T3NA 1U48A 3H0MB 5JI3E 2XICA 2M60A 4KLHA 1DO2A 1VEJA 4DL4A 2JZ0A 1QLNA 1WCNA 4RQMA 2BQ3A 4IBEA 4PDGA 4FWDA 4KMUA 1LVHA 1IXRC 4Z8XA 1ZJNA 1ZQBA 1XNQM 2K47A 4NSOB 3M7DA 1JX4A 4MB7A 5ALYA 3M8RA 3JAMS 3LWMA 3OPXA 1PVRA 4Y28F 2M0NA 3M6AA 3WK7A 3KS8A 3EUB2 2DQNB 1NKCA 5FTLA 1OFHA 2C96A 2KJ8A 5HR6A 2DI0A 4US9A 5L1JA 3ZQJA 1R6BX 3U6EA 5AI4A 3ILKA 5JRTA 1L7MA 2R8HA 5CJ7A 1U4BA 2JH7A 5KT6A 4TUQA 9ICJA 3B9JA 4YR3A 4IRCA 3KVWA 3AV0A 3W0LB 7ICGA 1Z3EB 1ZQGA 3CYMA 3B0XA 4KLDA 2YMQA 2UXBM 3BS5B 4I2IA 2CP8A 2WB1F 4KITB 3SAFA 4RKUF 1TGUA 4B7FA 1NV8A 4G4QA 3J81S 1PK1B 5G5GA 3MR3A 3PX6A 2DAIA 2FDRA 2J6SA 2Q2EB 3GIJA 4O0IA 4HLQA 1NJZA 1YUBA 4KLLA 1L2BA 2EUCA 2F1JA 8ICAA 2Z4RA 5FTJA 4LZGA 2LYBA 2E8NA 4QOSA 3U6OA 1N63A 1QQ6A 3V7KA 2H3IA 1QCKA 4BB9A 1ZQDA 4P4MA 5J2HA 1JALA 5KFGA 2JUJA 2FNAA 2XO7A 5HR7A 5DB7A 3LK9A 1F5SA 5DBAA 1B4FA 5KG4A 2VIXA 4YG2A 5KFRA 2W8LA 4A3VB 4UB1A 3PVSA 3WK9A 2I6XA 9ICOA 3G6VA 3ETRA 1L3UA 2BPGA 4FS1A 1TFRA 1BPBA 2G5HB 2Y1JA 5IZ7D 2GWSA 1WR1B 2KE7A 9ICPA 2MAXA 3UMGA 1D0KA 5CWRA 4EEKA 2A3VA 2LTUA 2KKVA 5JI2E 1PJIA 4FE3A 3V6KA 4ZPXA 4DF4A 2KZUA 3C2KA 5AKIA 2KZMA 4I2FA 5DBCA 1TK8A 4DQPA 4NY8A 1JR3E 2V4QA 2AQ4A 3FTFA 1VLBA 2C22A 4KLOA 8ICKA 5DDMA 2VIIA 3THVA 4B9NA 1NK5A 3FUXA 3DA1A 5AM5A 3WHKA 1XMQM 3J7AS 2Q0ZX 4ECWA 5A2QS 3ZD8A 4DS5A 1MQ3A 3V6JA 3GLIA 3D2NA 3GLFE 3M9MB 2KNAA 3UJNA 3M9OB 1QDRA 1RM6C 5G5HA 2KHQA 3L5KA 3KP1E 4GXIA 5EWEA 3SMPA 4QW8A 5DG7A 1N56A 4LF9M 1UT8A 1JR3D 3JPPA 2HHUA 4DL6A 3GRRA 4QWCA 4RQ2A 5KTQA 2YMPA 3HZJA 4C8LA 1G4AE 4DR4M 1D8YA 3SAVA 2DPIA 5KFYA 3ISDA 3HGIA 2C2RA 3H4BA 1DGSA 1ZQTA 2LH0A 3SASA 2KSOA 4O3SA 1S8OA 1MN8A 3RB3A 3JR5A 4GMQA 1ZQNA 1QZEA 4Y2TA 4PH5A 9ICTA 1QYRA 1JB0F 2DWQA 4NV0A 2VA3A 4IRKA 4KMOB 5ALDA 5DBBA 4BWMA 5IWAM 2LXEA 4P16A 5KO3A 1N60A 5KFUA 5ALIA 3L4PA 4B3RM 1OKSA 2JMGA 2QZ4A 4PGYA 2DWLA 3FYCA 5KFKA 3RJFA 1IXSB 1N33M 4FBUA 2K4EA 5J29A 4O3QA 4M9XA 8ICCA 4MGIE 4L16A 5DB9A 3MR5A 4KLMA 2G8LA 1X2IA 4M9NA 4O5CA 1KSFX 2ZAOA 3LW5F 1TAQA 2Y0SC 1SXJE 4Q44A 3GO8A 2FPKA 1ZYQA 2JEFA 3GQCA 1JN3A 1E9RA 1XXHE 1IBMM 3LWLA 3GLGB 2BGWA 1ZQJA 1OIZA 2APLA 2AH5A 8ICOA 1Z19A 2OXOA 1VG5A 2E1EA 3VKGA 1SGGA 1KQQA 2B0CA 3G6XA 5GKNA 3TADC 4NC6A 2QNJA 3IHPA 4LZJA 3MABA 5E79U 4QNRA 4FWHA 3AQEA 4LZZA 2QQ8A 3T79A 1SXJD 2RRDA 2JEGA 2KZZA 2BQUA 2A1JB 2LM4A 4GHLA 1OAIA 1S3SA 1UPHA 4Q43A 3RJGA 2YX8A 1WCLA 4PHEA 3EWAA 3PSIA 2B6GA 4M9GA 4NRVA 2DBYA 2NRVA 2IA6A 5KFOA 4AG6A 2R8JA 4PZNA 3F2BA 4RU9A 4X65M 2KDLA 2LYHA 2QP9X 4M9HA 1ZD3A 3Q8SB 1NK0A 4P0QB 2MUTB 1E9SA 3ICXA 3RH4A 2LPEA 4AYBF 1Q39A 3FRIA 2PFQA 5HNKA 8ICXA 2BJWA 1P7DA 2YTUA 2OH2A 5BOLA 3E58A 1RZTA 4F2LA 3K92A 5BPCA 1IIPA 4Y2SA 2G09A 5EE3A 1ZV1A 4GC7A 4EBEA 3GRVA 4R8UB 2PFOA 1TH4A 2QB0B 4Y2QA 2DENA 3UXNA 4QIWC 2GH1A 5EXSA 3ZD9A 4JI8M 1IN5A 3HJQA 4FZNA 1QVRA 2MUTA 5ITUA 2KG5A 1YZ6A 2FFJA 5HHIA 3CP8A 2RKOA 4DL7A 4J9LA 4QWEA 3D8LA 2R8IA 9ICKA 2N35A 3C3DA 3F5EA 2P6RA 8ICFA 1X40A 2JR5A 4L4UA 5KPTA 3FM9A 5AI8A 1Z00B 3EPIA 3Q8LA 5J8YA 4Y2PA 1NK6A 3PSPA 2ZXIA 3B7ZA 5J0QA 3MDCA 1ZXIA 1WHCA 1Q3BA 4R8UA 3ORYA 5KFNA 2KFNA 2W43A 3U6MA 4FCTA 2RQ5A 2AJQA 4JYAM 3NUQA 4DEZA 1NK7A 4LJ5A 1RG6A 1WGLA 4G4RA 3UMCA 1IQPA 4JI3M 5ALQA 4BX9C 4CF5A 2PXIA 1Z1VA 1KLNA 1P3QQ 3ISCA 4JI7M 5KL1B 2A1AA 3TANA 5CHGA 5EXXA 3IDWA 4HAIA 3SZ2A 4PL2A 4F1IA 2WFAA 1BPYA 1W5SA 4IL6U 2HVIA 4M0DA 1Z00A 2XFTA 5DDYA 3BQ2A 3PXGA 4RNAA 4QZAA 9ICEA 1RDFA 3IG8A 3A0HU 4IBJA 2YB4A 3TFSA 2XGNA 4MGKE 3L26A 1N77A 1TH2A 1UA1A 3TE6A 4MGZE 5DYGA 3LMMA 3KBBA 3MGVA 4GH9A 5J0WA 3U6PA 3RR7A 3WK4A 3GLHB 8ICGA 4QZCA 4UB2A 3JPTA 9ICUA 3M1YA 1N2XA 2K8CB 2KK0A 1DK3A 2W9BB 1IM4A 2X4AA 4QZHA 3HKZC 1QDTA 3GPPA 5KFCA 2BHNA 1R2ZA 4JV5M 4QZFA 4UB3A 3ETLA 3KFUF 3AJIB 3HWSA 5HMLA 4RQ1A 1MU5A 3OJSA 1TAUA 4QZ8A 4FZMA 1Q8KA 1WGNA 1DGJA 2KD1A 1GLNA 4NJ8A 8ICYA 4KLQA 3VFDA 4QNLA 5KG3A 2BNKA 1J97A 1QAMA 5F3WA 4BGDA 3LDAA 4PHAA 2L4EA 5AKEA 2LNHC 1IV8A 4QWAA 1ECWA 5AIAA 3QUCA 3AU6A 3C2MA 3QUBA 2WSEF 4MH0E 2EZYA 1NHGC 2WF6A 1TKDA 2ZUCA 4XA5A 2E8OA 1N34M 4ED8A 2H1RA 5AM0A 5ALJA 2UVRA 3FTCA 1Q3UA 4M0WA 4F5QA 3HHXA 7ICHA 1NNUC 2Y0TA 4YHHM 4TUSA 3PNCA 3AL0B 3QU9A 2R8GA 3PR5B 1S9FA 4IBIA 3PR4A 4EZ6A 2XF3A 4TURA 3K2LA 2O6KA 2ZM6M 4UBCA 2ZIXB 3D2SA 2JH1A 3GQ4A 3MR6A 3H0RB 4RZRA 1KYIA 2HOFA 2YB1A 2G08A 3RB4A 1MN3A 4UATA 3UXOA 1Z5AA 2PI4A 1MJGM 3FAHA 3T1YM 4RQ7A 5AM4A 4CRXA 1ZRNA 3B0YA 3T5HA 3E4RA 3U6DA 1V9PA 4O3PA 3WKBA 4L6V6 4LG2A 4PD2A 5J2IA 2Z7JA 4OJLA 3H8JA 4RQNA 1R4GA 3GQ5A 4CF4A 5C0YA 4WURA 2HL7A 4A8EA 5KFIA 4F71A 5DYIA 4LF8M 3AMZA 2UU9M 2VKQA 2DL0A 2X49A 5CA7A 2JY5A 2ZIWA 2F2AB 2R4JA 4ED1A 9ICBA 3L3FX 2KJ9A 2LI6A 4B7GA 2DZOB 5KFVA 2F1IA 5C1BA 2CV1A 4F4ZA 2RLTA 2FMQA 1DGHB 2GOLA 3FD9A 3FRHA 3PY8A 3AM9A 2LMRA 3BDPA 4GFJA 2LVQD 1X37A 2HBJA 5J2JA 1OFIA 4DQRA 4LGYA 3AEVA 3CTWB 1Q3CA 4JN6A 3PNYA 4M2YA 3RE8A 2I7NA 2XGPA 2HKJA 1N78A 4FFDA 3E46A 2HHQA 2HCBA 4W5WA 4AW4A 4JI4M 2UXCM 2M9NA 2L7IA 1LV5A 3RB6A 5T14A 1H38A 3FUTA 1N32M 2FMPA 3OTQA 5AM2A 2HMXA 3RFWA 2HHHM 4DFKA 4YXMA 2KKPA 3FKEA 4OU7A 3UPQA 3NS1A 5AKGA 3B7QA 4D82A 1COKA 2R44A 4KHPM 4MEYA 3QXGA 1QAOA 3PVXA 2ZIUB 4I8OA 4GC6A 1TV9A 2UVVA 5CRXA 4CF3A 4YQWA 4LJ4A 4GKJM 3LVWA 2FJ6A 2VANA 5ALHA 3SD7A 5DFLA 2HHXA 1E32A 2KJ5A 3FYHA 1HQYE 3TKAA 1GL6A 3I76A 1ZETA 3I04M 2W55A 1DRGA 1S77D 3L2AA 2HDOA 2KOBA 3PW0A 3A42A 4RPYA 4I4LA 1OUQA 1F44A 4NM1A 2CUZA 3N7RC 3UMBA 4DLEA 4NM2A 4EX7A 1K1SA 2ZIUA 4F3OA 4YN4A 2FLNA 5DNYA 1HT2E 2EKKA 2D7GA 3SBJA 2XCAA 3FC4A 2AGOA 2C28A 2EQYA 2EAMA 3GLGE 7ICLA 2OEHA 1IBKM 5EJCA 2BQRA 4KN4A 4O3RA 2VJ5A 4NXMM 2ISOA 3PX0A 1XHBA 3C9PA 3U61A 2Y21A 4RQ3A 4RF0A 1KFSA 4LY6A 1IXRA 2JRZA 4UAWA 3VKHA 2EAPA 4MFAA 1IXZA 4B7HA 2LVAA 4L15A 3WK6A 3JPOA 3R9XB 4DV4M 4KTQA 3NASA 3VK8A 1L2CA 5DGBA 2UVUA 3H7IA 1FFUA 5AK3A 3GIKA 2C5RA 4G9BA 2CRUA 1TVAA 4OO1J 1COOA 2EJSA 2FOIC 4G4NA 4X64M 4Q7JA 3C5GA 4M9SA 2G5GX 1FO4A 3TARA 4M04A 1NSFA 2WSCF 1YSYA 4BWJA 2NO4A 4UAVA 4DV0M 1TE2A 4USAA 5E26A 4QJFB 3BQ0A 2ZANA 4B9UA 4ELVA 4M9JA 4DWIA 5H37D 4PHDA 4BXOA 2EH9A 4Z6EA 5KFQA 1KKXA 1OTRA 1SB3C 1HR0M 4QZDA 3T5JA 2RRUA 4C7YA 5AIBA 4R71A 2FI1A 4U7CA 4UB4A 4GLXA 2ZTCA 2UXDM 4C8MA 3W67A 5EOZA 5L1LA 8ICMA 2OWOA 1F4IA 8ICQA 2KW0A 4MFCA 3RJEA 4I27A 1IN7A 5AICA 1YLAA 2F1HA 3BQ7A 4OJOA 1SWVA 2RGHA 2A19A 1KFDA 2D8CA 1AIPC 1XU4A 3TI0A 3M6KA 1GABA 1RYUA 4O5KA 1UQVA 2PMZC 2BCVA 3SAUA 1QUTA 4I81A 4YP3A 4FZLA 1IY1A 4ECVA 1TF0B 5B5EU 5AK4A 1CEZA 2LVNC 1V38A 3CF2A 2FE9A 1ZQQA 3HWTA 2HI0A 2K4IA 1QANA 3V72A 7ICVA 4DL3A 2O5RA 1NHWC 1ZQHA 5K4LA 3LVVA 3OSPA 5ITTA 1PJTA 1DXSA 1JMSA 2P35A 4L78A 2LVPC 5CEHA 4NXZA 4JK1A 1V33A 3ZH9B 4UASA 4KLIA 4ANRA 4WP2A 2KNZA 3ZDDA 5IIKA 2ZUBA 2K89A 2V4RA 4GEWA 1HIWA 1ZQ1C 5JUMA 3S6JA 2JHDA 4REZA 1NZBA 2J6UA 1XS9D 5IINA 5AI6A 2Y0SF 3E21A 5KQDA 1BNPA 8ICNA 1SWWA 4X66M 1SXEA 2QCUA 2QSFX 3QAUA 2EA0A 1RQLA 3GLHE 4B6JA 3TWKA 2O25A 3GLIB 2IOFK 2XIDA 8CATA 2Y0QA 2R4EA 1LV7A 5H2FU 2DUYA 4DV1M 1QSLA 1R7RA 3PMLA 2XY7A 1HNXM 1XNRM 4K4HA 3E0FA 1X9MA 3C23A 3DOAA 4EZ9A 1GJSA 1BPXA 7ICIA 1NO1A 4IBCA 1TH3A 4IQTA 2UUCM 5L1KA 4J9RA 2ZTEA 3KSJA 2O01F 3Q8RB 2C9OA 4F50A 2V9WA 5D46A 4YD2A 4IIWA 2KSOB 4KLEA 1UM8A 5AKJA 1QQ5A 2KIWA 4RQ6A 2JP7A 3QUTA 4YCXA 2DHYA 1HNWM 2ZIVB 5AKXA 5D49A 1BNOA 3T15A 3SYLA 3AU2A 1N61A 1L7NA 5FTMA 1RQNA 3PZPA 3D8BA 4TUWA 2F3NA 2DPJA 4NLGA 3AUOA 1GKIA 3SARA 4IQUA 4GIBA 1ZMVA 2HHWA 2F77X 3SHGB 1U9LA 4K4IA 2P6UA 2K4HA 3ZDCA 4JI6M 1RXWA 2DF4B 2V6ZM 2YMMA 4PGQA 1R5LA 1ZQWA 3ISBA 1ZQCA 3J27B 3RJJA 1QUSA 4IJEA 3Q8GA 3KDSE 2ZIVA 1Y88A 4F4XA 1T3QA 4O3OA 2F8KA 4P17A 4G4OA 4DFJA 4J03A 3HW8A 5BPVA 3G6YA 1ZD4A 3IN5A 4FS2A 1ZRMA 2D6FC 4QIWF 4DQSA 2JXJA 3MJ5A 4NLNA 1NZPA 9ICWA 3RR8A 4FWGA 4LCBA 3TADA 4DL5A 2HW3A 1T3TA 2XSZA 5KT5A 1OIPA 4RPXA 5A0LA 2BWBA 3KOOA 3FE3A 1NJGA 2M5ZA 4XGIA 1K1QA 5CB1A 2CFOA 3W0FA 3GZFA 4P4PA 3QU4A 4P2HA 2CE7A 5EWGA 1Z4OA 1ZQOA 2BCUA 3TWLA 2DKLA 3EYZA 2OO9A 2P66A 1CI4A 3OJUA 4ECRA 4C4RA 3SV4A 7ICSA 3AOGA 2LWXA 4I5SA 2W9AA 3IP4B 1Z5BA 5EXPA 3HRDD 1XO0A 5J2FA 2AGPA 1ZMWA 4ED7A 4IS7A 2JGAA 2DAKA 4DSLA 9ICQA 1VDVA 4GHAA 1Z59A 5KG5A 3TWMA 4F4YA 1A76A 4OJ5A 4CDGA 2Y1IA 3F5AA 1CRXA 5JTIA 1D8BA 1VQ1A 2KMDA 2WHEA 2W03A 4XRHA 2OCEA 1G59A 2VF8A 2WTFA 1ZQAA 2NO5A 4ACOA 3FUWA 5ALFA 3T3FA 7ICJA 2AHOB 3KP0E 2JWSA 2NRXA 4O5EA 2BPFA 1N75A 4RNMA 2ES6A 4O9MA 4JI0M 4AZFA 5AM1A 5J0UA 3RJKA 1J7KA 1MX0A 2DNAA 1Q02A 4IR1A 2XVTA 4F2RA 1AQ6A 2KN7A 3HKZF 2ZJ8A 8ICVA 4EIWA 4F92B 4ELTA 2JY8A 2HBMA 4LJXA 4M0AA 2CN1A 3F2DA 1SL1A 4JI1M 4KLNA 4Z6DA 3AKZA 3VCBA 1VJ5A 1SKRA 2KFZA 4OD0A 1FEZA 2ASDA 1T43A 3HHYA 4C8KA 4R7GA 4CHTB 2OHFA 2RDIA 3F53A 4F93B 2VA2A 5KPZA 4F8RA 3HT3A 4PT5A 2FPMA 2K4PA 5ALTA 3C1YA 4DSFA 2BPCA 3RF9A 4RF1A 3PW5A 3N28A 2KNJA 3SFZA 3OHBA 3FTDA 1HJPA 2A5YB 9ICMA 3HX3A 2BWEA 4NRWA 2ZTDA 5HP4A 1DO0A 3KXEC 4OVZB 2NRWA 4B9SA 4ECSA 3V7JA 1D9DA 3VDUA 3QEBZ 2KICA 4BDPA 1GL7A 5KFSA 2HAKA 5IIMA 8ICTA 1TDZA 1HQCA 3JPNA 2XC9A 5DQIA 4ICAA 3MBYA 2HHTA 3IM1A 2KZSA 2XCPA 3LQQA 1I4WA 5AI9A 1KRPA 1N5WA 5DLGA 3U26A 1IM2A 1NV9A 3PSFA 5J2KA 2XY6A 1Q46A 4RUAA 4Q45A 3K1JA 1PK3A 5ALZA 3UMMA 3GV5B 1NNLA 4UB6U 1HT1E 3J80S 2I5HA 3J7BA 2W04A 3C29A 2XLJA 3GFKB 3KOZE 2KHVA 1ZMUA 4OVZA 5C18A 5EE1A 4MHVA 1ED1A 2GQFA 2R45A 4CCHA 4YR2A 5EP1A 7ICQA 1LTMA 1T4GA 2DGZA 3HU3A 3T5KA 3VK7A 2IMWP 1NK8A 5KT7A 4ECZA 2UUBM 3C58A 2Q4TA 4J9SA 1NJYA 4LJAA 3WHLA 4Y2YA 3FUUA 3Q8KA 4YD1A 4I2EA 4OW0A 1IN6A 2QARA 8ICJA 4RUCA 2MGWA 4JI2M 3UXPA 2ASLA 4LF6M 1UA0A 4FCVA 9ICLA 4B9TA 2WAQC 3WKEA 5LMNM 4GXKA 4C4SA 2Z3XA 4DOAA 2F4VM 1NY5A 5ALPA 2JZ1A 5J2BA 3I1YA 2DAMA 4K0KM 3HILA 3PW2A 4R66A 3QE9Y 2BKEA 1IY0A 2DVWB 4XUSA 5HMMA 5AHXA 1NJFA 9ICGA 1NVMA 4O3MA 5J0TA 3KHHA 5KFTA 3KTQA 1MA7A 2F5OA 2P5TA 2D7HA 3GP1A 2G5IB 4UAZA 4Q8FA 1QSYA 3I28A 4LFBM
chains in the Genus database with same CATH topology
3U6QA 3C28A 1E32A 2KJ5A 2FNAA 1HQYE 5HR7A 1GL6A 2UUAM 1DRGA 4LGMA 2VIXA 3L2AA 4NL4H 4LF7M 2WAQF 3SC3A 4A3VB 4LJ6A 2XI9A 2KOBA 3PVSA 3A42A 4I4LA 1OUQA 1F44A 2K8AA 1QQWA 2CUZA 3A45A 3N7RC 2ZBKB 1L6NA 1JQJC 2G5HB 2ZIUA 1Q3VA 3GLGA 2ZAMA 3PNVA 5IZ7D 1HEKA 3AFHA 1HT2E 1W5TA 5DNYA 4LF4M 3I51A 4CISA 4BUGA 4S12A 2D7GA 3SBJA 2A3VA 3RGSA 3JR4A 2KKVA 2LHTA 3THGA 1IBKM 5JI2E 1PJIA 4FE3A 3FUVA 4ZPXA 5EJCA 2KJ8A 4KX3A 2KZUA 3K1ZA 4AKHA 4P0PA 4LFAM 4NXMM 1IBLM 2VJ5A 2AHMA 2LBOA 2QBYA 1EE8A 3DFZA 1YT3A 2ZIWB 4D80A 4CGYB 1XHBA 3U61A 2Y21A 4GITA 4WW0A 3FTFA 4RF0A 4LY6A 3TQSA 2OQ4A 2VJ4A 3VKHA 4LRTA 1IXZA 4B7HA 2VIIA 4L15A 3GPUA 4GIPA 3R9XB 4DV4M 3FUXA 4GKKM 3DA1A 3WHKA 3VK8A 1XMQM 1L2CA 3J7AS 5A2QS 1K82A 1G3IA 2C5RA 3GLIA 3D2NA 3KOYE 2DZNB 4OO1J 2FOIC 2R18A 4AG5A 3UJNA 4G4NA 4X64M 4M9SA 2KHQA 3KP1E 2G5GX 4P0QA 4HL4A 3SMPA 4AQYM 1L1ZA 1NSFA 4LF9M 1YSYA 1JR3D 1E94E 3LQRA 3GRRA 4DV0M 4QJFB 5E26A 2OYYA 3GRYA 2ZANA 2RGOA 4QHSA 1G4AE 4NOOB 4DR4M 3SAVA 5H37D 2CRXA 3HGIA 4MGYE 2X8AA 1GVNA 1WXQA 2LH0A 3SASA 4LFCM 3GPYA 3TPZA 2C99A 1HR0M 3JR5A 4GMQA 2E5SA 2CEAA 3MHVC 1L1TA 3H0LB 3RGPA 4U7CA 4NLCA 5EP2A 1QYRA 4NV0A 4DR3M 2UXDM 1D2NA 1WUDA 4KMOB 3PFIA 5IWAM 2LXEA 2KW0A 4P16A 1H6UA 5KO3A 5IT9S 3HHWA 4B3RM 1IN7A 4R3DA 2KA6B 3U6LA 2QZ4A 2JMGA 2DWLA 3FYCA 1IXSB 3KFUG 1N33M 3KOXE 4AKIA 2K8BB 2RHFA 4OJOA 2RGHA 2K4EA 3M7GA 3UK6A 4DUYM 3M6KA 2XFSA 4M9XA 2PMZC 4DV5M 4OJ6A 4DR2M 4OJPA 1SXJA 3HHZA 4MGIE 4L16A 4D81A 3SAUA 1ZQ9A 4I81A 1SZHA 2G8LA 4FZLA 2N1RA 3FYDA 1IY1A 1I94M 1KSFX 2ZAOA 5ITYA 4DR5M 4LJ7A 1XC8A 2Y0SC 4YY3M 1SXJE 3U5ZB 2F5QA 3CF2A 2Z4SA 3GO8A 2W7OA 2H3ZA 2KXEA 3A98B 2K4IA 2KRUA 1QANA 1E9RA 4DR1M 1IBMM 3GLGB 3SQIA 5KQ8A 3RFAA 3IG5A 2HBKA 2O5RA 1L2DA 3I4VA 1NHWC 3SAWA 4FD2A 1Z19A 2OXOA 3Q8XA 3LVVA 2E1EA 5ITTA 3VKGA 4L78A 2NV3A 5GKNA 4LJ8A 4GKJM 2ZXHA 1K3WA 3R8FA 2HOIA 3HJSA 3ZH9B 1Z5CA 2YFQA 4AYBC 4DV6M 4P0PB 4LZJA 1XMOM 2C98A 4GC5A 1QZMA 1IN8A 2K89A 2QBYB 4QNRA 1SXJC 4FWHA 3UGJA 4LZZA 3AQEA 2DXIA 3HJ8A 2PMZF 3AQFA 1ORYB 3T79A 1SXJD 1HIWA 1ZQ1C 2NQ8C 3U61B 2RRDA 2JHDA 4REZA 3U5ZA 1NZBA 4JI5M 2FE8A 4GHLA 1S3SA 1UPHA 4PCZA 3ZC7B 3GLHA 1ZAEA 2YX8A 1A6SA 2F5NA 2Y0SF 5KQDA 3GLFB 3SAHA 2C9CA 3PSIA 4X66M 1NNJA 2QCUA 3QAUA 4NRVA 2EA0A 4AI6A 1VDDA 4IBDA 3TWKA 3GLIB 4AG6A 8CATA 2XIDA 3KZXA 2BJVA 1G41A 2R4EA 1LV7A 2Y0QA 3F2BA 4DV1M 1JR3A 4X65M 1R7RA 4LRSA 4PL1A 2QP9X 5KL8B 4X62M 1HNXM 1XNRM 3E0FA 4P0QB 4Z6YA 2HBLA 1E9SA 3DOAA 3U6CA 4FVMA 4B3TM 3ICXA 4AYBF 3L27A 1Q39A 3TL4X 2YQZA 4B3SM 1GO3F 4IBCA 1TH3A 4BBAA 2VQFM 2BJWA 2UUCM 1P7DA 2OH2A 3KSJA 2C9OA 3GLFA 3K92A 4IBFA 5LMUM 1OJLA 4IIWA 1IN4A 1UM8A 2F5SA 4DV2M 2XEPA 1IIPA 2KIWA 4IBBA 2G09A 3GRVA 3M0EA 1TH4A 1PJJA 4IJFA 2JA2A 1HNWM 3J2PB 2ZIVB 2XH9A 4QIWC 2GH1A 1G8PA 5EXSA 3SYLA 3T15A 2E1FA 4JI8M 1IN5A 3SATA 3HJQA 5FTMA 2J7OA 1J5EM 3D8BA 4PDIA 3PZPA 4FZNA 4TUWA 1QVRA 1GKIA 4NXNM 5ITUA 3GQ3A 2CHVA 3H4MA 3SARA 4JMUA 2FFJA 3L28A 2ERCA 2L6OA 2MA1A 3CP8A 2F77X 2RKOA 3HU2A 3SHGB 4DV3M 5ITRA 2K4HA 5ITXE 3D8LA 4JI6M 2KV2A 3AOEC 2V6ZM 2DF4B 3F5EA 1KBUA 3F2CA 2CHQA 4L4UA 5EP3A 5KPTA 2H3QA 3J27B 1SXJB 2ZIXA 3PSPA 2ZXIA 4IJEA 3K8ZA 5E6JA 2YNMD 1Q3BA 3U60B 3DEEA 2DHRA 3KDSE 1XXHB 2CV0A 3U6MA 4FCTA 2ZIVA 4JYAM 3VDPA 7CATA 3NUQA 3ALRA 4LJ5A 4G4OA 3L25A 5BPVA 3KS4A 1QAQA 4G4RA 3IN5A 2D6FC 4QIWF 1IQPA 4OX9M 4JI3M 4B08A 4BX9C 5KPRA 2E5LM 3MJ5A 1KFVA 1Z1BA 2G06A 2G07A 1R2YA 4JI7M 5KL1B 4FWGA 4LCBA 4NSRA 4NLBA 3EIEA 5EXXA 1T3TA 2XSZA 1K3XA 3U6SA 3AL0C 4PL2A 1TDHA 1XWIA 5A0LA 1W5SA 4FW9A 1NJGA 2M5ZA 4M0DA 2EO2A 3KSXA 4XGIA 4U6PA 1XNSA 5HR6A 2CFOA 2XFTA 3W0FA 4L8RC 3GZFA 3PXGA 4RNAA 2XZUA 1NY6A 3U60A 5BR8M 1XXHA 3IG8A 2CE7A 3GPXA 3HKPA 4IBJA 5EXTA 2YB4A 2XGNA 4MGKE 3TWLA 3L26A 1N77A 1J09A 1TH2A 2CPRA 3GU3A 2I7PA 3TE6A 4MGZE 5DYGA 3LMMA 2G0AA 3SMVA 1C1KA 3MGVA 4FCWA 4GH9A 3U6PA 2F76X 3AOGA 2LWXA 3GLHB 5FLXS 3E9SA 3N7PD 4I5SA 4IBGA 3IP4B 1Z5BA 5EXPA 4IBKA 1XO0A 3T1HM 2K8CB 1DGGA 4BJQA 1DGBA 2KEBA 2BDUA 3GRUA 3QWLA 4MGHA 2J7NA 3T38A 2X4AA 2H3FA 1DGHA 2JGAA 3HKZC 3B9PA 3GPPA 3A46A 4GHAA 1R2ZA 1FJGM 4JV5M 1Z59A 2DWZB 3TWMA 4OJ5A 4CDGA 1CRXA 3F5AA 3KFUF 1D8BA 3AJIB 2XSZD 3HWSA 1TAMA 2R65A 1MU5A 2W03A 3D2QA 4FZMA 4GC9A 1G59A 5ITQA 4II7A 1URJA 2KD1A 1GLNA 4XBOA 4ACOA 3FUWA 3VFDA 1IY2A 4QNLA 3CF0A 3KP0E 2BNKA 4QHTA 4MM3B 2RP5A 4CGZA 1QAMA 5F3WA 4DR7M 4LJ9A 4DUZM 1N75A 3ONNA 4JI0M 4AZFA 3L29A 1T94A 3MK6A 2LNHC 3O0FA 4IC9A 1A0PA 1ECWA 1J7KA 1MX0A 3ZCBB 4WJ3B 2XVTA 4MH0E 3OTOM 5FSWA 1NHGC 3N7SC 2R46A 3HKZF 2V1UA 1FNNA 4EIWA 3SAGA 3HU1A 2ZG6A 1N34M 2HBMA 2H1RA 2CN1A 3F2DA 4NWIA 3FTCA 1Q3UA 4M0WA 2L09A 3AOEA 3HHXA 2F8LA 1NNUC 4KLNA 2Y0TA 4YHHM 3AKZA 4JI1M 1Z6TA 3AL0B 3VCBA 4GRIA 3UZUA 3VLFB 3HHYA 4IBIA 4R7GA 4CHTB 3F53A 2XF3A 5KPZA 2OPFA 4C0ZA 3K2LA 4AKGA 2ZM6M 4PT5A 2ZIXB 1PM5A 2KRKA 4QOZC 3D2SA 2JH1A 4DR6M 3NWLA 3GQ4A 1PVQA 3H0RB 3RF9A 4RF1A 2YR0A 2KNJA 3SFZA 3VC8A 5EP4A 3SYKA 3FTDA 1KYIA 2HOFA 2YB1A 2A5YB 2G08A 4JXJA 4LF5M 5ITXA 4QNMA 4NRWA 2HOQA 4B3MM 3PSTA 1DO0A 3KXEC 1Z5AA 4OVZB 3T1YM 4CRXA 2LYAA 2XZFA 3VDUA 3E4RA 3NBIA 1GL7A 2KICA 3U6DA 1TDZA 1HQCA 4LG2A 4PD2A 4KX5A 2Z7JA 4ICAA 4OJLA 2KZSA 3LQQA 1I4WA 4M9ZA 4KO8A 1IM2A 3DZDA 3GQ5A 3PSFA 2R62A 3BOSA 4WURA 5C0YA 1HNZM 2HL7A 2Y20A 2DWNA 4BLCA 2CV2A 4A8EA 3K1JA 3KOWE 5DYIA 3UMMA 4LF8M 2W82A 2VQEM 1HT1E 3J80S 2UU9M 2OM6A 2MRLA 2VKQA 3J7BA 2W04A 2X49A 3NRWA 3C29A 3H0MB 5JI3E 2XLJA 2XICA 2F2AB 2R4JA 2M60A 3KOZE 2KHVA 1DO2A 2ZIWA 3EIHA 3L3FX 2KJ9A 3SHFA 4OVZA 5C18A 4B7GA 2DZOB 4IBEA 4ITQA 4PDGA 4FWDA 1ED1A 2R45A 2WB1C 2KVCA 1IXRC 4Z8XA 5C1BA 2CV1A 1XNQM 2K47A 4NSOB 2DWMA 1DGHB 2GOLA 5EP1A 3FD9A 3M7DA 4MB7A 4GFJA 2DGZA 1X37A 3JAMS 3HU3A 3OPXA 2HBJA 3VK7A 1PVRA 2M0NA 3M6AA 3KS8A 1OFIA 4DV7M 2DQNB 2QENA 5FTNA 5EQTA 5FTLA 1OFHA 2C96A 4LGYA 5FTKA 3CTWB 1Q3CA 4JN6A 3PNYA 2V1CA 3RE8A 3C58A 1N36M 4G6ZA 4LJAA 3WHLA 1R6BX 2UUBM 2Q4TA 3FUUA 2CHGA 2I7NA 3U6EA 3FTEA 3ILKA 2HKJA 4OW0A 2D7EA 1YE9A 1N78A 1IN6A 2HCBA 4W5WA 4AW4A 2JH7A 4JI4M 2UXCM 2L7IA 3KW6A 4JI2M 1DGFA 3I4YA 3KVWA 4LF6M 3AV0A 1L8QA 3W0LB 4FCVA 5IREB 3FUTA 1N32M 3CYMA 5T14A 2LKYA 3CF6E 2WAQC 2HMXA 2W7PA 5LMNM 3RFWA 2UXBM 2Z3XA 2HHHM 2WB1F 2KKPA 3SAFA 3FKEA 4OU7A 2F4VM 1NY5A 1TGUA 2H3VA 4B7FA 2QPAA 4G4QA 1PVPA 3J81S 4D82A 4K0KM 3LYSA 2Q2EB 4KHPM 1IY0A 2DVWB 4HLQA 1YUBA 1QAOA 3CRXA 2L7HA 3SMSA 1L2BA 1NJFA 2EUCA 2ZIUB 1NVMA 4I8OA 4O3MA 2Z4RA 5FTJA 3M6ZA 5CRXA 2LYBA 1MA7A 2F5OA 4QOSA 2P5TA 4LJ4A 2D7HA 3GP1A 4KODA 3U6OA 2G5IB 2KEYA 2H3IA 3LVWA 2F5PA 4BB9A 4LFBM
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R18 A;  2Z7J A; 
#chains in the Genus database with same CATH topology
 3SEN A;  3C28 A;  3OSN A;  1Y8G A;  4F4K A;  1JXL A;  3NVW A;  2UUA M;  3RBE A;  5F3X B;  4NL4 H;  3SC3 A;  2MJ5 B;  4CE6 A;  5AK6 A;  5D4B A;  1X6J A;  2K8A A;  1KEJ A;  2NRZ A;  1ZQS A;  2ZBK B;  1JQJ C;  2IBK A;  4ELU A;  3ZDA A;  1HEK A;  1S5L U;  3AFH A;  4LF4 M;  1W5T A;  2WF9 A;  3RAX A;  3QYB A;  4CIS A;  4S12 A;  5AKK A;  4IQV A;  3JR4 A;  4I2B A;  1PZN A;  5AKY A;  2JXN A;  4PPX A;  4M47 A;  3FUV A;  4KX3 A;  4DBG B;  4I2A A;  1C7Y A;  4P0P A;  2Y9U A;  1ZQM A;  5AKH A;  3MFH A;  1QTM A;  2PFP A;  2QBY A;  1EE8 A;  4F5P A;  1ZQK A;  4Z6C A;  1YT3 A;  4UN2 B;  4D80 A;  4CGY B;  2ZIW B;  1NJX A;  3B74 A;  5AKL A;  4GIT A;  1X9X A;  1WYG A;  4LRT A;  2I1Q A;  2MU2 A;  1JXE A;  4TQR A;  2QHO B;  4P4O A;  4GIP A;  3RH6 A;  2C2E A;  4GXJ A;  4UAR A;  5ALR A;  3KHL A;  2RDJ A;  1ZQX A;  2YML A;  4B9L A;  4DLG A;  2DZN B;  1T8E A;  2R18 A;  3KKA A;  5J0X A;  2KP7 A;  5L8R F;  4HL4 A;  1N62 A;  3GLI E;  3R9K A;  1L1Z A;  2JV3 A;  4MF2 A;  1VEG A;  3LQR A;  5IIJ A;  5KAI U;  4I2G A;  3T5L A;  2RGO A;  1D8L A;  3QX7 A;  1XO1 A;  3SYZ A;  4EYI B;  3RJI A;  2H5X A;  4EBD A;  2NRT A;  2EKF A;  2X8A A;  1WXQ A;  2DAE A;  5J0P A;  3GPY A;  1T6O A;  3W68 A;  2E5S A;  2J5Y A;  1XWL A;  3MHV C;  3RGP A;  2JY6 B;  4DF8 A;  4DR3 M;  3KZI U;  1TK5 A;  2AU0 A;  1TK0 A;  5KFX A;  3PMN A;  2BCR A;  3Q8M A;  3KKA C;  3A0B U;  5KG7 A;  1H6U A;  5GTH U;  4QZ9 A;  1SV0 A;  4PHP A;  2KVS A;  3U6L A;  4YMO A;  4US8 A;  4I2H A;  3KOX E;  3J81 j;  3M7G A;  2Z8Y M;  3UK6 A;  4DUY M;  4C4T A;  1L5U A;  4DQI A;  3WK5 A;  4DR2 M;  1SXJ A;  5KFW A;  3HHZ A;  4PJ0 U;  4D81 A;  1ZQ9 A;  4IRD A;  3WKA A;  3PV8 A;  2N1R A;  3M9N B;  5L1I A;  2EAN A;  4YXJ A;  1I94 M;  4DR5 M;  4LJ7 A;  4YY3 M;  2Z4S A;  2W7O A;  2KRU A;  2KTQ A;  3H8W A;  3SQI A;  3RFA A;  1S97 A;  5ALM A;  1L2D A;  1M6Y A;  3SAW A;  3SR6 A;  4DCC A;  1D9F A;  1SV0 C;  2NV3 A;  2B3T A;  3CW2 C;  4KLJ A;  1X6I A;  4KN7 A;  5ALW A;  4AP9 A;  1IG6 A;  2ZXH A;  1K3W A;  3R8F A;  2HOI A;  3HJS A;  2YFQ A;  2C98 A;  2MR9 A;  4GC5 A;  4ECU A;  5DLF A;  1NJW A;  1DV0 A;  2YN4 A;  4PGX A;  1ZQL A;  1SXJ C;  3AQF A;  3UGJ A;  1ZQV A;  1CUK A;  3HJ8 A;  2PMZ F;  1ORY B;  2HWJ A;  3U61 B;  5ALS A;  1VDL A;  4JI5 M;  2FE8 A;  1GJT A;  1ZAE A;  4EYH B;  5AI5 A;  2F5N A;  4B9V A;  3SAH A;  2C9C A;  1L3V A;  1VEK A;  2K9D A;  4ZOH C;  9ICS A;  3UQ2 A;  2LBC A;  5F9L A;  2BJV A;  3Q8Q B;  2WF8 A;  4LRS A;  4PL1 A;  5CP2 A;  8ICE A;  2HBL A;  4Y2R A;  3NVZ A;  4UAU A;  4Y2J A;  3TL4 X;  1GO3 F;  2BZF A;  5FP0 A;  5DQH A;  4HEO A;  2D3D A;  3TAQ A;  2EAO A;  1JIH A;  5J2G A;  4BXO B;  4IBF A;  5LMU M;  1OJL A;  2ASJ A;  4RNN A;  1IN4 A;  1OAO C;  2F5S A;  2XEP A;  4IBB A;  4DOB A;  2DAG A;  4ECQ A;  4C8N A;  5KG6 A;  4IJF A;  2JA2 A;  1G8P A;  5TZV A;  3CGW A;  3QYP A;  2FLL A;  2W54 A;  2J7O A;  1J5E M;  4PDI A;  4NXN M;  3GQ3 A;  2G3Q A;  4JMU A;  2ERC A;  2L6O A;  5EE0 A;  4DV3 M;  3GV7 B;  3GV8 B;  2OOB A;  2KV2 A;  5IIL A;  3AOE C;  3T6P A;  2CXY A;  3NTU A;  1L8L A;  3RJH A;  2CHQ A;  3QNM A;  3H8S A;  2L4F A;  2H3Q A;  3OGU A;  3K4G A;  1L7P A;  2F44 A;  1RU3 A;  3ZDB A;  5KFB A;  1NOM A;  2YNM D;  2DHR A;  2CV0 A;  3QU2 A;  4C8O A;  3RRG A;  4F72 A;  7CAT A;  1S0N A;  5AK5 A;  4EBC A;  3L25 A;  3KS4 A;  3BZC A;  1QAQ A;  5EE9 A;  2JZB A;  4OX9 M;  1ZD2 P;  4R64 A;  1WG8 A;  2W9M A;  1QSS A;  1C20 A;  1XSL A;  3SI8 A;  1N5X A;  2G06 A;  4EEL A;  3B89 A;  3H40 A;  1BGX T;  4I29 A;  3EIE A;  4M6W A;  1K3X A;  3U6S A;  1EXN A;  2EO2 A;  5L1M A;  5IIO A;  4L8R C;  5J0O A;  5KFJ A;  1XSP A;  2XZU A;  5BR8 M;  1TR8 A;  3SMV A;  2G0A A;  7ICT A;  4FCW A;  5FLX S;  3N7P D;  4IBG A;  1X42 A;  4IBK A;  1DGG A;  4BJQ A;  1DGB A;  3QWL A;  2VF7 A;  4MGH A;  3T38 A;  2H3F A;  3A46 A;  4X5V A;  1FJG M;  2JNH A;  3Q8P B;  4QWD A;  4C80 A;  4ED2 A;  2OOA A;  1TAM A;  4ECY A;  2R65 A;  3WU2 U;  1URJ A;  4II7 A;  4XBO A;  4M9L A;  4I2D A;  4HYK A;  1ZOL A;  3QUQ A;  4QHT A;  4CGZ A;  1WIV A;  4DR7 M;  4LJ9 A;  4DUZ M;  3HX0 A;  1SL2 A;  2BCQ A;  2AXT U;  2W11 A;  5KFA A;  1T94 A;  3MK6 A;  2E3T A;  5KFL A;  1EIJ A;  1ARO P;  1UFZ A;  3ZCB B;  3BS5 A;  4WJ3 B;  2FPL A;  1A5T A;  3TAP A;  3GIL A;  1SXD A;  5III A;  4OCZ A;  1PK1 A;  1Z4N A;  2IHN A;  2V1U A;  2DZL A;  3SAG A;  2ZG6 A;  8ICZ A;  4NWI A;  3TFR A;  2F8L A;  1PUZ A;  2PI5 A;  3FDS A;  4GRI A;  3DDH A;  1UT5 A;  1PJQ A;  2OPF A;  4DSE A;  4AKG A;  3H4J A;  4RT3 A;  3BZK A;  2ODG A;  4JWM A;  1PM5 A;  3UM9 A;  2KRK A;  4J9P A;  4IQW A;  4DR6 M;  3PW4 A;  3NWL A;  4RPZ A;  3I01 M;  1RXV A;  3VC8 A;  5BOM A;  3NVY A;  1PJS A;  4JXJ A;  5ITX A;  4QNM A;  3PST A;  3QU7 A;  1SG9 A;  4YVZ A;  1YZ7 A;  9ICV A;  2R0I A;  2LYA A;  1V92 A;  3ZI4 A;  1BVS A;  3NBI A;  2W3S A;  7ICK A;  4KX5 A;  3JPS A;  4M9Z A;  4KO8 A;  3DV9 A;  1OXJ A;  2QKQ A;  2R62 A;  4IR9 A;  3D6J A;  1L3T A;  2Y20 A;  7ICM A;  3PO5 A;  4BLC A;  2CV2 A;  4UAY A;  8ICW A;  3KOW E;  1V34 A;  1X66 A;  1RPL A;  2W82 A;  3QZ7 A;  2OM6 A;  2MH8 A;  2MSN A;  2MRL A;  1ZQP A;  2YQE A;  5HHH A;  4KLG A;  3EIH A;  1WWV A;  3NBX X;  2BR0 A;  5L9X A;  4KLT A;  3SHF A;  1U49 A;  1ZQZ A;  1U47 A;  4ITQ A;  1SKS A;  2WB1 C;  2WZJ A;  2KVC A;  4DSJ A;  1ZJM A;  2DWM A;  1IFY A;  3TAC B;  5ALK A;  4DFD A;  4DV7 M;  2QEN A;  5FTN A;  4DSK A;  5EQT A;  1KW4 A;  5FTK A;  2V1C A;  1N36 M;  4G6Z A;  3MFI A;  2CHG A;  3FTE A;  1WWU A;  2D7E A;  1YE9 A;  3F92 A;  4MFF A;  1OW5 A;  3BXW A;  1JRO A;  2K60 A;  3KW6 A;  2GNO A;  1DGF A;  3I4Y A;  4UBB A;  1L8Q A;  5IRE B;  3LCU A;  2LKY A;  3CF6 E;  2W7P A;  2KHH A;  4RQ5 A;  2FLP A;  1MSW D;  1NK4 A;  1J2N A;  2H3V A;  2LM1 A;  2LHC A;  2QPA A;  1PVP A;  3IRU A;  3LYS A;  5KFF A;  1FFV A;  2XY5 A;  7ICN A;  3CRX A;  2L7H A;  3SMS A;  1O08 A;  3ZDE A;  4JB3 A;  4RQ0 A;  2BDP A;  3BBZ A;  2XGQ A;  3M6Z A;  9ICN A;  1SKW A;  1KSP A;  4KOD A;  2KEY A;  1IXS A;  2F5P A;  2W8K A;  4F91 B;  5JU5 A;  3U6Q A;  1PRB A;  3CNH A;  3RH5 A;  5AM3 A;  4LGM A;  2HHV A;  4LF7 M;  2WAQ F;  2CWB A;  1LB2 B;  4LJ6 A;  2XI9 A;  5EWF A;  1KN5 A;  2AQ0 A;  3JPQ A;  2I9G A;  2DFL A;  4C7Z A;  3QEA Z;  1QQW A;  3A45 A;  1L6N A;  4JUZ A;  5DB6 A;  1AUA A;  1QH9 A;  4F5O A;  1Q3V A;  3GLG A;  2ZAM A;  2QLT A;  3PNV A;  3V6H A;  4RT2 A;  2ALZ A;  4BUG A;  3I51 A;  1S76 D;  3RGS A;  4FO6 A;  2W9C B;  3RBD A;  2LHT A;  2IOH A;  3THG A;  4XQ8 A;  4JV0 A;  3ED5 A;  1ZD5 A;  3MC1 A;  7ICU A;  4LZD A;  3K1Z A;  4AKH A;  3RAQ A;  4LFA M;  3NVV A;  1IBL M;  3PO4 A;  4E0D A;  2AHM A;  2LBO A;  1B43 A;  3DFZ A;  2Y9T A;  2A1J A;  4WW0 A;  3MGH A;  3TQS A;  2OQ4 A;  2VJ4 A;  4B9M A;  2HHS A;  3GPU A;  3K9O A;  2VA8 A;  4GKK M;  2K6B A;  1MQ2 A;  8ICH A;  1K82 A;  1G3I A;  2W9C A;  3KOY E;  4ECT A;  3BQT A;  1V97 A;  4AG5 A;  2FMS A;  3IHQ B;  4QZI A;  4YR0 A;  4P0Q A;  2ATL A;  4QZG A;  4AQY M;  1B0X A;  1DK2 A;  1KL9 A;  3UQ0 A;  1E94 E;  1L7O A;  3C21 A;  1ZQF A;  2OYY A;  3GRY A;  1S0O A;  4QHS A;  4KLU A;  2QAR B;  3OHA A;  4NOO B;  2GLE A;  4KLF A;  3GII A;  2CRX A;  2WSF F;  4MGY E;  3IEC A;  2E8M A;  5B66 U;  2ESE A;  1GVN A;  4F2S A;  4LFC M;  4QWB A;  3TPZ A;  4DFP A;  2C99 A;  3QU5 A;  2L5Y A;  5KG0 A;  4G3O A;  4CJ6 A;  2QB0 A;  3BJY A;  2CEA A;  1L1T A;  4JWN A;  3H0L B;  4NLC A;  8ICB A;  5EP2 A;  1GO5 A;  4YMM A;  1D2N A;  1WUD A;  4RQ4 A;  5ALU A;  5F9N A;  8ICR A;  2ZUD A;  1ZQY A;  3PFI A;  4JV1 A;  5CR0 A;  1BPZ A;  5IT9 S;  5J2A A;  3HHW A;  2UVW A;  4R3D A;  2KA6 B;  7ICE A;  5DG9 A;  3KFU G;  4AKI A;  2K8B B;  2RHF A;  7ICR A;  2KIV A;  4G3I A;  1S0M A;  1U45 A;  4J9K A;  2XFS A;  4OJ6 A;  4DV5 M;  8ICL A;  5KNI A;  4OJP A;  1ZQE A;  3QYE A;  2IHM A;  2QB1 A;  4J9N A;  5ALN A;  1SZH A;  4DQQ A;  5J8Y C;  5J2E A;  3FYD A;  5ITY A;  5ALO A;  1XC8 A;  3U5Z B;  4PZO A;  2F5Q A;  4DL2 A;  2H3Z A;  2KXE A;  3A98 B;  4DR1 M;  5KQ8 A;  1L8O A;  3IG5 A;  2HBK A;  8ICS A;  2DKZ A;  3I4V A;  3EZ5 A;  4FD2 A;  1RYS A;  3Q8X A;  4NL9 A;  5J2C A;  4LJ8 A;  9ICI A;  1Z5C A;  3QZ8 A;  4J9Q A;  5KG1 A;  4AYB C;  4DV6 M;  5DG8 A;  4P0P B;  1XMO M;  1QZM A;  4CIZ A;  1IN8 A;  2DKX A;  3V7L A;  2QBY B;  3PX4 A;  2DXI A;  3SV3 A;  3MR2 A;  5AKZ A;  2NQ8 C;  2HCF A;  3EPG A;  3C2L A;  3U5Z A;  1BPD A;  2GO7 A;  4PCZ A;  3ZC7 B;  3GLH A;  1D0L A;  4MEX A;  1A6S A;  3HP6 A;  3GLF B;  1T7P A;  2FH0 A;  1NKB A;  2BCS A;  9ICF A;  2W9B A;  1NNJ A;  1PGY A;  2IOF A;  4AI6 A;  4DS4 A;  1VDD A;  4IBD A;  3KZX A;  1G41 A;  3EW9 A;  3K75 D;  4NL9 C;  1S10 A;  1JR3 A;  7ICO A;  4JV2 A;  5KL8 B;  4X62 M;  1K5O A;  1MC8 A;  1QQ7 A;  4I2C A;  1DOQ A;  4Z6Y A;  3RTV A;  3N4M B;  1UHU A;  3U6C A;  4FVM A;  4B3T M;  2FS1 A;  3TQ1 A;  3L27 A;  1XSN A;  1A77 A;  2YQZ A;  3BQ1 A;  4B3S M;  2B21 A;  4YMN A;  1NKE A;  9ICR A;  1OQY A;  4BBA A;  3HJE A;  2VDB B;  2VQF M;  2C2D A;  2HSZ A;  4UB5 A;  3GLF A;  4UB8 U;  4DV2 M;  3RRH A;  1X9W A;  4CNQ A;  4ECX A;  1RYR A;  1KTQ A;  3M0E A;  1PJJ A;  4TUP A;  5ALE A;  3J2P B;  2AGQ A;  2XH9 A;  2E1F A;  1ZQR A;  8ICI A;  4O3N A;  3SAT A;  1JUD A;  4NLK A;  3HY5 A;  1LKY B;  4ZH4 A;  5DKW A;  4RQ8 A;  2CHV A;  3H4M A;  2R8K A;  3L28 A;  4I2J A;  2MA1 A;  4J9M A;  3HU2 A;  5ITR A;  5ITX E;  4F5R A;  3PW7 A;  3KD3 A;  5KFZ A;  1KBU A;  3F2C A;  4Z6F A;  5EP3 A;  1X9S A;  5KG2 A;  4Y2U A;  4QZE A;  1SXJ B;  2ZIX A;  4F5N A;  3E2E A;  3K8Z A;  5E6J A;  3U60 B;  4DFM A;  1HUO A;  3DEE A;  1XXH B;  9ICH A;  2KNV A;  1KDH A;  4UW9 A;  3VDP A;  3ALR A;  1LKY A;  2ZJ5 A;  8ICU A;  4B08 A;  1O03 A;  1FIQ A;  3IV6 A;  5KPR A;  4KT0 F;  2E5L M;  1F0M A;  5KFM A;  1KFV A;  1Z1B A;  2G07 A;  5DB8 A;  2L2D A;  1R2Y A;  2NYV A;  3MDA A;  1UCV A;  4NSR A;  4NLB A;  3LCV B;  5GTI U;  3AL0 C;  1TDH A;  1XWI A;  4FW9 A;  1XNS A;  4U6P A;  1XB2 B;  3KSX A;  3K9P A;  5AI0 A;  2LVO C;  5KT4 A;  1NY6 A;  2MRO B;  3U60 A;  2WF7 A;  3JPR A;  4FBT A;  1SL0 A;  3H4D A;  1XXH A;  2LHG A;  3GPX A;  3HKP A;  3AN1 A;  5EXT A;  2CPR A;  2KZ3 A;  3GU3 A;  4Q8E A;  1J09 A;  4DO9 A;  1KFT A;  2I7P A;  5C5J A;  1C1K A;  5ALX A;  3MGI A;  1NK9 A;  5DGA A;  2F76 X;  3E9S A;  3MMP A;  4RNO A;  3C5F A;  4NLZ A;  4TQS A;  3T1H M;  3GIM A;  2KEB A;  2EZX A;  2BDU A;  3GRU A;  3GDX A;  3N97 B;  5KFP A;  2J7N A;  5ALG A;  1DGH A;  2EDU A;  3B9P A;  3V76 A;  4Y2V A;  2DWZ B;  2PKE A;  2ZJA A;  1SV4 A;  4R63 A;  2XSZ D;  3K1R B;  3D2Q A;  5KT3 A;  4GC9 A;  3WK8 A;  5ITQ A;  4ED6 A;  3B7N A;  5KAF U;  3KHR A;  4KLS A;  1L3S A;  5ALV A;  1IY2 A;  3CF0 A;  5TIS U;  7ICF A;  5J2D A;  4MM3 B;  2RP5 A;  4XK8 F;  3ONN A;  3NRZ A;  3L29 A;  2W3R A;  3O0F A;  2JEI A;  1EFU B;  4EEY A;  4I28 A;  4IC9 A;  1A0P A;  5KFH A;  2JEJ A;  1WJ7 A;  9ICC A;  4EX6 A;  5KFD A;  4EEN A;  4LVS A;  1HUZ A;  3WKD A;  3OTO M;  5FSW A;  2J6T A;  3N7S C;  2R46 A;  1FNN A;  1TTE A;  2JY7 A;  3HU1 A;  1ZQI A;  2EZZ A;  5J0Y A;  1J2M A;  1JI7 A;  1SIJ A;  4ED3 A;  1D0M A;  2L09 A;  3AOE A;  1B22 A;  5J0R A;  1BPE A;  4R65 A;  5KFE A;  1Z6T A;  2HVH A;  2ISP A;  3UZU A;  3VLF B;  4Y2X A;  2E8P A;  5J0S A;  9ICX A;  1XC9 A;  4C0Z A;  1NI3 A;  3SEI A;  4QOZ C;  1S0V A;  4UQG A;  1N48 A;  3M8S A;  2R6F A;  1PVQ A;  2PFN A;  2YR0 A;  5EP4 A;  3SYK A;  4YFK A;  4QZB A;  3KHG A;  4LF5 M;  4K4G A;  2HOQ A;  4B3M M;  2JZB B;  1V85 A;  4J9O A;  4DOC A;  1SZP A;  2XZF A;  2WF5 A;  4DSI A;  5DQG A;  9ICA A;  3RB0 A;  5ALL A;  3HPO A;  4MF8 A;  3WKC A;  1JRP A;  4M6W B;  4ED0 A;  3BS7 A;  1ZQU A;  1G71 A;  3DZD A;  3BOS A;  5KT2 A;  3C3E A;  1HNZ M;  3H8M A;  3NGD A;  2DWN A;  4QW9 A;  7ICP A;  2K0B X;  8ICP A;  4F4W A;  2VQE M;  2YY6 A;  3NRW A;  3C1Z A;  1T3N A;  1U48 A;  3H0M B;  5JI3 E;  2XIC A;  2M60 A;  4KLH A;  1DO2 A;  1VEJ A;  4DL4 A;  2JZ0 A;  1QLN A;  1WCN A;  4RQM A;  2BQ3 A;  4IBE A;  4PDG A;  4FWD A;  4KMU A;  1LVH A;  1IXR C;  4Z8X A;  1ZJN A;  1ZQB A;  1XNQ M;  2K47 A;  4NSO B;  3M7D A;  1JX4 A;  4MB7 A;  5ALY A;  3M8R A;  3JAM S;  3LWM A;  3OPX A;  1PVR A;  4Y28 F;  2M0N A;  3M6A A;  3WK7 A;  3KS8 A;  3EUB 2;  2DQN B;  1NKC A;  5FTL A;  1OFH A;  2C96 A;  2KJ8 A;  5HR6 A;  2DI0 A;  4US9 A;  5L1J A;  3ZQJ A;  1R6B X;  3U6E A;  5AI4 A;  3ILK A;  5JRT A;  1L7M A;  2R8H A;  5CJ7 A;  1U4B A;  2JH7 A;  5KT6 A;  4TUQ A;  9ICJ A;  3B9J A;  4YR3 A;  4IRC A;  3KVW A;  3AV0 A;  3W0L B;  7ICG A;  1Z3E B;  1ZQG A;  3CYM A;  3B0X A;  4KLD A;  2YMQ A;  2UXB M;  3BS5 B;  4I2I A;  2CP8 A;  2WB1 F;  4KIT B;  3SAF A;  4RKU F;  1TGU A;  4B7F A;  1NV8 A;  4G4Q A;  3J81 S;  1PK1 B;  5G5G A;  3MR3 A;  3PX6 A;  2DAI A;  2FDR A;  2J6S A;  2Q2E B;  3GIJ A;  4O0I A;  4HLQ A;  1NJZ A;  1YUB A;  4KLL A;  1L2B A;  2EUC A;  2F1J A;  8ICA A;  2Z4R A;  5FTJ A;  4LZG A;  2LYB A;  2E8N A;  4QOS A;  3U6O A;  1N63 A;  1QQ6 A;  3V7K A;  2H3I A;  1QCK A;  4BB9 A;  1ZQD A;  4P4M A;  5J2H A;  1JAL A;  5KFG A;  2JUJ A;  2FNA A;  2XO7 A;  5HR7 A;  5DB7 A;  3LK9 A;  1F5S A;  5DBA A;  1B4F A;  5KG4 A;  2VIX A;  4YG2 A;  5KFR A;  2W8L A;  4A3V B;  4UB1 A;  3PVS A;  3WK9 A;  2I6X A;  9ICO A;  3G6V A;  3ETR A;  1L3U A;  2BPG A;  4FS1 A;  1TFR A;  1BPB A;  2G5H B;  2Y1J A;  5IZ7 D;  2GWS A;  1WR1 B;  2KE7 A;  9ICP A;  2MAX A;  3UMG A;  1D0K A;  5CWR A;  4EEK A;  2A3V A;  2LTU A;  2KKV A;  5JI2 E;  1PJI A;  4FE3 A;  3V6K A;  4ZPX A;  4DF4 A;  2KZU A;  3C2K A;  5AKI A;  2KZM A;  4I2F A;  5DBC A;  1TK8 A;  4DQP A;  4NY8 A;  1JR3 E;  2V4Q A;  2AQ4 A;  3FTF A;  1VLB A;  2C22 A;  4KLO A;  8ICK A;  5DDM A;  2VII A;  3THV A;  4B9N A;  1NK5 A;  3FUX A;  3DA1 A;  5AM5 A;  3WHK A;  1XMQ M;  3J7A S;  2Q0Z X;  4ECW A;  5A2Q S;  3ZD8 A;  4DS5 A;  1MQ3 A;  3V6J A;  3GLI A;  3D2N A;  3GLF E;  3M9M B;  2KNA A;  3UJN A;  3M9O B;  1QDR A;  1RM6 C;  5G5H A;  2KHQ A;  3L5K A;  3KP1 E;  4GXI A;  5EWE A;  3SMP A;  4QW8 A;  5DG7 A;  1N56 A;  4LF9 M;  1UT8 A;  1JR3 D;  3JPP A;  2HHU A;  4DL6 A;  3GRR A;  4QWC A;  4RQ2 A;  5KTQ A;  2YMP A;  3HZJ A;  4C8L A;  1G4A E;  4DR4 M;  1D8Y A;  3SAV A;  2DPI A;  5KFY A;  3ISD A;  3HGI A;  2C2R A;  3H4B A;  1DGS A;  1ZQT A;  2LH0 A;  3SAS A;  2KSO A;  4O3S A;  1S8O A;  1MN8 A;  3RB3 A;  3JR5 A;  4GMQ A;  1ZQN A;  1QZE A;  4Y2T A;  4PH5 A;  9ICT A;  1QYR A;  1JB0 F;  2DWQ A;  4NV0 A;  2VA3 A;  4IRK A;  4KMO B;  5ALD A;  5DBB A;  4BWM A;  5IWA M;  2LXE A;  4P16 A;  5KO3 A;  1N60 A;  5KFU A;  5ALI A;  3L4P A;  4B3R M;  1OKS A;  2JMG A;  2QZ4 A;  4PGY A;  2DWL A;  3FYC A;  5KFK A;  3RJF A;  1IXS B;  1N33 M;  4FBU A;  2K4E A;  5J29 A;  4O3Q A;  4M9X A;  8ICC A;  4MGI E;  4L16 A;  5DB9 A;  3MR5 A;  4KLM A;  2G8L A;  1X2I A;  4M9N A;  4O5C A;  1KSF X;  2ZAO A;  3LW5 F;  1TAQ A;  2Y0S C;  1SXJ E;  4Q44 A;  3GO8 A;  2FPK A;  1ZYQ A;  2JEF A;  3GQC A;  1JN3 A;  1E9R A;  1XXH E;  1IBM M;  3LWL A;  3GLG B;  2BGW A;  1ZQJ A;  1OIZ A;  2APL A;  2AH5 A;  8ICO A;  1Z19 A;  2OXO A;  1VG5 A;  2E1E A;  3VKG A;  1SGG A;  1KQQ A;  2B0C A;  3G6X A;  5GKN A;  3TAD C;  4NC6 A;  2QNJ A;  3IHP A;  4LZJ A;  3MAB A;  5E79 U;  4QNR A;  4FWH A;  3AQE A;  4LZZ A;  2QQ8 A;  3T79 A;  1SXJ D;  2RRD A;  2JEG A;  2KZZ A;  2BQU A;  2A1J B;  2LM4 A;  4GHL A;  1OAI A;  1S3S A;  1UPH A;  4Q43 A;  3RJG A;  2YX8 A;  1WCL A;  4PHE A;  3EWA A;  3PSI A;  2B6G A;  4M9G A;  4NRV A;  2DBY A;  2NRV A;  2IA6 A;  5KFO A;  4AG6 A;  2R8J A;  4PZN A;  3F2B A;  4RU9 A;  4X65 M;  2KDL A;  2LYH A;  2QP9 X;  4M9H A;  1ZD3 A;  3Q8S B;  1NK0 A;  4P0Q B;  2MUT B;  1E9S A;  3ICX A;  3RH4 A;  2LPE A;  4AYB F;  1Q39 A;  3FRI A;  2PFQ A;  5HNK A;  8ICX A;  2BJW A;  1P7D A;  2YTU A;  2OH2 A;  5BOL A;  3E58 A;  1RZT A;  4F2L A;  3K92 A;  5BPC A;  1IIP A;  4Y2S A;  2G09 A;  5EE3 A;  1ZV1 A;  4GC7 A;  4EBE A;  3GRV A;  4R8U B;  2PFO A;  1TH4 A;  2QB0 B;  4Y2Q A;  2DEN A;  3UXN A;  4QIW C;  2GH1 A;  5EXS A;  3ZD9 A;  4JI8 M;  1IN5 A;  3HJQ A;  4FZN A;  1QVR A;  2MUT A;  5ITU A;  2KG5 A;  1YZ6 A;  2FFJ A;  5HHI A;  3CP8 A;  2RKO A;  4DL7 A;  4J9L A;  4QWE A;  3D8L A;  2R8I A;  9ICK A;  2N35 A;  3C3D A;  3F5E A;  2P6R A;  8ICF A;  1X40 A;  2JR5 A;  4L4U A;  5KPT A;  3FM9 A;  5AI8 A;  1Z00 B;  3EPI A;  3Q8L A;  5J8Y A;  4Y2P A;  1NK6 A;  3PSP A;  2ZXI A;  3B7Z A;  5J0Q A;  3MDC A;  1ZXI A;  1WHC A;  1Q3B A;  4R8U A;  3ORY A;  5KFN A;  2KFN A;  2W43 A;  3U6M A;  4FCT A;  2RQ5 A;  2AJQ A;  4JYA M;  3NUQ A;  4DEZ A;  1NK7 A;  4LJ5 A;  1RG6 A;  1WGL A;  4G4R A;  3UMC A;  1IQP A;  4JI3 M;  5ALQ A;  4BX9 C;  4CF5 A;  2PXI A;  1Z1V A;  1KLN A;  1P3Q Q;  3ISC A;  4JI7 M;  5KL1 B;  2A1A A;  3TAN A;  5CHG A;  5EXX A;  3IDW A;  4HAI A;  3SZ2 A;  4PL2 A;  4F1I A;  2WFA A;  1BPY A;  1W5S A;  4IL6 U;  2HVI A;  4M0D A;  1Z00 A;  2XFT A;  5DDY A;  3BQ2 A;  3PXG A;  4RNA A;  4QZA A;  9ICE A;  1RDF A;  3IG8 A;  3A0H U;  4IBJ A;  2YB4 A;  3TFS A;  2XGN A;  4MGK E;  3L26 A;  1N77 A;  1TH2 A;  1UA1 A;  3TE6 A;  4MGZ E;  5DYG A;  3LMM A;  3KBB A;  3MGV A;  4GH9 A;  5J0W A;  3U6P A;  3RR7 A;  3WK4 A;  3GLH B;  8ICG A;  4QZC A;  4UB2 A;  3JPT A;  9ICU A;  3M1Y A;  1N2X A;  2K8C B;  2KK0 A;  1DK3 A;  2W9B B;  1IM4 A;  2X4A A;  4QZH A;  3HKZ C;  1QDT A;  3GPP A;  5KFC A;  2BHN A;  1R2Z A;  4JV5 M;  4QZF A;  4UB3 A;  3ETL A;  3KFU F;  3AJI B;  3HWS A;  5HML A;  4RQ1 A;  1MU5 A;  3OJS A;  1TAU A;  4QZ8 A;  4FZM A;  1Q8K A;  1WGN A;  1DGJ A;  2KD1 A;  1GLN A;  4NJ8 A;  8ICY A;  4KLQ A;  3VFD A;  4QNL A;  5KG3 A;  2BNK A;  1J97 A;  1QAM A;  5F3W A;  4BGD A;  3LDA A;  4PHA A;  2L4E A;  5AKE A;  2LNH C;  1IV8 A;  4QWA A;  1ECW A;  5AIA A;  3QUC A;  3AU6 A;  3C2M A;  3QUB A;  2WSE F;  4MH0 E;  2EZY A;  1NHG C;  2WF6 A;  1TKD A;  2ZUC A;  4XA5 A;  2E8O A;  1N34 M;  4ED8 A;  2H1R A;  5AM0 A;  5ALJ A;  2UVR A;  3FTC A;  1Q3U A;  4M0W A;  4F5Q A;  3HHX A;  7ICH A;  1NNU C;  2Y0T A;  4YHH M;  4TUS A;  3PNC A;  3AL0 B;  3QU9 A;  2R8G A;  3PR5 B;  1S9F A;  4IBI A;  3PR4 A;  4EZ6 A;  2XF3 A;  4TUR A;  3K2L A;  2O6K A;  2ZM6 M;  4UBC A;  2ZIX B;  3D2S A;  2JH1 A;  3GQ4 A;  3MR6 A;  3H0R B;  4RZR A;  1KYI A;  2HOF A;  2YB1 A;  2G08 A;  3RB4 A;  1MN3 A;  4UAT A;  3UXO A;  1Z5A A;  2PI4 A;  1MJG M;  3FAH A;  3T1Y M;  4RQ7 A;  5AM4 A;  4CRX A;  1ZRN A;  3B0Y A;  3T5H A;  3E4R A;  3U6D A;  1V9P A;  4O3P A;  3WKB A;  4L6V 6;  4LG2 A;  4PD2 A;  5J2I A;  2Z7J A;  4OJL A;  3H8J A;  4RQN A;  1R4G A;  3GQ5 A;  4CF4 A;  5C0Y A;  4WUR A;  2HL7 A;  4A8E A;  5KFI A;  4F71 A;  5DYI A;  4LF8 M;  3AMZ A;  2UU9 M;  2VKQ A;  2DL0 A;  2X49 A;  5CA7 A;  2JY5 A;  2ZIW A;  2F2A B;  2R4J A;  4ED1 A;  9ICB A;  3L3F X;  2KJ9 A;  2LI6 A;  4B7G A;  2DZO B;  5KFV A;  2F1I A;  5C1B A;  2CV1 A;  4F4Z A;  2RLT A;  2FMQ A;  1DGH B;  2GOL A;  3FD9 A;  3FRH A;  3PY8 A;  3AM9 A;  2LMR A;  3BDP A;  4GFJ A;  2LVQ D;  1X37 A;  2HBJ A;  5J2J A;  1OFI A;  4DQR A;  4LGY A;  3AEV A;  3CTW B;  1Q3C A;  4JN6 A;  3PNY A;  4M2Y A;  3RE8 A;  2I7N A;  2XGP A;  2HKJ A;  1N78 A;  4FFD A;  3E46 A;  2HHQ A;  2HCB A;  4W5W A;  4AW4 A;  4JI4 M;  2UXC M;  2M9N A;  2L7I A;  1LV5 A;  3RB6 A;  5T14 A;  1H38 A;  3FUT A;  1N32 M;  2FMP A;  3OTQ A;  5AM2 A;  2HMX A;  3RFW A;  2HHH M;  4DFK A;  4YXM A;  2KKP A;  3FKE A;  4OU7 A;  3UPQ A;  3NS1 A;  5AKG A;  3B7Q A;  4D82 A;  1COK A;  2R44 A;  4KHP M;  4MEY A;  3QXG A;  1QAO A;  3PVX A;  2ZIU B;  4I8O A;  4GC6 A;  1TV9 A;  2UVV A;  5CRX A;  4CF3 A;  4YQW A;  4LJ4 A;  4GKJ M;  3LVW A;  2FJ6 A;  2VAN A;  5ALH A;  3SD7 A;  5DFL A;  2HHX A;  1E32 A;  2KJ5 A;  3FYH A;  1HQY E;  3TKA A;  1GL6 A;  3I76 A;  1ZET A;  3I04 M;  2W55 A;  1DRG A;  1S77 D;  3L2A A;  2HDO A;  2KOB A;  3PW0 A;  3A42 A;  4RPY A;  4I4L A;  1OUQ A;  1F44 A;  4NM1 A;  2CUZ A;  3N7R C;  3UMB A;  4DLE A;  4NM2 A;  4EX7 A;  1K1S A;  2ZIU A;  4F3O A;  4YN4 A;  2FLN A;  5DNY A;  1HT2 E;  2EKK A;  2D7G A;  3SBJ A;  2XCA A;  3FC4 A;  2AGO A;  2C28 A;  2EQY A;  2EAM A;  3GLG E;  7ICL A;  2OEH A;  1IBK M;  5EJC A;  2BQR A;  4KN4 A;  4O3R A;  2VJ5 A;  4NXM M;  2ISO A;  3PX0 A;  1XHB A;  3C9P A;  3U61 A;  2Y21 A;  4RQ3 A;  4RF0 A;  1KFS A;  4LY6 A;  1IXR A;  2JRZ A;  4UAW A;  3VKH A;  2EAP A;  4MFA A;  1IXZ A;  4B7H A;  2LVA A;  4L15 A;  3WK6 A;  3JPO A;  3R9X B;  4DV4 M;  4KTQ A;  3NAS A;  3VK8 A;  1L2C A;  5DGB A;  2UVU A;  3H7I A;  1FFU A;  5AK3 A;  3GIK A;  2C5R A;  4G9B A;  2CRU A;  1TVA A;  4OO1 J;  1COO A;  2EJS A;  2FOI C;  4G4N A;  4X64 M;  4Q7J A;  3C5G A;  4M9S A;  2G5G X;  1FO4 A;  3TAR A;  4M04 A;  1NSF A;  2WSC F;  1YSY A;  4BWJ A;  2NO4 A;  4UAV A;  4DV0 M;  1TE2 A;  4USA A;  5E26 A;  4QJF B;  3BQ0 A;  2ZAN A;  4B9U A;  4ELV A;  4M9J A;  4DWI A;  5H37 D;  4PHD A;  4BXO A;  2EH9 A;  4Z6E A;  5KFQ A;  1KKX A;  1OTR A;  1SB3 C;  1HR0 M;  4QZD A;  3T5J A;  2RRU A;  4C7Y A;  5AIB A;  4R71 A;  2FI1 A;  4U7C A;  4UB4 A;  4GLX A;  2ZTC A;  2UXD M;  4C8M A;  3W67 A;  5EOZ A;  5L1L A;  8ICM A;  2OWO A;  1F4I A;  8ICQ A;  2KW0 A;  4MFC A;  3RJE A;  4I27 A;  1IN7 A;  5AIC A;  1YLA A;  2F1H A;  3BQ7 A;  4OJO A;  1SWV A;  2RGH A;  2A19 A;  1KFD A;  2D8C A;  1AIP C;  1XU4 A;  3TI0 A;  3M6K A;  1GAB A;  1RYU A;  4O5K A;  1UQV A;  2PMZ C;  2BCV A;  3SAU A;  1QUT A;  4I81 A;  4YP3 A;  4FZL A;  1IY1 A;  4ECV A;  1TF0 B;  5B5E U;  5AK4 A;  1CEZ A;  2LVN C;  1V38 A;  3CF2 A;  2FE9 A;  1ZQQ A;  3HWT A;  2HI0 A;  2K4I A;  1QAN A;  3V72 A;  7ICV A;  4DL3 A;  2O5R A;  1NHW C;  1ZQH A;  5K4L A;  3LVV A;  3OSP A;  5ITT A;  1PJT A;  1DXS A;  1JMS A;  2P35 A;  4L78 A;  2LVP C;  5CEH A;  4NXZ A;  4JK1 A;  1V33 A;  3ZH9 B;  4UAS A;  4KLI A;  4ANR A;  4WP2 A;  2KNZ A;  3ZDD A;  5IIK A;  2ZUB A;  2K89 A;  2V4R A;  4GEW A;  1HIW A;  1ZQ1 C;  5JUM A;  3S6J A;  2JHD A;  4REZ A;  1NZB A;  2J6U A;  1XS9 D;  5IIN A;  5AI6 A;  2Y0S F;  3E21 A;  5KQD A;  1BNP A;  8ICN A;  1SWW A;  4X66 M;  1SXE A;  2QCU A;  2QSF X;  3QAU A;  2EA0 A;  1RQL A;  3GLH E;  4B6J A;  3TWK A;  2O25 A;  3GLI B;  2IOF K;  2XID A;  8CAT A;  2Y0Q A;  2R4E A;  1LV7 A;  5H2F U;  2DUY A;  4DV1 M;  1QSL A;  1R7R A;  3PML A;  2XY7 A;  1HNX M;  1XNR M;  4K4H A;  3E0F A;  1X9M A;  3C23 A;  3DOA A;  4EZ9 A;  1GJS A;  1BPX A;  7ICI A;  1NO1 A;  4IBC A;  1TH3 A;  4IQT A;  2UUC M;  5L1K A;  4J9R A;  2ZTE A;  3KSJ A;  2O01 F;  3Q8R B;  2C9O A;  4F50 A;  2V9W A;  5D46 A;  4YD2 A;  4IIW A;  2KSO B;  4KLE A;  1UM8 A;  5AKJ A;  1QQ5 A;  2KIW A;  4RQ6 A;  2JP7 A;  3QUT A;  4YCX A;  2DHY A;  1HNW M;  2ZIV B;  5AKX A;  5D49 A;  1BNO A;  3T15 A;  3SYL A;  3AU2 A;  1N61 A;  1L7N A;  5FTM A;  1RQN A;  3PZP A;  3D8B A;  4TUW A;  2F3N A;  2DPJ A;  4NLG A;  3AUO A;  1GKI A;  3SAR A;  4IQU A;  4GIB A;  1ZMV A;  2HHW A;  2F77 X;  3SHG B;  1U9L A;  4K4I A;  2P6U A;  2K4H A;  3ZDC A;  4JI6 M;  1RXW A;  2DF4 B;  2V6Z M;  2YMM A;  4PGQ A;  1R5L A;  1ZQW A;  3ISB A;  1ZQC A;  3J27 B;  3RJJ A;  1QUS A;  4IJE A;  3Q8G A;  3KDS E;  2ZIV A;  1Y88 A;  4F4X A;  1T3Q A;  4O3O A;  2F8K A;  4P17 A;  4G4O A;  4DFJ A;  4J03 A;  3HW8 A;  5BPV A;  3G6Y A;  1ZD4 A;  3IN5 A;  4FS2 A;  1ZRM A;  2D6F C;  4QIW F;  4DQS A;  2JXJ A;  3MJ5 A;  4NLN A;  1NZP A;  9ICW A;  3RR8 A;  4FWG A;  4LCB A;  3TAD A;  4DL5 A;  2HW3 A;  1T3T A;  2XSZ A;  5KT5 A;  1OIP A;  4RPX A;  5A0L A;  2BWB A;  3KOO A;  3FE3 A;  1NJG A;  2M5Z A;  4XGI A;  1K1Q A;  5CB1 A;  2CFO A;  3W0F A;  3GZF A;  4P4P A;  3QU4 A;  4P2H A;  2CE7 A;  5EWG A;  1Z4O A;  1ZQO A;  2BCU A;  3TWL A;  2DKL A;  3EYZ A;  2OO9 A;  2P66 A;  1CI4 A;  3OJU A;  4ECR A;  4C4R A;  3SV4 A;  7ICS A;  3AOG A;  2LWX A;  4I5S A;  2W9A A;  3IP4 B;  1Z5B A;  5EXP A;  3HRD D;  1XO0 A;  5J2F A;  2AGP A;  1ZMW A;  4ED7 A;  4IS7 A;  2JGA A;  2DAK A;  4DSL A;  9ICQ A;  1VDV A;  4GHA A;  1Z59 A;  5KG5 A;  3TWM A;  4F4Y A;  1A76 A;  4OJ5 A;  4CDG A;  2Y1I A;  3F5A A;  1CRX A;  5JTI A;  1D8B A;  1VQ1 A;  2KMD A;  2WHE A;  2W03 A;  4XRH A;  2OCE A;  1G59 A;  2VF8 A;  2WTF A;  1ZQA A;  2NO5 A;  4ACO A;  3FUW A;  5ALF A;  3T3F A;  7ICJ A;  2AHO B;  3KP0 E;  2JWS A;  2NRX A;  4O5E A;  2BPF A;  1N75 A;  4RNM A;  2ES6 A;  4O9M A;  4JI0 M;  4AZF A;  5AM1 A;  5J0U A;  3RJK A;  1J7K A;  1MX0 A;  2DNA A;  1Q02 A;  4IR1 A;  2XVT A;  4F2R A;  1AQ6 A;  2KN7 A;  3HKZ F;  2ZJ8 A;  8ICV A;  4EIW A;  4F92 B;  4ELT A;  2JY8 A;  2HBM A;  4LJX A;  4M0A A;  2CN1 A;  3F2D A;  1SL1 A;  4JI1 M;  4KLN A;  4Z6D A;  3AKZ A;  3VCB A;  1VJ5 A;  1SKR A;  2KFZ A;  4OD0 A;  1FEZ A;  2ASD A;  1T43 A;  3HHY A;  4C8K A;  4R7G A;  4CHT B;  2OHF A;  2RDI A;  3F53 A;  4F93 B;  2VA2 A;  5KPZ A;  4F8R A;  3HT3 A;  4PT5 A;  2FPM A;  2K4P A;  5ALT A;  3C1Y A;  4DSF A;  2BPC A;  3RF9 A;  4RF1 A;  3PW5 A;  3N28 A;  2KNJ A;  3SFZ A;  3OHB A;  3FTD A;  1HJP A;  2A5Y B;  9ICM A;  3HX3 A;  2BWE A;  4NRW A;  2ZTD A;  5HP4 A;  1DO0 A;  3KXE C;  4OVZ B;  2NRW A;  4B9S A;  4ECS A;  3V7J A;  1D9D A;  3VDU A;  3QEB Z;  2KIC A;  4BDP A;  1GL7 A;  5KFS A;  2HAK A;  5IIM A;  8ICT A;  1TDZ A;  1HQC A;  3JPN A;  2XC9 A;  5DQI A;  4ICA A;  3MBY A;  2HHT A;  3IM1 A;  2KZS A;  2XCP A;  3LQQ A;  1I4W A;  5AI9 A;  1KRP A;  1N5W A;  5DLG A;  3U26 A;  1IM2 A;  1NV9 A;  3PSF A;  5J2K A;  2XY6 A;  1Q46 A;  4RUA A;  4Q45 A;  3K1J A;  1PK3 A;  5ALZ A;  3UMM A;  3GV5 B;  1NNL A;  4UB6 U;  1HT1 E;  3J80 S;  2I5H A;  3J7B A;  2W04 A;  3C29 A;  2XLJ A;  3GFK B;  3KOZ E;  2KHV A;  1ZMU A;  4OVZ A;  5C18 A;  5EE1 A;  4MHV A;  1ED1 A;  2GQF A;  2R45 A;  4CCH A;  4YR2 A;  5EP1 A;  7ICQ A;  1LTM A;  1T4G A;  2DGZ A;  3HU3 A;  3T5K A;  3VK7 A;  2IMW P;  1NK8 A;  5KT7 A;  4ECZ A;  2UUB M;  3C58 A;  2Q4T A;  4J9S A;  1NJY A;  4LJA A;  3WHL A;  4Y2Y A;  3FUU A;  3Q8K A;  4YD1 A;  4I2E A;  4OW0 A;  1IN6 A;  2QAR A;  8ICJ A;  4RUC A;  2MGW A;  4JI2 M;  3UXP A;  2ASL A;  4LF6 M;  1UA0 A;  4FCV A;  9ICL A;  4B9T A;  2WAQ C;  3WKE A;  5LMN M;  4GXK A;  4C4S A;  2Z3X A;  4DOA A;  2F4V M;  1NY5 A;  5ALP A;  2JZ1 A;  5J2B A;  3I1Y A;  2DAM A;  4K0K M;  3HIL A;  3PW2 A;  4R66 A;  3QE9 Y;  2BKE A;  1IY0 A;  2DVW B;  4XUS A;  5HMM A;  5AHX A;  1NJF A;  9ICG A;  1NVM A;  4O3M A;  5J0T A;  3KHH A;  5KFT A;  3KTQ A;  1MA7 A;  2F5O A;  2P5T A;  2D7H A;  3GP1 A;  2G5I B;  4UAZ A;  4Q8F A;  1QSY A;  3I28 A;  4LFB M; 
#chains in the Genus database with same CATH homology
 3U6Q A;  3C28 A;  1E32 A;  2KJ5 A;  2FNA A;  1HQY E;  5HR7 A;  1GL6 A;  2UUA M;  1DRG A;  4LGM A;  2VIX A;  3L2A A;  4NL4 H;  4LF7 M;  2WAQ F;  3SC3 A;  4A3V B;  4LJ6 A;  2XI9 A;  2KOB A;  3PVS A;  3A42 A;  4I4L A;  1OUQ A;  1F44 A;  2K8A A;  1QQW A;  2CUZ A;  3A45 A;  3N7R C;  2ZBK B;  1L6N A;  1JQJ C;  2G5H B;  2ZIU A;  1Q3V A;  3GLG A;  2ZAM A;  3PNV A;  5IZ7 D;  1HEK A;  3AFH A;  1HT2 E;  1W5T A;  5DNY A;  4LF4 M;  3I51 A;  4CIS A;  4BUG A;  4S12 A;  2D7G A;  3SBJ A;  2A3V A;  3RGS A;  3JR4 A;  2KKV A;  2LHT A;  3THG A;  1IBK M;  5JI2 E;  1PJI A;  4FE3 A;  3FUV A;  4ZPX A;  5EJC A;  2KJ8 A;  4KX3 A;  2KZU A;  3K1Z A;  4AKH A;  4P0P A;  4LFA M;  4NXM M;  1IBL M;  2VJ5 A;  2AHM A;  2LBO A;  2QBY A;  1EE8 A;  3DFZ A;  1YT3 A;  2ZIW B;  4D80 A;  4CGY B;  1XHB A;  3U61 A;  2Y21 A;  4GIT A;  4WW0 A;  3FTF A;  4RF0 A;  4LY6 A;  3TQS A;  2OQ4 A;  2VJ4 A;  3VKH A;  4LRT A;  1IXZ A;  4B7H A;  2VII A;  4L15 A;  3GPU A;  4GIP A;  3R9X B;  4DV4 M;  3FUX A;  4GKK M;  3DA1 A;  3WHK A;  3VK8 A;  1XMQ M;  1L2C A;  3J7A S;  5A2Q S;  1K82 A;  1G3I A;  2C5R A;  3GLI A;  3D2N A;  3KOY E;  2DZN B;  4OO1 J;  2FOI C;  2R18 A;  4AG5 A;  3UJN A;  4G4N A;  4X64 M;  4M9S A;  2KHQ A;  3KP1 E;  2G5G X;  4P0Q A;  4HL4 A;  3SMP A;  4AQY M;  1L1Z A;  1NSF A;  4LF9 M;  1YSY A;  1JR3 D;  1E94 E;  3LQR A;  3GRR A;  4DV0 M;  4QJF B;  5E26 A;  2OYY A;  3GRY A;  2ZAN A;  2RGO A;  4QHS A;  1G4A E;  4NOO B;  4DR4 M;  3SAV A;  5H37 D;  2CRX A;  3HGI A;  4MGY E;  2X8A A;  1GVN A;  1WXQ A;  2LH0 A;  3SAS A;  4LFC M;  3GPY A;  3TPZ A;  2C99 A;  1HR0 M;  3JR5 A;  4GMQ A;  2E5S A;  2CEA A;  3MHV C;  1L1T A;  3H0L B;  3RGP A;  4U7C A;  4NLC A;  5EP2 A;  1QYR A;  4NV0 A;  4DR3 M;  2UXD M;  1D2N A;  1WUD A;  4KMO B;  3PFI A;  5IWA M;  2LXE A;  2KW0 A;  4P16 A;  1H6U A;  5KO3 A;  5IT9 S;  3HHW A;  4B3R M;  1IN7 A;  4R3D A;  2KA6 B;  3U6L A;  2QZ4 A;  2JMG A;  2DWL A;  3FYC A;  1IXS B;  3KFU G;  1N33 M;  3KOX E;  4AKI A;  2K8B B;  2RHF A;  4OJO A;  2RGH A;  2K4E A;  3M7G A;  3UK6 A;  4DUY M;  3M6K A;  2XFS A;  4M9X A;  2PMZ C;  4DV5 M;  4OJ6 A;  4DR2 M;  4OJP A;  1SXJ A;  3HHZ A;  4MGI E;  4L16 A;  4D81 A;  3SAU A;  1ZQ9 A;  4I81 A;  1SZH A;  2G8L A;  4FZL A;  2N1R A;  3FYD A;  1IY1 A;  1I94 M;  1KSF X;  2ZAO A;  5ITY A;  4DR5 M;  4LJ7 A;  1XC8 A;  2Y0S C;  4YY3 M;  1SXJ E;  3U5Z B;  2F5Q A;  3CF2 A;  2Z4S A;  3GO8 A;  2W7O A;  2H3Z A;  2KXE A;  3A98 B;  2K4I A;  2KRU A;  1QAN A;  1E9R A;  4DR1 M;  1IBM M;  3GLG B;  3SQI A;  5KQ8 A;  3RFA A;  3IG5 A;  2HBK A;  2O5R A;  1L2D A;  3I4V A;  1NHW C;  3SAW A;  4FD2 A;  1Z19 A;  2OXO A;  3Q8X A;  3LVV A;  2E1E A;  5ITT A;  3VKG A;  4L78 A;  2NV3 A;  5GKN A;  4LJ8 A;  4GKJ M;  2ZXH A;  1K3W A;  3R8F A;  2HOI A;  3HJS A;  3ZH9 B;  1Z5C A;  2YFQ A;  4AYB C;  4DV6 M;  4P0P B;  4LZJ A;  1XMO M;  2C98 A;  4GC5 A;  1QZM A;  1IN8 A;  2K89 A;  2QBY B;  4QNR A;  1SXJ C;  4FWH A;  3UGJ A;  4LZZ A;  3AQE A;  2DXI A;  3HJ8 A;  2PMZ F;  3AQF A;  1ORY B;  3T79 A;  1SXJ D;  1HIW A;  1ZQ1 C;  2NQ8 C;  3U61 B;  2RRD A;  2JHD A;  4REZ A;  3U5Z A;  1NZB A;  4JI5 M;  2FE8 A;  4GHL A;  1S3S A;  1UPH A;  4PCZ A;  3ZC7 B;  3GLH A;  1ZAE A;  2YX8 A;  1A6S A;  2F5N A;  2Y0S F;  5KQD A;  3GLF B;  3SAH A;  2C9C A;  3PSI A;  4X66 M;  1NNJ A;  2QCU A;  3QAU A;  4NRV A;  2EA0 A;  4AI6 A;  1VDD A;  4IBD A;  3TWK A;  3GLI B;  4AG6 A;  8CAT A;  2XID A;  3KZX A;  2BJV A;  1G41 A;  2R4E A;  1LV7 A;  2Y0Q A;  3F2B A;  4DV1 M;  1JR3 A;  4X65 M;  1R7R A;  4LRS A;  4PL1 A;  2QP9 X;  5KL8 B;  4X62 M;  1HNX M;  1XNR M;  3E0F A;  4P0Q B;  4Z6Y A;  2HBL A;  1E9S A;  3DOA A;  3U6C A;  4FVM A;  4B3T M;  3ICX A;  4AYB F;  3L27 A;  1Q39 A;  3TL4 X;  2YQZ A;  4B3S M;  1GO3 F;  4IBC A;  1TH3 A;  4BBA A;  2VQF M;  2BJW A;  2UUC M;  1P7D A;  2OH2 A;  3KSJ A;  2C9O A;  3GLF A;  3K92 A;  4IBF A;  5LMU M;  1OJL A;  4IIW A;  1IN4 A;  1UM8 A;  2F5S A;  4DV2 M;  2XEP A;  1IIP A;  2KIW A;  4IBB A;  2G09 A;  3GRV A;  3M0E A;  1TH4 A;  1PJJ A;  4IJF A;  2JA2 A;  1HNW M;  3J2P B;  2ZIV B;  2XH9 A;  4QIW C;  2GH1 A;  1G8P A;  5EXS A;  3SYL A;  3T15 A;  2E1F A;  4JI8 M;  1IN5 A;  3SAT A;  3HJQ A;  5FTM A;  2J7O A;  1J5E M;  3D8B A;  4PDI A;  3PZP A;  4FZN A;  4TUW A;  1QVR A;  1GKI A;  4NXN M;  5ITU A;  3GQ3 A;  2CHV A;  3H4M A;  3SAR A;  4JMU A;  2FFJ A;  3L28 A;  2ERC A;  2L6O A;  2MA1 A;  3CP8 A;  2F77 X;  2RKO A;  3HU2 A;  3SHG B;  4DV3 M;  5ITR A;  2K4H A;  5ITX E;  3D8L A;  4JI6 M;  2KV2 A;  3AOE C;  2V6Z M;  2DF4 B;  3F5E A;  1KBU A;  3F2C A;  2CHQ A;  4L4U A;  5EP3 A;  5KPT A;  2H3Q A;  3J27 B;  1SXJ B;  2ZIX A;  3PSP A;  2ZXI A;  4IJE A;  3K8Z A;  5E6J A;  2YNM D;  1Q3B A;  3U60 B;  3DEE A;  2DHR A;  3KDS E;  1XXH B;  2CV0 A;  3U6M A;  4FCT A;  2ZIV A;  4JYA M;  3VDP A;  7CAT A;  3NUQ A;  3ALR A;  4LJ5 A;  4G4O A;  3L25 A;  5BPV A;  3KS4 A;  1QAQ A;  4G4R A;  3IN5 A;  2D6F C;  4QIW F;  1IQP A;  4OX9 M;  4JI3 M;  4B08 A;  4BX9 C;  5KPR A;  2E5L M;  3MJ5 A;  1KFV A;  1Z1B A;  2G06 A;  2G07 A;  1R2Y A;  4JI7 M;  5KL1 B;  4FWG A;  4LCB A;  4NSR A;  4NLB A;  3EIE A;  5EXX A;  1T3T A;  2XSZ A;  1K3X A;  3U6S A;  3AL0 C;  4PL2 A;  1TDH A;  1XWI A;  5A0L A;  1W5S A;  4FW9 A;  1NJG A;  2M5Z A;  4M0D A;  2EO2 A;  3KSX A;  4XGI A;  4U6P A;  1XNS A;  5HR6 A;  2CFO A;  2XFT A;  3W0F A;  4L8R C;  3GZF A;  3PXG A;  4RNA A;  2XZU A;  1NY6 A;  3U60 A;  5BR8 M;  1XXH A;  3IG8 A;  2CE7 A;  3GPX A;  3HKP A;  4IBJ A;  5EXT A;  2YB4 A;  2XGN A;  4MGK E;  3TWL A;  3L26 A;  1N77 A;  1J09 A;  1TH2 A;  2CPR A;  3GU3 A;  2I7P A;  3TE6 A;  4MGZ E;  5DYG A;  3LMM A;  2G0A A;  3SMV A;  1C1K A;  3MGV A;  4FCW A;  4GH9 A;  3U6P A;  2F76 X;  3AOG A;  2LWX A;  3GLH B;  5FLX S;  3E9S A;  3N7P D;  4I5S A;  4IBG A;  3IP4 B;  1Z5B A;  5EXP A;  4IBK A;  1XO0 A;  3T1H M;  2K8C B;  1DGG A;  4BJQ A;  1DGB A;  2KEB A;  2BDU A;  3GRU A;  3QWL A;  4MGH A;  2J7N A;  3T38 A;  2X4A A;  2H3F A;  1DGH A;  2JGA A;  3HKZ C;  3B9P A;  3GPP A;  3A46 A;  4GHA A;  1R2Z A;  1FJG M;  4JV5 M;  1Z59 A;  2DWZ B;  3TWM A;  4OJ5 A;  4CDG A;  1CRX A;  3F5A A;  3KFU F;  1D8B A;  3AJI B;  2XSZ D;  3HWS A;  1TAM A;  2R65 A;  1MU5 A;  2W03 A;  3D2Q A;  4FZM A;  4GC9 A;  1G59 A;  5ITQ A;  4II7 A;  1URJ A;  2KD1 A;  1GLN A;  4XBO A;  4ACO A;  3FUW A;  3VFD A;  1IY2 A;  4QNL A;  3CF0 A;  3KP0 E;  2BNK A;  4QHT A;  4MM3 B;  2RP5 A;  4CGZ A;  1QAM A;  5F3W A;  4DR7 M;  4LJ9 A;  4DUZ M;  1N75 A;  3ONN A;  4JI0 M;  4AZF A;  3L29 A;  1T94 A;  3MK6 A;  2LNH C;  3O0F A;  4IC9 A;  1A0P A;  1ECW A;  1J7K A;  1MX0 A;  3ZCB B;  4WJ3 B;  2XVT A;  4MH0 E;  3OTO M;  5FSW A;  1NHG C;  3N7S C;  2R46 A;  3HKZ F;  2V1U A;  1FNN A;  4EIW A;  3SAG A;  3HU1 A;  2ZG6 A;  1N34 M;  2HBM A;  2H1R A;  2CN1 A;  3F2D A;  4NWI A;  3FTC A;  1Q3U A;  4M0W A;  2L09 A;  3AOE A;  3HHX A;  2F8L A;  1NNU C;  4KLN A;  2Y0T A;  4YHH M;  3AKZ A;  4JI1 M;  1Z6T A;  3AL0 B;  3VCB A;  4GRI A;  3UZU A;  3VLF B;  3HHY A;  4IBI A;  4R7G A;  4CHT B;  3F53 A;  2XF3 A;  5KPZ A;  2OPF A;  4C0Z A;  3K2L A;  4AKG A;  2ZM6 M;  4PT5 A;  2ZIX B;  1PM5 A;  2KRK A;  4QOZ C;  3D2S A;  2JH1 A;  4DR6 M;  3NWL A;  3GQ4 A;  1PVQ A;  3H0R B;  3RF9 A;  4RF1 A;  2YR0 A;  2KNJ A;  3SFZ A;  3VC8 A;  5EP4 A;  3SYK A;  3FTD A;  1KYI A;  2HOF A;  2YB1 A;  2A5Y B;  2G08 A;  4JXJ A;  4LF5 M;  5ITX A;  4QNM A;  4NRW A;  2HOQ A;  4B3M M;  3PST A;  1DO0 A;  3KXE C;  1Z5A A;  4OVZ B;  3T1Y M;  4CRX A;  2LYA A;  2XZF A;  3VDU A;  3E4R A;  3NBI A;  1GL7 A;  2KIC A;  3U6D A;  1TDZ A;  1HQC A;  4LG2 A;  4PD2 A;  4KX5 A;  2Z7J A;  4ICA A;  4OJL A;  2KZS A;  3LQQ A;  1I4W A;  4M9Z A;  4KO8 A;  1IM2 A;  3DZD A;  3GQ5 A;  3PSF A;  2R62 A;  3BOS A;  4WUR A;  5C0Y A;  1HNZ M;  2HL7 A;  2Y20 A;  2DWN A;  4BLC A;  2CV2 A;  4A8E A;  3K1J A;  3KOW E;  5DYI A;  3UMM A;  4LF8 M;  2W82 A;  2VQE M;  1HT1 E;  3J80 S;  2UU9 M;  2OM6 A;  2MRL A;  2VKQ A;  3J7B A;  2W04 A;  2X49 A;  3NRW A;  3C29 A;  3H0M B;  5JI3 E;  2XLJ A;  2XIC A;  2F2A B;  2R4J A;  2M60 A;  3KOZ E;  2KHV A;  1DO2 A;  2ZIW A;  3EIH A;  3L3F X;  2KJ9 A;  3SHF A;  4OVZ A;  5C18 A;  4B7G A;  2DZO B;  4IBE A;  4ITQ A;  4PDG A;  4FWD A;  1ED1 A;  2R45 A;  2WB1 C;  2KVC A;  1IXR C;  4Z8X A;  5C1B A;  2CV1 A;  1XNQ M;  2K47 A;  4NSO B;  2DWM A;  1DGH B;  2GOL A;  5EP1 A;  3FD9 A;  3M7D A;  4MB7 A;  4GFJ A;  2DGZ A;  1X37 A;  3JAM S;  3HU3 A;  3OPX A;  2HBJ A;  3VK7 A;  1PVR A;  2M0N A;  3M6A A;  3KS8 A;  1OFI A;  4DV7 M;  2DQN B;  2QEN A;  5FTN A;  5EQT A;  5FTL A;  1OFH A;  2C96 A;  4LGY A;  5FTK A;  3CTW B;  1Q3C A;  4JN6 A;  3PNY A;  2V1C A;  3RE8 A;  3C58 A;  1N36 M;  4G6Z A;  4LJA A;  3WHL A;  1R6B X;  2UUB M;  2Q4T A;  3FUU A;  2CHG A;  2I7N A;  3U6E A;  3FTE A;  3ILK A;  2HKJ A;  4OW0 A;  2D7E A;  1YE9 A;  1N78 A;  1IN6 A;  2HCB A;  4W5W A;  4AW4 A;  2JH7 A;  4JI4 M;  2UXC M;  2L7I A;  3KW6 A;  4JI2 M;  1DGF A;  3I4Y A;  3KVW A;  4LF6 M;  3AV0 A;  1L8Q A;  3W0L B;  4FCV A;  5IRE B;  3FUT A;  1N32 M;  3CYM A;  5T14 A;  2LKY A;  3CF6 E;  2WAQ C;  2HMX A;  2W7P A;  5LMN M;  3RFW A;  2UXB M;  2Z3X A;  2HHH M;  2WB1 F;  2KKP A;  3SAF A;  3FKE A;  4OU7 A;  2F4V M;  1NY5 A;  1TGU A;  2H3V A;  4B7F A;  2QPA A;  4G4Q A;  1PVP A;  3J81 S;  4D82 A;  4K0K M;  3LYS A;  2Q2E B;  4KHP M;  1IY0 A;  2DVW B;  4HLQ A;  1YUB A;  1QAO A;  3CRX A;  2L7H A;  3SMS A;  1L2B A;  1NJF A;  2EUC A;  2ZIU B;  1NVM A;  4I8O A;  4O3M A;  2Z4R A;  5FTJ A;  3M6Z A;  5CRX A;  2LYB A;  1MA7 A;  2F5O A;  4QOS A;  2P5T A;  4LJ4 A;  2D7H A;  3GP1 A;  4KOD A;  3U6O A;  2G5I B;  2KEY A;  2H3I A;  3LVW A;  2F5P A;  4BB9 A;  4LFB M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...