2Z7JA

Structural insights into de multifunctional vp3 protein of birnaviruses:gold derivative
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
125
structure length
125
Chain Sequence
AQREKDTRISKKMETMGIYFATPEWVALNGHRGPSPGQLKYWQNTREIPDPNEDYLDYVHAEKSRLASEEQILRAATSIYGAPGQAEPPQAFIDEVAKVYEINHGRGPNQEQMKDLLLTAMEMKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid assembly protein VP3
publication title Structural insights into the multifunctional protein VP3 of birnaviruses.
pubmed doi rcsb
source organism Infectious bursal disease virus
molecule tags Viral protein
total genus 44
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2007-08-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.880 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2z7jA02
1.10.150.620 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2z7jA01
2R18A 2Z7JA
chains in the Genus database with same CATH superfamily
2ZTEA 3SV3A 5DYIA 3QYPA 2OO9A 3CF6E 3QU4A 3V72A 4CF4A 1LB2B 4UATA 7ICFA 1FNNA 9ICIA 1ZQSA 4DUYM 4LF6M 4PHEA 2UU9M 2KHVA 3PR5B 4FZMA 5CR0A 3TWLA 1T94A 1MQ2A 3HU1A 1DK3A 3MR6A 2H3QA 2FNAA 3SFZA 2HBJA 2LVPC 2YR0A 4QHTA 1MC8A 1K1QA 3KHRA 5ALQA 3GIJA 3G6XA 4JUZA 1JALA 2KNZA 2K4EA 5KFLA 4IBDA 1W5SA 4YCXA 4KLOA 2FPLA 1ZQMA 4XK8F 2G09A 4KODA 3SZ2A 1QSSA 4PL2A 2VA2A 1VEJA 2ZIXB 4ZOHC 3U5ZB 1YUBA 4JV0A 4O3QA 4FCVA 2QBYA 5IIJA 1Z5BA 1LKYB 4NLNA 1R4GA 2EKFA 4QNLA 5DLGA 4ECTA 2ISPA 2HCFA 4G3IA 1B0XA 1HNWM 4QNRA 5KQ8A 5ALVA 4KLMA 2KEYA 4GITA 1S10A 5TISU 1HUZA 1NNLA 5DG7A 4I81A 2DQNB 2L2DA 3FTEA 4LJ9A 4Y2TA 4DSLA 1ZRMA 2ZIWB 3K8ZA 4FCWA 4FWHA 3T5LA 2Q4TA 4II7A 2KHQA 2HKJA 1HNZM 4Q45A 7ICMA 1HQCA 2WAQC 4RF0A 3F53A 4A3VB 8ICOA 1Z4NA 5KPZA 1R2ZA 3MR2A 1ZJNA 2HHQA 5ALGA 4F5PA 5CEHA 1MX0A 4XQ8A 4I8OA 3RRHA 5J2FA 2KZSA 2F1IA 2E5LM 3V7JA 1U4BA 1RDFA 2EH9A 3UXNA 3FDSA 4UAUA 3J7AS 5IREB 3RJHA 2FLPA 3L25A 2YY6A 2YQEA 5ALNA 4I2FA 3KW6A 2VA8A 3OPXA 4FZNA 4QWEA 2UXCM 4US8A 8ICTA 1SL2A 1NJGA 1Q3UA 3AUOA 1IG6A 2DAGA 3ZC7B 3H4MA 3OTQA 2ZXIA 4TUQA 4UQGA 3M9NB 3NRWA 3QUQA 3PNYA 1NOMA 4BGDA 5AKZA 3GV5B 2JA2A 3MDCA 1N60A 2FJ6A 4EYIB 5ALMA 2DVWB 2AQ0A 4AI6A 4RQ7A 3UQ2A 1XXHB 1BPYA 3M7DA 5F9LA 3PZPA 1DO0A 1G3IA 2DHYA 2NRZA 3NGDA 4CHTB 2V1CA 3JPSA 3GLFA 1L7OA 3I4VA 5EE9A 2Y20A 5KT6A 3NS1A 1QAMA 4GKJM 4TURA 3FUUA 1PJQA 5EOZA 2R6FA 1N2XA 1DGHA 2HHSA 4LY6A 1J2NA 1L1TA 2MU2A 3N28A 2BNKA 3L2AA 4OO1J 4YXJA 8ICKA 2JEJA 2MR9A 1AUAA 2VF7A 3EPIA 4BLCA 3AJIB 9ICFA 4GIBA 2VJ5A 5JUMA 4DV2M 1SXJE 4I27A 3H0LB 1ZQTA 3W68A 4YP3A 1X9MA 2DBYA 2YFQA 4CCHA 1S0VA 4E0DA 1DRGA 1PUZA 3SAHA 2MH8A 3ETLA 4GFJA 3C5GA 7ICUA 5IINA 3GLHB 2OWOA 3OJUA 4NL9C 3RTVA 3OSPA 1K3XA 4DSJA 1NY6A 2DZLA 3U61A 3GIKA 4JI3M 4LZGA 3GIIA 4B3MM 3KVWA 3JR4A 2W55A 1PK1A 3I76A 3SYZA 3DEEA 1M6YA 4USAA 9ICBA 5J0PA 1ZQQA 2CWBA 2F5QA 5KFRA 3VCBA 4KX5A 3I51A 9ICXA 3AU2A 3RGPA 1F5SA 2IHMA 3GLFB 4EX6A 5J29A 2VIXA 2EZXA 3B9JA 2WF8A 4NOOB 4ICAA 5DGBA 4J9KA 2FPMA 1L8QA 8ICUA 7ICQA 3R8FA 1BGXT 9ICKA 3J7BA 4O5KA 4EZ6A 4I5SA 4MEXA 2V6ZM 4RPYA 1DGGA 1I94M 2Y0SC 5D49A 3BOSA 3SYLA 3TL4X 4X5VA 5AKYA 5FTLA 4DS4A 5AKKA 1C20A 4I2DA 2XFTA 1Z3EB 3VDUA 4Q8FA 2KSOA 3L5KA 1D8BA 1X40A 3NTUA 3FTDA 1V92A 1KL9A 3H8JA 1S77D 4RQ8A 3NVWA 3N7PD 5KFNA 4ECRA 2Y0SF 1ZQKA 4QZAA 5DBAA 2E8PA 4PJ0U 1GO3F 2RKOA 3QUCA 5CJ7A 2ZANA 5EXPA 1YT3A 1XMOM 5AK3A 2D8CA 5J0XA 3F2BA 2BPGA 4LGYA 4HEOA 3MHVC 1TFRA 2RGHA 2W43A 3SAFA 2P66A 2J5YA 2HAKA 2CRUA 4F2SA 5JI3E 5IWAM 2DAMA 3U6PA 4Y2PA 2BQUA 3HJ8A 5AIBA 4RPZA 2K4HA 4Y2VA 3QYEA 3QZ7A 4L6V6 3U61B 5ITTA 3U60B 4US9A 1ZMUA 3JPQA 2FPKA 1IN6A 2KOBA 3ETRA 2HCBA 2NRTA 1B22A 2LVOC 4O5EA 5F3WA 3WKBA 4GIPA 4O3RA 3AFHA 3L27A 1RXVA 3Q8RB 3R9XB 4IJFA 3GZFA 2RGOA 3SASA 1K3WA 4Q7JA 3J81j 3T79A 3MGIA 5H37D 4M9ZA 2W9MA 2H1RA 4MFAA 4KMUA 5KFKA 4WJ3B 3M8SA 4FO6A 4NL9A 3K75D 8ICQA 4HL4A 3TWMA 4BWJA 2NRXA 5HMLA 5IIOA 1COOA 2C9CA 4IL6U 4QIWC 4B3TM 3RE8A 3MK6A 1NNUC 4PHPA 1J09A 4RQ4A 3BXWA 9ICQA 2D7HA 4R71A 4NLCA 8ICBA 4RUCA 2L7HA 4QIWF 2ISOA 4XRHA 3D8LA 2FOIC 1WGNA 5D46A 5J2GA 3UMCA 3PXGA 1KTQA 5AI5A 1IXRC 3GLIB 2CV1A 2ZXHA 2R65A 1NKEA 4LF9M 4FCTA 2XZFA 2HHVA 4GC9A 8ICXA 2R8IA 4B7FA 5DB6A 2KRKA 5CB1A 3NBXX 1SG9A 1KSPA 5ALLA 4O5CA 3M7GA 3T1HM 4IBBA 4LG2A 1N56A 5ITXE 1N63A 2V4RA 4LGMA 9ICJA 2MGWA 2F5NA 1TVAA 2I7PA 1CI4A 2KIVA 8ICLA 5E6JA 1PVPA 3IP4B 2A1JA 9ICTA 2X4AA 1VLBA 3AM9A 4U7CA 1Z6TA 3GV8B 2Y1JA 3KOXE 2I9GA 1RU3A 2APLA 5FTNA 4QWBA 2FH0A 4DR3M 3PSTA 4RQ2A 5IILA 3C29A 4PD2A 5KFAA 5AHXA 1IXSA 3KS8A 2P35A 4DSEA 2EJSA 1WCLA 1SL1A 4FVMA 3BDPA 2FI1A 2UXBM 2A3VA 3RAXA 2BPFA 2JHDA 2FMSA 1DV0A 2OEHA 1PM5A 4HYKA 2M5ZA 3MFHA 4YMMA 1KEJA 3B89A 3NVYA 1V85A 1XMQM 3PMLA 1OIPA 1T6OA 3TADC 1EIJA 3RB4A 3SC3A 4M9SA 1QANA 2FMQA 3LDAA 3C58A 2EAOA 2QARA 3C21A 4LFBM 3RH6A 1N75A 3KKAC 4NV0A 3KP0E 3BJYA 3C1YA 3RB0A 4C8LA 1QDRA 1NK8A 2D7EA 2B6GA 2WF5A 4J9RA 3ISDA 5B5EU 2NQ8C 4JV2A 5KL8B 4YFKA 2JY6B 3PW5A 1NJXA 1ZQUA 3PO4A 2CXYA 1SWVA 2A1JB 2JRZA 4QW8A 1XSLA 2IOFA 7ICOA 2JZBA 1J7KA 2DGZA 4YY3M 5AK6A 1C1KA 4CDGA 5DGAA 2PFQA 5DLFA 4FWDA 5BPVA 2DWZB 2EDUA 5KFHA 4J03A 4JI2M 2WHEA 2Y21A 1TR8A 3BQ1A 4LJAA 1NNJA 2DF4B 2KK0A 1IXSB 3SENA 2DKLA 4IBIA 2C9OA 2R18A 4FFDA 5CRXA 2F8LA 1GLNA 4ED0A 2H3VA 2XFSA 4C8KA 3B9PA 5DG9A 5J0UA 4MF8A 1T8EA 4IRCA 5EP4A 5DYGA 4DSKA 1ZV1A 3KOWE 4XGIA 1RXWA 8ICPA 3PSFA 4OU7A 1N48A 1XSPA 5ALIA 3WHLA 1FO4A 5ALPA 1IN8A 1PJJA 3JPOA 4IRKA 4KLJA 5ALZA 4D80A 1YE9A 1WR1B 4FZLA 2KFNA 1IY0A 4O3PA 2JY7A 1TDZA 2ZG6A 3M9OB 2GWSA 2QARB 3SATA 5FSWA 3OHBA 2EAMA 2ZJ8A 3DDHA 4MGYE 2Z3XA 4KLUA 2G07A 1ZQBA 1L6NA 1BPXA 1KFDA 2XZUA 2J6TA 1IM4A 3F92A 3GV7B 3IHPA 5KFMA 3C23A 9ICLA 4M6WA 2XY6A 7ICIA 3CNHA 3GLGA 1KLNA 1NV8A 5EJCA 3C1ZA 1N5WA 2E5SA 8ICMA 3KHLA 2V1UA 1GL6A 2KP7A 4I28A 3FE3A 2C22A 3TADA 1T3TA 5DB9A 1L2DA 1R2YA 2HHXA 3F2DA 2LM4A 3WKEA 1SKRA 4F3OA 3C3EA 5C0YA 2R4EA 1NJFA 2QKQA 2CEAA 1DGJA 3LQQA 4JWNA 4XUSA 4K4GA 3KKAA 5JU5A 2HHUA 2XGNA 1HEKA 1QQ5A 4KLIA 4DF8A 1BPBA 1SZHA 4O3NA 3RF9A 3G6YA 4EEYA 1S76D 1IV8A 1YZ6A 2YQZA 5IIMA 4UB5A 3QWLA 1BPDA 3GPUA 3WK7A 4NSOB 4Z6FA 1TK5A 2J7NA 5HP4A 2ASDA 2LYHA 4AZFA 4IBKA 2W11A 7ICGA 1QQWA 1KN5A 1UT8A 3QU7A 3BZKA 5EP1A 9ICMA 3HU2A 5J0SA 3ZCBB 2RLTA 2GH1A 4Y2YA 1OFIA 4LZJA 4EZ9A 5DKWA 2R4JA 5HHIA 5ITYA 4M6WB 3RH4A 5IT9S 5KG0A 4FW9A 2LMRA 3KZXA 2R0IA 4D82A 4DQPA 9ICEA 2W9BA 3SHFA 1QZEA 2MUTB 4LF5M 4P2HA 2W3SA 1NI3A 2HBKA 2KKVA 4DL4A 4JK1A 1OUQA 4Q8EA 1VDDA 4RZRA 8ICEA 1O08A 1YZ7A 2E3TA 3M8RA 1D0LA 4GKKM 4DSIA 2DHRA 4DV5M 1XC8A 3C2KA 1E94E 3WK8A 5J8YC 5KPRA 3RFWA 1FJGM 2PMZC 4MGHA 2ZIXA 4IS7A 5CA7A 4LFCM 2KZUA 1PGYA 1XS9D 4Y2JA 1Y88A 4G4QA 4F50A 1LKYA 2KZMA 1QUTA 2RP5A 1QZMA 4Y28F 2K47A 1L7NA 3H4BA 4QWAA 4EEKA 3HGIA 3GLFE 4TUSA 2CRXA 3V76A 1NK5A 2QHOB 1A76A 2OOAA 4DO9A 2HHWA 2W3RA 2LTUA 2ZIWA 2C96A 4NXMM 4R7GA 2DFLA 9ICAA 8ICCA 2DI0A 2F4VM 4Y2UA 2WFAA 4I29A 2HHTA 2B3TA 3UXOA 1IN4A 1QLNA 3MDAA 1MQ3A 2YMQA 4AKGA 5TZVA 2IHNA 2JMGA 3D8BA 2JUJA 4O3OA 3D2SA 2W9BB 2HOFA 5AM0A 3GRVA 3QXGA 4DWIA 2LVAA 4FS2A 1IIPA 3SYKA 3W0FA 4DSFA 4M9NA 1JXEA 4YD2A 4Y2XA 2UVWA 3A42A 2K89A 1PRBA 2QSFX 4IBGA 4GMQA 2ZM6M 1XHBA 4ELTA 1KDHA 2MROB 1TAUA 1HJPA 3FUXA 5J0OA 4G4NA 1QQ6A 5ALYA 4KLFA 1ZD5A 2AGOA 4O9MA 5BOMA 3EZ5A 3MC1A 2OQ4A 4KX3A 4NLGA 3FRHA 5ITRA 1L8OA 8ICNA 3L26A 4MH0E 3M9MB 1V9PA 2HOIA 4MGIE 8ICAA 1QTMA 1NJYA 1QH9A 1XXHA 7ICVA 2AHMA 1G71A 1V97A 3SI8A 4JMUA 5F3XB 7ICSA 3GPXA 4DOBA 4FBUA 3A0BU 1RYSA 5DG8A 3RBDA 2Q0ZX 1NK0A 3FC4A 2XI9A 5DDMA 5AI8A 5J8YA 4F4XA 5E26A 9ICGA 1VDLA 4I2GA 9ICUA 1OFHA 4KT0F 4QOSA 4Z8XA 2DWLA 4CNQA 3PW0A 2BPCA 2HMXA 3TFRA 4YR3A 2Z7JA 4JV5M 2UXDM 2WAQF 2GO7A 5ALTA 3FAHA 3BQ2A 1RYRA 2QB1A 3T1YM 5AM3A 2CHVA 3HPOA 1J2MA 2LHTA 3ISCA 3TARA 1NKCA 4XBOA 8ICVA 1ZQIA 4M2YA 5KPTA 3KFUF 1Z4OA 1IY1A 1AROP 1ZOLA 1RZTA 4F4WA 3TE6A 4UBBA 3TKAA 3T3FA 1NHGC 3PVSA 4HLQA 5ALHA 5KFUA 2HOQA 7ICNA 4F4YA 4P17A 1WHCA 3FM9A 1COKA 3J80S 3GLHA 4DR2M 2D3DA 1Q3CA 2RDJA 4CJ6A 4G9BA 5DQGA 2BDUA 1Q39A 4LRSA 2ZIVA 3WK5A 5DBCA 4KLHA 1ZRNA 4DV0M 1GKIA 2JZ0A 2WZJA 5AI9A 4UAYA 4QWDA 4C8MA 4BXOA 1S9FA 5KAFU 1A77A 4J9PA 3VK7A 4EBEA 4UN2B 2AGQA 2I5HA 3F2CA 2E1EA 4K0KM 2HI0A 2KIWA 5GTHU 1Z5CA 2KJ8A 4Z6EA 3CRXA 4MFCA 4I2CA 3WKCA 1L3VA 2HL7A 3BQTA 2Q2EB 4J9NA 4AW4A 3R9KA 1E32A 4TUPA 4DFJA 3C5FA 7ICLA 1UA1A 2RRUA 4AQYM 2YB1A 1X2IA 1TAQA 1QUSA 5EP3A 3RFAA 2ZUCA 5J2CA 1ZQHA 2C28A 3B74A 2AH5A 3NVVA 2J6UA 3E58A 4TQRA 5L9XA 2D6FC 4Q44A 1VEKA 4QZFA 1L3SA 2RQ5A 1KSFX 2VF8A 4MHVA 1HIWA 5G5GA 3U6QA 1WWUA 4I2AA 1D0KA 4PPXA 3KS4A 1ZXIA 2R8GA 4JI5M 3BZCA 2PXIA 4UARA 1ZQDA 1PJTA 2NRWA 5KG7A 3EPGA 4UW9A 5GKNA 2EA0A 2ZTDA 3LW5F 3U60A 2ZIVB 3IHQB 2C98A 1C7YA 1NHWC 3MBYA 4W5WA 1T4GA 3EIEA 3U26A 3FTCA 3V6KA 4BXOB 2F2AB 3V6JA 1TF0B 2J7OA 4NSRA 3B7ZA 1PJIA 2K8AA 8ICJA 1JXLA 2XIDA 1S8OA 4ZH4A 2JH7A 2VA3A 1KW4A 3U6SA 4IQTA 4GXKA 4ECVA 1VEGA 3QYBA 4NY8A 3EW9A 1U9LA 1TDHA 4UB4A 3QZ8A 4DQSA 1D9FA 1E9RA 4C80A 4P4OA 3QEBZ 5CWRA 1X6JA 1R7RA 5KFSA 5HR7A 3PW7A 2K4IA 2KNJA 5HHHA 1H38A 2BCVA 9ICNA 1SV4A 4I4LA 1OKSA 4DLEA 4Y2QA 1JUDA 5KFQA 1G41A 1Q02A 3WKDA 2PFNA 5FTKA 2K8BB 5J2EA 1HNXM 2L4FA 5B66U 4JI8M 2D7GA 2ESEA 4UBCA 3CGWA 3LMMA 1Z00B 3GFKB 4PL1A 2F8KA 1UPHA 2KNVA 4OJ5A 2N35A 4IBFA 4LJXA 3A46A 2DL0A 2W54A 1SXJC 2ASLA 4IRDA 5KT7A 2HVHA 1TGUA 1XSNA 2M60A 4BDPA 4G4OA 5KT4A 3PW4A 3CYMA 2ZUBA 1TH4A 4GC7A 1VJ5A 3GLIA 1X9SA 5AKXA 2C2DA 4OW0A 4PGQA 1ZETA 2JXNA 4G3OA 4DV6M 3HP6A 4ITQA 4IIWA 3GDXA 3JPNA 1JR3A 3PR4A 2N1RA 3A98B 4M9HA 5KFPA 5KFYA 1LVHA 2QPAA 3B0XA 3TQSA 3IV6A 4YD1A 1LV7A 4QZ9A 3QX7A 9ICPA 5EXXA 4B9NA 3HX0A 1UHUA 4CIZA 2JH1A 3M0EA 5J0WA 2LI6A 4F71A 2AQ4A 1ZD4A 4B08A 3JAMS 1RQNA 3THGA 3FUVA 4B7HA 4PH5A 4Y2RA 4EBCA 3TACB 1D9DA 1T43A 4R63A 2KDLA 1ZQGA 3DZDA 1RPLA 2I7NA 1WWVA 5BOLA 2PI5A 3UXPA 5EE3A 2R8KA 2ZBKB 2DKXA 5DNYA 4I2BA 5A2QS 4IR9A 3BBZA 5T14A 1F44A 2KJ9A 2CN1A 2JEGA 2G5GX 3LVWA 1Q46A 1B43A 4IBJA 4PHAA 3RJFA 2JY8A 2KFZA 5HMMA 8ICZA 3M6KA 4J9OA 1NJZA 3M6AA 3L28A 5KFFA 3T5KA 4ECXA 7ICPA 2KW0A 2VIIA 2QB0A 5KFEA 1T3QA 3I4YA 3HKPA 4ECYA 1XC9A 1ZQVA 1ZQRA 4NL4H 2DPJA 3SR6A 4YR0A 4ANRA 1ECWA 5J2IA 4JI6M 2DPIA 1W5TA 1JRPA 5KG2A 5ALDA 4ECQA 4QZCA 1HQYE 2CUZA 3QAUA 1XWLA 1OW5A 4RQMA 3PNCA 4NC6A 4J9LA 3GLGE 4L4UA 4FS1A 1L3TA 4RT3A 4CRXA 4B9TA 2L5YA 5DDYA 4RUAA 5BR8M 1NJWA 3FTFA 1B4FA 3UZUA 2KMDA 1XNRM 5L1KA 4JI7M 4OD0A 4DCCA 4OCZA 1GL7A 1Q3BA 4NWIA 5IIIA 4EYHB 1D8YA 8ICIA 3HRDD 1JB0F 3BQ0A 3ZDBA 4MEYA 1K82A 4F5OA 4LCBA 5DFLA 3AKZA 3OSNA 4CISA 5KG4A 4GHAA 4IR1A 1N33M 4R64A 1Q3VA 7CATA 2HW3A 4GEWA 2QQ8A 4YMOA 2HDOA 4LZZA 4M47A 4WP2A 5ALXA 4LJ7A 3VK8A 4UB8U 4AP9A 4YMNA 1SWWA 4FE3A 2R8JA 3GQ4A 2LNHC 4PZNA 2QB0B 2W7PA 1BPEA 2HBMA 3PV8A 2ASJA 2A1AA 3CF2A 5AI4A 4DQIA 4BBAA 1A5TA 2YN4A 5L8RF 4A8EA 2X49A 4LRTA 4KMOB 3GO8A 1KRPA 3LCUA 2BQRA 1RG6A 1ZQZA 4WURA 1NO1A 1N5XA 2O01F 3T38A 3SMSA 2XSZA 4B6JA 2ALZA 2JP7A 4RF1A 4F1IA 4GXIA 2BCQA 2UVRA 3EYZA 5KL1B 4F2LA 4DR1M 1SXJB 2I6XA 4G4RA 4KLSA 4EBDA 2YMPA 3WK6A 3E4RA 1S5LU 3N7SC 3QNMA 3LWMA 1IXRA 4ED8A 5C18A 2NV3A 1PVQA 2NO5A 1ZQNA 2UUAM 4B9LA 1PK3A 2VQEM 2QZ4A 1K1SA 3CP8A 5AKJA 3TANA 3I28A 2L6OA 3QEAZ 1AQ6A 4KLLA 3TFSA 3IN5A 4DOCA 2QNJA 2JZ1A 2YTUA 1Z1VA 4RQ6A 3RBEA 2WF6A 4P0QA 1KKXA 3UMGA 3KZIU 4UB1A 2KRUA 4KLGA 2PI4A 2H3ZA 1N77A 3DFZA 1OAIA 2DZNB 2KE7A 4M9XA 4DLGA 4IJEA 1ZQYA 1QYRA 1FFVA 5AK5A 3KXEC 4KHPM 1R6BX 2DZOB 8ICWA 1VG5A 9ICRA 3C3DA 1UCVA 4IBCA 3SMPA 4F5RA 3T5JA 4FBTA 3EWAA 2BCSA 2ES6A 3ZD8A 4LVSA 2EZYA 2G5HB 3MABA 3QU9A 1V33A 3ZD9A 2HVIA 3KDSE 2LYBA 1J97A 2G3QA 4NRVA 4J9MA 1UM8A 2KICA 2QP9X 4QW9A 4MF2A 3IECA 5EP2A 3HY5A 1IN7A 4TUWA 4B3RM 2XO7A 1WIVA 2LH0A 3VLFB 5L1LA 3UQ0A 3FD9A 1NK4A 3S6JA 2XSZD 4F5QA 1URJA 2C2RA 4XA5A 4ECSA 3AMZA 5D4BA 4NXNM 2H5XA 1A6SA 5AI6A 2V9WA 3J2PB 3G6VA 3HU3A 2WB1C 3QU2A 4LJ4A 4DR4M 1EXNA 3PY8A 3NBIA 3K1RB 2AGPA 3AV0A 3K2LA 2PKEA 2WB1F 2Y1IA 1WCNA 3AU6A 8ICFA 4C7ZA 4C8NA 2P5TA 2MUTA 4RU9A 3KHGA 2MAXA 2WTFA 2F5PA 3C2MA 4LZDA 4DR5M 4Y2SA 3UMBA 1QSLA 4P0QB 4C4RA 2ATLA 2ZTCA 3MFIA 3W67A 3SD7A 1WXQA 3HWSA 4B7GA 4KN7A 1MU5A 3ONNA 5ALEA 3GQ5A 3FKEA 3KBBA 1XXHE 2H3FA 1XNSA 4P0PB 2C5RA 4PHDA 5C5JA 5EWFA 5FTJA 1IFYA 1DGBA 1TH2A 5HNKA 3T5HA 2NYVA 4UB3A 4C0ZA 3JPRA 4C7YA 3VDPA 3J81S 5K4LA 4B9VA 2KEBA 5AKLA 4JYAM 3U6MA 2QCUA 1Z59A 3ILKA 2X8AA 5KFXA 3AQEA 1L8LA 1ZQEA 5A0LA 5ALKA 4PCZA 3RB6A 2JGAA 2LYAA 5DQIA 2P6RA 1TH3A 3UJNA 2NO4A 1BNPA 3U6LA 3CF0A 3PFIA 2OCEA 3D2NA 4OX9M 2CHQA 3HILA 1ZMVA 5KFBA 4C8OA 1CEZA 7ICEA 1V38A 4D81A 1L1ZA 3MMPA 2LM1A 2HHHM 5J2DA 4JB3A 1J5EM 5L1JA 3ICXA 3B0YA 4EENA 5AKIA 4M9GA 4O3SA 3A0HU 2R8HA 4CF5A 1F4IA 4PDGA 1DOQA 1ZYQA 3L29A 4AG6A 2O25A 3F5EA 2BZFA 1QDTA 3AL0C 3GIMA 1XO0A 1YSYA 1K5OA 1I4WA 3GLHE 1L2BA 2IMWP 3VC8A 4RQNA 5IIKA 1MN8A 1NSFA 4NJ8A 3PSIA 5KFWA 4UAVA 9ICWA 5KFTA 4M0DA 1T3NA 2M0NA 2JY5A 4DL5A 3AEVA 4X65M 4ECWA 4DV1M 2K8CB 4ED7A 4PGYA 1L7MA 5KFDA 3DV9A 1GVNA 4DV7M 1QCKA 4UAWA 2OHFA 2PMZF 4GC6A 1ZQWA 1GABA 1D0MA 7ICKA 2K6BA 5ITUA 4X66M 1HT1E 3MJ5A 1ZQJA 4DFDA 5ALOA 3AOEC 1TV9A 2B0CA 5AM5A 3NUQA 1JMSA 4I2IA 1BVSA 5KG6A 5JI2E 1N62A 4L78A 2DUYA 3HKZC 1QSYA 2Z4RA 4GC5A 2R45A 1X66A 1OIZA 8ICYA 1ZQ9A 3HZJA 4DFMA 4LJ6A 4I2JA 4MFFA 3H0MB 4F72A 2FLNA 4R3DA 4B9UA 2EANA 3H40A 4M9JA 2CP8A 2G8LA 2XEPA 3E46A 2XGPA 1G4AE 4AG5A 3IG8A 3HX3A 4QWCA 1NKBA 5FP0A 5CP2A 1NZBA 3AOGA 1F0MA 1CUKA 2W8LA 4RQ5A 2R44A 3KOZE 5LMUM 4F4KA 4QNMA 3B7QA 2QENA 3ZDCA 2K0BX 2KJ5A 3C2LA 1D2NA 2ZAMA 2BKEA 4CGYB 2RHFA 3ALRA 4KLNA 1SIJA 4PZOA 5AIAA 4NXZA 3RJJA 3HHWA 4QHSA 2VKQA 3K1JA 2ZAOA 1DGFA 4JXJA 4ELUA 1Z1BA 4R8UA 4P16A 2WF9A 4AKIA 5ALSA 3JPPA 2EZZA 1PJSA 5KTQA 1ZQ1C 4BUGA 1S0MA 2IOHA 2OXOA 3H4DA 5HR6A 3A45A 2L09A 3PSPA 2F77X 5DBBA 5EXTA 2XVTA 4UASA 1U45A 2EO2A 3Q8KA 4YXMA 2DAEA 3GQ3A 4PT5A 5AM1A 2DAIA 9ICVA 2K9DA 1JX4A 3U6CA 3V7LA 3E21A 2E8MA 3M1YA 3SHGB 3LYSA 4RQ0A 3SAGA 5KT5A 4CGZA 4Z6CA 3EUB2 5ALRA 1SB3C 2HWJA 2GQFA 1WG8A 1XU4A 3PX4A 2QLTA 1AIPC 5AICA 3AOEA 3GLIE 2RDIA 2KVSA 2KZZA 4LF8M 4REZA 3U6EA 2XY7A 1N78A 2YMMA 5KFIA 4ELVA 3NWLA 3RR7A 5J0YA 4IQUA 1JR3E 3WHKA 4C4TA 4M0AA 3D6JA 1OTRA 2PFOA 3IDWA 2BWEA 2IOFK 5F9NA 7ICJA 3RAQA 8ICRA 5EE1A 4QZBA 3Q8MA 2FLLA 3E2EA 4GHLA 5KQDA 2DXIA 4S12A 2F3NA 1ZQCA 3K92A 2DENA 4R8UB 3QUTA 1UA0A 1UQVA 1SGGA 2DKZA 3Q8PB 3AL0B 2ODGA 4JI1M 2BJVA 4L8RC 4DQQA 3UMMA 4PDIA 3QE9Y 2QBYB 4K4HA 4RKUF 9ICHA 3C28A 2OYYA 4Z6DA 2Y9UA 2EQYA 4EIWA 2GNOA 2W8KA 8ICHA 3TPZA 4I2HA 4EELA 4J9QA 3H8SA 1DK2A 1TK8A 3NASA 5EXSA 2WSCF 3FUTA 1L5UA 1SXDA 5JTIA 2Z8YM 2PFPA 4B9MA 3SAUA 1QAOA 3O0FA 3ZDDA 3RGSA 5KG5A 1ZQOA 2E8OA 3SARA 2K4PA 4F4ZA 3CW2C 3D2QA 2FE9A 2A19A 4UAZA 1Z00A 2ZJ5A 5EE0A 1GJTA 1P7DA 4UB6U 4BX9C 1EE8A 4OJPA 3DA1A 4MGKE 4FD2A 3ZDEA 2AU0A 1N34M 1S0NA 2JEFA 3SQIA 1IN5A 4P4PA 3TAPA 2EUCA 3K4GA 5ALWA 4U6PA 2DWMA 4LF7M 5J0RA 1NY5A 2L7IA 4M0WA 4Z6YA 5ALUA 1PZNA 1LTMA 4F91B 3I04M 1VDVA 2KG5A 2A5YB 4J9SA 3PVXA 4RQ3A 2OH2A 1ZQPA 1SKSA 3MGVA 3NVZA 3T15A 2EAPA 2LPEA 1X37A 4ECUA 9ICCA 4NLZA 3GPYA 1KFVA 1ZQFA 1SKWA 3LWLA 1IM2A 1YLAA 5G5HA 5AKEA 5KFJA 2UUBM 4JV1A 1NV9A 1NK6A 3TQ1A 3LQRA 1HT2E 4DBGB 2BR0A 9ICSA 1OXJA 4F92B 4RNOA 4LJ8A 2XC9A 3MR5A 1WJ7A 1TAMA 2BDPA 5KNIA 3HWTA 1NVMA 3RB3A 4JI4M 2W03A 4L16A 5CHGA 4BWMA 2I1QA 3VKHA 4DFPA 2J6SA 2LVQD 1FIQA 4YQWA 1DGHB 5C1BA 1A0PA 3Q8SB 2G06A 1VQ1A 3HJEA 3BS5A 4DR7M 3Q8GA 1IBKM 4AYBC 4DEZA 3J27B 2DWQA 4JWMA 3H0RB 3KHHA 1KBUA 3E9SA 3HHYA 4QJFB 3HHXA 4KLDA 1S97A 4AYBF 3MR3A 3EIHA 2BCUA 1GJSA 2C2EA 3KP1E 3RJKA 4K4IA 2KKPA 3FYDA 5DQHA 1G8PA 2XF3A 1X42A 4CF3A 1E9SA 1IBMM 1FEZA 4KLQA 1DO2A 1ZD3A 3W0LB 3H8MA 4B9SA 2AXTU 1ZQAA 2BWBA 1XWIA 4F93B 2KHHA 4F8RA 4YR2A 1PK1B 3VKGA 2UVUA 8ICGA 3CTWB 1ZAEA 2CV2A 5J2AA 2UVVA 3ZI4A 3WKAA 3RR8A 1MSWD 2V4QA 3PW2A 4RQ1A 3SBJA 1L7PA 1ZMWA 3RJEA 1QQ7A 4PGXA 3JPTA 3TAQA 4I2EA 1WGLA 4YHHM 4DFKA 4DL6A 1UFZA 1L3UA 4NM2A 1OAOC 5KFCA 2ZUDA 2XCAA 8ICSA 3Q8LA 5JRTA 5L1IA 3DOAA 3FYHA 3BS5B 2CFOA 3L4PA 4YN4A 1HUOA 2F1HA 4KITB 1IXZA 2KSOB 1WYGA 2KNAA 4C4SA 4YG2A 1ZD2P 8CATA 1CRXA 4TQSA 4KLTA 3IM1A 1XNQM 1JR3D 1P3QQ 3M6ZA 3ISBA 3C9PA 4IBEA 4B3SM 1Z19A 4OJ6A 2JEIA 3THVA 4MM3B 3N7RC 1JQJC 3H4JA 4X62M 1OQYA 1NK9A 5AK4A 3TI0A 2KZ3A 4G6ZA 2KTQA 2GLEA 2JR5A 2R46A 1MA7A 3KSXA 2CPRA 1U47A 5J2JA 2VJ4A 2LHGA 2LXEA 1SXJA 9ICOA 4NRWA 4DS5A 2WF7A 1G59A 2YNMD 2JWSA 4QOZC 3RRGA 4DF4A 3KD3A 3WK4A 2XH9A 4DV3M 5LMNM 4QZ8A 2FS1A 1ZQLA 1QVRA 2LBCA 2H3IA 3K9OA 4Q43A 4KO8A 4JN6A 2MA1A 3SV4A 2W9CA 1S0OA 5J2KA 3JR5A 1SL0A 4RNMA 3OJSA 4DL3A 5KO3A 4DR6M 1TTEA 4DQRA 1MJGM 3GRYA 1S3SA 3V6HA 3OHAA 3N97B 3AQFA 1JI7A 1ED1A 4ZPXA 4NLKA 4BB9A 1R5LA 4KTQA 2KN7A 2B21A 2DAKA 4OVZA 3ZQJA 1KQQA 3VFDA 3ORYA 4ACOA 3IRUA 5AM4A 4UB2A 2FFJA 3SAVA 7ICTA 4MB7A 4P4MA 4FWGA 3SAWA 4QZDA 3GPPA 4R65A 3UM9A 5J0QA 1BNOA 2Y9TA 2XICA 2ZJAA 3SMVA 4RT2A 2ERCA 1KFSA 3I01M 4M04A 3UPQA 2LBOA 3N4MB 1SXEA 1BPZA 2NRVA 5GTIU 3ZH9B 2E8NA 2MRLA 3GU3A 3PX0A 2CV0A 1JROA 1SXJD 3FRIA 3KOOA 3LVVA 1LV5A 3UGJA 3PO5A 5KG3A 3LK9A 4RNNA 1U48A 5H2FU 2F76X 5DB8A 3ZDAA 2YX8A 7ICRA 3FUWA 3E0FA 1TE2A 2F5SA 1N61A 1SZPA 1N36M 1HR0M 3QUBA 2W9CB 2W82A 4GH9A 1GO5A 2C99A 2F1JA 2LKYA 5KFVA 3RH5A 2KVCA 2G5IB 2OPFA 2F44A 3HW8A 2FMPA 4O0IA 2G0AA 5AKHA 3TWKA 2E1FA 3Q8XA 2K60A 2VANA 3RJGA 4OVZB 4P0PA 1JIHA 5AI0A 4LJ5A 5KFOA 3IG5A 1IBLM 5BPCA 1IY2A 3GRRA 2G08A 3B7NA 4NM1A 3BQ7A 3U6OA 3K9PA 2MSNA 3U6DA 4DL7A 4WW0A 3RJIA 4ED1A 3K1ZA 4L15A 2DNAA 3UK6A 1FFUA 1SV0C 1TKDA 2CE7A 1ZQXA 2DWNA 2HSZA 4DL2A 1RYUA 4QZIA 2MJ5B 2BCRA 5ITQA 2W7OA 4X64M 1D8LA 2M9NA 3H7IA 5AKGA 2JV3A 2Y0TA 2LHCA 2WSFF 3NRZA 3T6PA 5DB7A 1ORYB 5EQTA 3AN1A 4RNAA 2WSEF 1RM6C 3I1YA 3SEIA 4KLEA 3PMNA 5ALJA 4DOAA 2O5RA 2LWXA 1Y8GA 2KXEA 1O03A 1Q8KA 2W9AA 5ALFA 4YVZA 5KG1A 1DXSA 5ITXA 3KFUG 2JZBB 3KTQA 5J0TA 3QU5A 2YB4A 2P6UA 5KFGA 1NZPA 1ZJMA 5KT2A 2Y0QA 3GQCA 3GRUA 2XCPA 5L1MA 2BGWA 5KAIU 4O3MA 2KD1A 3GILA 4NLBA 5FTMA 4MGZE 3Q8QB 1IQPA 4HAIA 2KV2A 3OTOM 1PVRA 2HBLA 4IQVA 5EWEA 1OJLA 4EX7A 2XY5A 4RPXA 3LCVB 2O6KA 4R66A 3MGHA 3PX6A 1X9WA 3WU2U 4IC9A 2YMLA 2AJQA 4IQWA 2OM6A 2F5OA 4ECZA 1MN3A 3HJSA 2ZIUA 4ED3A 2OOBA 2LVNC 3HHZA 5KFZA 4ED2A 4ED6A 2L4EA 2IBKA 2XGQA 1T7PA 4LF4M 1XO1A 1DGSA 4GLXA 4LFAM 3KSJA 2IA6A 3V7KA 3L3FX 2RRDA 3FYCA 1KFTA 2UUCM 2GOLA 4OJOA 5IZ7D 1XB2B 1TK0A 3GLGB 1SV0A 2R62A 3H8WA 4F5NA 1X6IA 4GXJA 4F2RA 4JI0M 2FE8A 3OGUA 1NK7A 7ICHA 3GP1A 5EWGA 1L2CA 5KT3A 4CE6A 3BS7A 4OJLA 3PNVA 1V34A 1UT5A 2KA6B 1RQLA 4BJQA 2VDBB 1KYIA 4AKHA 4QZEA 2W04A 2BQ3A 2BHNA 3WK9A 3HJQA 4M9LA 1X9XA 1U49A 3KOYE 3U5ZA 1WUDA 2EKKA 2Z4SA 1JN3A 5FLXS 4DUZM 2CHGA 1Z5AA 2JNHA 4QZHA 4QZGA 3HKZF 2FDRA 4KN4A 2ZIUB 3ED5A 3HT3A 1EFUB 4GRIA 3F5AA 1H6UA 5J2BA 5AM2A 2XLJA 2JXJA 1QAQA 5E79U 2AHOB 2VQFM 4DV4M 5J2HA 2BJWA 1N32M
chains in the Genus database with same CATH topology
3I4YA 3HKPA 5DYIA 4D80A 1YE9A 4FZLA 3DA1A 4MGKE 4NL4H 4OJPA 4FD2A 1IY0A 5HR7A 1TDZA 3CF6E 2ZG6A 1N34M 3SATA 5FSWA 1ECWA 4JI6M 1FNNA 1W5TA 3SQIA 4MGYE 2Z3XA 1IN5A 4DUYM 2G07A 1HQYE 2CUZA 4LF6M 2EUCA 3QAUA 1L6NA 2XZUA 2UU9M 2KHVA 4U6PA 2DWMA 4LF7M 1NY5A 2L7IA 4M0WA 4Z6YA 4FZMA 3TWLA 1T94A 3HU1A 4L4UA 2H3QA 2FNAA 3SFZA 2HBJA 4CRXA 3GLGA 5EJCA 2YR0A 4QHTA 2E5SA 5BR8M 3FTFA 2A5YB 3UZUA 1XNRM 2V1UA 1GL6A 4JI7M 2OH2A 2K4EA 3MGVA 1T3TA 4IBDA 1W5SA 1L2DA 3T15A 1GL7A 1R2YA 1Q3BA 4NWIA 1X37A 3F2DA 3GPYA 2G09A 4KODA 1KFVA 4PL2A 2R4EA 5C0YA 1NJFA 1IM2A 2CEAA 2ZIXB 3LQQA 1K82A 4LCBA 3U5ZB 1YUBA 3AKZA 2XGNA 4FCVA 2QBYA 4CISA 4GHAA 1HEKA 1N33M 2UUBM 1Z5BA 1Q3VA 1SZHA 7CATA 3RF9A 4QNLA 3LQRA 1HT2E 2YQZA 4LZZA 4LJ8A 1HNWM 4QNRA 3QWLA 1TAMA 4LJ7A 5KQ8A 2KEYA 4GITA 3VK8A 1NVMA 3GPUA 4NSOB 4I81A 4JI4M 4L16A 3FTEA 2DQNB 2J7NA 3GQ4A 2LNHC 2W03A 4FE3A 3VKHA 4LJ9A 2W7PA 4AZFA 2ZIWB 4IBKA 3K8ZA 2HBMA 4FCWA 4FWHA 1DGHB 1QQWA 3CF2A 5C1BA 1A0PA 2Q4TA 4II7A 2KHQA 2HKJA 1HNZM 4BBAA 2G06A 1HQCA 5EP1A 2WAQC 4RF0A 4A8EA 3F53A 2X49A 4LRTA 4A3VB 3HU2A 4KMOB 3ZCBB 3GO8A 4DR7M 5KPZA 1R2ZA 4WURA 2GH1A 1OFIA 1IBKM 4LZJA 4AYBC 3T38A 3SMSA 1MX0A 3J27B 2XSZA 2R4JA 4I8OA 2KZSA 4RF1A 5ITYA 2E5LM 3H0RB 1KBUA 5IT9S 3E9SA 3HHYA 4QJFB 5KL1B 3HHXA 5IREB 3J7AS 4FW9A 4DR1M 3KZXA 4AYBF 3EIHA 4D82A 1SXJB 3L25A 4G4RA 3KP1E 2KKPA 3FYDA 3KW6A 1G8PA 2XF3A 3E4RA 3N7SC 3OPXA 1E9SA 3SHFA 1IBMM 4FZNA 1PVQA 5C18A 2UXCM 4LF5M 2NV3A 1DO2A 1NJGA 2UUAM 3W0LB 1Q3UA 2HBKA 2VQEM 3ZC7B 3H4MA 2KKVA 2QZ4A 3CP8A 1OUQA 2ZXIA 1VDDA 1XWIA 4GKKM 2DHRA 2L6OA 4DV5M 1XC8A 3IN5A 3NRWA 1E94E 3VKGA 5KPRA 3RFWA 3PNYA 1FJGM 2PMZC 3CTWB 1ZAEA 4MGHA 2CV2A 2ZIXA 4P0QA 2JA2A 2KRUA 4LFCM 2KZUA 2H3ZA 1N77A 4G4QA 3DFZA 2DVWB 2DZNB 4AI6A 4M9XA 3SBJA 4IJEA 2RP5A 1QYRA 1QZMA 1XXHB 3KXEC 2K47A 1R6BX 2DZOB 4KHPM 3M7DA 4IBCA 3HGIA 3SMPA 1DO0A 4YHHM 1G3IA 3PZPA 4CHTB 2CRXA 2V1CA 3GLFA 2G5HB 3I4VA 2Y20A 3KDSE 2LYBA 1QAMA 3DOAA 4NRVA 4GKJM 1UM8A 2CFOA 3FUUA 2KICA 2QP9X 2ZIWA 5EP2A 2C96A 1IXZA 1IN7A 4TUWA 1DGHA 4B3RM 3VLFB 2LH0A 4LY6A 4R7GA 4NXMM 3FD9A 8CATA 1L1TA 1CRXA 2XSZD 2BNKA 3L2AA 1XNQM 1URJA 4OO1J 1JR3D 3M6ZA 4NXNM 2F4VM 1A6SA 4B3SM 4IBEA 1Z19A 4OJ6A 4MM3B 3N7RC 3J2PB 1JQJC 4X62M 1IN4A 3HU3A 2WB1C 4LJ4A 4BLCA 4AKGA 4G6ZA 3AJIB 2JMGA 4DR4M 3D8BA 2R46A 2VJ5A 1MA7A 3D2SA 3NBIA 3KSXA 4DV2M 2CPRA 1SXJE 2HOFA 3H0LB 3GRVA 3AV0A 3K2LA 2VJ4A 2LXEA 1SXJA 2YFQA 2WB1F 4NRWA 1IIPA 1DRGA 3SYKA 3W0FA 3SAHA 1G59A 2YNMD 4QOZC 4GFJA 2P5TA 3A42A 2K89A 4IBGA 3GLHB 4GMQA 2ZM6M 2XH9A 4DV3M 5LMNM 1XHBA 2F5PA 1K3XA 4DR5M 4P0QB 3FUXA 1NY6A 3U61A 1QVRA 4G4NA 4JI3M 2H3IA 4B3MM 3KVWA 3JR4A 1WXQA 4JN6A 3HWSA 4KO8A 2MA1A 3DEEA 4B7GA 1MU5A 3ONNA 3JR5A 2F5QA 3GQ5A 3VCBA 5KO3A 3FKEA 2OQ4A 4DR6M 4KX3A 4KX5A 3I51A 3GRYA 5ITRA 1S3SA 3RGPA 3L26A 4MH0E 2H3FA 3AQFA 1XNSA 2HOIA 4MGIE 2C5RA 3GLFB 4P0PB 5FTJA 1DGBA 2VIXA 1TH2A 1XXHA 4NOOB 4ICAA 2AHMA 4ZPXA 1L8QA 1ED1A 4C0ZA 3R8FA 3VDPA 4BB9A 3J7BA 3GPXA 4JMUA 3J81S 2KEBA 4JYAM 3U6MA 4OVZA 2QCUA 3ILKA 1Z59A 4I5SA 2V6ZM 3VFDA 2XI9A 2X8AA 4ACOA 1DGGA 1I94M 2Y0SC 3AQEA 2FFJA 3BOSA 3SYLA 3TL4X 5E26A 3SAVA 4MB7A 5FTLA 4FWGA 3SAWA 5A0LA 4PCZA 2XFTA 3GPPA 3VDUA 2JGAA 2LYAA 1OFHA 4Z8XA 4QOSA 1TH3A 3UJNA 2DWLA 2XICA 3FTDA 3U6LA 1D8BA 3SMVA 2HMXA 3CF0A 3PFIA 2ERCA 3D2NA 3N7PD 4OX9M 2Y0SF 2CHQA 2Z7JA 4JV5M 2UXDM 2WAQF 2LBOA 4D81A 1L1ZA 1GO3F 2HHHM 2RKOA 3T1YM 2CHVA 3ZH9B 2LHTA 1J5EM 2MRLA 2ZANA 5EXPA 1YT3A 4XBOA 3GU3A 1XMOM 2CV0A 3ICXA 1SXJD 3F2BA 4LGYA 5KPTA 3LVVA 3KFUF 3MHVC 1IY1A 2RGHA 3UGJA 3SAFA 4PDGA 5JI3E 3TE6A 5IWAM 3L29A 3U6PA 4AG6A 1NHGC 3PVSA 4HLQA 2F76X 3F5EA 3HJ8A 3AL0C 2HOQA 2YX8A 1XO0A 2K4HA 1YSYA 3FUWA 1I4WA 3U61B 5ITTA 1L2BA 3E0FA 3VC8A 2F5SA 3U60B 3J80S 1NSFA 3GLHA 4DR2M 3PSIA 1N36M 4M0DA 1HR0M 1PVRA 2M0NA 1IN6A 2KOBA 1Q3CA 2W82A 2HCBA 4GH9A 2C99A 2LKYA 5F3WA 4X65M 2BDUA 1Q39A 4LRSA 4GIPA 4DV1M 2ZIVA 2K8CB 3AFHA 3L27A 2KVCA 4DV0M 2G5IB 1GKIA 2OPFA 1GVNA 4DV7M 3R9XB 4IJFA 3GZFA 2RGOA 3SASA 2PMZF 1K3WA 3T79A 2G0AA 3TWKA 2E1FA 3Q8XA 5H37D 4M9ZA 2H1RA 5ITUA 3VK7A 4P0PA 4OVZB 4X66M 3F2CA 1HT1E 2E1EA 4WJ3B 4K0KM 2KIWA 4LJ5A 3MJ5A 1Z5CA 2KJ8A 3CRXA 3IG5A 3AOEC 1IBLM 1IY2A 3NUQA 3GRRA 2G08A 4HL4A 2HL7A 3TWMA 2Q2EB 5JI2E 4AW4A 4L78A 3HKZC 3U6OA 1E32A 2Z4RA 4GC5A 2R45A 3U6DA 2C9CA 4QIWC 4B3TM 4WW0A 1ZQ9A 3RE8A 4AQYM 3MK6A 4LJ6A 1NNUC 2YB1A 1J09A 3K1ZA 4L15A 2D7HA 3UK6A 3H0MB 5EP3A 4NLCA 3RFAA 4R3DA 2CE7A 2DWNA 2L7HA 4QIWF 2G8LA 5ITQA 2XEPA 3D8LA 2W7OA 2FOIC 2D6FC 4X64M 1G4AE 3PXGA 4AG5A 3IG8A 1IXRC 3GLIB 2CV1A 2ZXHA 1NZBA 2R65A 3AOGA 4LF9M 2Y0TA 1KSFX 4FCTA 2XZFA 1ORYB 4GC9A 3KOZE 5EQTA 5LMUM 4RNAA 3U6QA 1HIWA 4QNMA 4B7FA 3KS4A 2KRKA 2QENA 4JI5M 2O5RA 2KJ5A 2LWXA 2KXEA 3M7GA 3T1HM 4IBBA 5GKNA 2EA0A 1D2NA 4LG2A 3U60A 2ZIVB 2ZAMA 5ITXE 4CGYB 2RHFA 3ALRA 4KLNA 4LGMA 2C98A 1NHWC 3HHWA 4QHSA 5ITXA 3KFUG 4W5WA 2VKQA 3K1JA 2F5NA 2ZAOA 3EIEA 3FTCA 1DGFA 2I7PA 2F2AB 5E6JA 2YB4A 4JXJA 1PVPA 3IP4B 1Z1BA 2J7OA 2X4AA 4NSRA 2K8AA 1PJIA 2XIDA 2Y0QA 4P16A 4U7CA 1Z6TA 2JH7A 3GRUA 3U6SA 4AKIA 3KOXE 4O3MA 2KD1A 4NLBA 1ZQ1C 5FTMA 5FTNA 4BUGA 1TDHA 4MGZE 1IQPA 1E9RA 4DR3M 2KV2A 2OXOA 5HR6A 3PSTA 3OTOM 1R7RA 2L09A 3A45A 2F77X 2HBLA 2K4IA 5EXTA 4PD2A 2KNJA 2XVTA 3PSPA 3C29A 1OJLA 4I4LA 3KS8A 2EO2A 4FVMA 1G41A 3GQ3A 5FTKA 4PT5A 2UXBM 2K8BB 1HNXM 4IC9A 2A3VA 4JI8M 2JHDA 2D7GA 3U6CA 2OM6A 3LMMA 3SHGB 2F5OA 3LYSA 3HJSA 4PL1A 1PM5A 3SAGA 1UPHA 2ZIUA 2M5ZA 4CGZA 4OJ5A 4IBFA 3HHZA 3A46A 1SXJC 1XMQM 1TGUA 3AOEA 2M60A 4G4OA 4LF8M 3CYMA 4REZA 1TH4A 3U6EA 3GLIA 4LF4M 1N78A 4OW0A 3NWLA 3SC3A 4M9SA 4LFAM 3WHKA 1QANA 3KSJA 4DV6M 4ITQA 4IIWA 3L3FX 3C58A 2RRDA 3FYCA 1JR3A 4LFBM 2UUCM 1N75A 4NV0A 2GOLA 3KP0E 2N1RA 3A98B 5IZ7D 4OJOA 2QPAA 3GLGB 2R62A 3TQSA 2D7EA 4GHLA 5KQDA 2DXIA 2NQ8C 1LV7A 5KL8B 4S12A 4JI0M 2FE8A 5EXXA 3GP1A 3K92A 1L2CA 2JH1A 3M0EA 4OJLA 3PNVA 1J7KA 2DGZA 4YY3M 1C1KA 4CDGA 3AL0B 4JI1M 4FWDA 2BJVA 4B08A 3JAMS 5BPVA 4L8RC 3THGA 3UMMA 2KA6B 2DWZB 3FUVA 4BJQA 4B7HA 4PDIA 2QBYB 1KYIA 4AKHA 2W04A 3HJQA 3C28A 2OYYA 3DZDA 4JI2M 2Y21A 4LJAA 4EIWA 3KOYE 2I7NA 1NNJA 2DF4B 1IXSB 3U5ZA 3TPZA 4IBIA 2C9OA 2R18A 5CRXA 2ZBKB 1WUDA 2F8LA 5DNYA 1GLNA 5A2QS 5EXSA 2H3VA 2Z4SA 5T14A 2XFSA 1F44A 3B9PA 3FUTA 5FLXS 1EE8A 2CN1A 2KJ9A 2G5GX 5EP4A 4DUZM 5DYGA 2CHGA 3KOWE 3LVWA 1Z5AA 4IBJA 4XGIA 3HKZF 3SAUA 1QAOA 2ZIUB 3PSFA 4OU7A 3M6KA 3O0FA 3F5AA 4GRIA 3RGSA 3WHLA 1H6UA 3SARA 3M6AA 2XLJA 3L28A 3D2QA 1IN8A 1QAQA 1P7DA 2KW0A 2VIIA 1PJJA 2VQFM 4DV4M 4BX9C 2BJWA 1N32M
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R18 A;  2Z7J A; 
#chains in the Genus database with same CATH topology
 2ZTE A;  3SV3 A;  5DYI A;  3QYP A;  2OO9 A;  3CF6 E;  3QU4 A;  3V72 A;  4CF4 A;  1LB2 B;  4UAT A;  7ICF A;  1FNN A;  9ICI A;  1ZQS A;  4DUY M;  4LF6 M;  4PHE A;  2UU9 M;  2KHV A;  3PR5 B;  4FZM A;  5CR0 A;  3TWL A;  1T94 A;  1MQ2 A;  3HU1 A;  1DK3 A;  3MR6 A;  2H3Q A;  2FNA A;  3SFZ A;  2HBJ A;  2LVP C;  2YR0 A;  4QHT A;  1MC8 A;  1K1Q A;  3KHR A;  5ALQ A;  3GIJ A;  3G6X A;  4JUZ A;  1JAL A;  2KNZ A;  2K4E A;  5KFL A;  4IBD A;  1W5S A;  4YCX A;  4KLO A;  2FPL A;  1ZQM A;  4XK8 F;  2G09 A;  4KOD A;  3SZ2 A;  1QSS A;  4PL2 A;  2VA2 A;  1VEJ A;  2ZIX B;  4ZOH C;  3U5Z B;  1YUB A;  4JV0 A;  4O3Q A;  4FCV A;  2QBY A;  5IIJ A;  1Z5B A;  1LKY B;  4NLN A;  1R4G A;  2EKF A;  4QNL A;  5DLG A;  4ECT A;  2ISP A;  2HCF A;  4G3I A;  1B0X A;  1HNW M;  4QNR A;  5KQ8 A;  5ALV A;  4KLM A;  2KEY A;  4GIT A;  1S10 A;  5TIS U;  1HUZ A;  1NNL A;  5DG7 A;  4I81 A;  2DQN B;  2L2D A;  3FTE A;  4LJ9 A;  4Y2T A;  4DSL A;  1ZRM A;  2ZIW B;  3K8Z A;  4FCW A;  4FWH A;  3T5L A;  2Q4T A;  4II7 A;  2KHQ A;  2HKJ A;  1HNZ M;  4Q45 A;  7ICM A;  1HQC A;  2WAQ C;  4RF0 A;  3F53 A;  4A3V B;  8ICO A;  1Z4N A;  5KPZ A;  1R2Z A;  3MR2 A;  1ZJN A;  2HHQ A;  5ALG A;  4F5P A;  5CEH A;  1MX0 A;  4XQ8 A;  4I8O A;  3RRH A;  5J2F A;  2KZS A;  2F1I A;  2E5L M;  3V7J A;  1U4B A;  1RDF A;  2EH9 A;  3UXN A;  3FDS A;  4UAU A;  3J7A S;  5IRE B;  3RJH A;  2FLP A;  3L25 A;  2YY6 A;  2YQE A;  5ALN A;  4I2F A;  3KW6 A;  2VA8 A;  3OPX A;  4FZN A;  4QWE A;  2UXC M;  4US8 A;  8ICT A;  1SL2 A;  1NJG A;  1Q3U A;  3AUO A;  1IG6 A;  2DAG A;  3ZC7 B;  3H4M A;  3OTQ A;  2ZXI A;  4TUQ A;  4UQG A;  3M9N B;  3NRW A;  3QUQ A;  3PNY A;  1NOM A;  4BGD A;  5AKZ A;  3GV5 B;  2JA2 A;  3MDC A;  1N60 A;  2FJ6 A;  4EYI B;  5ALM A;  2DVW B;  2AQ0 A;  4AI6 A;  4RQ7 A;  3UQ2 A;  1XXH B;  1BPY A;  3M7D A;  5F9L A;  3PZP A;  1DO0 A;  1G3I A;  2DHY A;  2NRZ A;  3NGD A;  4CHT B;  2V1C A;  3JPS A;  3GLF A;  1L7O A;  3I4V A;  5EE9 A;  2Y20 A;  5KT6 A;  3NS1 A;  1QAM A;  4GKJ M;  4TUR A;  3FUU A;  1PJQ A;  5EOZ A;  2R6F A;  1N2X A;  1DGH A;  2HHS A;  4LY6 A;  1J2N A;  1L1T A;  2MU2 A;  3N28 A;  2BNK A;  3L2A A;  4OO1 J;  4YXJ A;  8ICK A;  2JEJ A;  2MR9 A;  1AUA A;  2VF7 A;  3EPI A;  4BLC A;  3AJI B;  9ICF A;  4GIB A;  2VJ5 A;  5JUM A;  4DV2 M;  1SXJ E;  4I27 A;  3H0L B;  1ZQT A;  3W68 A;  4YP3 A;  1X9M A;  2DBY A;  2YFQ A;  4CCH A;  1S0V A;  4E0D A;  1DRG A;  1PUZ A;  3SAH A;  2MH8 A;  3ETL A;  4GFJ A;  3C5G A;  7ICU A;  5IIN A;  3GLH B;  2OWO A;  3OJU A;  4NL9 C;  3RTV A;  3OSP A;  1K3X A;  4DSJ A;  1NY6 A;  2DZL A;  3U61 A;  3GIK A;  4JI3 M;  4LZG A;  3GII A;  4B3M M;  3KVW A;  3JR4 A;  2W55 A;  1PK1 A;  3I76 A;  3SYZ A;  3DEE A;  1M6Y A;  4USA A;  9ICB A;  5J0P A;  1ZQQ A;  2CWB A;  2F5Q A;  5KFR A;  3VCB A;  4KX5 A;  3I51 A;  9ICX A;  3AU2 A;  3RGP A;  1F5S A;  2IHM A;  3GLF B;  4EX6 A;  5J29 A;  2VIX A;  2EZX A;  3B9J A;  2WF8 A;  4NOO B;  4ICA A;  5DGB A;  4J9K A;  2FPM A;  1L8Q A;  8ICU A;  7ICQ A;  3R8F A;  1BGX T;  9ICK A;  3J7B A;  4O5K A;  4EZ6 A;  4I5S A;  4MEX A;  2V6Z M;  4RPY A;  1DGG A;  1I94 M;  2Y0S C;  5D49 A;  3BOS A;  3SYL A;  3TL4 X;  4X5V A;  5AKY A;  5FTL A;  4DS4 A;  5AKK A;  1C20 A;  4I2D A;  2XFT A;  1Z3E B;  3VDU A;  4Q8F A;  2KSO A;  3L5K A;  1D8B A;  1X40 A;  3NTU A;  3FTD A;  1V92 A;  1KL9 A;  3H8J A;  1S77 D;  4RQ8 A;  3NVW A;  3N7P D;  5KFN A;  4ECR A;  2Y0S F;  1ZQK A;  4QZA A;  5DBA A;  2E8P A;  4PJ0 U;  1GO3 F;  2RKO A;  3QUC A;  5CJ7 A;  2ZAN A;  5EXP A;  1YT3 A;  1XMO M;  5AK3 A;  2D8C A;  5J0X A;  3F2B A;  2BPG A;  4LGY A;  4HEO A;  3MHV C;  1TFR A;  2RGH A;  2W43 A;  3SAF A;  2P66 A;  2J5Y A;  2HAK A;  2CRU A;  4F2S A;  5JI3 E;  5IWA M;  2DAM A;  3U6P A;  4Y2P A;  2BQU A;  3HJ8 A;  5AIB A;  4RPZ A;  2K4H A;  4Y2V A;  3QYE A;  3QZ7 A;  4L6V 6;  3U61 B;  5ITT A;  3U60 B;  4US9 A;  1ZMU A;  3JPQ A;  2FPK A;  1IN6 A;  2KOB A;  3ETR A;  2HCB A;  2NRT A;  1B22 A;  2LVO C;  4O5E A;  5F3W A;  3WKB A;  4GIP A;  4O3R A;  3AFH A;  3L27 A;  1RXV A;  3Q8R B;  3R9X B;  4IJF A;  3GZF A;  2RGO A;  3SAS A;  1K3W A;  4Q7J A;  3J81 j;  3T79 A;  3MGI A;  5H37 D;  4M9Z A;  2W9M A;  2H1R A;  4MFA A;  4KMU A;  5KFK A;  4WJ3 B;  3M8S A;  4FO6 A;  4NL9 A;  3K75 D;  8ICQ A;  4HL4 A;  3TWM A;  4BWJ A;  2NRX A;  5HML A;  5IIO A;  1COO A;  2C9C A;  4IL6 U;  4QIW C;  4B3T M;  3RE8 A;  3MK6 A;  1NNU C;  4PHP A;  1J09 A;  4RQ4 A;  3BXW A;  9ICQ A;  2D7H A;  4R71 A;  4NLC A;  8ICB A;  4RUC A;  2L7H A;  4QIW F;  2ISO A;  4XRH A;  3D8L A;  2FOI C;  1WGN A;  5D46 A;  5J2G A;  3UMC A;  3PXG A;  1KTQ A;  5AI5 A;  1IXR C;  3GLI B;  2CV1 A;  2ZXH A;  2R65 A;  1NKE A;  4LF9 M;  4FCT A;  2XZF A;  2HHV A;  4GC9 A;  8ICX A;  2R8I A;  4B7F A;  5DB6 A;  2KRK A;  5CB1 A;  3NBX X;  1SG9 A;  1KSP A;  5ALL A;  4O5C A;  3M7G A;  3T1H M;  4IBB A;  4LG2 A;  1N56 A;  5ITX E;  1N63 A;  2V4R A;  4LGM A;  9ICJ A;  2MGW A;  2F5N A;  1TVA A;  2I7P A;  1CI4 A;  2KIV A;  8ICL A;  5E6J A;  1PVP A;  3IP4 B;  2A1J A;  9ICT A;  2X4A A;  1VLB A;  3AM9 A;  4U7C A;  1Z6T A;  3GV8 B;  2Y1J A;  3KOX E;  2I9G A;  1RU3 A;  2APL A;  5FTN A;  4QWB A;  2FH0 A;  4DR3 M;  3PST A;  4RQ2 A;  5IIL A;  3C29 A;  4PD2 A;  5KFA A;  5AHX A;  1IXS A;  3KS8 A;  2P35 A;  4DSE A;  2EJS A;  1WCL A;  1SL1 A;  4FVM A;  3BDP A;  2FI1 A;  2UXB M;  2A3V A;  3RAX A;  2BPF A;  2JHD A;  2FMS A;  1DV0 A;  2OEH A;  1PM5 A;  4HYK A;  2M5Z A;  3MFH A;  4YMM A;  1KEJ A;  3B89 A;  3NVY A;  1V85 A;  1XMQ M;  3PML A;  1OIP A;  1T6O A;  3TAD C;  1EIJ A;  3RB4 A;  3SC3 A;  4M9S A;  1QAN A;  2FMQ A;  3LDA A;  3C58 A;  2EAO A;  2QAR A;  3C21 A;  4LFB M;  3RH6 A;  1N75 A;  3KKA C;  4NV0 A;  3KP0 E;  3BJY A;  3C1Y A;  3RB0 A;  4C8L A;  1QDR A;  1NK8 A;  2D7E A;  2B6G A;  2WF5 A;  4J9R A;  3ISD A;  5B5E U;  2NQ8 C;  4JV2 A;  5KL8 B;  4YFK A;  2JY6 B;  3PW5 A;  1NJX A;  1ZQU A;  3PO4 A;  2CXY A;  1SWV A;  2A1J B;  2JRZ A;  4QW8 A;  1XSL A;  2IOF A;  7ICO A;  2JZB A;  1J7K A;  2DGZ A;  4YY3 M;  5AK6 A;  1C1K A;  4CDG A;  5DGA A;  2PFQ A;  5DLF A;  4FWD A;  5BPV A;  2DWZ B;  2EDU A;  5KFH A;  4J03 A;  4JI2 M;  2WHE A;  2Y21 A;  1TR8 A;  3BQ1 A;  4LJA A;  1NNJ A;  2DF4 B;  2KK0 A;  1IXS B;  3SEN A;  2DKL A;  4IBI A;  2C9O A;  2R18 A;  4FFD A;  5CRX A;  2F8L A;  1GLN A;  4ED0 A;  2H3V A;  2XFS A;  4C8K A;  3B9P A;  5DG9 A;  5J0U A;  4MF8 A;  1T8E A;  4IRC A;  5EP4 A;  5DYG A;  4DSK A;  1ZV1 A;  3KOW E;  4XGI A;  1RXW A;  8ICP A;  3PSF A;  4OU7 A;  1N48 A;  1XSP A;  5ALI A;  3WHL A;  1FO4 A;  5ALP A;  1IN8 A;  1PJJ A;  3JPO A;  4IRK A;  4KLJ A;  5ALZ A;  4D80 A;  1YE9 A;  1WR1 B;  4FZL A;  2KFN A;  1IY0 A;  4O3P A;  2JY7 A;  1TDZ A;  2ZG6 A;  3M9O B;  2GWS A;  2QAR B;  3SAT A;  5FSW A;  3OHB A;  2EAM A;  2ZJ8 A;  3DDH A;  4MGY E;  2Z3X A;  4KLU A;  2G07 A;  1ZQB A;  1L6N A;  1BPX A;  1KFD A;  2XZU A;  2J6T A;  1IM4 A;  3F92 A;  3GV7 B;  3IHP A;  5KFM A;  3C23 A;  9ICL A;  4M6W A;  2XY6 A;  7ICI A;  3CNH A;  3GLG A;  1KLN A;  1NV8 A;  5EJC A;  3C1Z A;  1N5W A;  2E5S A;  8ICM A;  3KHL A;  2V1U A;  1GL6 A;  2KP7 A;  4I28 A;  3FE3 A;  2C22 A;  3TAD A;  1T3T A;  5DB9 A;  1L2D A;  1R2Y A;  2HHX A;  3F2D A;  2LM4 A;  3WKE A;  1SKR A;  4F3O A;  3C3E A;  5C0Y A;  2R4E A;  1NJF A;  2QKQ A;  2CEA A;  1DGJ A;  3LQQ A;  4JWN A;  4XUS A;  4K4G A;  3KKA A;  5JU5 A;  2HHU A;  2XGN A;  1HEK A;  1QQ5 A;  4KLI A;  4DF8 A;  1BPB A;  1SZH A;  4O3N A;  3RF9 A;  3G6Y A;  4EEY A;  1S76 D;  1IV8 A;  1YZ6 A;  2YQZ A;  5IIM A;  4UB5 A;  3QWL A;  1BPD A;  3GPU A;  3WK7 A;  4NSO B;  4Z6F A;  1TK5 A;  2J7N A;  5HP4 A;  2ASD A;  2LYH A;  4AZF A;  4IBK A;  2W11 A;  7ICG A;  1QQW A;  1KN5 A;  1UT8 A;  3QU7 A;  3BZK A;  5EP1 A;  9ICM A;  3HU2 A;  5J0S A;  3ZCB B;  2RLT A;  2GH1 A;  4Y2Y A;  1OFI A;  4LZJ A;  4EZ9 A;  5DKW A;  2R4J A;  5HHI A;  5ITY A;  4M6W B;  3RH4 A;  5IT9 S;  5KG0 A;  4FW9 A;  2LMR A;  3KZX A;  2R0I A;  4D82 A;  4DQP A;  9ICE A;  2W9B A;  3SHF A;  1QZE A;  2MUT B;  4LF5 M;  4P2H A;  2W3S A;  1NI3 A;  2HBK A;  2KKV A;  4DL4 A;  4JK1 A;  1OUQ A;  4Q8E A;  1VDD A;  4RZR A;  8ICE A;  1O08 A;  1YZ7 A;  2E3T A;  3M8R A;  1D0L A;  4GKK M;  4DSI A;  2DHR A;  4DV5 M;  1XC8 A;  3C2K A;  1E94 E;  3WK8 A;  5J8Y C;  5KPR A;  3RFW A;  1FJG M;  2PMZ C;  4MGH A;  2ZIX A;  4IS7 A;  5CA7 A;  4LFC M;  2KZU A;  1PGY A;  1XS9 D;  4Y2J A;  1Y88 A;  4G4Q A;  4F50 A;  1LKY A;  2KZM A;  1QUT A;  2RP5 A;  1QZM A;  4Y28 F;  2K47 A;  1L7N A;  3H4B A;  4QWA A;  4EEK A;  3HGI A;  3GLF E;  4TUS A;  2CRX A;  3V76 A;  1NK5 A;  2QHO B;  1A76 A;  2OOA A;  4DO9 A;  2HHW A;  2W3R A;  2LTU A;  2ZIW A;  2C96 A;  4NXM M;  4R7G A;  2DFL A;  9ICA A;  8ICC A;  2DI0 A;  2F4V M;  4Y2U A;  2WFA A;  4I29 A;  2HHT A;  2B3T A;  3UXO A;  1IN4 A;  1QLN A;  3MDA A;  1MQ3 A;  2YMQ A;  4AKG A;  5TZV A;  2IHN A;  2JMG A;  3D8B A;  2JUJ A;  4O3O A;  3D2S A;  2W9B B;  2HOF A;  5AM0 A;  3GRV A;  3QXG A;  4DWI A;  2LVA A;  4FS2 A;  1IIP A;  3SYK A;  3W0F A;  4DSF A;  4M9N A;  1JXE A;  4YD2 A;  4Y2X A;  2UVW A;  3A42 A;  2K89 A;  1PRB A;  2QSF X;  4IBG A;  4GMQ A;  2ZM6 M;  1XHB A;  4ELT A;  1KDH A;  2MRO B;  1TAU A;  1HJP A;  3FUX A;  5J0O A;  4G4N A;  1QQ6 A;  5ALY A;  4KLF A;  1ZD5 A;  2AGO A;  4O9M A;  5BOM A;  3EZ5 A;  3MC1 A;  2OQ4 A;  4KX3 A;  4NLG A;  3FRH A;  5ITR A;  1L8O A;  8ICN A;  3L26 A;  4MH0 E;  3M9M B;  1V9P A;  2HOI A;  4MGI E;  8ICA A;  1QTM A;  1NJY A;  1QH9 A;  1XXH A;  7ICV A;  2AHM A;  1G71 A;  1V97 A;  3SI8 A;  4JMU A;  5F3X B;  7ICS A;  3GPX A;  4DOB A;  4FBU A;  3A0B U;  1RYS A;  5DG8 A;  3RBD A;  2Q0Z X;  1NK0 A;  3FC4 A;  2XI9 A;  5DDM A;  5AI8 A;  5J8Y A;  4F4X A;  5E26 A;  9ICG A;  1VDL A;  4I2G A;  9ICU A;  1OFH A;  4KT0 F;  4QOS A;  4Z8X A;  2DWL A;  4CNQ A;  3PW0 A;  2BPC A;  2HMX A;  3TFR A;  4YR3 A;  2Z7J A;  4JV5 M;  2UXD M;  2WAQ F;  2GO7 A;  5ALT A;  3FAH A;  3BQ2 A;  1RYR A;  2QB1 A;  3T1Y M;  5AM3 A;  2CHV A;  3HPO A;  1J2M A;  2LHT A;  3ISC A;  3TAR A;  1NKC A;  4XBO A;  8ICV A;  1ZQI A;  4M2Y A;  5KPT A;  3KFU F;  1Z4O A;  1IY1 A;  1ARO P;  1ZOL A;  1RZT A;  4F4W A;  3TE6 A;  4UBB A;  3TKA A;  3T3F A;  1NHG C;  3PVS A;  4HLQ A;  5ALH A;  5KFU A;  2HOQ A;  7ICN A;  4F4Y A;  4P17 A;  1WHC A;  3FM9 A;  1COK A;  3J80 S;  3GLH A;  4DR2 M;  2D3D A;  1Q3C A;  2RDJ A;  4CJ6 A;  4G9B A;  5DQG A;  2BDU A;  1Q39 A;  4LRS A;  2ZIV A;  3WK5 A;  5DBC A;  4KLH A;  1ZRN A;  4DV0 M;  1GKI A;  2JZ0 A;  2WZJ A;  5AI9 A;  4UAY A;  4QWD A;  4C8M A;  4BXO A;  1S9F A;  5KAF U;  1A77 A;  4J9P A;  3VK7 A;  4EBE A;  4UN2 B;  2AGQ A;  2I5H A;  3F2C A;  2E1E A;  4K0K M;  2HI0 A;  2KIW A;  5GTH U;  1Z5C A;  2KJ8 A;  4Z6E A;  3CRX A;  4MFC A;  4I2C A;  3WKC A;  1L3V A;  2HL7 A;  3BQT A;  2Q2E B;  4J9N A;  4AW4 A;  3R9K A;  1E32 A;  4TUP A;  4DFJ A;  3C5F A;  7ICL A;  1UA1 A;  2RRU A;  4AQY M;  2YB1 A;  1X2I A;  1TAQ A;  1QUS A;  5EP3 A;  3RFA A;  2ZUC A;  5J2C A;  1ZQH A;  2C28 A;  3B74 A;  2AH5 A;  3NVV A;  2J6U A;  3E58 A;  4TQR A;  5L9X A;  2D6F C;  4Q44 A;  1VEK A;  4QZF A;  1L3S A;  2RQ5 A;  1KSF X;  2VF8 A;  4MHV A;  1HIW A;  5G5G A;  3U6Q A;  1WWU A;  4I2A A;  1D0K A;  4PPX A;  3KS4 A;  1ZXI A;  2R8G A;  4JI5 M;  3BZC A;  2PXI A;  4UAR A;  1ZQD A;  1PJT A;  2NRW A;  5KG7 A;  3EPG A;  4UW9 A;  5GKN A;  2EA0 A;  2ZTD A;  3LW5 F;  3U60 A;  2ZIV B;  3IHQ B;  2C98 A;  1C7Y A;  1NHW C;  3MBY A;  4W5W A;  1T4G A;  3EIE A;  3U26 A;  3FTC A;  3V6K A;  4BXO B;  2F2A B;  3V6J A;  1TF0 B;  2J7O A;  4NSR A;  3B7Z A;  1PJI A;  2K8A A;  8ICJ A;  1JXL A;  2XID A;  1S8O A;  4ZH4 A;  2JH7 A;  2VA3 A;  1KW4 A;  3U6S A;  4IQT A;  4GXK A;  4ECV A;  1VEG A;  3QYB A;  4NY8 A;  3EW9 A;  1U9L A;  1TDH A;  4UB4 A;  3QZ8 A;  4DQS A;  1D9F A;  1E9R A;  4C80 A;  4P4O A;  3QEB Z;  5CWR A;  1X6J A;  1R7R A;  5KFS A;  5HR7 A;  3PW7 A;  2K4I A;  2KNJ A;  5HHH A;  1H38 A;  2BCV A;  9ICN A;  1SV4 A;  4I4L A;  1OKS A;  4DLE A;  4Y2Q A;  1JUD A;  5KFQ A;  1G41 A;  1Q02 A;  3WKD A;  2PFN A;  5FTK A;  2K8B B;  5J2E A;  1HNX M;  2L4F A;  5B66 U;  4JI8 M;  2D7G A;  2ESE A;  4UBC A;  3CGW A;  3LMM A;  1Z00 B;  3GFK B;  4PL1 A;  2F8K A;  1UPH A;  2KNV A;  4OJ5 A;  2N35 A;  4IBF A;  4LJX A;  3A46 A;  2DL0 A;  2W54 A;  1SXJ C;  2ASL A;  4IRD A;  5KT7 A;  2HVH A;  1TGU A;  1XSN A;  2M60 A;  4BDP A;  4G4O A;  5KT4 A;  3PW4 A;  3CYM A;  2ZUB A;  1TH4 A;  4GC7 A;  1VJ5 A;  3GLI A;  1X9S A;  5AKX A;  2C2D A;  4OW0 A;  4PGQ A;  1ZET A;  2JXN A;  4G3O A;  4DV6 M;  3HP6 A;  4ITQ A;  4IIW A;  3GDX A;  3JPN A;  1JR3 A;  3PR4 A;  2N1R A;  3A98 B;  4M9H A;  5KFP A;  5KFY A;  1LVH A;  2QPA A;  3B0X A;  3TQS A;  3IV6 A;  4YD1 A;  1LV7 A;  4QZ9 A;  3QX7 A;  9ICP A;  5EXX A;  4B9N A;  3HX0 A;  1UHU A;  4CIZ A;  2JH1 A;  3M0E A;  5J0W A;  2LI6 A;  4F71 A;  2AQ4 A;  1ZD4 A;  4B08 A;  3JAM S;  1RQN A;  3THG A;  3FUV A;  4B7H A;  4PH5 A;  4Y2R A;  4EBC A;  3TAC B;  1D9D A;  1T43 A;  4R63 A;  2KDL A;  1ZQG A;  3DZD A;  1RPL A;  2I7N A;  1WWV A;  5BOL A;  2PI5 A;  3UXP A;  5EE3 A;  2R8K A;  2ZBK B;  2DKX A;  5DNY A;  4I2B A;  5A2Q S;  4IR9 A;  3BBZ A;  5T14 A;  1F44 A;  2KJ9 A;  2CN1 A;  2JEG A;  2G5G X;  3LVW A;  1Q46 A;  1B43 A;  4IBJ A;  4PHA A;  3RJF A;  2JY8 A;  2KFZ A;  5HMM A;  8ICZ A;  3M6K A;  4J9O A;  1NJZ A;  3M6A A;  3L28 A;  5KFF A;  3T5K A;  4ECX A;  7ICP A;  2KW0 A;  2VII A;  2QB0 A;  5KFE A;  1T3Q A;  3I4Y A;  3HKP A;  4ECY A;  1XC9 A;  1ZQV A;  1ZQR A;  4NL4 H;  2DPJ A;  3SR6 A;  4YR0 A;  4ANR A;  1ECW A;  5J2I A;  4JI6 M;  2DPI A;  1W5T A;  1JRP A;  5KG2 A;  5ALD A;  4ECQ A;  4QZC A;  1HQY E;  2CUZ A;  3QAU A;  1XWL A;  1OW5 A;  4RQM A;  3PNC A;  4NC6 A;  4J9L A;  3GLG E;  4L4U A;  4FS1 A;  1L3T A;  4RT3 A;  4CRX A;  4B9T A;  2L5Y A;  5DDY A;  4RUA A;  5BR8 M;  1NJW A;  3FTF A;  1B4F A;  3UZU A;  2KMD A;  1XNR M;  5L1K A;  4JI7 M;  4OD0 A;  4DCC A;  4OCZ A;  1GL7 A;  1Q3B A;  4NWI A;  5III A;  4EYH B;  1D8Y A;  8ICI A;  3HRD D;  1JB0 F;  3BQ0 A;  3ZDB A;  4MEY A;  1K82 A;  4F5O A;  4LCB A;  5DFL A;  3AKZ A;  3OSN A;  4CIS A;  5KG4 A;  4GHA A;  4IR1 A;  1N33 M;  4R64 A;  1Q3V A;  7CAT A;  2HW3 A;  4GEW A;  2QQ8 A;  4YMO A;  2HDO A;  4LZZ A;  4M47 A;  4WP2 A;  5ALX A;  4LJ7 A;  3VK8 A;  4UB8 U;  4AP9 A;  4YMN A;  1SWW A;  4FE3 A;  2R8J A;  3GQ4 A;  2LNH C;  4PZN A;  2QB0 B;  2W7P A;  1BPE A;  2HBM A;  3PV8 A;  2ASJ A;  2A1A A;  3CF2 A;  5AI4 A;  4DQI A;  4BBA A;  1A5T A;  2YN4 A;  5L8R F;  4A8E A;  2X49 A;  4LRT A;  4KMO B;  3GO8 A;  1KRP A;  3LCU A;  2BQR A;  1RG6 A;  1ZQZ A;  4WUR A;  1NO1 A;  1N5X A;  2O01 F;  3T38 A;  3SMS A;  2XSZ A;  4B6J A;  2ALZ A;  2JP7 A;  4RF1 A;  4F1I A;  4GXI A;  2BCQ A;  2UVR A;  3EYZ A;  5KL1 B;  4F2L A;  4DR1 M;  1SXJ B;  2I6X A;  4G4R A;  4KLS A;  4EBD A;  2YMP A;  3WK6 A;  3E4R A;  1S5L U;  3N7S C;  3QNM A;  3LWM A;  1IXR A;  4ED8 A;  5C18 A;  2NV3 A;  1PVQ A;  2NO5 A;  1ZQN A;  2UUA M;  4B9L A;  1PK3 A;  2VQE M;  2QZ4 A;  1K1S A;  3CP8 A;  5AKJ A;  3TAN A;  3I28 A;  2L6O A;  3QEA Z;  1AQ6 A;  4KLL A;  3TFS A;  3IN5 A;  4DOC A;  2QNJ A;  2JZ1 A;  2YTU A;  1Z1V A;  4RQ6 A;  3RBE A;  2WF6 A;  4P0Q A;  1KKX A;  3UMG A;  3KZI U;  4UB1 A;  2KRU A;  4KLG A;  2PI4 A;  2H3Z A;  1N77 A;  3DFZ A;  1OAI A;  2DZN B;  2KE7 A;  4M9X A;  4DLG A;  4IJE A;  1ZQY A;  1QYR A;  1FFV A;  5AK5 A;  3KXE C;  4KHP M;  1R6B X;  2DZO B;  8ICW A;  1VG5 A;  9ICR A;  3C3D A;  1UCV A;  4IBC A;  3SMP A;  4F5R A;  3T5J A;  4FBT A;  3EWA A;  2BCS A;  2ES6 A;  3ZD8 A;  4LVS A;  2EZY A;  2G5H B;  3MAB A;  3QU9 A;  1V33 A;  3ZD9 A;  2HVI A;  3KDS E;  2LYB A;  1J97 A;  2G3Q A;  4NRV A;  4J9M A;  1UM8 A;  2KIC A;  2QP9 X;  4QW9 A;  4MF2 A;  3IEC A;  5EP2 A;  3HY5 A;  1IN7 A;  4TUW A;  4B3R M;  2XO7 A;  1WIV A;  2LH0 A;  3VLF B;  5L1L A;  3UQ0 A;  3FD9 A;  1NK4 A;  3S6J A;  2XSZ D;  4F5Q A;  1URJ A;  2C2R A;  4XA5 A;  4ECS A;  3AMZ A;  5D4B A;  4NXN M;  2H5X A;  1A6S A;  5AI6 A;  2V9W A;  3J2P B;  3G6V A;  3HU3 A;  2WB1 C;  3QU2 A;  4LJ4 A;  4DR4 M;  1EXN A;  3PY8 A;  3NBI A;  3K1R B;  2AGP A;  3AV0 A;  3K2L A;  2PKE A;  2WB1 F;  2Y1I A;  1WCN A;  3AU6 A;  8ICF A;  4C7Z A;  4C8N A;  2P5T A;  2MUT A;  4RU9 A;  3KHG A;  2MAX A;  2WTF A;  2F5P A;  3C2M A;  4LZD A;  4DR5 M;  4Y2S A;  3UMB A;  1QSL A;  4P0Q B;  4C4R A;  2ATL A;  2ZTC A;  3MFI A;  3W67 A;  3SD7 A;  1WXQ A;  3HWS A;  4B7G A;  4KN7 A;  1MU5 A;  3ONN A;  5ALE A;  3GQ5 A;  3FKE A;  3KBB A;  1XXH E;  2H3F A;  1XNS A;  4P0P B;  2C5R A;  4PHD A;  5C5J A;  5EWF A;  5FTJ A;  1IFY A;  1DGB A;  1TH2 A;  5HNK A;  3T5H A;  2NYV A;  4UB3 A;  4C0Z A;  3JPR A;  4C7Y A;  3VDP A;  3J81 S;  5K4L A;  4B9V A;  2KEB A;  5AKL A;  4JYA M;  3U6M A;  2QCU A;  1Z59 A;  3ILK A;  2X8A A;  5KFX A;  3AQE A;  1L8L A;  1ZQE A;  5A0L A;  5ALK A;  4PCZ A;  3RB6 A;  2JGA A;  2LYA A;  5DQI A;  2P6R A;  1TH3 A;  3UJN A;  2NO4 A;  1BNP A;  3U6L A;  3CF0 A;  3PFI A;  2OCE A;  3D2N A;  4OX9 M;  2CHQ A;  3HIL A;  1ZMV A;  5KFB A;  4C8O A;  1CEZ A;  7ICE A;  1V38 A;  4D81 A;  1L1Z A;  3MMP A;  2LM1 A;  2HHH M;  5J2D A;  4JB3 A;  1J5E M;  5L1J A;  3ICX A;  3B0Y A;  4EEN A;  5AKI A;  4M9G A;  4O3S A;  3A0H U;  2R8H A;  4CF5 A;  1F4I A;  4PDG A;  1DOQ A;  1ZYQ A;  3L29 A;  4AG6 A;  2O25 A;  3F5E A;  2BZF A;  1QDT A;  3AL0 C;  3GIM A;  1XO0 A;  1YSY A;  1K5O A;  1I4W A;  3GLH E;  1L2B A;  2IMW P;  3VC8 A;  4RQN A;  5IIK A;  1MN8 A;  1NSF A;  4NJ8 A;  3PSI A;  5KFW A;  4UAV A;  9ICW A;  5KFT A;  4M0D A;  1T3N A;  2M0N A;  2JY5 A;  4DL5 A;  3AEV A;  4X65 M;  4ECW A;  4DV1 M;  2K8C B;  4ED7 A;  4PGY A;  1L7M A;  5KFD A;  3DV9 A;  1GVN A;  4DV7 M;  1QCK A;  4UAW A;  2OHF A;  2PMZ F;  4GC6 A;  1ZQW A;  1GAB A;  1D0M A;  7ICK A;  2K6B A;  5ITU A;  4X66 M;  1HT1 E;  3MJ5 A;  1ZQJ A;  4DFD A;  5ALO A;  3AOE C;  1TV9 A;  2B0C A;  5AM5 A;  3NUQ A;  1JMS A;  4I2I A;  1BVS A;  5KG6 A;  5JI2 E;  1N62 A;  4L78 A;  2DUY A;  3HKZ C;  1QSY A;  2Z4R A;  4GC5 A;  2R45 A;  1X66 A;  1OIZ A;  8ICY A;  1ZQ9 A;  3HZJ A;  4DFM A;  4LJ6 A;  4I2J A;  4MFF A;  3H0M B;  4F72 A;  2FLN A;  4R3D A;  4B9U A;  2EAN A;  3H40 A;  4M9J A;  2CP8 A;  2G8L A;  2XEP A;  3E46 A;  2XGP A;  1G4A E;  4AG5 A;  3IG8 A;  3HX3 A;  4QWC A;  1NKB A;  5FP0 A;  5CP2 A;  1NZB A;  3AOG A;  1F0M A;  1CUK A;  2W8L A;  4RQ5 A;  2R44 A;  3KOZ E;  5LMU M;  4F4K A;  4QNM A;  3B7Q A;  2QEN A;  3ZDC A;  2K0B X;  2KJ5 A;  3C2L A;  1D2N A;  2ZAM A;  2BKE A;  4CGY B;  2RHF A;  3ALR A;  4KLN A;  1SIJ A;  4PZO A;  5AIA A;  4NXZ A;  3RJJ A;  3HHW A;  4QHS A;  2VKQ A;  3K1J A;  2ZAO A;  1DGF A;  4JXJ A;  4ELU A;  1Z1B A;  4R8U A;  4P16 A;  2WF9 A;  4AKI A;  5ALS A;  3JPP A;  2EZZ A;  1PJS A;  5KTQ A;  1ZQ1 C;  4BUG A;  1S0M A;  2IOH A;  2OXO A;  3H4D A;  5HR6 A;  3A45 A;  2L09 A;  3PSP A;  2F77 X;  5DBB A;  5EXT A;  2XVT A;  4UAS A;  1U45 A;  2EO2 A;  3Q8K A;  4YXM A;  2DAE A;  3GQ3 A;  4PT5 A;  5AM1 A;  2DAI A;  9ICV A;  2K9D A;  1JX4 A;  3U6C A;  3V7L A;  3E21 A;  2E8M A;  3M1Y A;  3SHG B;  3LYS A;  4RQ0 A;  3SAG A;  5KT5 A;  4CGZ A;  4Z6C A;  3EUB 2;  5ALR A;  1SB3 C;  2HWJ A;  2GQF A;  1WG8 A;  1XU4 A;  3PX4 A;  2QLT A;  1AIP C;  5AIC A;  3AOE A;  3GLI E;  2RDI A;  2KVS A;  2KZZ A;  4LF8 M;  4REZ A;  3U6E A;  2XY7 A;  1N78 A;  2YMM A;  5KFI A;  4ELV A;  3NWL A;  3RR7 A;  5J0Y A;  4IQU A;  1JR3 E;  3WHK A;  4C4T A;  4M0A A;  3D6J A;  1OTR A;  2PFO A;  3IDW A;  2BWE A;  2IOF K;  5F9N A;  7ICJ A;  3RAQ A;  8ICR A;  5EE1 A;  4QZB A;  3Q8M A;  2FLL A;  3E2E A;  4GHL A;  5KQD A;  2DXI A;  4S12 A;  2F3N A;  1ZQC A;  3K92 A;  2DEN A;  4R8U B;  3QUT A;  1UA0 A;  1UQV A;  1SGG A;  2DKZ A;  3Q8P B;  3AL0 B;  2ODG A;  4JI1 M;  2BJV A;  4L8R C;  4DQQ A;  3UMM A;  4PDI A;  3QE9 Y;  2QBY B;  4K4H A;  4RKU F;  9ICH A;  3C28 A;  2OYY A;  4Z6D A;  2Y9U A;  2EQY A;  4EIW A;  2GNO A;  2W8K A;  8ICH A;  3TPZ A;  4I2H A;  4EEL A;  4J9Q A;  3H8S A;  1DK2 A;  1TK8 A;  3NAS A;  5EXS A;  2WSC F;  3FUT A;  1L5U A;  1SXD A;  5JTI A;  2Z8Y M;  2PFP A;  4B9M A;  3SAU A;  1QAO A;  3O0F A;  3ZDD A;  3RGS A;  5KG5 A;  1ZQO A;  2E8O A;  3SAR A;  2K4P A;  4F4Z A;  3CW2 C;  3D2Q A;  2FE9 A;  2A19 A;  4UAZ A;  1Z00 A;  2ZJ5 A;  5EE0 A;  1GJT A;  1P7D A;  4UB6 U;  4BX9 C;  1EE8 A;  4OJP A;  3DA1 A;  4MGK E;  4FD2 A;  3ZDE A;  2AU0 A;  1N34 M;  1S0N A;  2JEF A;  3SQI A;  1IN5 A;  4P4P A;  3TAP A;  2EUC A;  3K4G A;  5ALW A;  4U6P A;  2DWM A;  4LF7 M;  5J0R A;  1NY5 A;  2L7I A;  4M0W A;  4Z6Y A;  5ALU A;  1PZN A;  1LTM A;  4F91 B;  3I04 M;  1VDV A;  2KG5 A;  2A5Y B;  4J9S A;  3PVX A;  4RQ3 A;  2OH2 A;  1ZQP A;  1SKS A;  3MGV A;  3NVZ A;  3T15 A;  2EAP A;  2LPE A;  1X37 A;  4ECU A;  9ICC A;  4NLZ A;  3GPY A;  1KFV A;  1ZQF A;  1SKW A;  3LWL A;  1IM2 A;  1YLA A;  5G5H A;  5AKE A;  5KFJ A;  2UUB M;  4JV1 A;  1NV9 A;  1NK6 A;  3TQ1 A;  3LQR A;  1HT2 E;  4DBG B;  2BR0 A;  9ICS A;  1OXJ A;  4F92 B;  4RNO A;  4LJ8 A;  2XC9 A;  3MR5 A;  1WJ7 A;  1TAM A;  2BDP A;  5KNI A;  3HWT A;  1NVM A;  3RB3 A;  4JI4 M;  2W03 A;  4L16 A;  5CHG A;  4BWM A;  2I1Q A;  3VKH A;  4DFP A;  2J6S A;  2LVQ D;  1FIQ A;  4YQW A;  1DGH B;  5C1B A;  1A0P A;  3Q8S B;  2G06 A;  1VQ1 A;  3HJE A;  3BS5 A;  4DR7 M;  3Q8G A;  1IBK M;  4AYB C;  4DEZ A;  3J27 B;  2DWQ A;  4JWM A;  3H0R B;  3KHH A;  1KBU A;  3E9S A;  3HHY A;  4QJF B;  3HHX A;  4KLD A;  1S97 A;  4AYB F;  3MR3 A;  3EIH A;  2BCU A;  1GJS A;  2C2E A;  3KP1 E;  3RJK A;  4K4I A;  2KKP A;  3FYD A;  5DQH A;  1G8P A;  2XF3 A;  1X42 A;  4CF3 A;  1E9S A;  1IBM M;  1FEZ A;  4KLQ A;  1DO2 A;  1ZD3 A;  3W0L B;  3H8M A;  4B9S A;  2AXT U;  1ZQA A;  2BWB A;  1XWI A;  4F93 B;  2KHH A;  4F8R A;  4YR2 A;  1PK1 B;  3VKG A;  2UVU A;  8ICG A;  3CTW B;  1ZAE A;  2CV2 A;  5J2A A;  2UVV A;  3ZI4 A;  3WKA A;  3RR8 A;  1MSW D;  2V4Q A;  3PW2 A;  4RQ1 A;  3SBJ A;  1L7P A;  1ZMW A;  3RJE A;  1QQ7 A;  4PGX A;  3JPT A;  3TAQ A;  4I2E A;  1WGL A;  4YHH M;  4DFK A;  4DL6 A;  1UFZ A;  1L3U A;  4NM2 A;  1OAO C;  5KFC A;  2ZUD A;  2XCA A;  8ICS A;  3Q8L A;  5JRT A;  5L1I A;  3DOA A;  3FYH A;  3BS5 B;  2CFO A;  3L4P A;  4YN4 A;  1HUO A;  2F1H A;  4KIT B;  1IXZ A;  2KSO B;  1WYG A;  2KNA A;  4C4S A;  4YG2 A;  1ZD2 P;  8CAT A;  1CRX A;  4TQS A;  4KLT A;  3IM1 A;  1XNQ M;  1JR3 D;  1P3Q Q;  3M6Z A;  3ISB A;  3C9P A;  4IBE A;  4B3S M;  1Z19 A;  4OJ6 A;  2JEI A;  3THV A;  4MM3 B;  3N7R C;  1JQJ C;  3H4J A;  4X62 M;  1OQY A;  1NK9 A;  5AK4 A;  3TI0 A;  2KZ3 A;  4G6Z A;  2KTQ A;  2GLE A;  2JR5 A;  2R46 A;  1MA7 A;  3KSX A;  2CPR A;  1U47 A;  5J2J A;  2VJ4 A;  2LHG A;  2LXE A;  1SXJ A;  9ICO A;  4NRW A;  4DS5 A;  2WF7 A;  1G59 A;  2YNM D;  2JWS A;  4QOZ C;  3RRG A;  4DF4 A;  3KD3 A;  3WK4 A;  2XH9 A;  4DV3 M;  5LMN M;  4QZ8 A;  2FS1 A;  1ZQL A;  1QVR A;  2LBC A;  2H3I A;  3K9O A;  4Q43 A;  4KO8 A;  4JN6 A;  2MA1 A;  3SV4 A;  2W9C A;  1S0O A;  5J2K A;  3JR5 A;  1SL0 A;  4RNM A;  3OJS A;  4DL3 A;  5KO3 A;  4DR6 M;  1TTE A;  4DQR A;  1MJG M;  3GRY A;  1S3S A;  3V6H A;  3OHA A;  3N97 B;  3AQF A;  1JI7 A;  1ED1 A;  4ZPX A;  4NLK A;  4BB9 A;  1R5L A;  4KTQ A;  2KN7 A;  2B21 A;  2DAK A;  4OVZ A;  3ZQJ A;  1KQQ A;  3VFD A;  3ORY A;  4ACO A;  3IRU A;  5AM4 A;  4UB2 A;  2FFJ A;  3SAV A;  7ICT A;  4MB7 A;  4P4M A;  4FWG A;  3SAW A;  4QZD A;  3GPP A;  4R65 A;  3UM9 A;  5J0Q A;  1BNO A;  2Y9T A;  2XIC A;  2ZJA A;  3SMV A;  4RT2 A;  2ERC A;  1KFS A;  3I01 M;  4M04 A;  3UPQ A;  2LBO A;  3N4M B;  1SXE A;  1BPZ A;  2NRV A;  5GTI U;  3ZH9 B;  2E8N A;  2MRL A;  3GU3 A;  3PX0 A;  2CV0 A;  1JRO A;  1SXJ D;  3FRI A;  3KOO A;  3LVV A;  1LV5 A;  3UGJ A;  3PO5 A;  5KG3 A;  3LK9 A;  4RNN A;  1U48 A;  5H2F U;  2F76 X;  5DB8 A;  3ZDA A;  2YX8 A;  7ICR A;  3FUW A;  3E0F A;  1TE2 A;  2F5S A;  1N61 A;  1SZP A;  1N36 M;  1HR0 M;  3QUB A;  2W9C B;  2W82 A;  4GH9 A;  1GO5 A;  2C99 A;  2F1J A;  2LKY A;  5KFV A;  3RH5 A;  2KVC A;  2G5I B;  2OPF A;  2F44 A;  3HW8 A;  2FMP A;  4O0I A;  2G0A A;  5AKH A;  3TWK A;  2E1F A;  3Q8X A;  2K60 A;  2VAN A;  3RJG A;  4OVZ B;  4P0P A;  1JIH A;  5AI0 A;  4LJ5 A;  5KFO A;  3IG5 A;  1IBL M;  5BPC A;  1IY2 A;  3GRR A;  2G08 A;  3B7N A;  4NM1 A;  3BQ7 A;  3U6O A;  3K9P A;  2MSN A;  3U6D A;  4DL7 A;  4WW0 A;  3RJI A;  4ED1 A;  3K1Z A;  4L15 A;  2DNA A;  3UK6 A;  1FFU A;  1SV0 C;  1TKD A;  2CE7 A;  1ZQX A;  2DWN A;  2HSZ A;  4DL2 A;  1RYU A;  4QZI A;  2MJ5 B;  2BCR A;  5ITQ A;  2W7O A;  4X64 M;  1D8L A;  2M9N A;  3H7I A;  5AKG A;  2JV3 A;  2Y0T A;  2LHC A;  2WSF F;  3NRZ A;  3T6P A;  5DB7 A;  1ORY B;  5EQT A;  3AN1 A;  4RNA A;  2WSE F;  1RM6 C;  3I1Y A;  3SEI A;  4KLE A;  3PMN A;  5ALJ A;  4DOA A;  2O5R A;  2LWX A;  1Y8G A;  2KXE A;  1O03 A;  1Q8K A;  2W9A A;  5ALF A;  4YVZ A;  5KG1 A;  1DXS A;  5ITX A;  3KFU G;  2JZB B;  3KTQ A;  5J0T A;  3QU5 A;  2YB4 A;  2P6U A;  5KFG A;  1NZP A;  1ZJM A;  5KT2 A;  2Y0Q A;  3GQC A;  3GRU A;  2XCP A;  5L1M A;  2BGW A;  5KAI U;  4O3M A;  2KD1 A;  3GIL A;  4NLB A;  5FTM A;  4MGZ E;  3Q8Q B;  1IQP A;  4HAI A;  2KV2 A;  3OTO M;  1PVR A;  2HBL A;  4IQV A;  5EWE A;  1OJL A;  4EX7 A;  2XY5 A;  4RPX A;  3LCV B;  2O6K A;  4R66 A;  3MGH A;  3PX6 A;  1X9W A;  3WU2 U;  4IC9 A;  2YML A;  2AJQ A;  4IQW A;  2OM6 A;  2F5O A;  4ECZ A;  1MN3 A;  3HJS A;  2ZIU A;  4ED3 A;  2OOB A;  2LVN C;  3HHZ A;  5KFZ A;  4ED2 A;  4ED6 A;  2L4E A;  2IBK A;  2XGQ A;  1T7P A;  4LF4 M;  1XO1 A;  1DGS A;  4GLX A;  4LFA M;  3KSJ A;  2IA6 A;  3V7K A;  3L3F X;  2RRD A;  3FYC A;  1KFT A;  2UUC M;  2GOL A;  4OJO A;  5IZ7 D;  1XB2 B;  1TK0 A;  3GLG B;  1SV0 A;  2R62 A;  3H8W A;  4F5N A;  1X6I A;  4GXJ A;  4F2R A;  4JI0 M;  2FE8 A;  3OGU A;  1NK7 A;  7ICH A;  3GP1 A;  5EWG A;  1L2C A;  5KT3 A;  4CE6 A;  3BS7 A;  4OJL A;  3PNV A;  1V34 A;  1UT5 A;  2KA6 B;  1RQL A;  4BJQ A;  2VDB B;  1KYI A;  4AKH A;  4QZE A;  2W04 A;  2BQ3 A;  2BHN A;  3WK9 A;  3HJQ A;  4M9L A;  1X9X A;  1U49 A;  3KOY E;  3U5Z A;  1WUD A;  2EKK A;  2Z4S A;  1JN3 A;  5FLX S;  4DUZ M;  2CHG A;  1Z5A A;  2JNH A;  4QZH A;  4QZG A;  3HKZ F;  2FDR A;  4KN4 A;  2ZIU B;  3ED5 A;  3HT3 A;  1EFU B;  4GRI A;  3F5A A;  1H6U A;  5J2B A;  5AM2 A;  2XLJ A;  2JXJ A;  1QAQ A;  5E79 U;  2AHO B;  2VQF M;  4DV4 M;  5J2H A;  2BJW A;  1N32 M; 
#chains in the Genus database with same CATH homology
 3I4Y A;  3HKP A;  5DYI A;  4D80 A;  1YE9 A;  4FZL A;  3DA1 A;  4MGK E;  4NL4 H;  4OJP A;  4FD2 A;  1IY0 A;  5HR7 A;  1TDZ A;  3CF6 E;  2ZG6 A;  1N34 M;  3SAT A;  5FSW A;  1ECW A;  4JI6 M;  1FNN A;  1W5T A;  3SQI A;  4MGY E;  2Z3X A;  1IN5 A;  4DUY M;  2G07 A;  1HQY E;  2CUZ A;  4LF6 M;  2EUC A;  3QAU A;  1L6N A;  2XZU A;  2UU9 M;  2KHV A;  4U6P A;  2DWM A;  4LF7 M;  1NY5 A;  2L7I A;  4M0W A;  4Z6Y A;  4FZM A;  3TWL A;  1T94 A;  3HU1 A;  4L4U A;  2H3Q A;  2FNA A;  3SFZ A;  2HBJ A;  4CRX A;  3GLG A;  5EJC A;  2YR0 A;  4QHT A;  2E5S A;  5BR8 M;  3FTF A;  2A5Y B;  3UZU A;  1XNR M;  2V1U A;  1GL6 A;  4JI7 M;  2OH2 A;  2K4E A;  3MGV A;  1T3T A;  4IBD A;  1W5S A;  1L2D A;  3T15 A;  1GL7 A;  1R2Y A;  1Q3B A;  4NWI A;  1X37 A;  3F2D A;  3GPY A;  2G09 A;  4KOD A;  1KFV A;  4PL2 A;  2R4E A;  5C0Y A;  1NJF A;  1IM2 A;  2CEA A;  2ZIX B;  3LQQ A;  1K82 A;  4LCB A;  3U5Z B;  1YUB A;  3AKZ A;  2XGN A;  4FCV A;  2QBY A;  4CIS A;  4GHA A;  1HEK A;  1N33 M;  2UUB M;  1Z5B A;  1Q3V A;  1SZH A;  7CAT A;  3RF9 A;  4QNL A;  3LQR A;  1HT2 E;  2YQZ A;  4LZZ A;  4LJ8 A;  1HNW M;  4QNR A;  3QWL A;  1TAM A;  4LJ7 A;  5KQ8 A;  2KEY A;  4GIT A;  3VK8 A;  1NVM A;  3GPU A;  4NSO B;  4I81 A;  4JI4 M;  4L16 A;  3FTE A;  2DQN B;  2J7N A;  3GQ4 A;  2LNH C;  2W03 A;  4FE3 A;  3VKH A;  4LJ9 A;  2W7P A;  4AZF A;  2ZIW B;  4IBK A;  3K8Z A;  2HBM A;  4FCW A;  4FWH A;  1DGH B;  1QQW A;  3CF2 A;  5C1B A;  1A0P A;  2Q4T A;  4II7 A;  2KHQ A;  2HKJ A;  1HNZ M;  4BBA A;  2G06 A;  1HQC A;  5EP1 A;  2WAQ C;  4RF0 A;  4A8E A;  3F53 A;  2X49 A;  4LRT A;  4A3V B;  3HU2 A;  4KMO B;  3ZCB B;  3GO8 A;  4DR7 M;  5KPZ A;  1R2Z A;  4WUR A;  2GH1 A;  1OFI A;  1IBK M;  4LZJ A;  4AYB C;  3T38 A;  3SMS A;  1MX0 A;  3J27 B;  2XSZ A;  2R4J A;  4I8O A;  2KZS A;  4RF1 A;  5ITY A;  2E5L M;  3H0R B;  1KBU A;  5IT9 S;  3E9S A;  3HHY A;  4QJF B;  5KL1 B;  3HHX A;  5IRE B;  3J7A S;  4FW9 A;  4DR1 M;  3KZX A;  4AYB F;  3EIH A;  4D82 A;  1SXJ B;  3L25 A;  4G4R A;  3KP1 E;  2KKP A;  3FYD A;  3KW6 A;  1G8P A;  2XF3 A;  3E4R A;  3N7S C;  3OPX A;  1E9S A;  3SHF A;  1IBM M;  4FZN A;  1PVQ A;  5C18 A;  2UXC M;  4LF5 M;  2NV3 A;  1DO2 A;  1NJG A;  2UUA M;  3W0L B;  1Q3U A;  2HBK A;  2VQE M;  3ZC7 B;  3H4M A;  2KKV A;  2QZ4 A;  3CP8 A;  1OUQ A;  2ZXI A;  1VDD A;  1XWI A;  4GKK M;  2DHR A;  2L6O A;  4DV5 M;  1XC8 A;  3IN5 A;  3NRW A;  1E94 E;  3VKG A;  5KPR A;  3RFW A;  3PNY A;  1FJG M;  2PMZ C;  3CTW B;  1ZAE A;  4MGH A;  2CV2 A;  2ZIX A;  4P0Q A;  2JA2 A;  2KRU A;  4LFC M;  2KZU A;  2H3Z A;  1N77 A;  4G4Q A;  3DFZ A;  2DVW B;  2DZN B;  4AI6 A;  4M9X A;  3SBJ A;  4IJE A;  2RP5 A;  1QYR A;  1QZM A;  1XXH B;  3KXE C;  2K47 A;  1R6B X;  2DZO B;  4KHP M;  3M7D A;  4IBC A;  3HGI A;  3SMP A;  1DO0 A;  4YHH M;  1G3I A;  3PZP A;  4CHT B;  2CRX A;  2V1C A;  3GLF A;  2G5H B;  3I4V A;  2Y20 A;  3KDS E;  2LYB A;  1QAM A;  3DOA A;  4NRV A;  4GKJ M;  1UM8 A;  2CFO A;  3FUU A;  2KIC A;  2QP9 X;  2ZIW A;  5EP2 A;  2C96 A;  1IXZ A;  1IN7 A;  4TUW A;  1DGH A;  4B3R M;  3VLF B;  2LH0 A;  4LY6 A;  4R7G A;  4NXM M;  3FD9 A;  8CAT A;  1L1T A;  1CRX A;  2XSZ D;  2BNK A;  3L2A A;  1XNQ M;  1URJ A;  4OO1 J;  1JR3 D;  3M6Z A;  4NXN M;  2F4V M;  1A6S A;  4B3S M;  4IBE A;  1Z19 A;  4OJ6 A;  4MM3 B;  3N7R C;  3J2P B;  1JQJ C;  4X62 M;  1IN4 A;  3HU3 A;  2WB1 C;  4LJ4 A;  4BLC A;  4AKG A;  4G6Z A;  3AJI B;  2JMG A;  4DR4 M;  3D8B A;  2R46 A;  2VJ5 A;  1MA7 A;  3D2S A;  3NBI A;  3KSX A;  4DV2 M;  2CPR A;  1SXJ E;  2HOF A;  3H0L B;  3GRV A;  3AV0 A;  3K2L A;  2VJ4 A;  2LXE A;  1SXJ A;  2YFQ A;  2WB1 F;  4NRW A;  1IIP A;  1DRG A;  3SYK A;  3W0F A;  3SAH A;  1G59 A;  2YNM D;  4QOZ C;  4GFJ A;  2P5T A;  3A42 A;  2K89 A;  4IBG A;  3GLH B;  4GMQ A;  2ZM6 M;  2XH9 A;  4DV3 M;  5LMN M;  1XHB A;  2F5P A;  1K3X A;  4DR5 M;  4P0Q B;  3FUX A;  1NY6 A;  3U61 A;  1QVR A;  4G4N A;  4JI3 M;  2H3I A;  4B3M M;  3KVW A;  3JR4 A;  1WXQ A;  4JN6 A;  3HWS A;  4KO8 A;  2MA1 A;  3DEE A;  4B7G A;  1MU5 A;  3ONN A;  3JR5 A;  2F5Q A;  3GQ5 A;  3VCB A;  5KO3 A;  3FKE A;  2OQ4 A;  4DR6 M;  4KX3 A;  4KX5 A;  3I51 A;  3GRY A;  5ITR A;  1S3S A;  3RGP A;  3L26 A;  4MH0 E;  2H3F A;  3AQF A;  1XNS A;  2HOI A;  4MGI E;  2C5R A;  3GLF B;  4P0P B;  5FTJ A;  1DGB A;  2VIX A;  1TH2 A;  1XXH A;  4NOO B;  4ICA A;  2AHM A;  4ZPX A;  1L8Q A;  1ED1 A;  4C0Z A;  3R8F A;  3VDP A;  4BB9 A;  3J7B A;  3GPX A;  4JMU A;  3J81 S;  2KEB A;  4JYA M;  3U6M A;  4OVZ A;  2QCU A;  3ILK A;  1Z59 A;  4I5S A;  2V6Z M;  3VFD A;  2XI9 A;  2X8A A;  4ACO A;  1DGG A;  1I94 M;  2Y0S C;  3AQE A;  2FFJ A;  3BOS A;  3SYL A;  3TL4 X;  5E26 A;  3SAV A;  4MB7 A;  5FTL A;  4FWG A;  3SAW A;  5A0L A;  4PCZ A;  2XFT A;  3GPP A;  3VDU A;  2JGA A;  2LYA A;  1OFH A;  4Z8X A;  4QOS A;  1TH3 A;  3UJN A;  2DWL A;  2XIC A;  3FTD A;  3U6L A;  1D8B A;  3SMV A;  2HMX A;  3CF0 A;  3PFI A;  2ERC A;  3D2N A;  3N7P D;  4OX9 M;  2Y0S F;  2CHQ A;  2Z7J A;  4JV5 M;  2UXD M;  2WAQ F;  2LBO A;  4D81 A;  1L1Z A;  1GO3 F;  2HHH M;  2RKO A;  3T1Y M;  2CHV A;  3ZH9 B;  2LHT A;  1J5E M;  2MRL A;  2ZAN A;  5EXP A;  1YT3 A;  4XBO A;  3GU3 A;  1XMO M;  2CV0 A;  3ICX A;  1SXJ D;  3F2B A;  4LGY A;  5KPT A;  3LVV A;  3KFU F;  3MHV C;  1IY1 A;  2RGH A;  3UGJ A;  3SAF A;  4PDG A;  5JI3 E;  3TE6 A;  5IWA M;  3L29 A;  3U6P A;  4AG6 A;  1NHG C;  3PVS A;  4HLQ A;  2F76 X;  3F5E A;  3HJ8 A;  3AL0 C;  2HOQ A;  2YX8 A;  1XO0 A;  2K4H A;  1YSY A;  3FUW A;  1I4W A;  3U61 B;  5ITT A;  1L2B A;  3E0F A;  3VC8 A;  2F5S A;  3U60 B;  3J80 S;  1NSF A;  3GLH A;  4DR2 M;  3PSI A;  1N36 M;  4M0D A;  1HR0 M;  1PVR A;  2M0N A;  1IN6 A;  2KOB A;  1Q3C A;  2W82 A;  2HCB A;  4GH9 A;  2C99 A;  2LKY A;  5F3W A;  4X65 M;  2BDU A;  1Q39 A;  4LRS A;  4GIP A;  4DV1 M;  2ZIV A;  2K8C B;  3AFH A;  3L27 A;  2KVC A;  4DV0 M;  2G5I B;  1GKI A;  2OPF A;  1GVN A;  4DV7 M;  3R9X B;  4IJF A;  3GZF A;  2RGO A;  3SAS A;  2PMZ F;  1K3W A;  3T79 A;  2G0A A;  3TWK A;  2E1F A;  3Q8X A;  5H37 D;  4M9Z A;  2H1R A;  5ITU A;  3VK7 A;  4P0P A;  4OVZ B;  4X66 M;  3F2C A;  1HT1 E;  2E1E A;  4WJ3 B;  4K0K M;  2KIW A;  4LJ5 A;  3MJ5 A;  1Z5C A;  2KJ8 A;  3CRX A;  3IG5 A;  3AOE C;  1IBL M;  1IY2 A;  3NUQ A;  3GRR A;  2G08 A;  4HL4 A;  2HL7 A;  3TWM A;  2Q2E B;  5JI2 E;  4AW4 A;  4L78 A;  3HKZ C;  3U6O A;  1E32 A;  2Z4R A;  4GC5 A;  2R45 A;  3U6D A;  2C9C A;  4QIW C;  4B3T M;  4WW0 A;  1ZQ9 A;  3RE8 A;  4AQY M;  3MK6 A;  4LJ6 A;  1NNU C;  2YB1 A;  1J09 A;  3K1Z A;  4L15 A;  2D7H A;  3UK6 A;  3H0M B;  5EP3 A;  4NLC A;  3RFA A;  4R3D A;  2CE7 A;  2DWN A;  2L7H A;  4QIW F;  2G8L A;  5ITQ A;  2XEP A;  3D8L A;  2W7O A;  2FOI C;  2D6F C;  4X64 M;  1G4A E;  3PXG A;  4AG5 A;  3IG8 A;  1IXR C;  3GLI B;  2CV1 A;  2ZXH A;  1NZB A;  2R65 A;  3AOG A;  4LF9 M;  2Y0T A;  1KSF X;  4FCT A;  2XZF A;  1ORY B;  4GC9 A;  3KOZ E;  5EQT A;  5LMU M;  4RNA A;  3U6Q A;  1HIW A;  4QNM A;  4B7F A;  3KS4 A;  2KRK A;  2QEN A;  4JI5 M;  2O5R A;  2KJ5 A;  2LWX A;  2KXE A;  3M7G A;  3T1H M;  4IBB A;  5GKN A;  2EA0 A;  1D2N A;  4LG2 A;  3U60 A;  2ZIV B;  2ZAM A;  5ITX E;  4CGY B;  2RHF A;  3ALR A;  4KLN A;  4LGM A;  2C98 A;  1NHW C;  3HHW A;  4QHS A;  5ITX A;  3KFU G;  4W5W A;  2VKQ A;  3K1J A;  2F5N A;  2ZAO A;  3EIE A;  3FTC A;  1DGF A;  2I7P A;  2F2A B;  5E6J A;  2YB4 A;  4JXJ A;  1PVP A;  3IP4 B;  1Z1B A;  2J7O A;  2X4A A;  4NSR A;  2K8A A;  1PJI A;  2XID A;  2Y0Q A;  4P16 A;  4U7C A;  1Z6T A;  2JH7 A;  3GRU A;  3U6S A;  4AKI A;  3KOX E;  4O3M A;  2KD1 A;  4NLB A;  1ZQ1 C;  5FTM A;  5FTN A;  4BUG A;  1TDH A;  4MGZ E;  1IQP A;  1E9R A;  4DR3 M;  2KV2 A;  2OXO A;  5HR6 A;  3PST A;  3OTO M;  1R7R A;  2L09 A;  3A45 A;  2F77 X;  2HBL A;  2K4I A;  5EXT A;  4PD2 A;  2KNJ A;  2XVT A;  3PSP A;  3C29 A;  1OJL A;  4I4L A;  3KS8 A;  2EO2 A;  4FVM A;  1G41 A;  3GQ3 A;  5FTK A;  4PT5 A;  2UXB M;  2K8B B;  1HNX M;  4IC9 A;  2A3V A;  4JI8 M;  2JHD A;  2D7G A;  3U6C A;  2OM6 A;  3LMM A;  3SHG B;  2F5O A;  3LYS A;  3HJS A;  4PL1 A;  1PM5 A;  3SAG A;  1UPH A;  2ZIU A;  2M5Z A;  4CGZ A;  4OJ5 A;  4IBF A;  3HHZ A;  3A46 A;  1SXJ C;  1XMQ M;  1TGU A;  3AOE A;  2M60 A;  4G4O A;  4LF8 M;  3CYM A;  4REZ A;  1TH4 A;  3U6E A;  3GLI A;  4LF4 M;  1N78 A;  4OW0 A;  3NWL A;  3SC3 A;  4M9S A;  4LFA M;  3WHK A;  1QAN A;  3KSJ A;  4DV6 M;  4ITQ A;  4IIW A;  3L3F X;  3C58 A;  2RRD A;  3FYC A;  1JR3 A;  4LFB M;  2UUC M;  1N75 A;  4NV0 A;  2GOL A;  3KP0 E;  2N1R A;  3A98 B;  5IZ7 D;  4OJO A;  2QPA A;  3GLG B;  2R62 A;  3TQS A;  2D7E A;  4GHL A;  5KQD A;  2DXI A;  2NQ8 C;  1LV7 A;  5KL8 B;  4S12 A;  4JI0 M;  2FE8 A;  5EXX A;  3GP1 A;  3K92 A;  1L2C A;  2JH1 A;  3M0E A;  4OJL A;  3PNV A;  1J7K A;  2DGZ A;  4YY3 M;  1C1K A;  4CDG A;  3AL0 B;  4JI1 M;  4FWD A;  2BJV A;  4B08 A;  3JAM S;  5BPV A;  4L8R C;  3THG A;  3UMM A;  2KA6 B;  2DWZ B;  3FUV A;  4BJQ A;  4B7H A;  4PDI A;  2QBY B;  1KYI A;  4AKH A;  2W04 A;  3HJQ A;  3C28 A;  2OYY A;  3DZD A;  4JI2 M;  2Y21 A;  4LJA A;  4EIW A;  3KOY E;  2I7N A;  1NNJ A;  2DF4 B;  1IXS B;  3U5Z A;  3TPZ A;  4IBI A;  2C9O A;  2R18 A;  5CRX A;  2ZBK B;  1WUD A;  2F8L A;  5DNY A;  1GLN A;  5A2Q S;  5EXS A;  2H3V A;  2Z4S A;  5T14 A;  2XFS A;  1F44 A;  3B9P A;  3FUT A;  5FLX S;  1EE8 A;  2CN1 A;  2KJ9 A;  2G5G X;  5EP4 A;  4DUZ M;  5DYG A;  2CHG A;  3KOW E;  3LVW A;  1Z5A A;  4IBJ A;  4XGI A;  3HKZ F;  3SAU A;  1QAO A;  2ZIU B;  3PSF A;  4OU7 A;  3M6K A;  3O0F A;  3F5A A;  4GRI A;  3RGS A;  3WHL A;  1H6U A;  3SAR A;  3M6A A;  2XLJ A;  3L28 A;  3D2Q A;  1IN8 A;  1QAQ A;  1P7D A;  2KW0 A;  2VII A;  1PJJ A;  2VQF M;  4DV4 M;  4BX9 C;  2BJW A;  1N32 M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...