2Z7JA

Structural insights into de multifunctional vp3 protein of birnaviruses:gold derivative
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
125
structure length
125
Chain Sequence
AQREKDTRISKKMETMGIYFATPEWVALNGHRGPSPGQLKYWQNTREIPDPNEDYLDYVHAEKSRLASEEQILRAATSIYGAPGQAEPPQAFIDEVAKVYEINHGRGPNQEQMKDLLLTAMEMKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into the multifunctional protein VP3 of birnaviruses.
pubmed doi rcsb
source organism Infectious bursal disease virus
molecule tags Viral protein
molecule keywords Capsid assembly protein VP3
total genus 44
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2007-08-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.880 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2z7jA02
1.10.150.620 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2z7jA01
2R18A 2Z7JA
chains in the Genus database with same CATH superfamily
1BVSA 5JU5A 3I4VA 3TE6A 5IIJA 1L5UA 2HHXA 2RGOA 1WWUA 3AM9A 2VDBB 4I81A 1N56A 3GRYA 1IQPA 1ZQMA 9ICVA 1PM5A 2EDUA 3RB6A 2VJ5A 2BHNA 3KS8A 3EWAA 2HDOA 1VEKA 1D0MA 2W7OA 4AQYM 2F5NA 2L4FA 1L3UA 2O25A 2W03A 3KKAA 4UATA 2FMQA 3PX6A 2DENA 2UUAM 2WFAA 3QAUA 1N5XA 2R8JA 1DK3A 2A19A 4AI6A 3AQEA 1NK5A 2RRUA 4IRKA 4PHAA 7ICKA 2KVCA 2E8OA 1F5SA 1A6SA 5BPCA 1S0VA 4DR7M 2JWSA 1ZQSA 3KZIU 3OGUA 3GLHE 4YQWA 5J0TA 3C3DA 5KFKA 4W5WA 1AROP 2KOBA 3GLGA 4IRDA 3E9SA 3LDAA 5KFPA 1JX4A 1L2DA 1GL6A 3NBXX 5DKWA 1PK1B 1GL7A 2R0IA 4GEWA 5AIAA 2K4PA 3PX4A 2BQRA 4B9LA 1Q39A 1ZQKA 3BS7A 2XSZA 8ICWA 3PSFA 4CF5A 2DAEA 4FBUA 4RUAA 3PW0A 3CF0A 4AG5A 3U60A 2DKZA 5F9LA 2HVIA 7ICLA 9ICHA 2QBYB 4FZLA 2LVOC 8ICKA 2KEBA 4Y2SA 2BJWA 3WKDA 5KG7A 3AMZA 3W67A 1IXZA 4EX6A 5KQ8A 2PMZC 1N63A 1NOMA 2VQFM 3KTQA 3ZC7B 1NNLA 2W04A 3BZCA 3AN1A 4LCBA 3PW5A 1NVMA 4F1IA 5DGBA 2JEGA 1Z6TA 4MFFA 4RNAA 4K0KM 1V92A 2KNJA 1NK9A 2GWSA 4XGIA 3D2NA 5KFXA 3N7PD 3GLFB 2KJ8A 1JROA 1VEGA 1BPXA 3TQSA 4GC7A 4KLFA 4IJEA 5J0XA 2KHVA 1K3XA 4DFJA 1SGGA 1JXEA 2ZIVB 3J7BA 1HIWA 4OCZA 3J80S 3LVWA 5J2CA 3OHAA 4RF0A 2VQEM 2XH9A 3HHXA 4QZGA 4C4TA 9ICLA 4OVZA 2W8KA 2GLEA 2LH0A 2N35A 2AGPA 4II7A 2JY8A 5KPRA 2JZBB 1X9WA 1LTMA 2ZTDA 1TGUA 3Q8GA 2PI5A 1F0MA 4DR5M 4IQVA 4P4PA 2JHDA 4KLDA 1HR0M 1J2NA 4G4NA 3U6PA 4K4GA 5E79U 5DNYA 2DZNB 1ZMVA 4GKJM 2YY6A 2E8MA 1SWWA 5L1LA 4YMMA 4IBEA 1YZ7A 3OSNA 5CA7A 2DAIA 3SARA 1J7KA 1JXLA 4GRIA 2R6FA 4DEZA 3VK8A 3HGIA 2FPKA 2XF3A 2NRZA 3M6ZA 4CF4A 1TAUA 4LZJA 3ORYA 3BBZA 1SWVA 1R7RA 2BDPA 2DZLA 2AGQA 3AUOA 4P0QA 1WR1B 1VDLA 4O0IA 3UQ0A 5HMLA 4Z6CA 3VC8A 2IBKA 9ICAA 2OOAA 5B5EU 1HQCA 1DXSA 1L8OA 5KFAA 4IIWA 2ASJA 3RBDA 4OW0A 3HX0A 1ZRMA 3L5KA 4M9HA 3SMSA 2YB1A 4R65A 3MR6A 4QOZC 2G07A 5AI4A 5EP4A 2FFJA 2JR5A 4TURA 3IP4B 4RNNA 3ZDBA 3A0HU 3FUUA 3ZD8A 3LK9A 2HOIA 2AJQA 1S8OA 4KT0F 5AM1A 2A3VA 3H8JA 2KW0A 1S0MA 4HYKA 5KFTA 1G3IA 1HT1E 4LZGA 4L4UA 2B3TA 5KFWA 5KT5A 1VQ1A 4FCTA 4I2HA 5AHXA 4NLZA 2HSZA 3DDHA 4UB8U 2DBYA 3BOSA 1BPEA 1QZMA 5ALUA 2Z3XA 1QDTA 3WK5A 4Y2UA 1ZMWA 3THGA 5KFCA 2ZM6M 1TVAA 3WK6A 4FVMA 4IBCA 5IREB 4F2RA 8ICLA 4DL2A 2KTQA 1RZTA 1KRPA 4I2IA 4B9UA 8CATA 4XBOA 5EXTA 4MGZE 2W54A 4PHDA 2CXYA 4LFBM 1RG6A 4KLNA 1IBMM 2HBKA 5CJ7A 3RH4A 4FFDA 4PPXA 3HY5A 2KRKA 3RBEA 4DV0M 1NHGC 4NXZA 3GILA 4G9BA 3FAHA 1OJLA 5J2KA 2BGWA 3RGPA 2LKYA 4Q8FA 1RXWA 4YMOA 3RTVA 2JXJA 4QNRA 4LF4M 2D7EA 4WURA 3D2SA 2L7HA 5ALYA 3C1YA 3KKAC 4JI7M 2F1IA 2DHRA 4YP3A 1PJSA 4HAIA 3AU2A 3FRHA 3VDUA 4UAWA 1SXJD 4ELTA 1S5LU 4MF8A 5EP1A 1WIVA 4B3TM 5G5GA 3JPNA 4DV1M 4Y2YA 4F5NA 2XCPA 2AHOB 3HWTA 3PVSA 1JRPA 2BCUA 4UAZA 3KOXE 1XMQM 2IHNA 3PO4A 5A0LA 4S12A 3V6HA 3Q8KA 1N48A 3HILA 4FCWA 3FTCA 2LXEA 5ALMA 2KNVA 1QAOA 3QZ7A 1ZQGA 4DV6M 2KZUA 5HMMA 3QU2A 4C7YA 4UBBA 5J0PA 4BLCA 9ICJA 4QW9A 1NI3A 4Y2VA 2YX8A 5L1KA 4K4HA 4BWJA 2JH1A 3K92A 3SBJA 4DFKA 3SYLA 1K82A 5CP2A 4QWEA 1K5OA 1I94M 2DZOB 5ALZA 3SAGA 1QQWA 4QZFA 1LB2B 2BCQA 5H37D 2I9GA 3RRHA 3OTQA 3B7QA 5F3XB 4NLCA 4YHHM 5HR7A 4YCXA 4B9SA 2E5SA 4Z8XA 5J8YC 4I5SA 5AKIA 1L7MA 4ECZA 1XWIA 3GV7B 2YN4A 4RQ7A 1MX0A 2F5QA 1FFUA 4TQSA 3GLGE 2FDRA 4CE6A 4M0AA 3LCVB 3BS5B 5F9NA 2Z4RA 5DYGA 5AM3A 4O5CA 4DR3M 3RAXA 3M9MB 5DBBA 7ICRA 5DBCA 3H4DA 1JQJC 4F91B 4TUPA 4PHPA 5ITXE 4QZAA 2UVRA 1S9FA 1N34M 1WWVA 5ALXA 8ICZA 3VLFB 7ICMA 3UMGA 9ICWA 3PW4A 4Q7JA 5G5HA 4MFAA 1WUDA 3LWMA 4P0PB 3B9PA 2LHTA 2EAOA 2BQ3A 3FYCA 3BQ7A 3H8SA 4O3OA 2CV1A 1X9MA 3A98B 2P35A 3UXPA 1TH3A 3UK6A 1L2BA 1B0XA 1SL0A 5AI6A 1NNJA 2VF8A 7ICHA 3TPZA 2DGZA 4NSOB 1ZQFA 2L4EA 1D8BA 2EH9A 4UB6U 3DZDA 2ZUDA 1KDHA 1W5TA 4MGIE 3KSXA 3HT3A 2FE9A 2ZJ8A 3RJHA 2ZUCA 4JXJA 1MSWD 1UFZA 3V6KA 1GO5A 3EUB2 1DGBA 4UB1A 2PMZF 4YR2A 8ICFA 1TTEA 4O3SA 3BQTA 3DFZA 2R46A 3NBIA 3GLIA 5KFOA 3J81j 1OXJA 5ALIA 5TZVA 1QSYA 1RM6C 5DG8A 1FFVA 3SYZA 3N97B 4IC9A 4EZ9A 2D6FC 1NHWC 2GNOA 2OXOA 3GLIE 2HMXA 1ZD4A 3NTUA 1O03A 3H7IA 3PX0A 2CWBA 1L6NA 3H0MB 3HHWA 1AQ6A 1OIPA 5KG5A 4B08A 5J0RA 4L15A 1ZQ9A 3TANA 3E58A 4LF9M 3KFUF 3HJQA 4GFJA 2OH2A 1SZPA 2VIXA 4KMUA 2UXBM 3GIIA 1WCLA 2XY7A 1K1SA 2Z7JA 5KO3A 4F92B 3I01M 3QU9A 3ICXA 3PXGA 2EO2A 1HUZA 2WB1F 2LTUA 3M8SA 4PL1A 3C29A 4KITB 9ICEA 1L3TA 2E3TA 1SV0C 5AKGA 2CRXA 2V1CA 3L28A 4BXOB 3VDPA 4C7ZA 2OWOA 5GTHU 5BR8M 4DFDA 3HW8A 1IXRA 4ELVA 2F1JA 4QZCA 1WXQA 2R44A 1Z4OA 3AU6A 3B89A 3N7SC 2CUZA 3TWKA 3WKAA 1SKSA 5KT2A 9ICGA 3QNMA 1WJ7A 4DSEA 1COOA 3FC4A 1KFSA 5DG9A 2OOBA 2XY5A 4YR0A 4G6ZA 5ALNA 5KG0A 2KJ5A 2DKLA 1F4IA 8ICCA 9ICXA 3RJKA 2KHHA 1DGSA 2C2EA 2GH1A 2HKJA 3F5AA 1IBKM 5IILA 1ZD2P 2OO9A 1SXJB 2AHMA 9ICMA 5LMNM 4JYAM 4NOOB 3KFUG 3JR4A 5D46A 1KBUA 1NJFA 4MH0E 5B66U 5EWFA 4RQ5A 4NSRA 2G3QA 2CPRA 3ZDEA 4F3OA 3NWLA 3AOGA 2EANA 1VLBA 2DPIA 3DA1A 4IBFA 3U61B 2L5YA 3MFHA 5EQTA 3QZ8A 4NY8A 3RR7A 3JR5A 3B7ZA 4NM2A 3Q8QB 4R63A 1QLNA 5JUMA 2P5TA 3TADA 4GMQA 5EE3A 7ICGA 5HR6A 4CIZA 3KZXA 2C22A 4RQ2A 2BPGA 2XFTA 4DOBA 3FYHA 1NKBA 4GC9A 1Z5BA 4X5VA 4AKHA 2BQUA 1A5TA 2FMSA 2V9WA 3ZH9B 1NJWA 1IXRC 4QIWC 3ZQJA 2VKQA 4ED2A 2YMMA 3T5HA 5E26A 3WKBA 1ZQPA 2UU9M 1IBLM 1P7DA 5KFZA 4GH9A 2JP7A 2DAMA 1R5LA 2EAMA 3HJSA 3ZCBB 4A3VB 3G6YA 2YR0A 1N36M 1L1TA 1QAQA 2ZIWB 3CYMA 4XQ8A 3SAUA 1TH2A 3M1YA 5KFQA 3TQ1A 2ES6A 9ICKA 1VDVA 5J2HA 4R8UB 4C0ZA 4KLGA 4KO8A 5C18A 2QSFX 4JI5M 1GKIA 1ZETA 1YUBA 3QUQA 3GLFE 3SAHA 4PHEA 2LYBA 4ZPXA 2JXNA 2W9CA 3K1ZA 5AM2A 3U6OA 3I1YA 4YVZA 1B43A 1F44A 3L29A 2LWXA 4Y2JA 1KEJA 3ZI4A 4ECXA 5J2IA 1E9SA 4AKIA 4KTQA 3NVVA 3NVZA 2R45A 4DR4M 5ALDA 5KT3A 4I2BA 5AKHA 4J9RA 5HHHA 4IJFA 3CP8A 3U26A 4LFCM 4DL7A 2PFQA 2DF4B 5BOLA 4OJ5A 2DAKA 2ALZA 2BCRA 5J0WA 5CR0A 2GOLA 2KDLA 1SL2A 3PR4A 2W3SA 2DVWB 2GO7A 2FI1A 4JN6A 3SMVA 5KNIA 4O3MA 2ZJ5A 1AIPC 4JB3A 3BS5A 2DFLA 1VEJA 3WKEA 3RE8A 4LF8M 4JI4M 4KODA 4B6JA 3KHGA 2MRLA 3EPIA 3I76A 1GJSA 1Z19A 3RH5A 4M6WB 2JUJA 2VIIA 2OEHA 2JEIA 1IY2A 4IL6U 7ICNA 3KOWE 2ZIWA 3IHPA 3GRUA 2R8GA 2C9OA 4NC6A 2XSZD 4I29A 4EENA 2HHSA 3E0FA 1L7NA 2R4EA 3Q8PB 1EXNA 1N77A 2VJ4A 1FJGM 4KMOB 3N7RC 5D49A 1CRXA 4NLNA 2ZUBA 4J9MA 4ECTA 1URJA 3M9OB 1Q46A 2RGHA 3M6KA 4NLBA 4BUGA 2ZBKB 5DBAA 4MFCA 1HJPA 2LYAA 7ICUA 5DB9A 4Z6EA 2BPCA 1QYRA 1ZYQA 3T1HM 2K8CB 2RP5A 5GKNA 1BPYA 3GIKA 1D2NA 1DGHA 4LGYA 1XC9A 4D82A 3J7AS 1JN3A 2E8NA 2G0AA 2OHFA 5AI5A 2K0BX 3RF9A 4CDGA 4ANRA 2GQFA 1KSPA 9ICBA 3L3FX 1ZQHA 3PW7A 1NY5A 4P17A 5EP3A 5L1IA 2Y21A 4MEYA 2B6GA 4KLQA 1H6UA 1YT3A 3KSJA 3KHHA 3K1JA 5KFIA 4MHVA 4YXJA 3C58A 2VA2A 2KFZA 3W68A 1RQNA 5EXSA 1U48A 1OFHA 1R2YA 2F1HA 2HL7A 2MA1A 5FTNA 4RPYA 2O5RA 2LNHC 2EA0A 1XB2B 3T5JA 4QZHA 4ACOA 5CWRA 4PH5A 2O6KA 1S0OA 4E0DA 2RRDA 1M6YA 4O3NA 4JI2M 2EZZA 1LKYA 2QLTA 3E21A 3M6AA 2LVAA 2I1QA 3AKZA 3FRIA 2AQ0A 4LRTA 3T38A 3A45A 2YQEA 1Z3EB 2XZFA 1RXVA 4IBJA 4DQQA 2F3NA 3F2BA 4Y2PA 1QTMA 1JR3E 2ATLA 4DV3M 2ODGA 4L78A 4DF8A 1DO0A 1SB3C 2L6OA 4PZOA 2R65A 3IECA 4XA5A 3H40A 4KN4A 2N1RA 2XO7A 5KPTA 3MR2A 1P3QQ 3VKHA 3ZDAA 4BXOA 4US9A 2HVHA 4YR3A 3BXWA 3QEAZ 3QYBA 2YMPA 3KOYE 9ICCA 2CHQA 8ICRA 2MGWA 2J6UA 3K2LA 1PJTA 2V4QA 4ELUA 2DXIA 2WB1C 5HNKA 9ICTA 4Z6FA 5DB7A 2HCBA 1NV8A 2EAPA 4I28A 2DWZB 3KBBA 2JZ1A 3LW5F 2MUTB 4NL4H 2HBLA 3EPGA 2K8AA 4M04A 4FW9A 4UB5A 3IG8A 4LZZA 5FTJA 1MU5A 2LVNC 3KP0E 3PR5B 1Q3CA 3KVWA 4NJ8A 1SZHA 5AKXA 3MGIA 4R7GA 4B3SM 4NRWA 2YMLA 3PNCA 5AKYA 2DPJA 2ASLA 2JH7A 2C2DA 1XNSA 4QOSA 4BX9C 2XGPA 1TAMA 1ZD5A 4MGKE 1JUDA 3Q8MA 2Y0SF 3T5KA 1NV9A 2QP9X 2W3RA 4JI3M 1ED1A 2VA8A 4OJLA 3B74A 4PCZA 5EE9A 2C5RA 5AK5A 3THVA 2KD1A 2E1FA 3UXNA 1QUSA 5DDMA 2KZMA 5L8RF 1Z1BA 2KZ3A 4LJ9A 1B4FA 5KG1A 1XS9D 2YNMD 4A8EA 2I5HA 2WHEA 3T79A 1XXHB 3U5ZB 1GO3F 1V33A 1IN4A 2DI0A 3HJ8A 4RUCA 4M0WA 4NM1A 1NK8A 3U61A 2F8LA 4LG2A 4B9TA 2FMPA 4FD2A 4D80A 5J0YA 2ZG6A 4I2FA 4KLEA 1IN5A 5KFUA 4EX7A 5C5JA 3RJEA 1NY6A 1D0KA 2Q4TA 2C9CA 2ZANA 2R18A 2EZXA 1Z5AA 3M8RA 1S97A 1S77D 1Q3VA 3D2QA 4KLUA 2C96A 4G4RA 1XMOM 1MC8A 4D81A 2G06A 5KT6A 4U6PA 2LHCA 2PXIA 3BQ2A 3HU2A 3WHKA 3C1ZA 3CF2A 2WF8A 2ZIUB 5KT7A 2DHYA 2HHUA 3C3EA 4RNMA 2YFQA 4BDPA 1XHBA 5ITXA 5ALTA 2XZUA 1QAMA 1N60A 2R4JA 5IIKA 4IQTA 3FUWA 1JIHA 1RDFA 4TUWA 2HHVA 3J81S 4OU7A 2BZFA 1S10A 1IN7A 3N28A 3QYEA 4ED1A 8ICVA 1TV9A 2LVQD 1IG6A 5KG6A 4B9VA 4Q44A 1N5WA 4IR9A 2NO5A 1I4WA 2PFPA 5IT9S 1J2MA 1LVHA 4F5RA 4ECVA 1DGHB 3OHBA 2KA6B 3FTDA 3IM1A 4F5OA 1BNOA 3FYDA 2MROB 1ZQTA 3AOEA 7ICQA 2JY7A 4LJ6A 4B7FA 5AI0A 3TARA 4DV2M 3BZKA 3GLIB 4HEOA 2AU0A 3FUTA 4DV5M 4GXKA 2BR0A 1KSFX 1L2CA 1DV0A 4ED6A 1QUTA 2W9BA 3OJSA 4AYBC 1R2ZA 4ECQA 1IY0A 5EE0A 5ALLA 1IN8A 2AGOA 3GLGB 1PUZA 3HU3A 3NRZA 4P2HA 4Z6YA 3L4PA 1GVNA 2E8PA 1ZQVA 5CRXA 2IA6A 3RH6A 1WGNA 4JI1M 2ZIXB 4PL2A 3PSIA 4F93B 5T14A 3UXOA 4YXMA 2K60A 2MAXA 1YE9A 5IIIA 4G3IA 2LM4A 3U6EA 4JMUA 5D4BA 4QWBA 4C4RA 3OSPA 2IMWP 1NZBA 3CNHA 4CGYB 3NGDA 3E2EA 1NKEA 1T4GA 1SXJA 2CP8A 3GLFA 4J9LA 2WAQF 4P0PA 3CRXA 1N33M 1SXEA 1ZV1A 2KHQA 1UM8A 5J0OA 4DF4A 2ERCA 4UW9A 1COKA 4UAUA 4DL3A 3V7LA 4IS7A 3I04M 2CFOA 1A76A 2DL0A 2HHTA 2OCEA 2FLPA 4J9NA 1EE8A 4QNLA 4LFAM 1X9SA 3Q8XA 4JI6M 2KNAA 1ZXIA 2H3ZA 2Z4SA 3OJUA 4I8OA 4DOAA 1C20A 1YSYA 1SV0A 3NUQA 3M0EA 4DQRA 3TAQA 1TH4A 3IRUA 2XC9A 3HKZF 4J9PA 1TKDA 4CNQA 5KFMA 3QE9Y 2G08A 1VG5A 3H8MA 8ICBA 3SQIA 3ZDDA 3B0YA 1CI4A 3AFHA 3RFAA 2PFNA 2QB0B 4JUZA 3HU1A 2W55A 1U4BA 1PK1A 3SAVA 2MR9A 5FTLA 4TQRA 1J5EM 4EBDA 1PVRA 4NWIA 5L1JA 3SFZA 2F5OA 4OJOA 2NRVA 1YLAA 3HP6A 2QCUA 4Q8EA 9ICUA 3F53A 4UAVA 4NV0A 4R71A 3KOOA 4PGQA 4ZOHC 4REZA 1JMSA 4M9LA 2F77X 4DCCA 2ZXHA 4DV4M 3AL0C 2I7PA 1U47A 3AJIB 2WF6A 3R9XB 1WCNA 2NQ8C 4GLXA 4QZEA 4I2EA 1TDZA 1ZQEA 2KP7A 1D9FA 4ICAA 1NNUC 4C8NA 2RLTA 3EIHA 1T3QA 4DS4A 3KP1E 2B0CA 5BOMA 3V72A 4FE3A 3HWSA 4F8RA 4O5KA 4KLSA 3WK9A 3QWLA 3QXGA 4P0QB 3U6SA 2KSOA 5AKEA 3IN5A 1Z1VA 2J7NA 2VF7A 1Y88A 4RPZA 4R66A 3ETRA 3MDCA 1ZQQA 3F2CA 8ICGA 4TUSA 2LMRA 9ICSA 2NRTA 2P6RA 3GRVA 2ZJAA 1Q3BA 4X64M 5C1BA 4DO9A 4M9NA 1T7PA 3BQ0A 3IG5A 2D7GA 3W0FA 2PFOA 4M9SA 3C2MA 3RR8A 4IRCA 2KXEA 1GLNA 1BPBA 2Q2EB 2YB4A 1S3SA 3F92A 1QZEA 2IOFA 1Z59A 4CHTB 2OM6A 1ZJMA 3ILKA 5KFVA 1N75A 3LVVA 1IXSB 2BJVA 1KFVA 1HEKA 4R3DA 1IXSA 5C0YA 1MJGM 1X42A 1O08A 1NK7A 5DYIA 2NO4A 2IOFK 2J5YA 3PY8A 2ZAOA 3D6JA 5KFFA 5IIMA 4FWHA 4LY6A 4F4YA 3J2PB 2QBYA 2BWBA 2UVWA 1Y8GA 1DK2A 4HLQA 5EXPA 2QHOB 3KOZE 2Y1JA 1D8LA 2Z8YM 3WK4A 5IZ7D 2DQNB 3M9NB 4I2JA 5KG2A 4EELA 1X66A 5ITTA 8ICAA 3HJEA 3HPOA 1ZD3A 4Y2QA 5KPZA 3F5EA 4IBGA 3GQ5A 1OUQA 1IFYA 3WK7A 4ITQA 1UQVA 1HNWM 3O0FA 3TKAA 4U7CA 3A46A 1MN3A 1RQLA 4O5EA 1NSFA 4MGYE 2CV2A 4F4KA 1ZQDA 4DUZM 4NRVA 1QVRA 2W9BB 1KFTA 3MR5A 1B22A 4RZRA 4P4MA 4US8A 8ICPA 2LVPC 1ZAEA 3MGVA 4KN7A 2A5YB 1SXJE 1ZQCA 4PZNA 1PJIA 3K75D 3BQ1A 1OFIA 3M7GA 1ZQUA 5FP0A 2HI0A 3CW2C 1VJ5A 3QUCA 3W0LB 4DV7M 2FLLA 2KRUA 4XRHA 2APLA 1NO1A 9ICQA 4RQ0A 1FNNA 5J2DA 1IM2A 1UT8A 3H4MA 4NXMM 3HHZA 4RQ8A 4IBKA 2QARA 3VK7A 4OJPA 4LJ4A 5KFYA 2EQYA 2C28A 1FEZA 2RDIA 3C5GA 4KLTA 5KFNA 2JY5A 4M47A 3AL0B 1UPHA 1G71A 1BPDA 2ZTCA 4ZH4A 3KHLA 1XSPA 1SXDA 4Y28F 1X9XA 5CHGA 9ICOA 1N2XA 1PRBA 1UA0A 3LQQA 5JI2E 4UARA 3PW2A 1PVPA 4YD1A 1C1KA 1PJJA 2Y0TA 3UGJA 2RHFA 2ASDA 2KEYA 4QJFB 5AKLA 2JEJA 7ICIA 5LMUM 1KKXA 2EJSA 3GQCA 3ZDCA 4X66M 2C99A 3JPTA 1E32A 2JZ0A 5AM4A 2CRUA 5KFGA 3T3FA 2JY6B 1OAIA 1ZQOA 9ICIA 2W8LA 4WJ3B 1ZQZA 4IBDA 3TADC 1FIQA 3B9JA 4NXNM 2QB1A 3RJIA 4WW0A 2F2AB 1NK0A 8ICMA 3GPXA 4UBCA 5EXXA 4DR1M 2FNAA 4JK1A 1IV8A 5KL1B 2H3IA 2R8IA 2UVUA 3FD9A 4Z6DA 1DGFA 2D8CA 1OQYA 1H38A 3SYKA 3HKZC 3J27B 4ECWA 4DFPA 8ICHA 4J9SA 3RB0A 2QNJA 2XIDA 1XC8A 2X8AA 2VANA 2ISPA 1HNZM 3EYZA 4IBIA 1N61A 4AW4A 3MFIA 2CHVA 5HHIA 5AK4A 2RKOA 2JNHA 4USAA 4CCHA 4CF3A 3PVXA 4BJQA 2KNZA 5KFSA 4RQ6A 3WHLA 2FJ6A 1DO2A 2KKPA 2KMDA 3T5LA 2JGAA 1V9PA 3MR3A 4ECYA 5DQIA 2UVVA 1NJXA 2WSFF 4EZ6A 2LBCA 3G6XA 1SG9A 4J9KA 3VKGA 3TFRA 3L2AA 3KW6A 3C23A 5AK6A 4EBEA 8ICQA 3GRRA 3MK6A 1SV4A 1HUOA 5EWEA 4EIWA 2FPMA 4PD2A 4UB2A 7CATA 3C2LA 5DFLA 1ZOLA 1E9RA 3HRDD 1BPZA 4F2SA 4IQUA 3T6PA 5ALRA 4C4SA 2D3DA 4GIBA 5IWAM 3UJNA 5IIOA 2XFSA 4UN2B 2WZJA 4UASA 4KLHA 4YMNA 1X6IA 4QHTA 3JPQA 2H3QA 2CEAA 2W82A 2W7PA 1RPLA 3AEVA 1UCVA 3LQRA 1BNPA 2EKKA 3GIJA 3F2DA 4O3RA 3EW9A 9ICNA 3SMPA 8ICEA 4QHSA 1A77A 4B9MA 1OIZA 2QQ8A 4CGZA 1NJGA 1FO4A 1TDHA 2DWQA 1PGYA 3U6MA 2HBJA 1UT5A 1ECWA 3RB3A 2FOIC 2O01F 2H3VA 3FTEA 3KXEC 3PSPA 3RJGA 2EZYA 1ZQRA 2KZZA 2M5ZA 4P16A 3UPQA 4UB4A 1QQ5A 1LV7A 3K8ZA 2WSEF 1TFRA 2K4IA 4OX9M 4IQWA 1ZQNA 4ED7A 2DUYA 3PSTA 3C28A 4IBBA 3U6LA 5IINA 1Z4NA 4KHPM 2B21A 3MMPA 2KKVA 4DSFA 1ZMUA 4DSKA 4MM3B 2KSOB 4IR1A 3NVWA 2EUCA 5KTQA 3NASA 4EEKA 2ZIVA 2OPFA 5KFEA 1ZJNA 2KFNA 5L9XA 5A2QS 3B0XA 2XLJA 1RU3A 1ZQLA 3CF6E 4YN4A 2UXDM 4FS1A 3OPXA 1SKRA 2FE8A 2LM1A 4DQPA 2WF9A 4F50A 2F76X 3KS4A 4F4WA 5AKJA 5H2FU 1X6JA 4QZDA 2XGQA 1X2IA 8ICNA 1WHCA 8ICSA 8ICYA 5CB1A 3ONNA 1ORYB 3DEEA 1HT2E 2M60A 1QQ6A 1Z00A 4GXIA 3SR6A 1XXHE 1QSSA 5J2FA 4DBGB 5KFRA 2NRWA 9ICFA 5AM5A 3RJFA 4PT5A 2FS1A 2G8LA 1OAOC 1TR8A 2V4RA 4M9XA 2R8HA 2KVSA 4DWIA 1Z5CA 2QPAA 3LMMA 2HHHM 2X49A 4BGDA 1RYRA 1MA7A 1D8YA 2P66A 1T8EA 4I2GA 2M9NA 2LI6A 8ICUA 4AG6A 5AICA 5AIBA 2W11A 2HWJA 4RT3A 1PZNA 4G4QA 3TWLA 4GITA 8ICIA 3L26A 4HL4A 3Q8RB 2F44A 2QKQA 2HHWA 1J09A 2C98A 4X65M 3TACB 1R6BX 2JMGA 1EIJA 5EOZA 3SHFA 4OO1J 1XNRM 4UB3A 2ISOA 4EBCA 3T15A 3HX3A 5DLFA 2HW3A 4KX5A 4DQIA 5KT4A 2UUCM 3C2KA 3GU3A 3GFKB 3MGHA 4FS2A 4TUQA 3MDAA 5EWGA 2XVTA 3SV4A 5KG4A 2WAQC 4F71A 3FTFA 3GLHB 4WP2A 2QZ4A 1YZ6A 4LJXA 2D7HA 4RT2A 2EKFA 4ECSA 4JV1A 4RPXA 4DLGA 1TF0B 8ICJA 4DSIA 3PNVA 7ICTA 2W9CB 2RDJA 3GO8A 2DWMA 3MBYA 4RQ3A 1A0PA 5F3WA 1WGLA 3QUBA 5ITUA 3H4JA 1ZQIA 2KV2A 4Y2RA 5FTMA 4OD0A 7ICEA 3ED5A 4L16A 5J2AA 4I4LA 1L3VA 4YD2A 2L2DA 2WSCF 2MJ5B 4JI0M 5ALHA 1DGJA 4I2CA 2LPEA 2AXTU 4DS5A 4Y2XA 3PFIA 2BKEA 3GPUA 1L7OA 3EZ5A 4K4IA 1KL9A 2K89A 1NK6A 3D8BA 3DOAA 1QH9A 2HOQA 1T94A 2J6TA 7ICJA 4PGXA 5ALQA 3UMBA 1XO1A 3AV0A 1G59A 4B7HA 1C7YA 1KQQA 3JPOA 4LF5M 4BWMA 4EYIB 1D0LA 3HZJA 5FLXS 1QQ7A 4R64A 4FBTA 4M2YA 3Q8LA 3GPPA 3GLHA 4XK8F 3QU5A 5ALJA 4EYHB 2R8KA 1V38A 5ALGA 4LVSA 3FM9A 1CUKA 2JZBA 4J9QA 4NLKA 5AI9A 4PJ0U 5ALSA 5J2BA 4BBAA 3SAWA 1X40A 5ITQA 4DUYM 5EJCA 1LKYB 4YY3M 1QSLA 1KFDA 5AI8A 4OVZB 1DRGA 4UAYA 3K4GA 4QNMA 3FUXA 1IM4A 4RQNA 5ALFA 3GV5B 1Q8KA 4G4OA 1RYUA 3RAQA 4M6WA 3E46A 3Q8SB 2XGNA 2A1JA 4GXJA 1NJYA 2A1JB 4AP9A 5KFLA 2IHMA 3GP1A 3OTOM 4ED0A 3SHGB 3KHRA 5JTIA 2R62A 5BPVA 1V34A 4DFMA 4DOCA 8ICXA 5KFBA 2G5GX 1X37A 2E5LM 4RQ1A 4RKUF 2K47A 3I28A 5ALKA 2NYVA 4FZNA 5DDYA 1T43A 1NZPA 5AKKA 5DB6A 5GTIU 4ECUA 5ALPA 2XCAA 3A42A 3L25A 3SASA 1UHUA 4ED8A 3D8LA 1PVQA 1ZQ1C 2JV3A 3UMMA 3C21A 2YTUA 4GHLA 4JWNA 1G41A 4GC6A 1KTQA 4QWDA 4KLLA 2I7NA 3R8FA 3V76A 4F4XA 1TAQA 4AKGA 3VFDA 2DWNA 2ZIXA 2W43A 1EFUB 3QEBZ 4DSLA 1ZQBA 4LF6M 4R8UA 7ICSA 2KN7A 2L09A 3C5FA 1TE2A 1G4AE 1W5SA 2MU2A 4XUSA 1TK0A 4I2AA 3BJYA 2G09A 1R4GA 2P6UA 3TFSA 2XY6A 3I51A 4DLEA 4QIWF 1XWLA 1ZQWA 4NL9C 2JRZA 2F8KA 4KLOA 1LV5A 4M9JA 2LBOA 3UM9A 1QDRA 4J9OA 1XU4A 2ZTEA 4M9GA 1N78A 3I4YA 1J97A 3L27A 4DL6A 3SC3A 1U45A 4MB7A 3QX7A 5CEHA 2NV3A 5DGAA 2DNAA 3RRGA 2C2RA 2X4AA 3RGSA 8ICTA 3ISBA 2FH0A 4AYBF 4ECRA 3CTWB 4F5PA 4QW8A 2RQ5A 2KIVA 1CEZA 5DLGA 5J0QA 4UQGA 1MQ3A 2KK0A 5L1MA 4MEXA 2K9DA 5ITRA 2H1RA 2HCFA 1HQYE 4JV0A 3V7JA 2IOHA 4QZBA 2QB0A 3N4MB 4PGYA 9ICRA 4QWCA 3GQ3A 2K4EA 5FSWA 4FWDA 4BB9A 5JI3E 4DQSA 4CISA 3LYSA 5ALOA 3JPPA 2I6XA 3GQ4A 4C8MA 2V1UA 1IY1A 2H3FA 4M0DA 4RU9A 2BNKA 2PI4A 2KZSA 5ITYA 2Y1IA 3V6JA 2YMQA 1XSLA 2BWEA 2A1AA 1BGXT 3JPSA 1GABA 4QZ8A 5DQGA 1U9LA 1V97A 2PKEA 1KLNA 1T3NA 1IIPA 1L7PA 3RFWA 4EEYA 4LGMA 2Y0QA 1AUAA 3ZD9A 2G5HB 4LRSA 2Y9TA 3U6DA 4RNOA 3SZ2A 3M7DA 2NRXA 4DR2M 3DV9A 2K6BA 5DB8A 4CRXA 8ICOA 5KAIU 3GPYA 4Y2TA 4Q45A 1Z00B 4C80A 3NS1A 1ZQAA 3HKPA 1MN8A 4KLIA 1SKWA 4GC5A 4LJ8A 5KQDA 2F5PA 3BDPA 5J2GA 2KICA 4FWGA 3LWLA 1KYIA 2XI9A 2OQ4A 3NVYA 3U5ZA 1SL1A 5J2JA 4KX3A 3B7NA 3JAMS 1SIJA 3FUVA 2HOFA 5J29A 4F72A 3E4RA 1XXHA 2UUBM 4YG2A 4FZMA 5KFDA 3NRWA 5K4LA 1PK3A 4Q43A 2V6ZM 4JWMA 1JALA 1SXJC 2BCVA 1WG8A 4F4ZA 3SENA 1S0NA 4PDGA 1DGGA 4QZIA 2K4HA 4B3MM 1RYSA 5AM0A 3WU2U 3KD3A 2ZIUA 1JB0F 3G6VA 2VA3A 3PMLA 1XSNA 4FCVA 7ICOA 1L8QA 3WK8A 4QZ9A 1ZQYA 2BDUA 2L7IA 2WF7A 5KL8B 4C8KA 1L3SA 3PNYA 3IV6A 3GDXA 1OTRA 2G5IB 1NK4A 4G3OA 3TI0A 5DQHA 2W9AA 4GKKM 4LZDA 1TK8A 1T3TA 3SI8A 4B7GA 2UXCM 2ZXIA 3PV8A 3S6JA 3ISCA 3SD7A 4OJ6A 3V7KA 2E1EA 2F5SA 4LJ7A 1NKCA 3UZUA 1TK5A 3A0BU 3ETLA 2JEFA 4JV2A 4B9NA 4DSJA 2HHQA 4DL4A 1K3WA 4DR6M 2K8BB 3H8WA 4LF7M 3JPRA 2DAGA 3FKEA 4O9MA 5KFJA 2QARB 5EP2A 1NJZA 5KG3A 4PDIA 5DG7A 1N32M 3IDWA 3IHQB 2HBMA 5TISU 4O3PA 3KDSE 1T6OA 1ZRNA 2XICA 3VCBA 2F4VM 3H0RB 3MC1A 3FDSA 3TWMA 3SEIA 4RF1A 4FO6A 2QENA 2CE7A 3MJ5A 4JI8M 3H4BA 1JR3A 4F2LA 4L8RC 1L8LA 3CGWA 2KIWA 5E6JA 2Y20A 3GIMA 3H0LB 3K1RB 2Q0ZX 4ED3A 5HP4A 2FPLA 4NL9A 5ALVA 1L1ZA 3LCUA 3MHVC 4NLGA 2MSNA 1U49A 4LJAA 2J7OA 5AK3A 4J03A 2WTFA 4I27A 2FLNA 2YQZA 2ZAMA 2KJ9A 3SAFA 3PMNA 1JR3D 4AZFA 2H5XA 1KW4A 4L6V6 4CJ6A 2CN1A 5AKZA 3WKCA 1G8PA 3PO5A 1VDDA 3K9OA 2AH5A 2KG5A 4X62M 3C9PA 1QANA 7ICPA 5JRTA 3GZFA 3UQ2A 4YFKA 1MQ2A 1HNXM 3U60B 5J0UA 3SATA 4RQ4A 4MGHA 1XNQM 2BPFA 1S76D 4I2DA 3ALRA 4JV5M 3U6CA 4MF2A 3GV8B 3R9KA 3TAPA 2Y0SC 4QWAA 1ZQJA 5ALEA 1WYGA 1V85A 1OKSA 4GHAA 2Y9UA 1KN5A 3K9PA 3QU7A 2J6SA 2LYHA 3SV3A 2CV0A 2BCSA 1Q02A 1Q3UA 4LJ5A 2W9MA 3QU4A 4KLMA 2ESEA 1N62A 3FE3A 3UMCA 1JI7A 7ICVA 2OYYA 5EE1A 5KFHA 2M0NA 2CHGA 4GIPA 3TL4X 2KE7A 1ZQXA 1E94E 7ICFA 3RB4A 1D9DA 1XO0A 2AQ4A 3U6QA 4DL5A 9ICPA 2DKXA 5J2EA 1PJQA 3QYPA 3AOEC 1DOQA 1IN6A 4M9ZA 3QUTA 2JA2A 1UA1A 4C8LA 4C8OA 4F5QA 4P4OA 2WF5A 5J0SA 2MUTA 3MABA 2XEPA 1K1QA 3AQFA 4O3QA 5FTKA 4RQMA 2DWLA 1QCKA 5J8YA 1OW5A 3EIEA 4KLJA 3ISDA 5ALWA 5KAFU 1GJTA 3RJJA 4B3RM 2HAKA 2MH8A 3HHYA 2LHGA 3T1YM 3PZPA
chains in the Genus database with same CATH topology
4HL4A 2CRXA 2V1CA 3I4VA 3L28A 3TE6A 3VDPA 2RGOA 1YE9A 5BR8M 1J09A 2C98A 4X65M 3U6EA 4JMUA 1R6BX 4I81A 2JMGA 3GRYA 1IQPA 3SHFA 4OO1J 1XNRM 1PM5A 1WXQA 3T15A 1NZBA 4CGYB 2VJ5A 3N7SC 2CUZA 3TWKA 4KX5A 3KS8A 1SXJA 4P0PA 3GLFA 2WAQF 3CRXA 2UUCM 1N33M 2KHQA 3GU3A 4AQYM 1UM8A 2W7OA 2F5NA 2W03A 2ERCA 4G6ZA 2XVTA 2UUAM 3QAUA 2KJ5A 2WAQC 2CFOA 3FTFA 3GLHB 2QZ4A 2GH1A 2HKJA 3F5AA 2D7HA 1EE8A 4QNLA 1IBKM 4AI6A 3AQEA 4LFAM 1SXJB 3PNVA 2AHMA 3Q8XA 4JI6M 3GO8A 2DWMA 2H3ZA 2Z4SA 5LMNM 2KVCA 4I8OA 4NOOB 3KFUG 3JR4A 4JYAM 1YSYA 3NUQA 1KBUA 3M0EA 4DR7M 1A6SA 1NJFA 1TH4A 4MH0E 1A0PA 5F3WA 3HKZF 2G08A 5ITUA 4NSRA 2CPRA 2KV2A 4W5WA 2KOBA 3NWLA 3AOGA 3SQIA 3GLGA 3AFHA 3RFAA 3DA1A 3E9SA 4IBFA 3U61B 5FTMA 5EQTA 1L2DA 1GL6A 4LFBM 1GL7A 3HU1A 4L16A 3JR5A 1Q39A 3SAVA 4I4LA 5FTLA 2XSZA 3PSFA 4JI0M 1J5EM 1PVRA 2P5TA 4NWIA 4GMQA 3SFZA 2F5OA 5HR6A 3CF0A 4AG5A 3KZXA 3PFIA 3U60A 4OJOA 3GPUA 2XFTA 2QBYB 4FZLA 2K89A 2KEBA 2BJWA 2QCUA 3D8BA 3DOAA 1Z5BA 4GC9A 2HOQA 1T94A 3F53A 4AKHA 1IXZA 3ZH9B 3AV0A 1IXRC 5KQ8A 4B7HA 1G59A 2VKQA 4NV0A 2PMZC 4QIWC 4REZA 4LF5M 2F77X 5FLXS 2VQFM 5E26A 3ZC7B 2W04A 2ZXHA 4DV4M 3AL0C 3GPPA 3GLHA 4LCBA 2UU9M 2I7PA 1NVMA 3AJIB 1IBLM 3R9XB 1P7DA 4GH9A 2NQ8C 1Z6TA 3HJSA 3ZCBB 4RNAA 4A3VB 1TDZA 4K0KM 2YR0A 1N36M 1L1TA 2KNJA 4ICAA 1NNUC 1QAQA 4BBAA 2ZIWB 4XGIA 3EIHA 3SAUA 1TH2A 3SAWA 2E1EA 3KP1E 5ITQA 3CYMA 3D2NA 3GLFB 3N7PD 4DUYM 4FE3A 5EJCA 4YY3M 2KJ8A 3HWSA 4OVZB 1DRGA 3TQSA 4IJEA 4QNMA 3FUXA 2KHVA 3QWLA 4P0QB 3U6SA 4C0ZA 1K3XA 4G4OA 4KO8A 3IN5A 2J7NA 5C18A 2XGNA 2ZIVB 4JI5M 3F2CA 1GKIA 3J7BA 1HIWA 1YUBA 3J80S 3LVWA 3GRVA 1Q3BA 3GP1A 4X64M 5C1BA 3OTOM 2LYBA 3SAHA 4RF0A 4ZPXA 2XH9A 3SHGB 2VQEM 3HHXA 3K1ZA 2R62A 5BPVA 4OVZA 3U6OA 3IG5A 2D7GA 3W0FA 2LH0A 4M9SA 1F44A 2G5GX 2KXEA 1GLNA 2LWXA 3L29A 1X37A 2E5LM 2Q2EB 1E9SA 3C29A 2YB4A 4II7A 1S3SA 4AKIA 2K47A 1Z59A 4CHTB 2R45A 4DR4M 5KPRA 2OM6A 4FZNA 3ILKA 1TGUA 4IJFA 3CP8A 4DR5M 4LFCM 1N75A 3LVVA 1IXSB 2BJVA 2DF4B 2JHDA 1KFVA 1HR0M 3A42A 4R3DA 3SASA 4G4NA 3L25A 1HEKA 3D8LA 4OJ5A 1PVQA 5C0YA 3U6PA 2GOLA 1ZQ1C 5DNYA 5DYIA 2DZNB 3UMMA 4GKJM 2DVWB 4JN6A 4GHLA 3SMVA 1G41A 4O3MA 2ZAOA 4FWHA 4LY6A 3J2PB 2QBYA 2I7NA 4IBEA 3R8FA 3SARA 1J7KA 4AKGA 4GRIA 3VFDA 2DWNA 2ZIXA 4HLQA 5EXPA 3VK8A 3HGIA 3KOZE 3RE8A 4LF8M 2XF3A 4KODA 4JI4M 5IZ7D 4LF6M 2DQNB 3M6ZA 2L09A 4LZJA 2MRLA 1G4AE 1W5SA 1R7RA 5ITTA 1Z19A 2G09A 4P0QA 3I51A 5KPZA 4QIWF 3F5EA 4IBGA 2VIIA 3VC8A 3GQ5A 1OUQA 1IY2A 4ITQA 1HNWM 3O0FA 4U7CA 3A46A 3KOWE 2ZIWA 1HQCA 2LBOA 3GRUA 1NSFA 4MGYE 2C9OA 4IIWA 2XSZD 2CV2A 4OW0A 1N78A 3I4YA 3E0FA 2R4EA 4DUZM 3SMSA 2YB1A 4NRVA 1N77A 3L27A 4QOZC 2G07A 2VJ4A 5EP4A 1QVRA 2FFJA 1FJGM 3N7RC 4KMOB 3SC3A 1CRXA 4MB7A 2NV3A 1URJA 3IP4B 3M6KA 2RGHA 4NLBA 4BUGA 2X4AA 2ZBKB 3FUUA 3RGSA 1ZAEA 3MGVA 2HOIA 2LYAA 2A5YB 4AYBF 1SXJE 3CTWB 2A3VA 1PJIA 1QYRA 3T1HM 2K8CB 2RP5A 5GKNA 2KW0A 1OFIA 3M7GA 5ITRA 2H1RA 1D2NA 1DGHA 4LGYA 1HQYE 4D82A 3J7AS 2G0AA 3RF9A 4CDGA 1G3IA 1HT1E 4L4UA 3W0LB 4DV7M 3L3FX 2KRUA 3GQ3A 4FCTA 2K4EA 5FSWA 4FWDA 4BB9A 5JI3E 1NY5A 5EP3A 2Y21A 1FNNA 4CISA 3LYSA 3BOSA 1QZMA 1IM2A 3GQ4A 1H6UA 1YT3A 2Z3XA 3H4MA 3KSJA 3HHZA 4NXMM 3K1JA 4IBKA 2V1UA 1IY1A 3C58A 4M0DA 3THGA 2H3FA 2ZM6M 3VK7A 4OJPA 4FVMA 4IBCA 4LJ4A 5EXSA 1OFHA 5IREB 1R2YA 2HL7A 2MA1A 2BNKA 5FTNA 2O5RA 2LNHC 2EA0A 2KZSA 5ITYA 3AL0B 1UPHA 4ACOA 2RRDA 4JI2M 8CATA 4XBOA 3LQQA 3M6AA 5EXTA 3AKZA 5JI2E 1IIPA 4MGZE 3RFWA 1PVPA 1C1KA 4LRTA 3T38A 4LGMA 2Y0TA 3UGJA 1PJJA 3A45A 4KLNA 2Y0QA 1IBMM 2HBKA 2RHFA 2G5HB 4LRSA 2KEYA 3U6DA 4QJFB 2KRKA 5LMUM 4DV0M 1NHGC 4IBJA 4DR2M 2XZFA 3M7DA 4CRXA 3F2BA 1OJLA 4X66M 2C99A 3GPYA 1E32A 3RGPA 4DV3M 2LKYA 4L78A 1DO0A 3HKPA 2L6OA 4QNRA 2R65A 4GC5A 4LJ8A 4LF4M 5KQDA 2F5PA 2D7EA 2N1RA 2KICA 4WJ3B 4FWGA 4IBDA 4WURA 5KPTA 1KYIA 2L7HA 3D2SA 3VKHA 2XI9A 2OQ4A 4NXNM 3U5ZA 4WW0A 4JI7M 2F2AB 3GPXA 4KX3A 3JAMS 2DHRA 5EXXA 3FUVA 4DR1M 2HOFA 3E4RA 3KOYE 1XXHA 2FNAA 5KL1B 2CHQA 2UUBM 3VDUA 2H3IA 3NRWA 3K2LA 4FZMA 3FD9A 1SXJD 1DGFA 3PZPA 2DXIA 2WB1C 2V6ZM 1SXJC 2HCBA 3SYKA 3HKZC 5EP1A 2DWZB 4B3TM 3J27B 4NL4H 2HBLA 4DV1M 2K8AA 4PDGA 4FW9A 1DGGA 2XIDA 1XC8A 2K4HA 2X8AA 4B3MM 3PVSA 1HNZM 3IG8A 4IBIA 4LZZA 5FTJA 1MU5A 3KOXE 3KP0E 1Q3CA 3KVWA 4AW4A 2CHVA 1XMQM 2ZIUA 1SZHA 4FCVA 5A0LA 4S12A 2RKOA 1L8QA 4R7GA 4B3SM 2BDUA 2L7IA 5KL8B 4NRWA 4FCWA 3PNYA 3FTCA 4BJQA 2LXEA 2JH7A 1QAOA 2G5IB 3WHLA 1DO2A 2KKPA 4DV6M 1XNSA 2KZUA 4QOSA 2JGAA 4BX9C 4GKKM 1T3TA 4BLCA 1TAMA 4B7GA 2UXCM 2YX8A 2ZXIA 4MGKE 2Y0SF 3VKGA 2QP9X 2JH1A 4OJ6A 4JI3M 3K92A 3KW6A 3L2AA 3SYLA 3SBJA 1K82A 2F5SA 4LJ7A 1ED1A 3UZUA 1I94M 4OJLA 2DZOB 3GRRA 4PCZA 3SAGA 1QQWA 3MK6A 2C5RA 4EIWA 5H37D 1K3WA 4DR6M 2KD1A 2E1FA 4PD2A 2K8BB 7CATA 4LF7M 4NLCA 4YHHM 5HR7A 3FKEA 1E9RA 1Z1BA 5EP2A 2E5SA 4PDIA 4Z8XA 4LJ9A 4I5SA 2YNMD 1N32M 1XWIA 2HBMA 4A8EA 5IWAM 3T79A 1XXHB 3KDSE 3U5ZB 1MX0A 1GO3F 2XICA 3VCBA 1IN4A 2F5QA 2F4VM 3H0RB 3HJ8A 3UJNA 4M0WA 2XFSA 3TWMA 4RF1A 3U61A 2F8LA 4LG2A 4QHTA 2QENA 2CE7A 3MJ5A 4JI8M 2CEAA 2W82A 2Z4RA 4FD2A 5DYGA 1JR3A 4D80A 4L8RC 2ZG6A 4DR3M 2KIWA 5E6JA 1IN5A 2Y20A 3H0LB 3LQRA 1NY6A 2C9CA 2ZANA 1JQJC 2R18A 3MHVC 1Z5AA 1L1ZA 2Q4TA 3F2DA 1Q3VA 3SMPA 4LJAA 4QHSA 3D2QA 2C96A 4G4RA 5ITXE 2J7OA 1XMOM 4CGZA 4D81A 1N34M 1NJGA 1TDHA 2G06A 3VLFB 2YQZA 4U6PA 2ZAMA 3U6MA 2HBJA 2KJ9A 1JR3D 1ECWA 2FOIC 4AZFA 1WUDA 3SAFA 4P0PB 3B9PA 2LHTA 2H3VA 3FTEA 3HU2A 3KXEC 3FYCA 2CN1A 3PSPA 3WHKA 1G8PA 2M5ZA 1VDDA 2CV1A 4P16A 3CF2A 3A98B 4X62M 1LV7A 3K8ZA 1TH3A 3UK6A 1QANA 1L2BA 2K4IA 4OX9M 2ZIUB 1NNJA 3TPZA 2DGZA 4NSOB 3GZFA 1D8BA 1HNXM 3DZDA 3U60B 3PSTA 2YFQA 3SATA 4IBBA 3C28A 4MGHA 1W5TA 4MGIE 3U6LA 1XNQM 1XHBA 5ITXA 3KSXA 3ALRA 2XZUA 4JV5M 3U6CA 4KHPM 2H3QA 1QAMA 4JXJA 2KKVA 2R4JA 4MM3B 2Y0SC 3FUWA 1DGBA 2EUCA 4TUWA 3J81S 4GHAA 2OPFA 2ZIVA 5A2QS 2PMZF 2CV0A 4OU7A 2XLJA 1Q3UA 4LJ5A 3CF6E 3DFZA 1IN7A 2UXDM 3OPXA 2R46A 3NBIA 2FE8A 3GLIA 2OYYA 2F76X 3KS4A 2M0NA 1I4WA 2CHGA 4GIPA 3TL4X 4IC9A 5IT9S 1E94E 2D6FC 1DGHB 1NHWC 2KA6B 1XO0A 3FTDA 2OXOA 3U6QA 3ONNA 1ORYB 3FYDA 2HMXA 3DEEA 3AOEA 1HT2E 2M60A 4LJ6A 4B7FA 3AOEC 4DV2M 1IN6A 4M9ZA 1L6NA 2JA2A 3GLIB 3H0MB 3HHWA 3FUTA 4DV5M 4B08A 4L15A 1KSFX 4PT5A 1L2CA 1ZQ9A 2G8LA 2XEPA 4M9XA 4AYBC 3AQFA 1R2ZA 5FTKA 1IY0A 4LF9M 1Z5CA 2DWLA 3KFUF 2QPAA 3LMMA 1IN8A 2X49A 3HJQA 2HHHM 4GFJA 3EIEA 3GLGB 1MA7A 2OH2A 2VIXA 2UXBM 3HU3A 2Z7JA 4AG6A 4Z6YA 5KO3A 2W7PA 1GVNA 4B3RM 5CRXA 3ICXA 3PXGA 2EO2A 3HHYA 4JI1M 2WB1F 2ZIXB 3PSIA 4PL2A 4G4QA 5T14A 3T1YM 3TWLA 4GITA 4PL1A 3L26A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R18 A;  2Z7J A; 
#chains in the Genus database with same CATH topology
 1BVS A;  5JU5 A;  3I4V A;  3TE6 A;  5IIJ A;  1L5U A;  2HHX A;  2RGO A;  1WWU A;  3AM9 A;  2VDB B;  4I81 A;  1N56 A;  3GRY A;  1IQP A;  1ZQM A;  9ICV A;  1PM5 A;  2EDU A;  3RB6 A;  2VJ5 A;  2BHN A;  3KS8 A;  3EWA A;  2HDO A;  1VEK A;  1D0M A;  2W7O A;  4AQY M;  2F5N A;  2L4F A;  1L3U A;  2O25 A;  2W03 A;  3KKA A;  4UAT A;  2FMQ A;  3PX6 A;  2DEN A;  2UUA M;  2WFA A;  3QAU A;  1N5X A;  2R8J A;  1DK3 A;  2A19 A;  4AI6 A;  3AQE A;  1NK5 A;  2RRU A;  4IRK A;  4PHA A;  7ICK A;  2KVC A;  2E8O A;  1F5S A;  1A6S A;  5BPC A;  1S0V A;  4DR7 M;  2JWS A;  1ZQS A;  3KZI U;  3OGU A;  3GLH E;  4YQW A;  5J0T A;  3C3D A;  5KFK A;  4W5W A;  1ARO P;  2KOB A;  3GLG A;  4IRD A;  3E9S A;  3LDA A;  5KFP A;  1JX4 A;  1L2D A;  1GL6 A;  3NBX X;  5DKW A;  1PK1 B;  1GL7 A;  2R0I A;  4GEW A;  5AIA A;  2K4P A;  3PX4 A;  2BQR A;  4B9L A;  1Q39 A;  1ZQK A;  3BS7 A;  2XSZ A;  8ICW A;  3PSF A;  4CF5 A;  2DAE A;  4FBU A;  4RUA A;  3PW0 A;  3CF0 A;  4AG5 A;  3U60 A;  2DKZ A;  5F9L A;  2HVI A;  7ICL A;  9ICH A;  2QBY B;  4FZL A;  2LVO C;  8ICK A;  2KEB A;  4Y2S A;  2BJW A;  3WKD A;  5KG7 A;  3AMZ A;  3W67 A;  1IXZ A;  4EX6 A;  5KQ8 A;  2PMZ C;  1N63 A;  1NOM A;  2VQF M;  3KTQ A;  3ZC7 B;  1NNL A;  2W04 A;  3BZC A;  3AN1 A;  4LCB A;  3PW5 A;  1NVM A;  4F1I A;  5DGB A;  2JEG A;  1Z6T A;  4MFF A;  4RNA A;  4K0K M;  1V92 A;  2KNJ A;  1NK9 A;  2GWS A;  4XGI A;  3D2N A;  5KFX A;  3N7P D;  3GLF B;  2KJ8 A;  1JRO A;  1VEG A;  1BPX A;  3TQS A;  4GC7 A;  4KLF A;  4IJE A;  5J0X A;  2KHV A;  1K3X A;  4DFJ A;  1SGG A;  1JXE A;  2ZIV B;  3J7B A;  1HIW A;  4OCZ A;  3J80 S;  3LVW A;  5J2C A;  3OHA A;  4RF0 A;  2VQE M;  2XH9 A;  3HHX A;  4QZG A;  4C4T A;  9ICL A;  4OVZ A;  2W8K A;  2GLE A;  2LH0 A;  2N35 A;  2AGP A;  4II7 A;  2JY8 A;  5KPR A;  2JZB B;  1X9W A;  1LTM A;  2ZTD A;  1TGU A;  3Q8G A;  2PI5 A;  1F0M A;  4DR5 M;  4IQV A;  4P4P A;  2JHD A;  4KLD A;  1HR0 M;  1J2N A;  4G4N A;  3U6P A;  4K4G A;  5E79 U;  5DNY A;  2DZN B;  1ZMV A;  4GKJ M;  2YY6 A;  2E8M A;  1SWW A;  5L1L A;  4YMM A;  4IBE A;  1YZ7 A;  3OSN A;  5CA7 A;  2DAI A;  3SAR A;  1J7K A;  1JXL A;  4GRI A;  2R6F A;  4DEZ A;  3VK8 A;  3HGI A;  2FPK A;  2XF3 A;  2NRZ A;  3M6Z A;  4CF4 A;  1TAU A;  4LZJ A;  3ORY A;  3BBZ A;  1SWV A;  1R7R A;  2BDP A;  2DZL A;  2AGQ A;  3AUO A;  4P0Q A;  1WR1 B;  1VDL A;  4O0I A;  3UQ0 A;  5HML A;  4Z6C A;  3VC8 A;  2IBK A;  9ICA A;  2OOA A;  5B5E U;  1HQC A;  1DXS A;  1L8O A;  5KFA A;  4IIW A;  2ASJ A;  3RBD A;  4OW0 A;  3HX0 A;  1ZRM A;  3L5K A;  4M9H A;  3SMS A;  2YB1 A;  4R65 A;  3MR6 A;  4QOZ C;  2G07 A;  5AI4 A;  5EP4 A;  2FFJ A;  2JR5 A;  4TUR A;  3IP4 B;  4RNN A;  3ZDB A;  3A0H U;  3FUU A;  3ZD8 A;  3LK9 A;  2HOI A;  2AJQ A;  1S8O A;  4KT0 F;  5AM1 A;  2A3V A;  3H8J A;  2KW0 A;  1S0M A;  4HYK A;  5KFT A;  1G3I A;  1HT1 E;  4LZG A;  4L4U A;  2B3T A;  5KFW A;  5KT5 A;  1VQ1 A;  4FCT A;  4I2H A;  5AHX A;  4NLZ A;  2HSZ A;  3DDH A;  4UB8 U;  2DBY A;  3BOS A;  1BPE A;  1QZM A;  5ALU A;  2Z3X A;  1QDT A;  3WK5 A;  4Y2U A;  1ZMW A;  3THG A;  5KFC A;  2ZM6 M;  1TVA A;  3WK6 A;  4FVM A;  4IBC A;  5IRE B;  4F2R A;  8ICL A;  4DL2 A;  2KTQ A;  1RZT A;  1KRP A;  4I2I A;  4B9U A;  8CAT A;  4XBO A;  5EXT A;  4MGZ E;  2W54 A;  4PHD A;  2CXY A;  4LFB M;  1RG6 A;  4KLN A;  1IBM M;  2HBK A;  5CJ7 A;  3RH4 A;  4FFD A;  4PPX A;  3HY5 A;  2KRK A;  3RBE A;  4DV0 M;  1NHG C;  4NXZ A;  3GIL A;  4G9B A;  3FAH A;  1OJL A;  5J2K A;  2BGW A;  3RGP A;  2LKY A;  4Q8F A;  1RXW A;  4YMO A;  3RTV A;  2JXJ A;  4QNR A;  4LF4 M;  2D7E A;  4WUR A;  3D2S A;  2L7H A;  5ALY A;  3C1Y A;  3KKA C;  4JI7 M;  2F1I A;  2DHR A;  4YP3 A;  1PJS A;  4HAI A;  3AU2 A;  3FRH A;  3VDU A;  4UAW A;  1SXJ D;  4ELT A;  1S5L U;  4MF8 A;  5EP1 A;  1WIV A;  4B3T M;  5G5G A;  3JPN A;  4DV1 M;  4Y2Y A;  4F5N A;  2XCP A;  2AHO B;  3HWT A;  3PVS A;  1JRP A;  2BCU A;  4UAZ A;  3KOX E;  1XMQ M;  2IHN A;  3PO4 A;  5A0L A;  4S12 A;  3V6H A;  3Q8K A;  1N48 A;  3HIL A;  4FCW A;  3FTC A;  2LXE A;  5ALM A;  2KNV A;  1QAO A;  3QZ7 A;  1ZQG A;  4DV6 M;  2KZU A;  5HMM A;  3QU2 A;  4C7Y A;  4UBB A;  5J0P A;  4BLC A;  9ICJ A;  4QW9 A;  1NI3 A;  4Y2V A;  2YX8 A;  5L1K A;  4K4H A;  4BWJ A;  2JH1 A;  3K92 A;  3SBJ A;  4DFK A;  3SYL A;  1K82 A;  5CP2 A;  4QWE A;  1K5O A;  1I94 M;  2DZO B;  5ALZ A;  3SAG A;  1QQW A;  4QZF A;  1LB2 B;  2BCQ A;  5H37 D;  2I9G A;  3RRH A;  3OTQ A;  3B7Q A;  5F3X B;  4NLC A;  4YHH M;  5HR7 A;  4YCX A;  4B9S A;  2E5S A;  4Z8X A;  5J8Y C;  4I5S A;  5AKI A;  1L7M A;  4ECZ A;  1XWI A;  3GV7 B;  2YN4 A;  4RQ7 A;  1MX0 A;  2F5Q A;  1FFU A;  4TQS A;  3GLG E;  2FDR A;  4CE6 A;  4M0A A;  3LCV B;  3BS5 B;  5F9N A;  2Z4R A;  5DYG A;  5AM3 A;  4O5C A;  4DR3 M;  3RAX A;  3M9M B;  5DBB A;  7ICR A;  5DBC A;  3H4D A;  1JQJ C;  4F91 B;  4TUP A;  4PHP A;  5ITX E;  4QZA A;  2UVR A;  1S9F A;  1N34 M;  1WWV A;  5ALX A;  8ICZ A;  3VLF B;  7ICM A;  3UMG A;  9ICW A;  3PW4 A;  4Q7J A;  5G5H A;  4MFA A;  1WUD A;  3LWM A;  4P0P B;  3B9P A;  2LHT A;  2EAO A;  2BQ3 A;  3FYC A;  3BQ7 A;  3H8S A;  4O3O A;  2CV1 A;  1X9M A;  3A98 B;  2P35 A;  3UXP A;  1TH3 A;  3UK6 A;  1L2B A;  1B0X A;  1SL0 A;  5AI6 A;  1NNJ A;  2VF8 A;  7ICH A;  3TPZ A;  2DGZ A;  4NSO B;  1ZQF A;  2L4E A;  1D8B A;  2EH9 A;  4UB6 U;  3DZD A;  2ZUD A;  1KDH A;  1W5T A;  4MGI E;  3KSX A;  3HT3 A;  2FE9 A;  2ZJ8 A;  3RJH A;  2ZUC A;  4JXJ A;  1MSW D;  1UFZ A;  3V6K A;  1GO5 A;  3EUB 2;  1DGB A;  4UB1 A;  2PMZ F;  4YR2 A;  8ICF A;  1TTE A;  4O3S A;  3BQT A;  3DFZ A;  2R46 A;  3NBI A;  3GLI A;  5KFO A;  3J81 j;  1OXJ A;  5ALI A;  5TZV A;  1QSY A;  1RM6 C;  5DG8 A;  1FFV A;  3SYZ A;  3N97 B;  4IC9 A;  4EZ9 A;  2D6F C;  1NHW C;  2GNO A;  2OXO A;  3GLI E;  2HMX A;  1ZD4 A;  3NTU A;  1O03 A;  3H7I A;  3PX0 A;  2CWB A;  1L6N A;  3H0M B;  3HHW A;  1AQ6 A;  1OIP A;  5KG5 A;  4B08 A;  5J0R A;  4L15 A;  1ZQ9 A;  3TAN A;  3E58 A;  4LF9 M;  3KFU F;  3HJQ A;  4GFJ A;  2OH2 A;  1SZP A;  2VIX A;  4KMU A;  2UXB M;  3GII A;  1WCL A;  2XY7 A;  1K1S A;  2Z7J A;  5KO3 A;  4F92 B;  3I01 M;  3QU9 A;  3ICX A;  3PXG A;  2EO2 A;  1HUZ A;  2WB1 F;  2LTU A;  3M8S A;  4PL1 A;  3C29 A;  4KIT B;  9ICE A;  1L3T A;  2E3T A;  1SV0 C;  5AKG A;  2CRX A;  2V1C A;  3L28 A;  4BXO B;  3VDP A;  4C7Z A;  2OWO A;  5GTH U;  5BR8 M;  4DFD A;  3HW8 A;  1IXR A;  4ELV A;  2F1J A;  4QZC A;  1WXQ A;  2R44 A;  1Z4O A;  3AU6 A;  3B89 A;  3N7S C;  2CUZ A;  3TWK A;  3WKA A;  1SKS A;  5KT2 A;  9ICG A;  3QNM A;  1WJ7 A;  4DSE A;  1COO A;  3FC4 A;  1KFS A;  5DG9 A;  2OOB A;  2XY5 A;  4YR0 A;  4G6Z A;  5ALN A;  5KG0 A;  2KJ5 A;  2DKL A;  1F4I A;  8ICC A;  9ICX A;  3RJK A;  2KHH A;  1DGS A;  2C2E A;  2GH1 A;  2HKJ A;  3F5A A;  1IBK M;  5IIL A;  1ZD2 P;  2OO9 A;  1SXJ B;  2AHM A;  9ICM A;  5LMN M;  4JYA M;  4NOO B;  3KFU G;  3JR4 A;  5D46 A;  1KBU A;  1NJF A;  4MH0 E;  5B66 U;  5EWF A;  4RQ5 A;  4NSR A;  2G3Q A;  2CPR A;  3ZDE A;  4F3O A;  3NWL A;  3AOG A;  2EAN A;  1VLB A;  2DPI A;  3DA1 A;  4IBF A;  3U61 B;  2L5Y A;  3MFH A;  5EQT A;  3QZ8 A;  4NY8 A;  3RR7 A;  3JR5 A;  3B7Z A;  4NM2 A;  3Q8Q B;  4R63 A;  1QLN A;  5JUM A;  2P5T A;  3TAD A;  4GMQ A;  5EE3 A;  7ICG A;  5HR6 A;  4CIZ A;  3KZX A;  2C22 A;  4RQ2 A;  2BPG A;  2XFT A;  4DOB A;  3FYH A;  1NKB A;  4GC9 A;  1Z5B A;  4X5V A;  4AKH A;  2BQU A;  1A5T A;  2FMS A;  2V9W A;  3ZH9 B;  1NJW A;  1IXR C;  4QIW C;  3ZQJ A;  2VKQ A;  4ED2 A;  2YMM A;  3T5H A;  5E26 A;  3WKB A;  1ZQP A;  2UU9 M;  1IBL M;  1P7D A;  5KFZ A;  4GH9 A;  2JP7 A;  2DAM A;  1R5L A;  2EAM A;  3HJS A;  3ZCB B;  4A3V B;  3G6Y A;  2YR0 A;  1N36 M;  1L1T A;  1QAQ A;  2ZIW B;  3CYM A;  4XQ8 A;  3SAU A;  1TH2 A;  3M1Y A;  5KFQ A;  3TQ1 A;  2ES6 A;  9ICK A;  1VDV A;  5J2H A;  4R8U B;  4C0Z A;  4KLG A;  4KO8 A;  5C18 A;  2QSF X;  4JI5 M;  1GKI A;  1ZET A;  1YUB A;  3QUQ A;  3GLF E;  3SAH A;  4PHE A;  2LYB A;  4ZPX A;  2JXN A;  2W9C A;  3K1Z A;  5AM2 A;  3U6O A;  3I1Y A;  4YVZ A;  1B43 A;  1F44 A;  3L29 A;  2LWX A;  4Y2J A;  1KEJ A;  3ZI4 A;  4ECX A;  5J2I A;  1E9S A;  4AKI A;  4KTQ A;  3NVV A;  3NVZ A;  2R45 A;  4DR4 M;  5ALD A;  5KT3 A;  4I2B A;  5AKH A;  4J9R A;  5HHH A;  4IJF A;  3CP8 A;  3U26 A;  4LFC M;  4DL7 A;  2PFQ A;  2DF4 B;  5BOL A;  4OJ5 A;  2DAK A;  2ALZ A;  2BCR A;  5J0W A;  5CR0 A;  2GOL A;  2KDL A;  1SL2 A;  3PR4 A;  2W3S A;  2DVW B;  2GO7 A;  2FI1 A;  4JN6 A;  3SMV A;  5KNI A;  4O3M A;  2ZJ5 A;  1AIP C;  4JB3 A;  3BS5 A;  2DFL A;  1VEJ A;  3WKE A;  3RE8 A;  4LF8 M;  4JI4 M;  4KOD A;  4B6J A;  3KHG A;  2MRL A;  3EPI A;  3I76 A;  1GJS A;  1Z19 A;  3RH5 A;  4M6W B;  2JUJ A;  2VII A;  2OEH A;  2JEI A;  1IY2 A;  4IL6 U;  7ICN A;  3KOW E;  2ZIW A;  3IHP A;  3GRU A;  2R8G A;  2C9O A;  4NC6 A;  2XSZ D;  4I29 A;  4EEN A;  2HHS A;  3E0F A;  1L7N A;  2R4E A;  3Q8P B;  1EXN A;  1N77 A;  2VJ4 A;  1FJG M;  4KMO B;  3N7R C;  5D49 A;  1CRX A;  4NLN A;  2ZUB A;  4J9M A;  4ECT A;  1URJ A;  3M9O B;  1Q46 A;  2RGH A;  3M6K A;  4NLB A;  4BUG A;  2ZBK B;  5DBA A;  4MFC A;  1HJP A;  2LYA A;  7ICU A;  5DB9 A;  4Z6E A;  2BPC A;  1QYR A;  1ZYQ A;  3T1H M;  2K8C B;  2RP5 A;  5GKN A;  1BPY A;  3GIK A;  1D2N A;  1DGH A;  4LGY A;  1XC9 A;  4D82 A;  3J7A S;  1JN3 A;  2E8N A;  2G0A A;  2OHF A;  5AI5 A;  2K0B X;  3RF9 A;  4CDG A;  4ANR A;  2GQF A;  1KSP A;  9ICB A;  3L3F X;  1ZQH A;  3PW7 A;  1NY5 A;  4P17 A;  5EP3 A;  5L1I A;  2Y21 A;  4MEY A;  2B6G A;  4KLQ A;  1H6U A;  1YT3 A;  3KSJ A;  3KHH A;  3K1J A;  5KFI A;  4MHV A;  4YXJ A;  3C58 A;  2VA2 A;  2KFZ A;  3W68 A;  1RQN A;  5EXS A;  1U48 A;  1OFH A;  1R2Y A;  2F1H A;  2HL7 A;  2MA1 A;  5FTN A;  4RPY A;  2O5R A;  2LNH C;  2EA0 A;  1XB2 B;  3T5J A;  4QZH A;  4ACO A;  5CWR A;  4PH5 A;  2O6K A;  1S0O A;  4E0D A;  2RRD A;  1M6Y A;  4O3N A;  4JI2 M;  2EZZ A;  1LKY A;  2QLT A;  3E21 A;  3M6A A;  2LVA A;  2I1Q A;  3AKZ A;  3FRI A;  2AQ0 A;  4LRT A;  3T38 A;  3A45 A;  2YQE A;  1Z3E B;  2XZF A;  1RXV A;  4IBJ A;  4DQQ A;  2F3N A;  3F2B A;  4Y2P A;  1QTM A;  1JR3 E;  2ATL A;  4DV3 M;  2ODG A;  4L78 A;  4DF8 A;  1DO0 A;  1SB3 C;  2L6O A;  4PZO A;  2R65 A;  3IEC A;  4XA5 A;  3H40 A;  4KN4 A;  2N1R A;  2XO7 A;  5KPT A;  3MR2 A;  1P3Q Q;  3VKH A;  3ZDA A;  4BXO A;  4US9 A;  2HVH A;  4YR3 A;  3BXW A;  3QEA Z;  3QYB A;  2YMP A;  3KOY E;  9ICC A;  2CHQ A;  8ICR A;  2MGW A;  2J6U A;  3K2L A;  1PJT A;  2V4Q A;  4ELU A;  2DXI A;  2WB1 C;  5HNK A;  9ICT A;  4Z6F A;  5DB7 A;  2HCB A;  1NV8 A;  2EAP A;  4I28 A;  2DWZ B;  3KBB A;  2JZ1 A;  3LW5 F;  2MUT B;  4NL4 H;  2HBL A;  3EPG A;  2K8A A;  4M04 A;  4FW9 A;  4UB5 A;  3IG8 A;  4LZZ A;  5FTJ A;  1MU5 A;  2LVN C;  3KP0 E;  3PR5 B;  1Q3C A;  3KVW A;  4NJ8 A;  1SZH A;  5AKX A;  3MGI A;  4R7G A;  4B3S M;  4NRW A;  2YML A;  3PNC A;  5AKY A;  2DPJ A;  2ASL A;  2JH7 A;  2C2D A;  1XNS A;  4QOS A;  4BX9 C;  2XGP A;  1TAM A;  1ZD5 A;  4MGK E;  1JUD A;  3Q8M A;  2Y0S F;  3T5K A;  1NV9 A;  2QP9 X;  2W3R A;  4JI3 M;  1ED1 A;  2VA8 A;  4OJL A;  3B74 A;  4PCZ A;  5EE9 A;  2C5R A;  5AK5 A;  3THV A;  2KD1 A;  2E1F A;  3UXN A;  1QUS A;  5DDM A;  2KZM A;  5L8R F;  1Z1B A;  2KZ3 A;  4LJ9 A;  1B4F A;  5KG1 A;  1XS9 D;  2YNM D;  4A8E A;  2I5H A;  2WHE A;  3T79 A;  1XXH B;  3U5Z B;  1GO3 F;  1V33 A;  1IN4 A;  2DI0 A;  3HJ8 A;  4RUC A;  4M0W A;  4NM1 A;  1NK8 A;  3U61 A;  2F8L A;  4LG2 A;  4B9T A;  2FMP A;  4FD2 A;  4D80 A;  5J0Y A;  2ZG6 A;  4I2F A;  4KLE A;  1IN5 A;  5KFU A;  4EX7 A;  5C5J A;  3RJE A;  1NY6 A;  1D0K A;  2Q4T A;  2C9C A;  2ZAN A;  2R18 A;  2EZX A;  1Z5A A;  3M8R A;  1S97 A;  1S77 D;  1Q3V A;  3D2Q A;  4KLU A;  2C96 A;  4G4R A;  1XMO M;  1MC8 A;  4D81 A;  2G06 A;  5KT6 A;  4U6P A;  2LHC A;  2PXI A;  3BQ2 A;  3HU2 A;  3WHK A;  3C1Z A;  3CF2 A;  2WF8 A;  2ZIU B;  5KT7 A;  2DHY A;  2HHU A;  3C3E A;  4RNM A;  2YFQ A;  4BDP A;  1XHB A;  5ITX A;  5ALT A;  2XZU A;  1QAM A;  1N60 A;  2R4J A;  5IIK A;  4IQT A;  3FUW A;  1JIH A;  1RDF A;  4TUW A;  2HHV A;  3J81 S;  4OU7 A;  2BZF A;  1S10 A;  1IN7 A;  3N28 A;  3QYE A;  4ED1 A;  8ICV A;  1TV9 A;  2LVQ D;  1IG6 A;  5KG6 A;  4B9V A;  4Q44 A;  1N5W A;  4IR9 A;  2NO5 A;  1I4W A;  2PFP A;  5IT9 S;  1J2M A;  1LVH A;  4F5R A;  4ECV A;  1DGH B;  3OHB A;  2KA6 B;  3FTD A;  3IM1 A;  4F5O A;  1BNO A;  3FYD A;  2MRO B;  1ZQT A;  3AOE A;  7ICQ A;  2JY7 A;  4LJ6 A;  4B7F A;  5AI0 A;  3TAR A;  4DV2 M;  3BZK A;  3GLI B;  4HEO A;  2AU0 A;  3FUT A;  4DV5 M;  4GXK A;  2BR0 A;  1KSF X;  1L2C A;  1DV0 A;  4ED6 A;  1QUT A;  2W9B A;  3OJS A;  4AYB C;  1R2Z A;  4ECQ A;  1IY0 A;  5EE0 A;  5ALL A;  1IN8 A;  2AGO A;  3GLG B;  1PUZ A;  3HU3 A;  3NRZ A;  4P2H A;  4Z6Y A;  3L4P A;  1GVN A;  2E8P A;  1ZQV A;  5CRX A;  2IA6 A;  3RH6 A;  1WGN A;  4JI1 M;  2ZIX B;  4PL2 A;  3PSI A;  4F93 B;  5T14 A;  3UXO A;  4YXM A;  2K60 A;  2MAX A;  1YE9 A;  5III A;  4G3I A;  2LM4 A;  3U6E A;  4JMU A;  5D4B A;  4QWB A;  4C4R A;  3OSP A;  2IMW P;  1NZB A;  3CNH A;  4CGY B;  3NGD A;  3E2E A;  1NKE A;  1T4G A;  1SXJ A;  2CP8 A;  3GLF A;  4J9L A;  2WAQ F;  4P0P A;  3CRX A;  1N33 M;  1SXE A;  1ZV1 A;  2KHQ A;  1UM8 A;  5J0O A;  4DF4 A;  2ERC A;  4UW9 A;  1COK A;  4UAU A;  4DL3 A;  3V7L A;  4IS7 A;  3I04 M;  2CFO A;  1A76 A;  2DL0 A;  2HHT A;  2OCE A;  2FLP A;  4J9N A;  1EE8 A;  4QNL A;  4LFA M;  1X9S A;  3Q8X A;  4JI6 M;  2KNA A;  1ZXI A;  2H3Z A;  2Z4S A;  3OJU A;  4I8O A;  4DOA A;  1C20 A;  1YSY A;  1SV0 A;  3NUQ A;  3M0E A;  4DQR A;  3TAQ A;  1TH4 A;  3IRU A;  2XC9 A;  3HKZ F;  4J9P A;  1TKD A;  4CNQ A;  5KFM A;  3QE9 Y;  2G08 A;  1VG5 A;  3H8M A;  8ICB A;  3SQI A;  3ZDD A;  3B0Y A;  1CI4 A;  3AFH A;  3RFA A;  2PFN A;  2QB0 B;  4JUZ A;  3HU1 A;  2W55 A;  1U4B A;  1PK1 A;  3SAV A;  2MR9 A;  5FTL A;  4TQR A;  1J5E M;  4EBD A;  1PVR A;  4NWI A;  5L1J A;  3SFZ A;  2F5O A;  4OJO A;  2NRV A;  1YLA A;  3HP6 A;  2QCU A;  4Q8E A;  9ICU A;  3F53 A;  4UAV A;  4NV0 A;  4R71 A;  3KOO A;  4PGQ A;  4ZOH C;  4REZ A;  1JMS A;  4M9L A;  2F77 X;  4DCC A;  2ZXH A;  4DV4 M;  3AL0 C;  2I7P A;  1U47 A;  3AJI B;  2WF6 A;  3R9X B;  1WCN A;  2NQ8 C;  4GLX A;  4QZE A;  4I2E A;  1TDZ A;  1ZQE A;  2KP7 A;  1D9F A;  4ICA A;  1NNU C;  4C8N A;  2RLT A;  3EIH A;  1T3Q A;  4DS4 A;  3KP1 E;  2B0C A;  5BOM A;  3V72 A;  4FE3 A;  3HWS A;  4F8R A;  4O5K A;  4KLS A;  3WK9 A;  3QWL A;  3QXG A;  4P0Q B;  3U6S A;  2KSO A;  5AKE A;  3IN5 A;  1Z1V A;  2J7N A;  2VF7 A;  1Y88 A;  4RPZ A;  4R66 A;  3ETR A;  3MDC A;  1ZQQ A;  3F2C A;  8ICG A;  4TUS A;  2LMR A;  9ICS A;  2NRT A;  2P6R A;  3GRV A;  2ZJA A;  1Q3B A;  4X64 M;  5C1B A;  4DO9 A;  4M9N A;  1T7P A;  3BQ0 A;  3IG5 A;  2D7G A;  3W0F A;  2PFO A;  4M9S A;  3C2M A;  3RR8 A;  4IRC A;  2KXE A;  1GLN A;  1BPB A;  2Q2E B;  2YB4 A;  1S3S A;  3F92 A;  1QZE A;  2IOF A;  1Z59 A;  4CHT B;  2OM6 A;  1ZJM A;  3ILK A;  5KFV A;  1N75 A;  3LVV A;  1IXS B;  2BJV A;  1KFV A;  1HEK A;  4R3D A;  1IXS A;  5C0Y A;  1MJG M;  1X42 A;  1O08 A;  1NK7 A;  5DYI A;  2NO4 A;  2IOF K;  2J5Y A;  3PY8 A;  2ZAO A;  3D6J A;  5KFF A;  5IIM A;  4FWH A;  4LY6 A;  4F4Y A;  3J2P B;  2QBY A;  2BWB A;  2UVW A;  1Y8G A;  1DK2 A;  4HLQ A;  5EXP A;  2QHO B;  3KOZ E;  2Y1J A;  1D8L A;  2Z8Y M;  3WK4 A;  5IZ7 D;  2DQN B;  3M9N B;  4I2J A;  5KG2 A;  4EEL A;  1X66 A;  5ITT A;  8ICA A;  3HJE A;  3HPO A;  1ZD3 A;  4Y2Q A;  5KPZ A;  3F5E A;  4IBG A;  3GQ5 A;  1OUQ A;  1IFY A;  3WK7 A;  4ITQ A;  1UQV A;  1HNW M;  3O0F A;  3TKA A;  4U7C A;  3A46 A;  1MN3 A;  1RQL A;  4O5E A;  1NSF A;  4MGY E;  2CV2 A;  4F4K A;  1ZQD A;  4DUZ M;  4NRV A;  1QVR A;  2W9B B;  1KFT A;  3MR5 A;  1B22 A;  4RZR A;  4P4M A;  4US8 A;  8ICP A;  2LVP C;  1ZAE A;  3MGV A;  4KN7 A;  2A5Y B;  1SXJ E;  1ZQC A;  4PZN A;  1PJI A;  3K75 D;  3BQ1 A;  1OFI A;  3M7G A;  1ZQU A;  5FP0 A;  2HI0 A;  3CW2 C;  1VJ5 A;  3QUC A;  3W0L B;  4DV7 M;  2FLL A;  2KRU A;  4XRH A;  2APL A;  1NO1 A;  9ICQ A;  4RQ0 A;  1FNN A;  5J2D A;  1IM2 A;  1UT8 A;  3H4M A;  4NXM M;  3HHZ A;  4RQ8 A;  4IBK A;  2QAR A;  3VK7 A;  4OJP A;  4LJ4 A;  5KFY A;  2EQY A;  2C28 A;  1FEZ A;  2RDI A;  3C5G A;  4KLT A;  5KFN A;  2JY5 A;  4M47 A;  3AL0 B;  1UPH A;  1G71 A;  1BPD A;  2ZTC A;  4ZH4 A;  3KHL A;  1XSP A;  1SXD A;  4Y28 F;  1X9X A;  5CHG A;  9ICO A;  1N2X A;  1PRB A;  1UA0 A;  3LQQ A;  5JI2 E;  4UAR A;  3PW2 A;  1PVP A;  4YD1 A;  1C1K A;  1PJJ A;  2Y0T A;  3UGJ A;  2RHF A;  2ASD A;  2KEY A;  4QJF B;  5AKL A;  2JEJ A;  7ICI A;  5LMU M;  1KKX A;  2EJS A;  3GQC A;  3ZDC A;  4X66 M;  2C99 A;  3JPT A;  1E32 A;  2JZ0 A;  5AM4 A;  2CRU A;  5KFG A;  3T3F A;  2JY6 B;  1OAI A;  1ZQO A;  9ICI A;  2W8L A;  4WJ3 B;  1ZQZ A;  4IBD A;  3TAD C;  1FIQ A;  3B9J A;  4NXN M;  2QB1 A;  3RJI A;  4WW0 A;  2F2A B;  1NK0 A;  8ICM A;  3GPX A;  4UBC A;  5EXX A;  4DR1 M;  2FNA A;  4JK1 A;  1IV8 A;  5KL1 B;  2H3I A;  2R8I A;  2UVU A;  3FD9 A;  4Z6D A;  1DGF A;  2D8C A;  1OQY A;  1H38 A;  3SYK A;  3HKZ C;  3J27 B;  4ECW A;  4DFP A;  8ICH A;  4J9S A;  3RB0 A;  2QNJ A;  2XID A;  1XC8 A;  2X8A A;  2VAN A;  2ISP A;  1HNZ M;  3EYZ A;  4IBI A;  1N61 A;  4AW4 A;  3MFI A;  2CHV A;  5HHI A;  5AK4 A;  2RKO A;  2JNH A;  4USA A;  4CCH A;  4CF3 A;  3PVX A;  4BJQ A;  2KNZ A;  5KFS A;  4RQ6 A;  3WHL A;  2FJ6 A;  1DO2 A;  2KKP A;  2KMD A;  3T5L A;  2JGA A;  1V9P A;  3MR3 A;  4ECY A;  5DQI A;  2UVV A;  1NJX A;  2WSF F;  4EZ6 A;  2LBC A;  3G6X A;  1SG9 A;  4J9K A;  3VKG A;  3TFR A;  3L2A A;  3KW6 A;  3C23 A;  5AK6 A;  4EBE A;  8ICQ A;  3GRR A;  3MK6 A;  1SV4 A;  1HUO A;  5EWE A;  4EIW A;  2FPM A;  4PD2 A;  4UB2 A;  7CAT A;  3C2L A;  5DFL A;  1ZOL A;  1E9R A;  3HRD D;  1BPZ A;  4F2S A;  4IQU A;  3T6P A;  5ALR A;  4C4S A;  2D3D A;  4GIB A;  5IWA M;  3UJN A;  5IIO A;  2XFS A;  4UN2 B;  2WZJ A;  4UAS A;  4KLH A;  4YMN A;  1X6I A;  4QHT A;  3JPQ A;  2H3Q A;  2CEA A;  2W82 A;  2W7P A;  1RPL A;  3AEV A;  1UCV A;  3LQR A;  1BNP A;  2EKK A;  3GIJ A;  3F2D A;  4O3R A;  3EW9 A;  9ICN A;  3SMP A;  8ICE A;  4QHS A;  1A77 A;  4B9M A;  1OIZ A;  2QQ8 A;  4CGZ A;  1NJG A;  1FO4 A;  1TDH A;  2DWQ A;  1PGY A;  3U6M A;  2HBJ A;  1UT5 A;  1ECW A;  3RB3 A;  2FOI C;  2O01 F;  2H3V A;  3FTE A;  3KXE C;  3PSP A;  3RJG A;  2EZY A;  1ZQR A;  2KZZ A;  2M5Z A;  4P16 A;  3UPQ A;  4UB4 A;  1QQ5 A;  1LV7 A;  3K8Z A;  2WSE F;  1TFR A;  2K4I A;  4OX9 M;  4IQW A;  1ZQN A;  4ED7 A;  2DUY A;  3PST A;  3C28 A;  4IBB A;  3U6L A;  5IIN A;  1Z4N A;  4KHP M;  2B21 A;  3MMP A;  2KKV A;  4DSF A;  1ZMU A;  4DSK A;  4MM3 B;  2KSO B;  4IR1 A;  3NVW A;  2EUC A;  5KTQ A;  3NAS A;  4EEK A;  2ZIV A;  2OPF A;  5KFE A;  1ZJN A;  2KFN A;  5L9X A;  5A2Q S;  3B0X A;  2XLJ A;  1RU3 A;  1ZQL A;  3CF6 E;  4YN4 A;  2UXD M;  4FS1 A;  3OPX A;  1SKR A;  2FE8 A;  2LM1 A;  4DQP A;  2WF9 A;  4F50 A;  2F76 X;  3KS4 A;  4F4W A;  5AKJ A;  5H2F U;  1X6J A;  4QZD A;  2XGQ A;  1X2I A;  8ICN A;  1WHC A;  8ICS A;  8ICY A;  5CB1 A;  3ONN A;  1ORY B;  3DEE A;  1HT2 E;  2M60 A;  1QQ6 A;  1Z00 A;  4GXI A;  3SR6 A;  1XXH E;  1QSS A;  5J2F A;  4DBG B;  5KFR A;  2NRW A;  9ICF A;  5AM5 A;  3RJF A;  4PT5 A;  2FS1 A;  2G8L A;  1OAO C;  1TR8 A;  2V4R A;  4M9X A;  2R8H A;  2KVS A;  4DWI A;  1Z5C A;  2QPA A;  3LMM A;  2HHH M;  2X49 A;  4BGD A;  1RYR A;  1MA7 A;  1D8Y A;  2P66 A;  1T8E A;  4I2G A;  2M9N A;  2LI6 A;  8ICU A;  4AG6 A;  5AIC A;  5AIB A;  2W11 A;  2HWJ A;  4RT3 A;  1PZN A;  4G4Q A;  3TWL A;  4GIT A;  8ICI A;  3L26 A;  4HL4 A;  3Q8R B;  2F44 A;  2QKQ A;  2HHW A;  1J09 A;  2C98 A;  4X65 M;  3TAC B;  1R6B X;  2JMG A;  1EIJ A;  5EOZ A;  3SHF A;  4OO1 J;  1XNR M;  4UB3 A;  2ISO A;  4EBC A;  3T15 A;  3HX3 A;  5DLF A;  2HW3 A;  4KX5 A;  4DQI A;  5KT4 A;  2UUC M;  3C2K A;  3GU3 A;  3GFK B;  3MGH A;  4FS2 A;  4TUQ A;  3MDA A;  5EWG A;  2XVT A;  3SV4 A;  5KG4 A;  2WAQ C;  4F71 A;  3FTF A;  3GLH B;  4WP2 A;  2QZ4 A;  1YZ6 A;  4LJX A;  2D7H A;  4RT2 A;  2EKF A;  4ECS A;  4JV1 A;  4RPX A;  4DLG A;  1TF0 B;  8ICJ A;  4DSI A;  3PNV A;  7ICT A;  2W9C B;  2RDJ A;  3GO8 A;  2DWM A;  3MBY A;  4RQ3 A;  1A0P A;  5F3W A;  1WGL A;  3QUB A;  5ITU A;  3H4J A;  1ZQI A;  2KV2 A;  4Y2R A;  5FTM A;  4OD0 A;  7ICE A;  3ED5 A;  4L16 A;  5J2A A;  4I4L A;  1L3V A;  4YD2 A;  2L2D A;  2WSC F;  2MJ5 B;  4JI0 M;  5ALH A;  1DGJ A;  4I2C A;  2LPE A;  2AXT U;  4DS5 A;  4Y2X A;  3PFI A;  2BKE A;  3GPU A;  1L7O A;  3EZ5 A;  4K4I A;  1KL9 A;  2K89 A;  1NK6 A;  3D8B A;  3DOA A;  1QH9 A;  2HOQ A;  1T94 A;  2J6T A;  7ICJ A;  4PGX A;  5ALQ A;  3UMB A;  1XO1 A;  3AV0 A;  1G59 A;  4B7H A;  1C7Y A;  1KQQ A;  3JPO A;  4LF5 M;  4BWM A;  4EYI B;  1D0L A;  3HZJ A;  5FLX S;  1QQ7 A;  4R64 A;  4FBT A;  4M2Y A;  3Q8L A;  3GPP A;  3GLH A;  4XK8 F;  3QU5 A;  5ALJ A;  4EYH B;  2R8K A;  1V38 A;  5ALG A;  4LVS A;  3FM9 A;  1CUK A;  2JZB A;  4J9Q A;  4NLK A;  5AI9 A;  4PJ0 U;  5ALS A;  5J2B A;  4BBA A;  3SAW A;  1X40 A;  5ITQ A;  4DUY M;  5EJC A;  1LKY B;  4YY3 M;  1QSL A;  1KFD A;  5AI8 A;  4OVZ B;  1DRG A;  4UAY A;  3K4G A;  4QNM A;  3FUX A;  1IM4 A;  4RQN A;  5ALF A;  3GV5 B;  1Q8K A;  4G4O A;  1RYU A;  3RAQ A;  4M6W A;  3E46 A;  3Q8S B;  2XGN A;  2A1J A;  4GXJ A;  1NJY A;  2A1J B;  4AP9 A;  5KFL A;  2IHM A;  3GP1 A;  3OTO M;  4ED0 A;  3SHG B;  3KHR A;  5JTI A;  2R62 A;  5BPV A;  1V34 A;  4DFM A;  4DOC A;  8ICX A;  5KFB A;  2G5G X;  1X37 A;  2E5L M;  4RQ1 A;  4RKU F;  2K47 A;  3I28 A;  5ALK A;  2NYV A;  4FZN A;  5DDY A;  1T43 A;  1NZP A;  5AKK A;  5DB6 A;  5GTI U;  4ECU A;  5ALP A;  2XCA A;  3A42 A;  3L25 A;  3SAS A;  1UHU A;  4ED8 A;  3D8L A;  1PVQ A;  1ZQ1 C;  2JV3 A;  3UMM A;  3C21 A;  2YTU A;  4GHL A;  4JWN A;  1G41 A;  4GC6 A;  1KTQ A;  4QWD A;  4KLL A;  2I7N A;  3R8F A;  3V76 A;  4F4X A;  1TAQ A;  4AKG A;  3VFD A;  2DWN A;  2ZIX A;  2W43 A;  1EFU B;  3QEB Z;  4DSL A;  1ZQB A;  4LF6 M;  4R8U A;  7ICS A;  2KN7 A;  2L09 A;  3C5F A;  1TE2 A;  1G4A E;  1W5S A;  2MU2 A;  4XUS A;  1TK0 A;  4I2A A;  3BJY A;  2G09 A;  1R4G A;  2P6U A;  3TFS A;  2XY6 A;  3I51 A;  4DLE A;  4QIW F;  1XWL A;  1ZQW A;  4NL9 C;  2JRZ A;  2F8K A;  4KLO A;  1LV5 A;  4M9J A;  2LBO A;  3UM9 A;  1QDR A;  4J9O A;  1XU4 A;  2ZTE A;  4M9G A;  1N78 A;  3I4Y A;  1J97 A;  3L27 A;  4DL6 A;  3SC3 A;  1U45 A;  4MB7 A;  3QX7 A;  5CEH A;  2NV3 A;  5DGA A;  2DNA A;  3RRG A;  2C2R A;  2X4A A;  3RGS A;  8ICT A;  3ISB A;  2FH0 A;  4AYB F;  4ECR A;  3CTW B;  4F5P A;  4QW8 A;  2RQ5 A;  2KIV A;  1CEZ A;  5DLG A;  5J0Q A;  4UQG A;  1MQ3 A;  2KK0 A;  5L1M A;  4MEX A;  2K9D A;  5ITR A;  2H1R A;  2HCF A;  1HQY E;  4JV0 A;  3V7J A;  2IOH A;  4QZB A;  2QB0 A;  3N4M B;  4PGY A;  9ICR A;  4QWC A;  3GQ3 A;  2K4E A;  5FSW A;  4FWD A;  4BB9 A;  5JI3 E;  4DQS A;  4CIS A;  3LYS A;  5ALO A;  3JPP A;  2I6X A;  3GQ4 A;  4C8M A;  2V1U A;  1IY1 A;  2H3F A;  4M0D A;  4RU9 A;  2BNK A;  2PI4 A;  2KZS A;  5ITY A;  2Y1I A;  3V6J A;  2YMQ A;  1XSL A;  2BWE A;  2A1A A;  1BGX T;  3JPS A;  1GAB A;  4QZ8 A;  5DQG A;  1U9L A;  1V97 A;  2PKE A;  1KLN A;  1T3N A;  1IIP A;  1L7P A;  3RFW A;  4EEY A;  4LGM A;  2Y0Q A;  1AUA A;  3ZD9 A;  2G5H B;  4LRS A;  2Y9T A;  3U6D A;  4RNO A;  3SZ2 A;  3M7D A;  2NRX A;  4DR2 M;  3DV9 A;  2K6B A;  5DB8 A;  4CRX A;  8ICO A;  5KAI U;  3GPY A;  4Y2T A;  4Q45 A;  1Z00 B;  4C80 A;  3NS1 A;  1ZQA A;  3HKP A;  1MN8 A;  4KLI A;  1SKW A;  4GC5 A;  4LJ8 A;  5KQD A;  2F5P A;  3BDP A;  5J2G A;  2KIC A;  4FWG A;  3LWL A;  1KYI A;  2XI9 A;  2OQ4 A;  3NVY A;  3U5Z A;  1SL1 A;  5J2J A;  4KX3 A;  3B7N A;  3JAM S;  1SIJ A;  3FUV A;  2HOF A;  5J29 A;  4F72 A;  3E4R A;  1XXH A;  2UUB M;  4YG2 A;  4FZM A;  5KFD A;  3NRW A;  5K4L A;  1PK3 A;  4Q43 A;  2V6Z M;  4JWM A;  1JAL A;  1SXJ C;  2BCV A;  1WG8 A;  4F4Z A;  3SEN A;  1S0N A;  4PDG A;  1DGG A;  4QZI A;  2K4H A;  4B3M M;  1RYS A;  5AM0 A;  3WU2 U;  3KD3 A;  2ZIU A;  1JB0 F;  3G6V A;  2VA3 A;  3PML A;  1XSN A;  4FCV A;  7ICO A;  1L8Q A;  3WK8 A;  4QZ9 A;  1ZQY A;  2BDU A;  2L7I A;  2WF7 A;  5KL8 B;  4C8K A;  1L3S A;  3PNY A;  3IV6 A;  3GDX A;  1OTR A;  2G5I B;  1NK4 A;  4G3O A;  3TI0 A;  5DQH A;  2W9A A;  4GKK M;  4LZD A;  1TK8 A;  1T3T A;  3SI8 A;  4B7G A;  2UXC M;  2ZXI A;  3PV8 A;  3S6J A;  3ISC A;  3SD7 A;  4OJ6 A;  3V7K A;  2E1E A;  2F5S A;  4LJ7 A;  1NKC A;  3UZU A;  1TK5 A;  3A0B U;  3ETL A;  2JEF A;  4JV2 A;  4B9N A;  4DSJ A;  2HHQ A;  4DL4 A;  1K3W A;  4DR6 M;  2K8B B;  3H8W A;  4LF7 M;  3JPR A;  2DAG A;  3FKE A;  4O9M A;  5KFJ A;  2QAR B;  5EP2 A;  1NJZ A;  5KG3 A;  4PDI A;  5DG7 A;  1N32 M;  3IDW A;  3IHQ B;  2HBM A;  5TIS U;  4O3P A;  3KDS E;  1T6O A;  1ZRN A;  2XIC A;  3VCB A;  2F4V M;  3H0R B;  3MC1 A;  3FDS A;  3TWM A;  3SEI A;  4RF1 A;  4FO6 A;  2QEN A;  2CE7 A;  3MJ5 A;  4JI8 M;  3H4B A;  1JR3 A;  4F2L A;  4L8R C;  1L8L A;  3CGW A;  2KIW A;  5E6J A;  2Y20 A;  3GIM A;  3H0L B;  3K1R B;  2Q0Z X;  4ED3 A;  5HP4 A;  2FPL A;  4NL9 A;  5ALV A;  1L1Z A;  3LCU A;  3MHV C;  4NLG A;  2MSN A;  1U49 A;  4LJA A;  2J7O A;  5AK3 A;  4J03 A;  2WTF A;  4I27 A;  2FLN A;  2YQZ A;  2ZAM A;  2KJ9 A;  3SAF A;  3PMN A;  1JR3 D;  4AZF A;  2H5X A;  1KW4 A;  4L6V 6;  4CJ6 A;  2CN1 A;  5AKZ A;  3WKC A;  1G8P A;  3PO5 A;  1VDD A;  3K9O A;  2AH5 A;  2KG5 A;  4X62 M;  3C9P A;  1QAN A;  7ICP A;  5JRT A;  3GZF A;  3UQ2 A;  4YFK A;  1MQ2 A;  1HNX M;  3U60 B;  5J0U A;  3SAT A;  4RQ4 A;  4MGH A;  1XNQ M;  2BPF A;  1S76 D;  4I2D A;  3ALR A;  4JV5 M;  3U6C A;  4MF2 A;  3GV8 B;  3R9K A;  3TAP A;  2Y0S C;  4QWA A;  1ZQJ A;  5ALE A;  1WYG A;  1V85 A;  1OKS A;  4GHA A;  2Y9U A;  1KN5 A;  3K9P A;  3QU7 A;  2J6S A;  2LYH A;  3SV3 A;  2CV0 A;  2BCS A;  1Q02 A;  1Q3U A;  4LJ5 A;  2W9M A;  3QU4 A;  4KLM A;  2ESE A;  1N62 A;  3FE3 A;  3UMC A;  1JI7 A;  7ICV A;  2OYY A;  5EE1 A;  5KFH A;  2M0N A;  2CHG A;  4GIP A;  3TL4 X;  2KE7 A;  1ZQX A;  1E94 E;  7ICF A;  3RB4 A;  1D9D A;  1XO0 A;  2AQ4 A;  3U6Q A;  4DL5 A;  9ICP A;  2DKX A;  5J2E A;  1PJQ A;  3QYP A;  3AOE C;  1DOQ A;  1IN6 A;  4M9Z A;  3QUT A;  2JA2 A;  1UA1 A;  4C8L A;  4C8O A;  4F5Q A;  4P4O A;  2WF5 A;  5J0S A;  2MUT A;  3MAB A;  2XEP A;  1K1Q A;  3AQF A;  4O3Q A;  5FTK A;  4RQM A;  2DWL A;  1QCK A;  5J8Y A;  1OW5 A;  3EIE A;  4KLJ A;  3ISD A;  5ALW A;  5KAF U;  1GJT A;  3RJJ A;  4B3R M;  2HAK A;  2MH8 A;  3HHY A;  2LHG A;  3T1Y M;  3PZP A; 
#chains in the Genus database with same CATH homology
 4HL4 A;  2CRX A;  2V1C A;  3I4V A;  3L28 A;  3TE6 A;  3VDP A;  2RGO A;  1YE9 A;  5BR8 M;  1J09 A;  2C98 A;  4X65 M;  3U6E A;  4JMU A;  1R6B X;  4I81 A;  2JMG A;  3GRY A;  1IQP A;  3SHF A;  4OO1 J;  1XNR M;  1PM5 A;  1WXQ A;  3T15 A;  1NZB A;  4CGY B;  2VJ5 A;  3N7S C;  2CUZ A;  3TWK A;  4KX5 A;  3KS8 A;  1SXJ A;  4P0P A;  3GLF A;  2WAQ F;  3CRX A;  2UUC M;  1N33 M;  2KHQ A;  3GU3 A;  4AQY M;  1UM8 A;  2W7O A;  2F5N A;  2W03 A;  2ERC A;  4G6Z A;  2XVT A;  2UUA M;  3QAU A;  2KJ5 A;  2WAQ C;  2CFO A;  3FTF A;  3GLH B;  2QZ4 A;  2GH1 A;  2HKJ A;  3F5A A;  2D7H A;  1EE8 A;  4QNL A;  1IBK M;  4AI6 A;  3AQE A;  4LFA M;  1SXJ B;  3PNV A;  2AHM A;  3Q8X A;  4JI6 M;  3GO8 A;  2DWM A;  2H3Z A;  2Z4S A;  5LMN M;  2KVC A;  4I8O A;  4NOO B;  3KFU G;  3JR4 A;  4JYA M;  1YSY A;  3NUQ A;  1KBU A;  3M0E A;  4DR7 M;  1A6S A;  1NJF A;  1TH4 A;  4MH0 E;  1A0P A;  5F3W A;  3HKZ F;  2G08 A;  5ITU A;  4NSR A;  2CPR A;  2KV2 A;  4W5W A;  2KOB A;  3NWL A;  3AOG A;  3SQI A;  3GLG A;  3AFH A;  3RFA A;  3DA1 A;  3E9S A;  4IBF A;  3U61 B;  5FTM A;  5EQT A;  1L2D A;  1GL6 A;  4LFB M;  1GL7 A;  3HU1 A;  4L16 A;  3JR5 A;  1Q39 A;  3SAV A;  4I4L A;  5FTL A;  2XSZ A;  3PSF A;  4JI0 M;  1J5E M;  1PVR A;  2P5T A;  4NWI A;  4GMQ A;  3SFZ A;  2F5O A;  5HR6 A;  3CF0 A;  4AG5 A;  3KZX A;  3PFI A;  3U60 A;  4OJO A;  3GPU A;  2XFT A;  2QBY B;  4FZL A;  2K89 A;  2KEB A;  2BJW A;  2QCU A;  3D8B A;  3DOA A;  1Z5B A;  4GC9 A;  2HOQ A;  1T94 A;  3F53 A;  4AKH A;  1IXZ A;  3ZH9 B;  3AV0 A;  1IXR C;  5KQ8 A;  4B7H A;  1G59 A;  2VKQ A;  4NV0 A;  2PMZ C;  4QIW C;  4REZ A;  4LF5 M;  2F77 X;  5FLX S;  2VQF M;  5E26 A;  3ZC7 B;  2W04 A;  2ZXH A;  4DV4 M;  3AL0 C;  3GPP A;  3GLH A;  4LCB A;  2UU9 M;  2I7P A;  1NVM A;  3AJI B;  1IBL M;  3R9X B;  1P7D A;  4GH9 A;  2NQ8 C;  1Z6T A;  3HJS A;  3ZCB B;  4RNA A;  4A3V B;  1TDZ A;  4K0K M;  2YR0 A;  1N36 M;  1L1T A;  2KNJ A;  4ICA A;  1NNU C;  1QAQ A;  4BBA A;  2ZIW B;  4XGI A;  3EIH A;  3SAU A;  1TH2 A;  3SAW A;  2E1E A;  3KP1 E;  5ITQ A;  3CYM A;  3D2N A;  3GLF B;  3N7P D;  4DUY M;  4FE3 A;  5EJC A;  4YY3 M;  2KJ8 A;  3HWS A;  4OVZ B;  1DRG A;  3TQS A;  4IJE A;  4QNM A;  3FUX A;  2KHV A;  3QWL A;  4P0Q B;  3U6S A;  4C0Z A;  1K3X A;  4G4O A;  4KO8 A;  3IN5 A;  2J7N A;  5C18 A;  2XGN A;  2ZIV B;  4JI5 M;  3F2C A;  1GKI A;  3J7B A;  1HIW A;  1YUB A;  3J80 S;  3LVW A;  3GRV A;  1Q3B A;  3GP1 A;  4X64 M;  5C1B A;  3OTO M;  2LYB A;  3SAH A;  4RF0 A;  4ZPX A;  2XH9 A;  3SHG B;  2VQE M;  3HHX A;  3K1Z A;  2R62 A;  5BPV A;  4OVZ A;  3U6O A;  3IG5 A;  2D7G A;  3W0F A;  2LH0 A;  4M9S A;  1F44 A;  2G5G X;  2KXE A;  1GLN A;  2LWX A;  3L29 A;  1X37 A;  2E5L M;  2Q2E B;  1E9S A;  3C29 A;  2YB4 A;  4II7 A;  1S3S A;  4AKI A;  2K47 A;  1Z59 A;  4CHT B;  2R45 A;  4DR4 M;  5KPR A;  2OM6 A;  4FZN A;  3ILK A;  1TGU A;  4IJF A;  3CP8 A;  4DR5 M;  4LFC M;  1N75 A;  3LVV A;  1IXS B;  2BJV A;  2DF4 B;  2JHD A;  1KFV A;  1HR0 M;  3A42 A;  4R3D A;  3SAS A;  4G4N A;  3L25 A;  1HEK A;  3D8L A;  4OJ5 A;  1PVQ A;  5C0Y A;  3U6P A;  2GOL A;  1ZQ1 C;  5DNY A;  5DYI A;  2DZN B;  3UMM A;  4GKJ M;  2DVW B;  4JN6 A;  4GHL A;  3SMV A;  1G41 A;  4O3M A;  2ZAO A;  4FWH A;  4LY6 A;  3J2P B;  2QBY A;  2I7N A;  4IBE A;  3R8F A;  3SAR A;  1J7K A;  4AKG A;  4GRI A;  3VFD A;  2DWN A;  2ZIX A;  4HLQ A;  5EXP A;  3VK8 A;  3HGI A;  3KOZ E;  3RE8 A;  4LF8 M;  2XF3 A;  4KOD A;  4JI4 M;  5IZ7 D;  4LF6 M;  2DQN B;  3M6Z A;  2L09 A;  4LZJ A;  2MRL A;  1G4A E;  1W5S A;  1R7R A;  5ITT A;  1Z19 A;  2G09 A;  4P0Q A;  3I51 A;  5KPZ A;  4QIW F;  3F5E A;  4IBG A;  2VII A;  3VC8 A;  3GQ5 A;  1OUQ A;  1IY2 A;  4ITQ A;  1HNW M;  3O0F A;  4U7C A;  3A46 A;  3KOW E;  2ZIW A;  1HQC A;  2LBO A;  3GRU A;  1NSF A;  4MGY E;  2C9O A;  4IIW A;  2XSZ D;  2CV2 A;  4OW0 A;  1N78 A;  3I4Y A;  3E0F A;  2R4E A;  4DUZ M;  3SMS A;  2YB1 A;  4NRV A;  1N77 A;  3L27 A;  4QOZ C;  2G07 A;  2VJ4 A;  5EP4 A;  1QVR A;  2FFJ A;  1FJG M;  3N7R C;  4KMO B;  3SC3 A;  1CRX A;  4MB7 A;  2NV3 A;  1URJ A;  3IP4 B;  3M6K A;  2RGH A;  4NLB A;  4BUG A;  2X4A A;  2ZBK B;  3FUU A;  3RGS A;  1ZAE A;  3MGV A;  2HOI A;  2LYA A;  2A5Y B;  4AYB F;  1SXJ E;  3CTW B;  2A3V A;  1PJI A;  1QYR A;  3T1H M;  2K8C B;  2RP5 A;  5GKN A;  2KW0 A;  1OFI A;  3M7G A;  5ITR A;  2H1R A;  1D2N A;  1DGH A;  4LGY A;  1HQY E;  4D82 A;  3J7A S;  2G0A A;  3RF9 A;  4CDG A;  1G3I A;  1HT1 E;  4L4U A;  3W0L B;  4DV7 M;  3L3F X;  2KRU A;  3GQ3 A;  4FCT A;  2K4E A;  5FSW A;  4FWD A;  4BB9 A;  5JI3 E;  1NY5 A;  5EP3 A;  2Y21 A;  1FNN A;  4CIS A;  3LYS A;  3BOS A;  1QZM A;  1IM2 A;  3GQ4 A;  1H6U A;  1YT3 A;  2Z3X A;  3H4M A;  3KSJ A;  3HHZ A;  4NXM M;  3K1J A;  4IBK A;  2V1U A;  1IY1 A;  3C58 A;  4M0D A;  3THG A;  2H3F A;  2ZM6 M;  3VK7 A;  4OJP A;  4FVM A;  4IBC A;  4LJ4 A;  5EXS A;  1OFH A;  5IRE B;  1R2Y A;  2HL7 A;  2MA1 A;  2BNK A;  5FTN A;  2O5R A;  2LNH C;  2EA0 A;  2KZS A;  5ITY A;  3AL0 B;  1UPH A;  4ACO A;  2RRD A;  4JI2 M;  8CAT A;  4XBO A;  3LQQ A;  3M6A A;  5EXT A;  3AKZ A;  5JI2 E;  1IIP A;  4MGZ E;  3RFW A;  1PVP A;  1C1K A;  4LRT A;  3T38 A;  4LGM A;  2Y0T A;  3UGJ A;  1PJJ A;  3A45 A;  4KLN A;  2Y0Q A;  1IBM M;  2HBK A;  2RHF A;  2G5H B;  4LRS A;  2KEY A;  3U6D A;  4QJF B;  2KRK A;  5LMU M;  4DV0 M;  1NHG C;  4IBJ A;  4DR2 M;  2XZF A;  3M7D A;  4CRX A;  3F2B A;  1OJL A;  4X66 M;  2C99 A;  3GPY A;  1E32 A;  3RGP A;  4DV3 M;  2LKY A;  4L78 A;  1DO0 A;  3HKP A;  2L6O A;  4QNR A;  2R65 A;  4GC5 A;  4LJ8 A;  4LF4 M;  5KQD A;  2F5P A;  2D7E A;  2N1R A;  2KIC A;  4WJ3 B;  4FWG A;  4IBD A;  4WUR A;  5KPT A;  1KYI A;  2L7H A;  3D2S A;  3VKH A;  2XI9 A;  2OQ4 A;  4NXN M;  3U5Z A;  4WW0 A;  4JI7 M;  2F2A B;  3GPX A;  4KX3 A;  3JAM S;  2DHR A;  5EXX A;  3FUV A;  4DR1 M;  2HOF A;  3E4R A;  3KOY E;  1XXH A;  2FNA A;  5KL1 B;  2CHQ A;  2UUB M;  3VDU A;  2H3I A;  3NRW A;  3K2L A;  4FZM A;  3FD9 A;  1SXJ D;  1DGF A;  3PZP A;  2DXI A;  2WB1 C;  2V6Z M;  1SXJ C;  2HCB A;  3SYK A;  3HKZ C;  5EP1 A;  2DWZ B;  4B3T M;  3J27 B;  4NL4 H;  2HBL A;  4DV1 M;  2K8A A;  4PDG A;  4FW9 A;  1DGG A;  2XID A;  1XC8 A;  2K4H A;  2X8A A;  4B3M M;  3PVS A;  1HNZ M;  3IG8 A;  4IBI A;  4LZZ A;  5FTJ A;  1MU5 A;  3KOX E;  3KP0 E;  1Q3C A;  3KVW A;  4AW4 A;  2CHV A;  1XMQ M;  2ZIU A;  1SZH A;  4FCV A;  5A0L A;  4S12 A;  2RKO A;  1L8Q A;  4R7G A;  4B3S M;  2BDU A;  2L7I A;  5KL8 B;  4NRW A;  4FCW A;  3PNY A;  3FTC A;  4BJQ A;  2LXE A;  2JH7 A;  1QAO A;  2G5I B;  3WHL A;  1DO2 A;  2KKP A;  4DV6 M;  1XNS A;  2KZU A;  4QOS A;  2JGA A;  4BX9 C;  4GKK M;  1T3T A;  4BLC A;  1TAM A;  4B7G A;  2UXC M;  2YX8 A;  2ZXI A;  4MGK E;  2Y0S F;  3VKG A;  2QP9 X;  2JH1 A;  4OJ6 A;  4JI3 M;  3K92 A;  3KW6 A;  3L2A A;  3SYL A;  3SBJ A;  1K82 A;  2F5S A;  4LJ7 A;  1ED1 A;  3UZU A;  1I94 M;  4OJL A;  2DZO B;  3GRR A;  4PCZ A;  3SAG A;  1QQW A;  3MK6 A;  2C5R A;  4EIW A;  5H37 D;  1K3W A;  4DR6 M;  2KD1 A;  2E1F A;  4PD2 A;  2K8B B;  7CAT A;  4LF7 M;  4NLC A;  4YHH M;  5HR7 A;  3FKE A;  1E9R A;  1Z1B A;  5EP2 A;  2E5S A;  4PDI A;  4Z8X A;  4LJ9 A;  4I5S A;  2YNM D;  1N32 M;  1XWI A;  2HBM A;  4A8E A;  5IWA M;  3T79 A;  1XXH B;  3KDS E;  3U5Z B;  1MX0 A;  1GO3 F;  2XIC A;  3VCB A;  1IN4 A;  2F5Q A;  2F4V M;  3H0R B;  3HJ8 A;  3UJN A;  4M0W A;  2XFS A;  3TWM A;  4RF1 A;  3U61 A;  2F8L A;  4LG2 A;  4QHT A;  2QEN A;  2CE7 A;  3MJ5 A;  4JI8 M;  2CEA A;  2W82 A;  2Z4R A;  4FD2 A;  5DYG A;  1JR3 A;  4D80 A;  4L8R C;  2ZG6 A;  4DR3 M;  2KIW A;  5E6J A;  1IN5 A;  2Y20 A;  3H0L B;  3LQR A;  1NY6 A;  2C9C A;  2ZAN A;  1JQJ C;  2R18 A;  3MHV C;  1Z5A A;  1L1Z A;  2Q4T A;  3F2D A;  1Q3V A;  3SMP A;  4LJA A;  4QHS A;  3D2Q A;  2C96 A;  4G4R A;  5ITX E;  2J7O A;  1XMO M;  4CGZ A;  4D81 A;  1N34 M;  1NJG A;  1TDH A;  2G06 A;  3VLF B;  2YQZ A;  4U6P A;  2ZAM A;  3U6M A;  2HBJ A;  2KJ9 A;  1JR3 D;  1ECW A;  2FOI C;  4AZF A;  1WUD A;  3SAF A;  4P0P B;  3B9P A;  2LHT A;  2H3V A;  3FTE A;  3HU2 A;  3KXE C;  3FYC A;  2CN1 A;  3PSP A;  3WHK A;  1G8P A;  2M5Z A;  1VDD A;  2CV1 A;  4P16 A;  3CF2 A;  3A98 B;  4X62 M;  1LV7 A;  3K8Z A;  1TH3 A;  3UK6 A;  1QAN A;  1L2B A;  2K4I A;  4OX9 M;  2ZIU B;  1NNJ A;  3TPZ A;  2DGZ A;  4NSO B;  3GZF A;  1D8B A;  1HNX M;  3DZD A;  3U60 B;  3PST A;  2YFQ A;  3SAT A;  4IBB A;  3C28 A;  4MGH A;  1W5T A;  4MGI E;  3U6L A;  1XNQ M;  1XHB A;  5ITX A;  3KSX A;  3ALR A;  2XZU A;  4JV5 M;  3U6C A;  4KHP M;  2H3Q A;  1QAM A;  4JXJ A;  2KKV A;  2R4J A;  4MM3 B;  2Y0S C;  3FUW A;  1DGB A;  2EUC A;  4TUW A;  3J81 S;  4GHA A;  2OPF A;  2ZIV A;  5A2Q S;  2PMZ F;  2CV0 A;  4OU7 A;  2XLJ A;  1Q3U A;  4LJ5 A;  3CF6 E;  3DFZ A;  1IN7 A;  2UXD M;  3OPX A;  2R46 A;  3NBI A;  2FE8 A;  3GLI A;  2OYY A;  2F76 X;  3KS4 A;  2M0N A;  1I4W A;  2CHG A;  4GIP A;  3TL4 X;  4IC9 A;  5IT9 S;  1E94 E;  2D6F C;  1DGH B;  1NHW C;  2KA6 B;  1XO0 A;  3FTD A;  2OXO A;  3U6Q A;  3ONN A;  1ORY B;  3FYD A;  2HMX A;  3DEE A;  3AOE A;  1HT2 E;  2M60 A;  4LJ6 A;  4B7F A;  3AOE C;  4DV2 M;  1IN6 A;  4M9Z A;  1L6N A;  2JA2 A;  3GLI B;  3H0M B;  3HHW A;  3FUT A;  4DV5 M;  4B08 A;  4L15 A;  1KSF X;  4PT5 A;  1L2C A;  1ZQ9 A;  2G8L A;  2XEP A;  4M9X A;  4AYB C;  3AQF A;  1R2Z A;  5FTK A;  1IY0 A;  4LF9 M;  1Z5C A;  2DWL A;  3KFU F;  2QPA A;  3LMM A;  1IN8 A;  2X49 A;  3HJQ A;  2HHH M;  4GFJ A;  3EIE A;  3GLG B;  1MA7 A;  2OH2 A;  2VIX A;  2UXB M;  3HU3 A;  2Z7J A;  4AG6 A;  4Z6Y A;  5KO3 A;  2W7P A;  1GVN A;  4B3R M;  5CRX A;  3ICX A;  3PXG A;  2EO2 A;  3HHY A;  4JI1 M;  2WB1 F;  2ZIX B;  3PSI A;  4PL2 A;  4G4Q A;  5T14 A;  3T1Y M;  3TWL A;  4GIT A;  4PL1 A;  3L26 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...