2Z7JA

Structural insights into de multifunctional vp3 protein of birnaviruses:gold derivative
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
125
structure length
125
Chain Sequence
b'AQREKDTRISKKMETMGIYFATPEWVALNGHRGPSPGQLKYWQNTREIPDPNEDYLDYVHAEKSRLASEEQILRAATSIYGAPGQAEPPQAFIDEVAKVYEINHGRGPNQEQMKDLLLTAMEMKH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid assembly protein VP3
publication title Structural insights into the multifunctional protein VP3 of birnaviruses.
pubmed doi rcsb
source organism Infectious bursal disease virus
molecule tags Viral protein
total genus 44
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2007-08-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.880 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2z7jA02
1.10.150.620 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2z7jA01
2R18A 2Z7JA
chains in the Genus database with same CATH superfamily
1KRPA 3T1HM 1H6UA 5IT9S 1HJPA 1VEJA 5LMUM 3TKAA 3T5LA 7ICEA 5KFKA 8ICQA 3KKAC 1XWIA 1FFUA 2W9CA 1ED1A 1Q3CA 2BPFA 2A1JB 4B3TM 3JPQA 2F5PA 3GLHA 4TUSA 2X4AA 1E94E 3C23A 4JMUA 1IQPA 3L3FX 3RJKA 5DG8A 4RUCA 4RT3A 3T15A 3KXEC 4I2FA 4NL4H 1RYRA 1KSFX 3PO4A 4QZEA 2LYHA 5ITYA 3J7AS 2KE7A 4F2RA 4NWIA 4NJ8A 3ISBA 3TWKA 3WK8A 2ZJAA 2NO4A 5ALIA 2ESEA 4QW8A 2VA3A 4RNMA 3PW4A 2QBYA 3LYSA 3AN1A 3FAHA 3SAGA 2K47A 2YQZA 4LGMA 3SI8A 4YY3M 2K60A 3RBEA 1M6YA 3C29A 5KFOA 1V97A 1RXWA 1ZJMA 2IBKA 4FBUA 4DBGB 4DLEA 1A5TA 4L4UA 3L29A 4IRKA 3E21A 1SV4A 2VA8A 4CISA 4ED8A 4B3MM 1TF0B 3MFIA 5AM3A 4MGZE 3M6ZA 3QU5A 4DV7M 4QZIA 2AHMA 2H3QA 5EE9A 4M2YA 3MC1A 2QPAA 1UFZA 4F3OA 1R7RA 3KTQA 3UMBA 3H7IA 4DQRA 2HDOA 3T79A 3NBIA 2KICA 4J9RA 3GRYA 3VFDA 3FUUA 3NGDA 3IECA 3U5ZB 2C5RA 3M9MB 3TL4X 2LMRA 5C5JA 2EAOA 3NTUA 7ICSA 3OJUA 1AQ6A 2KW0A 3K9PA 2FFJA 1U47A 3HPOA 7ICTA 4RKUF 4U7CA 3NRZA 1KTQA 1SKWA 2M60A 7ICHA 3L5KA 1NNJA 5ALJA 4NSOB 2XZUA 4PH5A 5EP3A 5KFMA 4TURA 1ZQWA 4DF8A 5KG7A 3GPPA 1K5OA 4M9SA 3UMGA 4ANRA 5K4LA 1V92A 4P4OA 2V6ZM 2HBJA 3DA1A 4GC5A 3RH5A 1WUDA 4QOZC 3GIMA 3QNMA 1U4BA 4RNAA 3QU2A 4Y2QA 4X5VA 4UQGA 8ICOA 1TH2A 3QYEA 5BPVA 2YY6A 2PFOA 3ZDAA 1L3VA 9ICLA 2FI1A 2HMXA 3HX0A 5C18A 2EH9A 8ICCA 2M9NA 2BCQA 3GV5B 1KFDA 2X49A 3KKAA 2V4QA 1ZQHA 4NXZA 3WK6A 4RQ0A 1BNOA 3H8SA 3Q8PB 1WG8A 3OPXA 2BCSA 2YB1A 4FW9A 1JX4A 4XGIA 3JR5A 4EIWA 4QW9A 2JRZA 5J2JA 2P35A 4I2JA 2JNHA 1ZQNA 3VKHA 4B9SA 4C0ZA 3CNHA 3MK6A 5AI5A 1Z19A 2WAQF 4EZ6A 2KRKA 2G5IB 1LTMA 1RZTA 2ZTDA 4CRXA 2Q4TA 2XGPA 1GJTA 2ZIWA 2XFSA 1PVRA 2EANA 3KS4A 3RH6A 3RB4A 1T94A 2KFZA 1J97A 4IBIA 1NJYA 9ICJA 3E0FA 8ICXA 3HW8A 2Y1JA 3WHKA 2HBLA 4LCBA 2ES6A 4C8NA 2MUTB 1XWLA 2BWBA 2FMSA 5EXXA 1J2MA 2XLJA 4EX6A 4LJ4A 4F92B 1PRBA 4FWDA 2JP7A 4Z6EA 5CRXA 1Q02A 4PDGA 4XBOA 3GLGB 4B3SM 4I2EA 8ICNA 1TFRA 2VKQA 2ZUCA 4UB4A 1BNPA 2YMLA 1ZQLA 4NLCA 4KLMA 1OAIA 4Q8EA 2RGHA 2DUYA 3PNYA 3DOAA 1TE2A 5KO3A 5BOLA 3UQ0A 2FMQA 1QQ6A 2Y9TA 2VF7A 2C22A 1MN3A 4YR0A 1OJLA 1QH9A 1Z00A 2KJ8A 5IIOA 2UUAM 1FFVA 4B9NA 2ZAMA 3A46A 2L5YA 2JV3A 1TK5A 1NJFA 5BR8M 4IQTA 1ZQ1C 3U6OA 3UM9A 2DENA 4P0QA 3ILKA 4M9NA 1F4IA 2AU0A 1V34A 1JR3D 1KYIA 1VG5A 4IBJA 2LYAA 5BOMA 5J0RA 3U61A 3K1RB 4B9VA 1OFHA 3B7NA 2BCRA 1VEKA 2W3RA 3FUWA 4LJ5A 4R8UB 3ZDCA 4GRIA 4L15A 4OVZB 3UPQA 4DCCA 3D2QA 2ZAOA 4O3PA 2C98A 5KG1A 1N56A 2DFLA 3OSNA 4O3SA 1NY6A 3TQSA 5KG4A 4HAIA 4GHAA 4BWMA 2XH9A 1JQJC 5JU5A 1ZQBA 2O01F 3LCUA 5AKLA 2OYYA 1ZQSA 2MJ5B 4ELUA 3CTWB 2RLTA 4C8OA 1BPXA 2C96A 5DDYA 1C1KA 1NV9A 4FE3A 4CJ6A 2E8PA 1QYRA 3TACB 2MU2A 1DGHB 3CYMA 4JV5M 4UASA 1SL1A 4KLFA 3ZDEA 1HQCA 5KG0A 3RH4A 4F2SA 2CE7A 4BGDA 5GTHU 4I27A 3K1ZA 1A76A 2YN4A 1WGLA 4DOBA 2I1QA 4F4YA 2CUZA 2K8CB 3THGA 3GLFE 1N5XA 1Z6TA 4B9UA 3N28A 4KLQA 3HJSA 1X6IA 3B9JA 3KHLA 2O25A 5AI4A 5AK5A 3PR5B 1VJ5A 1IIPA 4FD2A 4JI2M 2W9BA 4DV6M 2I7NA 1NK5A 2KJ9A 4LF6M 3RFAA 4LFBM 4KLLA 3FYCA 4I2HA 4F4XA 2JMGA 4IR1A 4K4IA 2FPKA 4LVSA 1OKSA 4PCZA 1NNLA 5DQHA 1HT2E 3EIEA 3K9OA 4F4KA 1XNQM 3BOSA 5L1LA 2OHFA 1N60A 2JWSA 2OPFA 1FEZA 5KFQA 4JV1A 3QYBA 2QARB 1XXHA 4REZA 4MFFA 5ALTA 7ICOA 4DL3A 4MFAA 5KFIA 4MB7A 5H37D 4MF8A 1JB0F 1YZ7A 4WP2A 2MGWA 5KQDA 4IL6U 5CHGA 1VQ1A 3N7RC 3D2SA 2Y0TA 4JI0M 1N77A 2D6FC 5HNKA 3IG8A 5G5HA 2XC9A 4J03A 3C1ZA 2UUCM 1L3SA 2Y0SF 4UAWA 4DR5M 4RQ2A 1Z5AA 2CXYA 2WF5A 1TVAA 2BQ3A 9ICKA 2DAEA 4UARA 3TWMA 5J29A 5DLFA 5AK4A 5J2FA 4ECXA 5HR7A 2CRUA 3WU2U 3F53A 4DF4A 3B0YA 1JR3E 2BDPA 1K82A 2FOIC 3QUTA 1N61A 2NRWA 3HHYA 5KT7A 1NJZA 4P0PB 8ICKA 5AM1A 2F8KA 1O03A 1S9FA 4KODA 4ECZA 4ELTA 2KXEA 4KN7A 8ICBA 3IV6A 3Q8RB 1R6BX 3VK8A 1PJIA 4C7YA 3GLHE 1ZQKA 2APLA 4RUAA 2EKKA 4YMMA 3GPYA 3E2EA 4QIWC 2KD1A 3TANA 3LQQA 5AKGA 1T4GA 2ZIWB 4LZJA 2BCVA 2G09A 2P6RA 3KOXE 3UJNA 2GLEA 2W54A 3M9NB 1KQQA 4QZAA 4QZ8A 3OJSA 4GITA 3FUTA 2KG5A 9ICBA 5DB6A 5AHXA 1ZQPA 4AP9A 1QDRA 4IJFA 3HWSA 3TQ1A 4CE6A 2A1JA 2JH1A 3IDWA 2FLLA 4DL2A 4NXNM 1F0MA 4PGXA 1YSYA 5KFLA 2RKOA 4PDIA 4F71A 3U6MA 4UBCA 5IREB 3EWAA 2EZXA 2GQFA 3UZUA 2HBKA 2MRLA 2VA2A 1Z4NA 9ICOA 5DQIA 3AOGA 1IN4A 2Q2EB 2XZFA 5L1KA 4UBBA 2OH2A 5JI3E 4LJ6A 5FTMA 2JHDA 3C21A 2DKXA 1L7OA 2ZANA 5DG9A 3N4MB 1QTMA 3SAWA 1J2NA 3IRUA 2DGZA 2C9CA 1T6OA 4ZPXA 2F4VM 2XFTA 3T5KA 1JALA 8CATA 5DLGA 3U61B 2O5RA 3SEIA 3RB6A 4MF2A 5GKNA 2KFNA 3F92A 2CRXA 3H8MA 5J0WA 3U6QA 4Y2JA 2JEIA 5D46A 2DKLA 3L27A 3HRDD 1S0OA 3LCVB 3ZD8A 1Q8KA 2DQNB 2EDUA 3TFSA 2MH8A 4K4GA 3RBDA 2K4IA 1IY2A 2BHNA 3U6PA 1I94M 1IFYA 3C5FA 4IRDA 3SAFA 4AZFA 3K75D 1ZQIA 4XA5A 4NV0A 3AU6A 5EOZA 3KHGA 3U5ZA 1KDHA 2CHVA 3GV8B 4UW9A 5KFXA 5AIBA 1IV8A 2MAXA 3GQCA 5AI9A 3F5AA 1S0NA 3BDPA 4DFJA 5D4BA 3PSFA 1YZ6A 4JYAM 5E6JA 1IN6A 1NHWC 5KFNA 4PL2A 3GIKA 3IHQB 1ZYQA 2D7EA 3MGVA 1ZRMA 4XRHA 4O5EA 4Y2RA 4YP3A 2DWQA 4GC6A 2JY6B 4CNQA 4PHPA 1MJGM 5KPZA 4DV1M 2ODGA 4KLHA 7ICRA 4BWJA 2KVCA 2BJWA 3I4YA 2ASJA 5KT6A 2F5QA 1NK8A 1NO1A 8ICLA 2LTUA 4P16A 5DNYA 4GXIA 4JI5M 2OCEA 1P3QQ 4J9OA 1URJA 3CW2C 4PHDA 4UAYA 1XC9A 4X66M 2Z4RA 4LJ7A 3Q8LA 5ALDA 1N62A 3ALRA 3OHAA 5J2IA 2FLNA 4CHTB 7ICKA 4OO1J 3NVWA 2HVIA 2RHFA 3FE3A 2I5HA 1HNWM 3PNCA 4OJOA 3B7ZA 3LK9A 2LVOC 5IIJA 5KFGA 4MHVA 7ICQA 4R71A 2L7HA 5J0YA 5ITXA 2IOHA 2PMZC 1JRPA 2WTFA 2W11A 4IQVA 2HHSA 3QUQA 1NI3A 2MA1A 4ECSA 3PMLA 1HIWA 2KNVA 1IN8A 3H4BA 5CA7A 1SZPA 1D8BA 2QLTA 1JUDA 4ELVA 9ICTA 1CEZA 2K0BX 5CR0A 4RT2A 4U6PA 2NRTA 2R8IA 3AOEC 4PHEA 2PKEA 4MGYE 4M04A 2IOFK 2OOAA 1ZD2P 5CEHA 1ZAEA 3WKBA 4G3IA 1ZD4A 2DAIA 2CWBA 3NBXX 4M0DA 4LY6A 2HHQA 3GLGA 8ICSA 2G07A 3PVSA 1ZQJA 4L16A 2CFOA 2VIIA 4JV0A 7ICPA 4ZOHC 1TDZA 2KA6B 1PJJA 2LHCA 3LVVA 4LRSA 2LPEA 3SMSA 1U45A 1P7DA 5ALRA 1ZQXA 2KDLA 3QEAZ 2NRVA 4KTQA 5J0SA 1YT3A 3I76A 3U26A 4GHLA 2KJ5A 4IBKA 1XSPA 3SFZA 4IBEA 3H0LB 4DQIA 4QWDA 2L6OA 4P4MA 1X9XA 2LBOA 1IBLM 4R65A 4E0DA 4GXJA 1L3UA 1PJQA 1KLNA 2QKQA 3Q8SB 4IBGA 4RF0A 4RQ6A 2W8LA 1XNSA 1UPHA 5F9NA 4B7GA 1MA7A 3KDSE 2JZ1A 4X64M 2XVTA 1VDLA 3A98B 1DXSA 4BXOB 5IIIA 4YXJA 4DLGA 9ICMA 4NLGA 1QCKA 2R6FA 4R8UA 2G08A 4OVZA 2VJ4A 3QZ7A 2HHHM 2VF8A 1LB2B 4ED2A 5KFFA 3C58A 1FNNA 1JXEA 2FPMA 1GO3F 3HX3A 1RM6C 2QB1A 1T3TA 5IWAM 5EWEA 1X66A 3KSXA 1COOA 1LKYB 9ICRA 3D6JA 3AQEA 2JXJA 2B0CA 3SR6A 3NUQA 2I7PA 5IIKA 4QOSA 8ICTA 4YQWA 1D9FA 2DXIA 3FYHA 2YMPA 4KO8A 2F5OA 3QEBZ 1DGHA 2L4EA 4IBFA 4KLUA 3HHWA 4ECWA 4ED6A 3BJYA 1JROA 2WF8A 3HHZA 5KG2A 2W03A 3WKEA 2DL0A 5KAIU 2BR0A 3ZH9B 3NVVA 2HHVA 2UVVA 3CRXA 4JK1A 3VKGA 4FZLA 2W43A 2F1IA 4YR3A 4ECQA 1QDTA 2UUBM 1QZMA 1AIPC 2EJSA 3HZJA 1WXQA 3HU3A 2VQEM 1WWVA 1ZQZA 3BQ0A 1XXHE 2BNKA 2MR9A 5IZ7D 3CGWA 3IHPA 3S6JA 2A3VA 3HGIA 1Q3BA 4DV5M 3AOEA 9ICNA 1DK2A 3I04M 1TDHA 3K92A 3I51A 9ICSA 1TR8A 2DZNB 3RGPA 2L2DA 3W68A 4ED0A 5TISU 4O9MA 4DFDA 5ITRA 2FE8A 1NHGC 3Q8XA 5FTJA 1JIHA 4OU7A 3GRUA 4I2IA 4G6ZA 4GIPA 3GLIE 4GIBA 1BVSA 2QARA 4CF5A 2FMPA 4O5CA 2HCFA 4RPXA 3KBBA 3MGHA 2ZJ5A 2R8GA 5EXSA 2PMZF 3AMZA 3F2CA 3Q8MA 1ZMWA 4DV4M 1N5WA 2JUJA 4YR2A 4US9A 1ZQFA 3GQ3A 1BPZA 1X42A 2IHNA 2J7OA 2ZIUB 3PR4A 4IS7A 3ZD9A 1ZQAA 2HHWA 1AROP 8ICYA 2H3VA 5AM5A 1DGBA 5G5GA 5IINA 2EAPA 3M6KA 3E9SA 3NASA 2K4PA 2LVNC 3FUVA 4G4NA 1SXJB 2ZUBA 2EA0A 4ED7A 4L78A 2A5YB 4I81A 2L7IA 2OEHA 4J9SA 1Z5BA 5KL1B 5HR6A 1MQ3A 3RJHA 1XO1A 2W9AA 1NK6A 5JTIA 2E8MA 3BQ1A 4CGZA 4J9MA 4GFJA 1UCVA 4TUQA 3SYZA 2KK0A 2QSFX 1GL6A 4P0PA 2YMQA 5ITUA 4AG6A 1NV8A 4PZNA 1KFVA 3C9PA 2F5SA 3SV4A 3RE8A 3AUOA 7ICFA 4A3VB 1A6SA 2DAMA 1G3IA 3TI0A 1S10A 3WKAA 1N48A 3TFRA 2PFPA 3RB0A 2PFNA 2B3TA 2DVWB 4O0IA 2O6KA 3HKPA 4F2LA 5JUMA 7ICGA 2DHYA 2JZ0A 5F3WA 2N1RA 2ALZA 2K6BA 3RRGA 3MDCA 4QWBA 2ZIXA 4NSRA 2M0NA 2ZUDA 4QZFA 4QZHA 3TADA 2MROB 3L28A 2IMWP 5DFLA 3H40A 3CF6E 5FLXS 1IBMM 4Y2XA 4X62M 4FVMA 1WGNA 2G3QA 5H2FU 4DQQA 2UXBM 2RGOA 3GZFA 5KQ8A 5ALXA 3QE9Y 5KFVA 2G5GX 2DWMA 3VDUA 2VANA 3UXOA 1IBKM 4RQ4A 4Y2UA 5L9XA 1R5LA 1SXDA 3GFKB 2LM1A 9ICVA 4LF5M 3T5JA 5EXTA 2V1UA 1HNXM 3GIJA 4LFCM 1Z59A 3PVXA 5ALZA 4DL5A 7ICMA 2F1HA 1TAQA 1XMQM 2C2EA 4JWMA 1E32A 1QVRA 1LVHA 1XO0A 5DBAA 4K0KM 4G4QA 1LV5A 2VQFM 5JRTA 1L7PA 2AGPA 3UXNA 2OO9A 1A0PA 5J0UA 1WYGA 3C2MA 8ICFA 2AQ4A 1KKXA 1K1SA 3HJEA 5AKKA 4TQRA 1ZV1A 2F8LA 4F91B 2XSZA 5EP1A 5EQTA 2Z4SA 3E46A 4MH0E 4C4RA 3KZIU 4Y2VA 3RFWA 1IM4A 1WR1B 5T14A 4TUPA 1ZJNA 3E4RA 2HHUA 3FTDA 5EE0A 3QYPA 2LH0A 2EQYA 1RYSA 1MN8A 3KP1E 5TZVA 1L8QA 4NM2A 4KMUA 3HJ8A 2HOIA 3RGSA 1XC8A 4QZBA 5AI8A 4JN6A 2R45A 1SWVA 5EE3A 3V76A 1HUOA 1XSNA 4Z6DA 3N7SC 5AKXA 1B43A 2LWXA 2KVSA 1ECWA 4EYIB 3AQFA 2OXOA 5DGAA 1Q3VA 1YLAA 1TAUA 2WF9A 2HCBA 3M7GA 4LF9M 4GH9A 4F5RA 2I6XA 4C8MA 2QB0A 5ALVA 3QU4A 4QWAA 3KOZE 3H4DA 4R66A 1WHCA 1IXSB 1N34M 3HP6A 1S3SA 3HY5A 5J2DA 1UA0A 4P2HA 3N97B 3QX7A 1N78A 5ITXE 2JXNA 1EFUB 2B21A 9ICCA 2IOFA 3J81S 1JN3A 2F5NA 2C2RA 8ICZA 2K8BB 8ICWA 2W82A 4IIWA 2JH7A 2R62A 4DL7A 3KP0E 1L8OA 2P66A 2KV2A 4EBCA 1L1ZA 2FNAA 3SENA 3MDAA 2K89A 3A0BU 4QZDA 5KFPA 3D2NA 1KN5A 4M9GA 4KLSA 5AKZA 1WCLA 1DGFA 3T3FA 2DWNA 5KFUA 1L3TA 1DV0A 5ALHA 3U6LA 4LJXA 1S5LU 2E3TA 1EE8A 1X6JA 2QCUA 1ZD5A 4X65M 3GLGE 5CWRA 3FUXA 2ZTEA 2KIWA 4JI3M 1VLBA 3B7QA 4NLNA 4O3OA 4IBCA 1L7MA 2YQEA 3ZC7B 3SYLA 3LVWA 3U60A 2ZXIA 3LMMA 2NRXA 5J2BA 3PW7A 2N35A 4GEWA 3C2KA 2W7OA 5J0XA 3UK6A 5J2GA 3D8BA 4O3RA 1QQ5A 4B9LA 2Y1IA 2WSCF 1ZQMA 4B3RM 2JEFA 3L4PA 4NRVA 4QZCA 3EW9A 3MR2A 2JR5A 1X9SA 4JI6M 1IG6A 4UB1A 4ICAA 4OJ5A 2ZM6M 3PX6A 1NKCA 1PK1B 4GXKA 3NVYA 8ICJA 2H3IA 4F5NA 4JV2A 1HQYE 5KFHA 1R2YA 3F2DA 1PVQA 8ICRA 5KFYA 1OXJA 4OD0A 1S97A 4F5OA 1L2DA 1L2CA 1XU4A 5BPCA 1K3XA 3WK7A 2D7GA 1NK0A 4Q8FA 5AI6A 5DYGA 4MGHA 7ICVA 2ZIXB 2R8HA 4UATA 3DDHA 1SXJC 1L7NA 1V33A 1E9RA 5AK6A 4PL1A 1W5TA 3MJ5A 4Y2PA 3THVA 1SV0C 3PO5A 4BXOA 1UT5A 4YMOA 5CJ7A 2H3FA 2EAMA 2G8LA 5L1MA 4M0WA 3JPRA 4C4SA 4G4RA 4LZDA 2BCUA 4HYKA 4DWIA 5E79U 5ALQA 4Q7JA 4CF4A 5ALEA 4BJQA 3MBYA 2WFAA 4DL6A 4PZOA 1T7PA 4IRCA 4F8RA 7CATA 3SZ2A 5FP0A 3UMCA 7ICLA 1J7KA 3VCBA 2KNJA 3C2LA 1LKYA 3MHVC 4EZ9A 4UAZA 4NLZA 4HEOA 4LGYA 1XSLA 3QUCA 3HKZC 2XGQA 4FWHA 1ZQQA 3SATA 3H4JA 4CIZA 2QQ8A 4BLCA 4C7ZA 4Q44A 2DBYA 9ICXA 4B08A 4DFMA 1PJTA 1L5UA 2ERCA 5J8YC 3IG5A 4I8OA 2YR0A 4DFPA 5KG6A 3QU9A 1NSFA 1TH3A 1E9SA 3GQ5A 3BS7A 3E58A 1RXVA 3MR5A 4GKJM 5L1IA 1ZQ9A 5C0YA 1NK7A 1VDVA 5J0OA 4JXJA 2XY6A 1J09A 3J80S 3GDXA 4IBBA 1UA1A 5DG7A 4RPYA 3SQIA 4I29A 4NM1A 1GVNA 2XSZD 1HNZM 4FZMA 3LQRA 5J0TA 2KMDA 2FJ6A 1QSSA 2LVQD 1PM5A 1GL7A 4W5WA 2Z3XA 2K4HA 9ICQA 3SYKA 2NQ8C 5IILA 3FD9A 1ZQRA 2DAKA 1L1TA 4C4TA 2DHRA 1MC8A 2FDRA 3RJIA 1Y8GA 1G41A 4US8A 4Z6YA 2G06A 4I2GA 2C9OA 5DGBA 2QHOB 1ZRNA 2BKEA 3ICXA 1PJSA 5FTKA 5L8RF 4LF7M 1SKRA 4KT0F 4J9LA 2BQUA 2OOBA 3V6KA 4I2DA 1G71A 4DEZA 8ICEA 2ZIVA 3RR8A 3KHRA 5KL8B 2XCPA 1QQWA 2QB0B 1TK8A 3RJGA 4KLOA 2BPGA 2ZIUA 2KHHA 2GWSA 1D8LA 4DR1M 2PFQA 2QZ4A 5AK3A 4F4WA 3T38A 3FTCA 1FO4A 4DSFA 2KNZA 4JI4M 3PW5A 3HJQA 2LVPC 4XQ8A 9ICWA 1COKA 4UB2A 4FS1A 1SXJA 1Z5CA 1JMSA 3PSTA 1FIQA 2HVHA 2Y20A 1SV0A 1RYUA 2KKPA 4GLXA 7ICIA 5GTIU 2RP5A 2CPRA 4AW4A 2XY5A 3HILA 1RU3A 4DUYM 3ISDA 4I5SA 5ALYA 2KOBA 2RDJA 4F93B 4KLDA 3FC4A 5KFAA 5HHHA 1KFTA 4IQUA 2DF4B 2V9WA 1MSWD 2E8OA 3C1YA 4YD1A 2DZOB 2LVAA 3U60B 2JY5A 4RQ8A 3NVZA 2EUCA 5J8YA 3EUB2 4QIWF 2FLPA 4CCHA 3OTQA 4PHAA 3RRHA 1CI4A 1NZBA 3GIIA 1YUBA 5AM2A 3J81j 1TV9A 4QWCA 1XB2B 2KSOB 5KG3A 2LXEA 1IN5A 2D8CA 3I1YA 4GC9A 1SB3C 1J5EM 3EYZA 2R44A 3BS5A 3OGUA 1OFIA 1QUSA 3PY8A 2F2AB 3V7JA 4FBTA 3T1YM 2BDUA 1ZQTA 4II7A 1L6NA 1GABA 2E1FA 4D82A 2J7NA 4QZGA 8ICVA 2QP9X 1IXRC 4BX9C 3SC3A 2ZXHA 3PZPA 4DS5A 2EZYA 2YB4A 3R9XB 3PXGA 5J2HA 4RNNA 3SV3A 3H4MA 4L8RC 5DYIA 3ETLA 3KSJA 3AM9A 5EJCA 5B5EU 2XY7A 2L09A 1CUKA 5J2EA 3WKCA 4I2BA 2KP7A 4GKKM 1AUAA 3ZCBB 4C8LA 4F72A 1ZQUA 2F77X 2KN7A 4PPXA 3C5GA 1A77A 9ICFA 1QANA 3MFHA 5D49A 3W0LB 4I2CA 1D2NA 4NC6A 4B7HA 3EIHA 4MGKE 1NJGA 3GP1A 1XMOM 2Y21A 3M1YA 4ECTA 5AICA 3G6VA 3ZDDA 4O3NA 4OCZA 4AKIA 1PUZA 5KNIA 3U6DA 4M9LA 2J6SA 1VEGA 4YN4A 2E1EA 1KFSA 2JZBB 1ZOLA 1TK0A 9ICGA 1OIPA 2DPIA 4LF4M 3Q8QB 4NLKA 3TADC 4AKGA 4G4OA 1QSYA 1G4AE 4DS4A 4WURA 3EPGA 4LRTA 3GO8A 3JPPA 2J6UA 4XUSA 4KLNA 2KZ3A 1Z1VA 3V72A 4BUGA 4EYHB 1NK9A 4RU9A 1U48A 3BXWA 2J5YA 5FTNA 1PVPA 5E26A 5KFJA 5HMMA 3TE6A 1IXSA 1SKSA 5KFDA 3MR6A 3VK7A 4JI7M 4ED1A 8ICMA 1BPDA 4RZRA 4IJEA 5KFBA 4DR6M 1YE9A 2AHOB 4DSIA 2CHQA 2LHGA 1NJWA 2CV2A 2NO5A 1ORYB 5EXPA 3OSPA 4FFDA 4ZH4A 1SL0A 3V7LA 3RF9A 8ICPA 4KLJA 1N75A 2P6UA 2HSZA 4DUZM 5J0QA 5J2KA 3NWLA 1DGSA 2F3NA 8ICUA 1TGUA 4DQSA 3WKDA 1IY1A 2VDBB 5DB9A 1H38A 1WJ7A 5ALGA 3TAPA 2ZIVB 3JPSA 2YNMD 4DSKA 3ED5A 4YVZA 4Y2SA 1D8YA 2A19A 2H1RA 2KZSA 3M8SA 3PMNA 4F1IA 2ASDA 2UVRA 2JA2A 2XEPA 4O3QA 1V85A 1IXRA 2PI5A 3LWMA 1ZMUA 4L6V6 1N2XA 9ICAA 5EP2A 2H3ZA 3ETRA 3HHXA 4RQ3A 2KTQA 4UAVA 3R9KA 4CDGA 4M6WB 3BZKA 2M5ZA 4I28A 3NS1A 2LNHC 5J0PA 4LG2A 8ICHA 3MABA 1SXJD 2W04A 5EWFA 2FH0A 4YFKA 1T43A 2ZG6A 5DBBA 3KHHA 1Z4OA 3UMMA 2KZZA 2QENA 3CF2A 1KEJA 1D9DA 2Z8YM 4MFCA 3OHBA 1BGXT 4QNMA 3AL0B 3M0EA 3DZDA 1ZETA 1PK1A 4DQPA 4AYBC 4Y2TA 3DFZA 4EENA 4BB9A 4R7GA 2ZBKB 3GLFB 3GRRA 2D3DA 4Z8XA 3F5EA 4BDPA 4JI1M 3G6XA 2V4RA 3FRIA 3J27B 3SBJA 5EE1A 5KFRA 4MEYA 4NLBA 2OQ4A 1B4FA 2J6TA 4KLTA 1PK3A 1S76D 5KFWA 3KOOA 5ALNA 5KFSA 2CN1A 2R0IA 2A1AA 3I28A 4ED3A 4DSLA 5ALLA 1V9PA 5ALOA 2W55A 1HEKA 2LYBA 1NZPA 5ALPA 4QZ9A 1X9MA 3B0XA 4TQSA 2EZZA 1IY0A 2DI0A 1DOQA 2LI6A 2H5XA 2Y0SC 1RDFA 2RRUA 1SG9A 2KIVA 2HHXA 2Y0QA 5KG5A 4NXMM 4DV2M 2XCAA 4RQNA 3NRWA 1ZQDA 1ZQEA 2RRDA 3UGJA 1MQ2A 1K3WA 1XS9D 2I9GA 4ACOA 3GU3A 2K8AA 3BS5B 2CHGA 4RQ5A 3SMPA 4KLEA 3T6PA 4MM3B 3SD7A 5KT5A 3DV9A 4DFKA 2AGOA 2HAKA 1UHUA 2KKVA 3ISCA 9ICUA 1VDDA 2WZJA 2JY7A 3OTOM 7ICJA 4FS2A 4D80A 4QNLA 3FTEA 5F9LA 1L8LA 4KX3A 2GOLA 1T3NA 4YMNA 2R18A 2FPLA 4EEYA 5IIMA 4WW0A 1PZNA 1ZD3A 3QAUA 3PW0A 3F2BA 3IM1A 3RB3A 1BPBA 1X2IA 3SARA 1X37A 3RAQA 4QHSA 3SASA 2HOFA 2WF6A 1SXEA 4CF3A 4M9ZA 2BQRA 2YFQA 1KW4A 4J9QA 4KITB 5KFZA 1NJXA 3AFHA 4DV0M 2W9CB 2XICA 9ICPA 4LJ9A 2MSNA 3AJIB 3FRHA 5KPTA 3GLHB 1X9WA 2JEGA 2WSFF 4F50A 1RG6A 5AKIA 3WK4A 2BJVA 4D81A 2OWOA 4DOAA 2YTUA 1KSPA 4HLQA 3A42A 2CV0A 1NNUC 1T3QA 3C3EA 4BBAA 1NKEA 2HW3A 4IQWA 3SAVA 2L4FA 9ICEA 1BPYA 1QZEA 5CP2A 1NK4A 2KZMA 1WWUA 4FWGA 5EWGA 4UB3A 1F44A 2E8NA 1SXJE 3GQ4A 1SWWA 2DKZA 4Y28F 2VJ5A 1ZQGA 2QBYB 1R4GA 4WJ3B 3QWLA 1OAOC 3GRVA 3AKZA 1GLNA 3IN5A 2Z7JA 4C8KA 5KPRA 4IBDA 1QAOA 2DWZB 4M47A 3KZXA 4RPZA 4DR3M 4J9KA 3FM9A 4HL4A 3D8LA 5AM0A 1Z1BA 3PX0A 2FS1A 2IA6A 4QNRA 4GMQA 4EEKA 1X40A 3V6HA 2KEYA 1V38A 3M7DA 3WK9A 4DSEA 4Y2YA 4Q43A 5ALFA 4DV3M 4ECRA 4Q45A 1IN7A 1KBUA 4Z6FA 4DL4A 1Q3UA 4LZGA 4RF1A 2W8KA 1B0XA 2NV3A 2XF3A 2DNAA 3KFUF 2KZUA 3Q8GA 1GO5A 3H8JA 4I2AA 2V1CA 3L2AA 4KHPM 1QQ7A 4RQ7A 4KLGA 1OIZA 4EBDA 4XK8F 5HP4A 2C99A 1SIJA 1S8OA 1T8EA 1I4WA 4P17A 5ITTA 1ZQVA 4AYBF 2W7PA 1OQYA 3T5HA 3B9PA 1QSLA 4LJ8A 2HWJA 4NOOB 1UQVA 5AKJA 3JPTA 2XI9A 2WHEA 3RTVA 3MMPA 2HBMA 2KHQA 2EO2A 4FCTA 5CB1A 3HWTA 2KHVA 3VDPA 4DSJA 1QAMA 2R8KA 3SHGB 3N7PD 3K1JA 2KRUA 3J7BA 3BQ2A 1MU5A 1GJSA 5DB8A 3EPIA 3HU1A 2KSOA 5DKWA 1Y88A 4F5QA 2R4EA 3LDAA 3J2PB 3DEEA 3VLFB 3GILA 3QU7A 3GLIA 3R8FA 8ICAA 1TTEA 3EZ5A 4DO9A 5ALKA 3Q8KA 2Q0ZX 2KNAA 4LFAM 3M6AA 2AQ0A 3JPNA 1B22A 4PJ0U 1DK3A 2AJQA 3TPZA 2CV1A 1ZMVA 2HL7A 4MGIE 4O5KA 2R65A 3M9OB 1TKDA 4LJAA 4AQYM 1KL9A 3JR4A 2D7HA 2ASLA 5FTLA 2UXCM 4DOCA 1SL2A 4R3DA 3I4VA 2RQ5A 1Z3EB 5ALWA 2E5LM 1NY5A 2BWEA 3FYDA 4JUZA 4Z6CA 3PV8A 4QHTA 5ALSA 4LZZA 3TWLA 4C80A 5AIAA 3MR3A 3ONNA 4KX5A 3K2LA 3KFUG 7ICUA 4LF8M 1S0MA 3G6YA 1ZXIA 1L2BA 1S0VA 3AV0A 2WF7A 3BQ7A 3RJFA 2Y9UA 4I4LA 3AL0C 1XHBA 3KOYE 1OTRA 1ZQCA 1N33M 5KT3A 1EIJA 4PT5A 2PXIA 1D0LA 5B66U 1FJGM 4NL9C 4OJPA 1D0MA 1O08A 4G3OA 1WIVA 1DGJA 4ITQA 2OM6A 1NOMA 3UQ2A 1HUZA 3A0HU 2GNOA 1C7YA 9ICHA 3H8WA 2JZBA 3WHLA 2WB1C 4UAUA 3PFIA 2AGQA 5C1BA 4KMOB 4EBEA 2YMMA 3U6CA 2GO7A 3MGIA 1Z00B 2KEBA 2K9DA 2DWLA 2GH1A 1ZQYA 3PSPA 1GKIA 4B7FA 4OJ6A 1G59A 4PD2A 2DZLA 2W3SA 2B6GA 3CP8A 4P0QB 4RQMA 5KAFU 2K4EA 4GC7A 2LBCA 4AG5A 1Q46A 2G5HB 2XIDA 2LM4A 3TAQA 3KVWA 3PSIA 2AH5A 1DO2A 1QUTA 3AEVA 4FO6A 3U6EA 1JXLA 4B9MA 8ICGA 3V7KA 2BGWA 5LMNM 3C28A 4B6JA 4KLIA 3H0MB 2X8AA 2XGNA 3W0FA 2F76X 4NRWA 5ITQA 1SGGA 3VC8A 3JPOA 2R46A 5FSWA 4USAA 3RAXA 4FZNA 1TH4A 4YHHM 7ICNA 3ZI4A 1UT8A 1QLNA 5AM4A 4S12A 5KFEA 4PGYA 3A45A 3FTFA 2QNJA 1NKBA 2HHTA 3K8ZA 3M8RA 3SAUA 4F4ZA 1CRXA 5L1JA 4M9HA 2HKJA 2BPCA 4YCXA 4M9XA 2P5TA 2HOQA 2FE9A 4TUWA 1IXZA 4MEXA 4R63A 2HI0A 1G8PA 2E5SA 4G9BA 5DDMA 1N32M 2XO7A 5KTQA 1ZQOA 2UVWA 3H0RB 4B9TA 3I01M 3ZQJA 3C3DA 3CF0A 1OW5A 3GPXA 1N63A 2UVUA 3RJJA 2ISPA 4ECVA 2R4JA 1BPEA 1EXNA 5KFCA 4ECYA 3ZDBA 1WCNA 4NY8A 2F1JA 4M6WA 2NRZA 1IM2A 3LW5F 1U9LA 2ATLA 2W9MA 4O3MA 3V6JA 4P4PA 4J9NA 2JY8A 5AKYA 2UU9M 3HU2A 3PNVA 3O0FA 4AI6A 2JGAA 4UB5A 3IP4B 2W9BB 2CP8A 3RR7A 2C28A 2CEAA 5JI2E 3QZ8A 4DR7M 1RPLA 5AKEA 3GV7B 5ALMA 5AI0A 4DR2M 8ICIA 1DO0A 3GLFA 3L26A 3WK5A 5A0LA 3BBZA 5J2CA 2F44A 4NL9A 3RJEA 2G0AA 5AKHA 4PGQA 1R2ZA 4OJLA 9ICIA 3UXPA 3PW2A 5ALUA 2ZJ8A 4EELA 1XXHB 5KT4A 1C20A 4DR4M 3JAMS 4CGYB 4F5PA 2WSEF 5DBCA 3KS8A 3TARA 1SZHA 3B89A 5HMLA 4QWEA 3HT3A 3LWLA 4EX7A 4K4HA 3AU2A 3FDSA 2JEJA 2EKFA 4YXMA 4JB3A 4JWNA 1N36M 1RQLA 2LHTA 4UB6U 2RDIA 1HT1E 3B74A 5F3XB 1JI7A 3GLIB 3QXGA 2ZTCA 1MX0A 4UN2B 4YG2A 1TAMA 1W5SA 3BQTA 1S77D 3SHFA 3KD3A 1K1QA 4AKHA 2BZFA 4M0AA 1DRGA 2AXTU 4J9PA 2MUTA 2UXDM 2PI4A 5KFTA 4M9JA 4R64A 3KOWE 4FCVA 3KW6A 5EP4A 4JI8M 4UB8U 1HR0M 4ECUA 3HKZF 4KN4A 3SAHA 3U6SA 2DPJA 2DAGA 4RQ1A 2IHMA 1F5SA 1RQNA 4RNOA 4OX9M 3BZCA 2LKYA 3K4GA 5A2QS 1UM8A 3PX4A 4YD2A 4OW0A 3FKEA 1LV7A 2VIXA 3ORYA 2WB1F 2WAQC 3QUBA 1PGYA 1XNRM 3SMVA 5HHIA 4QJFB 4FCWA 1D0KA 1NVMA 2C2DA 4A8EA 2R8JA 1Q39A 1JR3A 4IR9A 1DGGA 2NYVA 4IC9A 3W67A 1OUQA 1QAQA 1U49A 3L25A 5J2AA 2YX8A 5KT2A 5DQGA 2ISOA 5DB7A 3GPUA
chains in the Genus database with same CATH topology
4AZFA 3T1HM 1H6UA 5IT9S 4NV0A 2DWNA 5LMUM 2CN1A 1XWIA 3U5ZA 3U6LA 1ED1A 1Q3CA 2CHVA 1EE8A 1HEKA 4B3TM 2LYBA 2QCUA 2F5PA 3GLHA 1IY0A 3F5AA 4X65M 2X4AA 2Y0SC 3FUXA 1E94E 2KIWA 4JMUA 1IQPA 4JI3M 3L3FX 3PSFA 2Y0QA 4JYAM 4NXMM 4DV2M 4IBCA 5E6JA 3NRWA 1IN6A 1NHWC 2RRDA 3T15A 3SYLA 3LVWA 3ZC7B 3UGJA 3U60A 3KXEC 1K3WA 2ZXIA 4PL2A 4ACOA 2D7EA 4NL4H 3GU3A 2K8AA 1KSFX 3MGVA 3LMMA 2CHGA 5ITYA 3SMPA 3J7AS 4MM3B 2W7OA 4NWIA 5KPZA 3UK6A 4DV1M 3TWKA 3D8BA 2KKVA 2KVCA 2BJWA 3I4YA 2F5QA 2QBYA 1VDDA 3LYSA 4P16A 5DNYA 4B3RM 3SAGA 2K47A 4NRVA 4JI5M 2YQZA 3OTOM 4LGMA 4YY3M 1URJA 4D80A 3C29A 4QNLA 3FTEA 4JI6M 4KX3A 2GOLA 4X66M 2R18A 4ICAA 4OJ5A 2ZM6M 4L4UA 2Z4RA 4WW0A 4LJ7A 3L29A 3QAUA 3ALRA 4CISA 2H3IA 4CHTB 4B3MM 3F2BA 3GPUA 4OO1J 3SARA 1HQYE 1X37A 1R2YA 4MGZE 4QHSA 3SASA 3M6ZA 3F2DA 1PVQA 2HOFA 4DV7M 2AHMA 2H3QA 4M9ZA 2RHFA 2QPAA 2YFQA 1HNWM 1L2DA 4OJOA 1L2CA 1R7RA 1K3XA 2D7GA 2L7HA 5DYGA 4MGHA 5ITXA 2PMZC 3AFHA 2ZIXB 3T79A 2MA1A 3NBIA 1SXJC 2KICA 3GRYA 4DV0M 3VFDA 3FUUA 1E9RA 2XICA 3U5ZB 4PL1A 1W5TA 3MJ5A 1HIWA 2C5RA 4LJ9A 3TL4X 3AJIB 1IN8A 5KPTA 3GLHB 2H3FA 2G8LA 1DGFA 4M0WA 4G4RA 1D8BA 2BJVA 4D81A 2KW0A 2FFJA 4BJQA 4HLQA 3A42A 2CV0A 4U6PA 1NNUC 4U7CA 7CATA 2M60A 4BBAA 3AOEC 4MGYE 1J7KA 3VCBA 3SAVA 2KNJA 1NNJA 3MHVC 4NSOB 2XZUA 4LGYA 5EP3A 1L6NA 4FWGA 1ZAEA 3HKZC 1F44A 4FWHA 1SXJE 3GPPA 3GQ4A 3SATA 4M9SA 2VJ5A 4BLCA 2QBYB 4M0DA 4LY6A 4B08A 2V6ZM 3QWLA 3GRVA 3DA1A 4GC5A 3AKZA 1GLNA 3GLGA 3PVSA 2G07A 4L16A 2CFOA 2VIIA 3IN5A 2Z7JA 2ERCA 4QOZC 1WUDA 1TDZA 5KPRA 4IBDA 4RNAA 1QAOA 2DWZB 2KA6B 1TH2A 1PJJA 3LVVA 4LRSA 3KZXA 3SMSA 5BPVA 1P7DA 4DR3M 3IG5A 4HL4A 3D8LA 4I8OA 2YR0A 1Z1BA 1YT3A 4GHLA 2KJ5A 4IBKA 4QNRA 2HMXA 1NSFA 1TH3A 4GMQA 5C18A 3SFZA 4IBEA 1E9SA 3GQ5A 2KEYA 3M7DA 3H0LB 4GKJM 4DV3M 2L6OA 2X49A 1IN7A 2LBOA 1ZQ9A 1IBLM 1KBUA 5C0YA 1Q3UA 4JXJA 4RF1A 1J09A 3J80S 2NV3A 4IBBA 2XF3A 4IBGA 3KFUF 3SQIA 3OPXA 2KZUA 1GVNA 2XSZD 4RF0A 1HNZM 2YB1A 4FZMA 3LQRA 4FW9A 4XGIA 1XNSA 3JR5A 4EIWA 1UPHA 2V1CA 4B7GA 3L2AA 4KHPM 1MA7A 1PM5A 1GL7A 3KDSE 4W5WA 2Z3XA 4X64M 3VKHA 2C99A 2XVTA 2K4HA 3A98B 3SYKA 1I4WA 2NQ8C 3FD9A 4C0ZA 5ITTA 3MK6A 1L1TA 2G08A 1Z19A 2DHRA 2WAQF 4OVZA 2VJ4A 4AYBF 2W7PA 2HHHM 2KRKA 2G5IB 3B9PA 4LJ8A 1G41A 4CRXA 4NOOB 4Z6YA 3C58A 2Q4TA 2G06A 2C9OA 2ZIWA 2XI9A 1FNNA 2XFSA 1PVRA 3KS4A 1GO3F 1T94A 2HBMA 1T3TA 5IWAM 2KHQA 3ICXA 3KSXA 5FTKA 4IBIA 4FCTA 4LF7M 3E0FA 3AQEA 3WHKA 2KHVA 3VDPA 2HBLA 1QAMA 4LCBA 5EXXA 3SHGB 2XLJA 2ZIVA 4LJ4A 3K1JA 3N7PD 3NUQA 2KRUA 2I7PA 3J7BA 4FWDA 5KL8B 5CRXA 1MU5A 4PDGA 4XBOA 3GLGB 4B3SM 4QOSA 1QQWA 2VKQA 3HU1A 2ZIUA 2R4EA 2DXIA 3J2PB 4NLCA 4DR1M 3DEEA 4KO8A 3VLFB 2RGHA 2F5OA 3PNYA 2QZ4A 1DGHA 3DOAA 5KO3A 3GLIA 4IBFA 3R8FA 3HHWA 3T38A 3FTCA 3HHZA 1OJLA 4LFAM 3M6AA 4JI4M 2KJ8A 3HJQA 2W03A 2UUAM 3TPZA 2ZAMA 2CV1A 3A46A 1SXJA 2HL7A 3ZH9B 1NJFA 1Z5CA 5BR8M 3PSTA 1ZQ1C 3U6OA 3CRXA 4MGIE 2R65A 3VKGA 4P0QA 2Y20A 2KKPA 3ILKA 4FZLA 4LJAA 4AQYM 3JR4A 2D7HA 2RP5A 2UUBM 1QZMA 1JR3D 2CPRA 1KYIA 4AW4A 4IBJA 5FTLA 2UXCM 2LYAA 4R3DA 1WXQA 3HU3A 3I4VA 2VQEM 3U61A 2BNKA 4DUYM 5IZ7D 2E5LM 4I5SA 1NY5A 1OFHA 2A3VA 3FYDA 1Q3BA 3HGIA 3AOEA 4DV5M 4QHTA 2KOBA 3FUWA 4LZZA 3TWLA 4LJ5A 1TDHA 3K92A 4GRIA 4L15A 3ONNA 4OVZB 3I51A 3K2LA 3KFUG 4KX5A 2DZNB 4LF8M 3D2QA 2ZAOA 3RGPA 2C98A 5ITRA 1L2BA 2DF4B 3AV0A 2FE8A 1NHGC 3Q8XA 5FTJA 1NY6A 2DZOB 3U60B 4I4LA 3GRUA 3TQSA 4OU7A 4G6ZA 4GIPA 2EUCA 1XHBA 3KOYE 2XH9A 1JQJC 4GHAA 4QIWF 1N33M 2OYYA 4PT5A 5EXSA 2PMZF 3F2CA 1NZBA 1FJGM 1YUBA 4OJPA 3CTWB 4DV4M 2OM6A 3GQ3A 4ITQA 2C96A 2J7OA 1C1KA 2ZIUB 4FE3A 2LXEA 1IN5A 1QYRA 1DGHB 3WHLA 2H3VA 1DGBA 2WB1C 3PFIA 4JV5M 4GC9A 3CYMA 5C1BA 4KMOB 3M6KA 3E9SA 3U6CA 1J5EM 1HQCA 2HBJA 2KEBA 2CE7A 1OFIA 2DWLA 2GH1A 3FUVA 4G4NA 2F2AB 3K1ZA 3PSPA 1GKIA 4B7FA 4OJ6A 3T1YM 1SXJB 1G59A 4PD2A 2EA0A 2BDUA 4L78A 2A5YB 4I81A 2L7IA 4II7A 2CUZA 1Z5BA 2K8CB 3CP8A 5KL1B 3THGA 4P0QB 2E1FA 4D82A 5HR6A 2J7NA 2K4EA 1Z6TA 2QP9X 1IXRC 4AG5A 2G5HB 2XIDA 3KVWA 3HJSA 3PSIA 4BX9C 3SC3A 2ZXHA 3PZPA 4CGZA 1DO2A 2YB4A 4GFJA 3U6EA 3R9XB 3PXGA 1GL6A 1IIPA 4P0PA 4FD2A 3H4MA 4L8RC 5ITUA 4AG6A 4JI2M 5LMNM 5DYIA 4DV6M 2I7NA 1KFVA 2KJ9A 3C28A 4LF6M 3KSJA 2F5SA 4LFBM 3RFAA 3RE8A 3FYCA 3H0MB 2X8AA 2XGNA 3W0FA 2F76X 4NRWA 5EJCA 4A3VB 5ITQA 1A6SA 2JMGA 3VC8A 1G3IA 2R46A 2L09A 5FSWA 4PCZA 4FZNA 1HT2E 1TH4A 4YHHM 4GKKM 2DVWB 3EIEA 3ZCBB 2F77X 3HKPA 1XNQM 3BOSA 4S12A 2OPFA 5F3WA 1QANA 2N1RA 1XXHA 3W0LB 4REZA 3A45A 3FTFA 1D2NA 2ZIXA 4NSRA 2M0NA 3K8ZA 4B7HA 3EIHA 4MB7A 3SAUA 4MGKE 1NJGA 1CRXA 3GP1A 5H37D 1XMOM 2HKJA 2Y21A 3L28A 3CF6E 4M9XA 5KQDA 2P5TA 5FLXS 4X62M 1IBMM 2HOQA 4FVMA 3AL0C 4AKIA 3U6DA 3N7RC 4TUWA 1IXZA 2Y0TA 4JI0M 1N77A 2D6FC 2UXBM 3D2SA 3IG8A 2E1EA 1G8PA 2E5SA 1N32M 2RGOA 3GZFA 5KQ8A 3H0RB 2UUCM 4LF4M 2G5GX 2DWMA 3CF0A 3VDUA 2Y0SF 4DR5M 1Z5AA 1IBKM 4AKGA 3GPXA 4G4OA 1G4AE 4WURA 4LRTA 2R4JA 3GO8A 5EXTA 3TWMA 4LF5M 2V1UA 1HNXM 4KLNA 4LFCM 1Z59A 1IM2A 5HR7A 4BUGA 3F53A 4O3MA 5FTNA 1XMQM 2FOIC 1K82A 1PVPA 5E26A 2UU9M 3HU2A 3PNVA 1E32A 1QVRA 3HHYA 3TE6A 3O0FA 1XO0A 4K0KM 4G4QA 3VK7A 4JI7M 4AI6A 4P0PB 2VQFM 2JGAA 4IJEA 3IP4B 4DR6M 1YE9A 2CEAA 5JI2E 4KODA 1A0PA 2CHQA 2KXEA 4DR7M 1R6BX 2CV2A 1ORYB 5EXPA 3VK8A 4DR2M 1PJIA 1DO0A 3GLFA 3L26A 3RF9A 2F8LA 5A0LA 2XSZA 5EP1A 5EQTA 2Z4SA 3GPYA 1N75A 2G0AA 4QIWC 1R2ZA 4MH0E 2KD1A 4DUZM 3LQQA 4OJLA 2ZIWB 4LZJA 2G09A 3KOXE 3RFWA 1XXHB 3UJNA 3NWLA 4DR4M 3JAMS 1TGUA 5T14A 4CGYB 3E4RA 1IY1A 4GITA 3FTDA 3FUTA 3KS8A 2LH0A 2ZIVB 1SZHA 4IJFA 3HWSA 2YNMD 3KP1E 2JH1A 1L8QA 4NXNM 2H1RA 2KZSA 3HJ8A 1N36M 1YSYA 2LHTA 2RKOA 3RGSA 2HOIA 1XC8A 1HT1E 2JA2A 2XEPA 4PDIA 3U6MA 4JN6A 3GLIB 5IREB 2R45A 1MX0A 3UZUA 1TAMA 1W5SA 2HBKA 2MRLA 2LWXA 3N7SC 1ECWA 3SAFA 3AQFA 2OXOA 3SHFA 5EP2A 3AOGA 2H3ZA 4AKHA 3HHXA 1IN4A 1Q3VA 2Q2EB 2XZFA 1DRGA 2UXDM 2HCBA 4CDGA 2OH2A 5JI3E 4LJ6A 5FTMA 3M7GA 2JHDA 2M5ZA 3KOWE 4FCVA 3KW6A 5EP4A 2LNHC 4GH9A 4JI8M 4LF9M 2ZANA 4LG2A 4WJ3B 1SXJD 2W04A 1HR0M 3SAWA 3HKZF 3SAHA 3U6SA 2ZG6A 2DGZA 3KOZE 3UMMA 2C9CA 2QENA 1IXSB 1N34M 1S3SA 3CF2A 2XFTA 4ZPXA 4OX9M 2F4VM 8CATA 2LKYA 3U61B 2O5RA 5A2QS 1N78A 1UM8A 5ITXE 4OW0A 3FKEA 1LV7A 4QNMA 5GKNA 3AL0B 3M0EA 3DZDA 2VIXA 2CRXA 3J81S 2WB1F 2F5NA 3U6QA 2WAQC 4AYBC 2K8BB 3DFZA 2W82A 4IIWA 1XNRM 2R62A 2JH7A 4BB9A 3KP0E 3L27A 4R7GA 3SMVA 4QJFB 4FCWA 2ZBKB 1NVMA 3GLFB 2KV2A 3GRRA 4Z8XA 3F5EA 1L1ZA 2FNAA 4JI1M 4A8EA 2K89A 1Q39A 1JR3A 2DQNB 1DGGA 3J27B 3SBJA 4IC9A 2K4IA 1IY2A 3D2NA 4NLBA 2OQ4A 1OUQA 1QAQA 3L25A 3U6PA 1I94M 2YX8A 2EO2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R18 A;  2Z7J A; 
#chains in the Genus database with same CATH topology
 1KRP A;  3T1H M;  1H6U A;  5IT9 S;  1HJP A;  1VEJ A;  5LMU M;  3TKA A;  3T5L A;  7ICE A;  5KFK A;  8ICQ A;  3KKA C;  1XWI A;  1FFU A;  2W9C A;  1ED1 A;  1Q3C A;  2BPF A;  2A1J B;  4B3T M;  3JPQ A;  2F5P A;  3GLH A;  4TUS A;  2X4A A;  1E94 E;  3C23 A;  4JMU A;  1IQP A;  3L3F X;  3RJK A;  5DG8 A;  4RUC A;  4RT3 A;  3T15 A;  3KXE C;  4I2F A;  4NL4 H;  1RYR A;  1KSF X;  3PO4 A;  4QZE A;  2LYH A;  5ITY A;  3J7A S;  2KE7 A;  4F2R A;  4NWI A;  4NJ8 A;  3ISB A;  3TWK A;  3WK8 A;  2ZJA A;  2NO4 A;  5ALI A;  2ESE A;  4QW8 A;  2VA3 A;  4RNM A;  3PW4 A;  2QBY A;  3LYS A;  3AN1 A;  3FAH A;  3SAG A;  2K47 A;  2YQZ A;  4LGM A;  3SI8 A;  4YY3 M;  2K60 A;  3RBE A;  1M6Y A;  3C29 A;  5KFO A;  1V97 A;  1RXW A;  1ZJM A;  2IBK A;  4FBU A;  4DBG B;  4DLE A;  1A5T A;  4L4U A;  3L29 A;  4IRK A;  3E21 A;  1SV4 A;  2VA8 A;  4CIS A;  4ED8 A;  4B3M M;  1TF0 B;  3MFI A;  5AM3 A;  4MGZ E;  3M6Z A;  3QU5 A;  4DV7 M;  4QZI A;  2AHM A;  2H3Q A;  5EE9 A;  4M2Y A;  3MC1 A;  2QPA A;  1UFZ A;  4F3O A;  1R7R A;  3KTQ A;  3UMB A;  3H7I A;  4DQR A;  2HDO A;  3T79 A;  3NBI A;  2KIC A;  4J9R A;  3GRY A;  3VFD A;  3FUU A;  3NGD A;  3IEC A;  3U5Z B;  2C5R A;  3M9M B;  3TL4 X;  2LMR A;  5C5J A;  2EAO A;  3NTU A;  7ICS A;  3OJU A;  1AQ6 A;  2KW0 A;  3K9P A;  2FFJ A;  1U47 A;  3HPO A;  7ICT A;  4RKU F;  4U7C A;  3NRZ A;  1KTQ A;  1SKW A;  2M60 A;  7ICH A;  3L5K A;  1NNJ A;  5ALJ A;  4NSO B;  2XZU A;  4PH5 A;  5EP3 A;  5KFM A;  4TUR A;  1ZQW A;  4DF8 A;  5KG7 A;  3GPP A;  1K5O A;  4M9S A;  3UMG A;  4ANR A;  5K4L A;  1V92 A;  4P4O A;  2V6Z M;  2HBJ A;  3DA1 A;  4GC5 A;  3RH5 A;  1WUD A;  4QOZ C;  3GIM A;  3QNM A;  1U4B A;  4RNA A;  3QU2 A;  4Y2Q A;  4X5V A;  4UQG A;  8ICO A;  1TH2 A;  3QYE A;  5BPV A;  2YY6 A;  2PFO A;  3ZDA A;  1L3V A;  9ICL A;  2FI1 A;  2HMX A;  3HX0 A;  5C18 A;  2EH9 A;  8ICC A;  2M9N A;  2BCQ A;  3GV5 B;  1KFD A;  2X49 A;  3KKA A;  2V4Q A;  1ZQH A;  4NXZ A;  3WK6 A;  4RQ0 A;  1BNO A;  3H8S A;  3Q8P B;  1WG8 A;  3OPX A;  2BCS A;  2YB1 A;  4FW9 A;  1JX4 A;  4XGI A;  3JR5 A;  4EIW A;  4QW9 A;  2JRZ A;  5J2J A;  2P35 A;  4I2J A;  2JNH A;  1ZQN A;  3VKH A;  4B9S A;  4C0Z A;  3CNH A;  3MK6 A;  5AI5 A;  1Z19 A;  2WAQ F;  4EZ6 A;  2KRK A;  2G5I B;  1LTM A;  1RZT A;  2ZTD A;  4CRX A;  2Q4T A;  2XGP A;  1GJT A;  2ZIW A;  2XFS A;  1PVR A;  2EAN A;  3KS4 A;  3RH6 A;  3RB4 A;  1T94 A;  2KFZ A;  1J97 A;  4IBI A;  1NJY A;  9ICJ A;  3E0F A;  8ICX A;  3HW8 A;  2Y1J A;  3WHK A;  2HBL A;  4LCB A;  2ES6 A;  4C8N A;  2MUT B;  1XWL A;  2BWB A;  2FMS A;  5EXX A;  1J2M A;  2XLJ A;  4EX6 A;  4LJ4 A;  4F92 B;  1PRB A;  4FWD A;  2JP7 A;  4Z6E A;  5CRX A;  1Q02 A;  4PDG A;  4XBO A;  3GLG B;  4B3S M;  4I2E A;  8ICN A;  1TFR A;  2VKQ A;  2ZUC A;  4UB4 A;  1BNP A;  2YML A;  1ZQL A;  4NLC A;  4KLM A;  1OAI A;  4Q8E A;  2RGH A;  2DUY A;  3PNY A;  3DOA A;  1TE2 A;  5KO3 A;  5BOL A;  3UQ0 A;  2FMQ A;  1QQ6 A;  2Y9T A;  2VF7 A;  2C22 A;  1MN3 A;  4YR0 A;  1OJL A;  1QH9 A;  1Z00 A;  2KJ8 A;  5IIO A;  2UUA M;  1FFV A;  4B9N A;  2ZAM A;  3A46 A;  2L5Y A;  2JV3 A;  1TK5 A;  1NJF A;  5BR8 M;  4IQT A;  1ZQ1 C;  3U6O A;  3UM9 A;  2DEN A;  4P0Q A;  3ILK A;  4M9N A;  1F4I A;  2AU0 A;  1V34 A;  1JR3 D;  1KYI A;  1VG5 A;  4IBJ A;  2LYA A;  5BOM A;  5J0R A;  3U61 A;  3K1R B;  4B9V A;  1OFH A;  3B7N A;  2BCR A;  1VEK A;  2W3R A;  3FUW A;  4LJ5 A;  4R8U B;  3ZDC A;  4GRI A;  4L15 A;  4OVZ B;  3UPQ A;  4DCC A;  3D2Q A;  2ZAO A;  4O3P A;  2C98 A;  5KG1 A;  1N56 A;  2DFL A;  3OSN A;  4O3S A;  1NY6 A;  3TQS A;  5KG4 A;  4HAI A;  4GHA A;  4BWM A;  2XH9 A;  1JQJ C;  5JU5 A;  1ZQB A;  2O01 F;  3LCU A;  5AKL A;  2OYY A;  1ZQS A;  2MJ5 B;  4ELU A;  3CTW B;  2RLT A;  4C8O A;  1BPX A;  2C96 A;  5DDY A;  1C1K A;  1NV9 A;  4FE3 A;  4CJ6 A;  2E8P A;  1QYR A;  3TAC B;  2MU2 A;  1DGH B;  3CYM A;  4JV5 M;  4UAS A;  1SL1 A;  4KLF A;  3ZDE A;  1HQC A;  5KG0 A;  3RH4 A;  4F2S A;  2CE7 A;  4BGD A;  5GTH U;  4I27 A;  3K1Z A;  1A76 A;  2YN4 A;  1WGL A;  4DOB A;  2I1Q A;  4F4Y A;  2CUZ A;  2K8C B;  3THG A;  3GLF E;  1N5X A;  1Z6T A;  4B9U A;  3N28 A;  4KLQ A;  3HJS A;  1X6I A;  3B9J A;  3KHL A;  2O25 A;  5AI4 A;  5AK5 A;  3PR5 B;  1VJ5 A;  1IIP A;  4FD2 A;  4JI2 M;  2W9B A;  4DV6 M;  2I7N A;  1NK5 A;  2KJ9 A;  4LF6 M;  3RFA A;  4LFB M;  4KLL A;  3FYC A;  4I2H A;  4F4X A;  2JMG A;  4IR1 A;  4K4I A;  2FPK A;  4LVS A;  1OKS A;  4PCZ A;  1NNL A;  5DQH A;  1HT2 E;  3EIE A;  3K9O A;  4F4K A;  1XNQ M;  3BOS A;  5L1L A;  2OHF A;  1N60 A;  2JWS A;  2OPF A;  1FEZ A;  5KFQ A;  4JV1 A;  3QYB A;  2QAR B;  1XXH A;  4REZ A;  4MFF A;  5ALT A;  7ICO A;  4DL3 A;  4MFA A;  5KFI A;  4MB7 A;  5H37 D;  4MF8 A;  1JB0 F;  1YZ7 A;  4WP2 A;  2MGW A;  5KQD A;  4IL6 U;  5CHG A;  1VQ1 A;  3N7R C;  3D2S A;  2Y0T A;  4JI0 M;  1N77 A;  2D6F C;  5HNK A;  3IG8 A;  5G5H A;  2XC9 A;  4J03 A;  3C1Z A;  2UUC M;  1L3S A;  2Y0S F;  4UAW A;  4DR5 M;  4RQ2 A;  1Z5A A;  2CXY A;  2WF5 A;  1TVA A;  2BQ3 A;  9ICK A;  2DAE A;  4UAR A;  3TWM A;  5J29 A;  5DLF A;  5AK4 A;  5J2F A;  4ECX A;  5HR7 A;  2CRU A;  3WU2 U;  3F53 A;  4DF4 A;  3B0Y A;  1JR3 E;  2BDP A;  1K82 A;  2FOI C;  3QUT A;  1N61 A;  2NRW A;  3HHY A;  5KT7 A;  1NJZ A;  4P0P B;  8ICK A;  5AM1 A;  2F8K A;  1O03 A;  1S9F A;  4KOD A;  4ECZ A;  4ELT A;  2KXE A;  4KN7 A;  8ICB A;  3IV6 A;  3Q8R B;  1R6B X;  3VK8 A;  1PJI A;  4C7Y A;  3GLH E;  1ZQK A;  2APL A;  4RUA A;  2EKK A;  4YMM A;  3GPY A;  3E2E A;  4QIW C;  2KD1 A;  3TAN A;  3LQQ A;  5AKG A;  1T4G A;  2ZIW B;  4LZJ A;  2BCV A;  2G09 A;  2P6R A;  3KOX E;  3UJN A;  2GLE A;  2W54 A;  3M9N B;  1KQQ A;  4QZA A;  4QZ8 A;  3OJS A;  4GIT A;  3FUT A;  2KG5 A;  9ICB A;  5DB6 A;  5AHX A;  1ZQP A;  4AP9 A;  1QDR A;  4IJF A;  3HWS A;  3TQ1 A;  4CE6 A;  2A1J A;  2JH1 A;  3IDW A;  2FLL A;  4DL2 A;  4NXN M;  1F0M A;  4PGX A;  1YSY A;  5KFL A;  2RKO A;  4PDI A;  4F71 A;  3U6M A;  4UBC A;  5IRE B;  3EWA A;  2EZX A;  2GQF A;  3UZU A;  2HBK A;  2MRL A;  2VA2 A;  1Z4N A;  9ICO A;  5DQI A;  3AOG A;  1IN4 A;  2Q2E B;  2XZF A;  5L1K A;  4UBB A;  2OH2 A;  5JI3 E;  4LJ6 A;  5FTM A;  2JHD A;  3C21 A;  2DKX A;  1L7O A;  2ZAN A;  5DG9 A;  3N4M B;  1QTM A;  3SAW A;  1J2N A;  3IRU A;  2DGZ A;  2C9C A;  1T6O A;  4ZPX A;  2F4V M;  2XFT A;  3T5K A;  1JAL A;  8CAT A;  5DLG A;  3U61 B;  2O5R A;  3SEI A;  3RB6 A;  4MF2 A;  5GKN A;  2KFN A;  3F92 A;  2CRX A;  3H8M A;  5J0W A;  3U6Q A;  4Y2J A;  2JEI A;  5D46 A;  2DKL A;  3L27 A;  3HRD D;  1S0O A;  3LCV B;  3ZD8 A;  1Q8K A;  2DQN B;  2EDU A;  3TFS A;  2MH8 A;  4K4G A;  3RBD A;  2K4I A;  1IY2 A;  2BHN A;  3U6P A;  1I94 M;  1IFY A;  3C5F A;  4IRD A;  3SAF A;  4AZF A;  3K75 D;  1ZQI A;  4XA5 A;  4NV0 A;  3AU6 A;  5EOZ A;  3KHG A;  3U5Z A;  1KDH A;  2CHV A;  3GV8 B;  4UW9 A;  5KFX A;  5AIB A;  1IV8 A;  2MAX A;  3GQC A;  5AI9 A;  3F5A A;  1S0N A;  3BDP A;  4DFJ A;  5D4B A;  3PSF A;  1YZ6 A;  4JYA M;  5E6J A;  1IN6 A;  1NHW C;  5KFN A;  4PL2 A;  3GIK A;  3IHQ B;  1ZYQ A;  2D7E A;  3MGV A;  1ZRM A;  4XRH A;  4O5E A;  4Y2R A;  4YP3 A;  2DWQ A;  4GC6 A;  2JY6 B;  4CNQ A;  4PHP A;  1MJG M;  5KPZ A;  4DV1 M;  2ODG A;  4KLH A;  7ICR A;  4BWJ A;  2KVC A;  2BJW A;  3I4Y A;  2ASJ A;  5KT6 A;  2F5Q A;  1NK8 A;  1NO1 A;  8ICL A;  2LTU A;  4P16 A;  5DNY A;  4GXI A;  4JI5 M;  2OCE A;  1P3Q Q;  4J9O A;  1URJ A;  3CW2 C;  4PHD A;  4UAY A;  1XC9 A;  4X66 M;  2Z4R A;  4LJ7 A;  3Q8L A;  5ALD A;  1N62 A;  3ALR A;  3OHA A;  5J2I A;  2FLN A;  4CHT B;  7ICK A;  4OO1 J;  3NVW A;  2HVI A;  2RHF A;  3FE3 A;  2I5H A;  1HNW M;  3PNC A;  4OJO A;  3B7Z A;  3LK9 A;  2LVO C;  5IIJ A;  5KFG A;  4MHV A;  7ICQ A;  4R71 A;  2L7H A;  5J0Y A;  5ITX A;  2IOH A;  2PMZ C;  1JRP A;  2WTF A;  2W11 A;  4IQV A;  2HHS A;  3QUQ A;  1NI3 A;  2MA1 A;  4ECS A;  3PML A;  1HIW A;  2KNV A;  1IN8 A;  3H4B A;  5CA7 A;  1SZP A;  1D8B A;  2QLT A;  1JUD A;  4ELV A;  9ICT A;  1CEZ A;  2K0B X;  5CR0 A;  4RT2 A;  4U6P A;  2NRT A;  2R8I A;  3AOE C;  4PHE A;  2PKE A;  4MGY E;  4M04 A;  2IOF K;  2OOA A;  1ZD2 P;  5CEH A;  1ZAE A;  3WKB A;  4G3I A;  1ZD4 A;  2DAI A;  2CWB A;  3NBX X;  4M0D A;  4LY6 A;  2HHQ A;  3GLG A;  8ICS A;  2G07 A;  3PVS A;  1ZQJ A;  4L16 A;  2CFO A;  2VII A;  4JV0 A;  7ICP A;  4ZOH C;  1TDZ A;  2KA6 B;  1PJJ A;  2LHC A;  3LVV A;  4LRS A;  2LPE A;  3SMS A;  1U45 A;  1P7D A;  5ALR A;  1ZQX A;  2KDL A;  3QEA Z;  2NRV A;  4KTQ A;  5J0S A;  1YT3 A;  3I76 A;  3U26 A;  4GHL A;  2KJ5 A;  4IBK A;  1XSP A;  3SFZ A;  4IBE A;  3H0L B;  4DQI A;  4QWD A;  2L6O A;  4P4M A;  1X9X A;  2LBO A;  1IBL M;  4R65 A;  4E0D A;  4GXJ A;  1L3U A;  1PJQ A;  1KLN A;  2QKQ A;  3Q8S B;  4IBG A;  4RF0 A;  4RQ6 A;  2W8L A;  1XNS A;  1UPH A;  5F9N A;  4B7G A;  1MA7 A;  3KDS E;  2JZ1 A;  4X64 M;  2XVT A;  1VDL A;  3A98 B;  1DXS A;  4BXO B;  5III A;  4YXJ A;  4DLG A;  9ICM A;  4NLG A;  1QCK A;  2R6F A;  4R8U A;  2G08 A;  4OVZ A;  2VJ4 A;  3QZ7 A;  2HHH M;  2VF8 A;  1LB2 B;  4ED2 A;  5KFF A;  3C58 A;  1FNN A;  1JXE A;  2FPM A;  1GO3 F;  3HX3 A;  1RM6 C;  2QB1 A;  1T3T A;  5IWA M;  5EWE A;  1X66 A;  3KSX A;  1COO A;  1LKY B;  9ICR A;  3D6J A;  3AQE A;  2JXJ A;  2B0C A;  3SR6 A;  3NUQ A;  2I7P A;  5IIK A;  4QOS A;  8ICT A;  4YQW A;  1D9F A;  2DXI A;  3FYH A;  2YMP A;  4KO8 A;  2F5O A;  3QEB Z;  1DGH A;  2L4E A;  4IBF A;  4KLU A;  3HHW A;  4ECW A;  4ED6 A;  3BJY A;  1JRO A;  2WF8 A;  3HHZ A;  5KG2 A;  2W03 A;  3WKE A;  2DL0 A;  5KAI U;  2BR0 A;  3ZH9 B;  3NVV A;  2HHV A;  2UVV A;  3CRX A;  4JK1 A;  3VKG A;  4FZL A;  2W43 A;  2F1I A;  4YR3 A;  4ECQ A;  1QDT A;  2UUB M;  1QZM A;  1AIP C;  2EJS A;  3HZJ A;  1WXQ A;  3HU3 A;  2VQE M;  1WWV A;  1ZQZ A;  3BQ0 A;  1XXH E;  2BNK A;  2MR9 A;  5IZ7 D;  3CGW A;  3IHP A;  3S6J A;  2A3V A;  3HGI A;  1Q3B A;  4DV5 M;  3AOE A;  9ICN A;  1DK2 A;  3I04 M;  1TDH A;  3K92 A;  3I51 A;  9ICS A;  1TR8 A;  2DZN B;  3RGP A;  2L2D A;  3W68 A;  4ED0 A;  5TIS U;  4O9M A;  4DFD A;  5ITR A;  2FE8 A;  1NHG C;  3Q8X A;  5FTJ A;  1JIH A;  4OU7 A;  3GRU A;  4I2I A;  4G6Z A;  4GIP A;  3GLI E;  4GIB A;  1BVS A;  2QAR A;  4CF5 A;  2FMP A;  4O5C A;  2HCF A;  4RPX A;  3KBB A;  3MGH A;  2ZJ5 A;  2R8G A;  5EXS A;  2PMZ F;  3AMZ A;  3F2C A;  3Q8M A;  1ZMW A;  4DV4 M;  1N5W A;  2JUJ A;  4YR2 A;  4US9 A;  1ZQF A;  3GQ3 A;  1BPZ A;  1X42 A;  2IHN A;  2J7O A;  2ZIU B;  3PR4 A;  4IS7 A;  3ZD9 A;  1ZQA A;  2HHW A;  1ARO P;  8ICY A;  2H3V A;  5AM5 A;  1DGB A;  5G5G A;  5IIN A;  2EAP A;  3M6K A;  3E9S A;  3NAS A;  2K4P A;  2LVN C;  3FUV A;  4G4N A;  1SXJ B;  2ZUB A;  2EA0 A;  4ED7 A;  4L78 A;  2A5Y B;  4I81 A;  2L7I A;  2OEH A;  4J9S A;  1Z5B A;  5KL1 B;  5HR6 A;  1MQ3 A;  3RJH A;  1XO1 A;  2W9A A;  1NK6 A;  5JTI A;  2E8M A;  3BQ1 A;  4CGZ A;  4J9M A;  4GFJ A;  1UCV A;  4TUQ A;  3SYZ A;  2KK0 A;  2QSF X;  1GL6 A;  4P0P A;  2YMQ A;  5ITU A;  4AG6 A;  1NV8 A;  4PZN A;  1KFV A;  3C9P A;  2F5S A;  3SV4 A;  3RE8 A;  3AUO A;  7ICF A;  4A3V B;  1A6S A;  2DAM A;  1G3I A;  3TI0 A;  1S10 A;  3WKA A;  1N48 A;  3TFR A;  2PFP A;  3RB0 A;  2PFN A;  2B3T A;  2DVW B;  4O0I A;  2O6K A;  3HKP A;  4F2L A;  5JUM A;  7ICG A;  2DHY A;  2JZ0 A;  5F3W A;  2N1R A;  2ALZ A;  2K6B A;  3RRG A;  3MDC A;  4QWB A;  2ZIX A;  4NSR A;  2M0N A;  2ZUD A;  4QZF A;  4QZH A;  3TAD A;  2MRO B;  3L28 A;  2IMW P;  5DFL A;  3H40 A;  3CF6 E;  5FLX S;  1IBM M;  4Y2X A;  4X62 M;  4FVM A;  1WGN A;  2G3Q A;  5H2F U;  4DQQ A;  2UXB M;  2RGO A;  3GZF A;  5KQ8 A;  5ALX A;  3QE9 Y;  5KFV A;  2G5G X;  2DWM A;  3VDU A;  2VAN A;  3UXO A;  1IBK M;  4RQ4 A;  4Y2U A;  5L9X A;  1R5L A;  1SXD A;  3GFK B;  2LM1 A;  9ICV A;  4LF5 M;  3T5J A;  5EXT A;  2V1U A;  1HNX M;  3GIJ A;  4LFC M;  1Z59 A;  3PVX A;  5ALZ A;  4DL5 A;  7ICM A;  2F1H A;  1TAQ A;  1XMQ M;  2C2E A;  4JWM A;  1E32 A;  1QVR A;  1LVH A;  1XO0 A;  5DBA A;  4K0K M;  4G4Q A;  1LV5 A;  2VQF M;  5JRT A;  1L7P A;  2AGP A;  3UXN A;  2OO9 A;  1A0P A;  5J0U A;  1WYG A;  3C2M A;  8ICF A;  2AQ4 A;  1KKX A;  1K1S A;  3HJE A;  5AKK A;  4TQR A;  1ZV1 A;  2F8L A;  4F91 B;  2XSZ A;  5EP1 A;  5EQT A;  2Z4S A;  3E46 A;  4MH0 E;  4C4R A;  3KZI U;  4Y2V A;  3RFW A;  1IM4 A;  1WR1 B;  5T14 A;  4TUP A;  1ZJN A;  3E4R A;  2HHU A;  3FTD A;  5EE0 A;  3QYP A;  2LH0 A;  2EQY A;  1RYS A;  1MN8 A;  3KP1 E;  5TZV A;  1L8Q A;  4NM2 A;  4KMU A;  3HJ8 A;  2HOI A;  3RGS A;  1XC8 A;  4QZB A;  5AI8 A;  4JN6 A;  2R45 A;  1SWV A;  5EE3 A;  3V76 A;  1HUO A;  1XSN A;  4Z6D A;  3N7S C;  5AKX A;  1B43 A;  2LWX A;  2KVS A;  1ECW A;  4EYI B;  3AQF A;  2OXO A;  5DGA A;  1Q3V A;  1YLA A;  1TAU A;  2WF9 A;  2HCB A;  3M7G A;  4LF9 M;  4GH9 A;  4F5R A;  2I6X A;  4C8M A;  2QB0 A;  5ALV A;  3QU4 A;  4QWA A;  3KOZ E;  3H4D A;  4R66 A;  1WHC A;  1IXS B;  1N34 M;  3HP6 A;  1S3S A;  3HY5 A;  5J2D A;  1UA0 A;  4P2H A;  3N97 B;  3QX7 A;  1N78 A;  5ITX E;  2JXN A;  1EFU B;  2B21 A;  9ICC A;  2IOF A;  3J81 S;  1JN3 A;  2F5N A;  2C2R A;  8ICZ A;  2K8B B;  8ICW A;  2W82 A;  4IIW A;  2JH7 A;  2R62 A;  4DL7 A;  3KP0 E;  1L8O A;  2P66 A;  2KV2 A;  4EBC A;  1L1Z A;  2FNA A;  3SEN A;  3MDA A;  2K89 A;  3A0B U;  4QZD A;  5KFP A;  3D2N A;  1KN5 A;  4M9G A;  4KLS A;  5AKZ A;  1WCL A;  1DGF A;  3T3F A;  2DWN A;  5KFU A;  1L3T A;  1DV0 A;  5ALH A;  3U6L A;  4LJX A;  1S5L U;  2E3T A;  1EE8 A;  1X6J A;  2QCU A;  1ZD5 A;  4X65 M;  3GLG E;  5CWR A;  3FUX A;  2ZTE A;  2KIW A;  4JI3 M;  1VLB A;  3B7Q A;  4NLN A;  4O3O A;  4IBC A;  1L7M A;  2YQE A;  3ZC7 B;  3SYL A;  3LVW A;  3U60 A;  2ZXI A;  3LMM A;  2NRX A;  5J2B A;  3PW7 A;  2N35 A;  4GEW A;  3C2K A;  2W7O A;  5J0X A;  3UK6 A;  5J2G A;  3D8B A;  4O3R A;  1QQ5 A;  4B9L A;  2Y1I A;  2WSC F;  1ZQM A;  4B3R M;  2JEF A;  3L4P A;  4NRV A;  4QZC A;  3EW9 A;  3MR2 A;  2JR5 A;  1X9S A;  4JI6 M;  1IG6 A;  4UB1 A;  4ICA A;  4OJ5 A;  2ZM6 M;  3PX6 A;  1NKC A;  1PK1 B;  4GXK A;  3NVY A;  8ICJ A;  2H3I A;  4F5N A;  4JV2 A;  1HQY E;  5KFH A;  1R2Y A;  3F2D A;  1PVQ A;  8ICR A;  5KFY A;  1OXJ A;  4OD0 A;  1S97 A;  4F5O A;  1L2D A;  1L2C A;  1XU4 A;  5BPC A;  1K3X A;  3WK7 A;  2D7G A;  1NK0 A;  4Q8F A;  5AI6 A;  5DYG A;  4MGH A;  7ICV A;  2ZIX B;  2R8H A;  4UAT A;  3DDH A;  1SXJ C;  1L7N A;  1V33 A;  1E9R A;  5AK6 A;  4PL1 A;  1W5T A;  3MJ5 A;  4Y2P A;  3THV A;  1SV0 C;  3PO5 A;  4BXO A;  1UT5 A;  4YMO A;  5CJ7 A;  2H3F A;  2EAM A;  2G8L A;  5L1M A;  4M0W A;  3JPR A;  4C4S A;  4G4R A;  4LZD A;  2BCU A;  4HYK A;  4DWI A;  5E79 U;  5ALQ A;  4Q7J A;  4CF4 A;  5ALE A;  4BJQ A;  3MBY A;  2WFA A;  4DL6 A;  4PZO A;  1T7P A;  4IRC A;  4F8R A;  7CAT A;  3SZ2 A;  5FP0 A;  3UMC A;  7ICL A;  1J7K A;  3VCB A;  2KNJ A;  3C2L A;  1LKY A;  3MHV C;  4EZ9 A;  4UAZ A;  4NLZ A;  4HEO A;  4LGY A;  1XSL A;  3QUC A;  3HKZ C;  2XGQ A;  4FWH A;  1ZQQ A;  3SAT A;  3H4J A;  4CIZ A;  2QQ8 A;  4BLC A;  4C7Z A;  4Q44 A;  2DBY A;  9ICX A;  4B08 A;  4DFM A;  1PJT A;  1L5U A;  2ERC A;  5J8Y C;  3IG5 A;  4I8O A;  2YR0 A;  4DFP A;  5KG6 A;  3QU9 A;  1NSF A;  1TH3 A;  1E9S A;  3GQ5 A;  3BS7 A;  3E58 A;  1RXV A;  3MR5 A;  4GKJ M;  5L1I A;  1ZQ9 A;  5C0Y A;  1NK7 A;  1VDV A;  5J0O A;  4JXJ A;  2XY6 A;  1J09 A;  3J80 S;  3GDX A;  4IBB A;  1UA1 A;  5DG7 A;  4RPY A;  3SQI A;  4I29 A;  4NM1 A;  1GVN A;  2XSZ D;  1HNZ M;  4FZM A;  3LQR A;  5J0T A;  2KMD A;  2FJ6 A;  1QSS A;  2LVQ D;  1PM5 A;  1GL7 A;  4W5W A;  2Z3X A;  2K4H A;  9ICQ A;  3SYK A;  2NQ8 C;  5IIL A;  3FD9 A;  1ZQR A;  2DAK A;  1L1T A;  4C4T A;  2DHR A;  1MC8 A;  2FDR A;  3RJI A;  1Y8G A;  1G41 A;  4US8 A;  4Z6Y A;  2G06 A;  4I2G A;  2C9O A;  5DGB A;  2QHO B;  1ZRN A;  2BKE A;  3ICX A;  1PJS A;  5FTK A;  5L8R F;  4LF7 M;  1SKR A;  4KT0 F;  4J9L A;  2BQU A;  2OOB A;  3V6K A;  4I2D A;  1G71 A;  4DEZ A;  8ICE A;  2ZIV A;  3RR8 A;  3KHR A;  5KL8 B;  2XCP A;  1QQW A;  2QB0 B;  1TK8 A;  3RJG A;  4KLO A;  2BPG A;  2ZIU A;  2KHH A;  2GWS A;  1D8L A;  4DR1 M;  2PFQ A;  2QZ4 A;  5AK3 A;  4F4W A;  3T38 A;  3FTC A;  1FO4 A;  4DSF A;  2KNZ A;  4JI4 M;  3PW5 A;  3HJQ A;  2LVP C;  4XQ8 A;  9ICW A;  1COK A;  4UB2 A;  4FS1 A;  1SXJ A;  1Z5C A;  1JMS A;  3PST A;  1FIQ A;  2HVH A;  2Y20 A;  1SV0 A;  1RYU A;  2KKP A;  4GLX A;  7ICI A;  5GTI U;  2RP5 A;  2CPR A;  4AW4 A;  2XY5 A;  3HIL A;  1RU3 A;  4DUY M;  3ISD A;  4I5S A;  5ALY A;  2KOB A;  2RDJ A;  4F93 B;  4KLD A;  3FC4 A;  5KFA A;  5HHH A;  1KFT A;  4IQU A;  2DF4 B;  2V9W A;  1MSW D;  2E8O A;  3C1Y A;  4YD1 A;  2DZO B;  2LVA A;  3U60 B;  2JY5 A;  4RQ8 A;  3NVZ A;  2EUC A;  5J8Y A;  3EUB 2;  4QIW F;  2FLP A;  4CCH A;  3OTQ A;  4PHA A;  3RRH A;  1CI4 A;  1NZB A;  3GII A;  1YUB A;  5AM2 A;  3J81 j;  1TV9 A;  4QWC A;  1XB2 B;  2KSO B;  5KG3 A;  2LXE A;  1IN5 A;  2D8C A;  3I1Y A;  4GC9 A;  1SB3 C;  1J5E M;  3EYZ A;  2R44 A;  3BS5 A;  3OGU A;  1OFI A;  1QUS A;  3PY8 A;  2F2A B;  3V7J A;  4FBT A;  3T1Y M;  2BDU A;  1ZQT A;  4II7 A;  1L6N A;  1GAB A;  2E1F A;  4D82 A;  2J7N A;  4QZG A;  8ICV A;  2QP9 X;  1IXR C;  4BX9 C;  3SC3 A;  2ZXH A;  3PZP A;  4DS5 A;  2EZY A;  2YB4 A;  3R9X B;  3PXG A;  5J2H A;  4RNN A;  3SV3 A;  3H4M A;  4L8R C;  5DYI A;  3ETL A;  3KSJ A;  3AM9 A;  5EJC A;  5B5E U;  2XY7 A;  2L09 A;  1CUK A;  5J2E A;  3WKC A;  4I2B A;  2KP7 A;  4GKK M;  1AUA A;  3ZCB B;  4C8L A;  4F72 A;  1ZQU A;  2F77 X;  2KN7 A;  4PPX A;  3C5G A;  1A77 A;  9ICF A;  1QAN A;  3MFH A;  5D49 A;  3W0L B;  4I2C A;  1D2N A;  4NC6 A;  4B7H A;  3EIH A;  4MGK E;  1NJG A;  3GP1 A;  1XMO M;  2Y21 A;  3M1Y A;  4ECT A;  5AIC A;  3G6V A;  3ZDD A;  4O3N A;  4OCZ A;  4AKI A;  1PUZ A;  5KNI A;  3U6D A;  4M9L A;  2J6S A;  1VEG A;  4YN4 A;  2E1E A;  1KFS A;  2JZB B;  1ZOL A;  1TK0 A;  9ICG A;  1OIP A;  2DPI A;  4LF4 M;  3Q8Q B;  4NLK A;  3TAD C;  4AKG A;  4G4O A;  1QSY A;  1G4A E;  4DS4 A;  4WUR A;  3EPG A;  4LRT A;  3GO8 A;  3JPP A;  2J6U A;  4XUS A;  4KLN A;  2KZ3 A;  1Z1V A;  3V72 A;  4BUG A;  4EYH B;  1NK9 A;  4RU9 A;  1U48 A;  3BXW A;  2J5Y A;  5FTN A;  1PVP A;  5E26 A;  5KFJ A;  5HMM A;  3TE6 A;  1IXS A;  1SKS A;  5KFD A;  3MR6 A;  3VK7 A;  4JI7 M;  4ED1 A;  8ICM A;  1BPD A;  4RZR A;  4IJE A;  5KFB A;  4DR6 M;  1YE9 A;  2AHO B;  4DSI A;  2CHQ A;  2LHG A;  1NJW A;  2CV2 A;  2NO5 A;  1ORY B;  5EXP A;  3OSP A;  4FFD A;  4ZH4 A;  1SL0 A;  3V7L A;  3RF9 A;  8ICP A;  4KLJ A;  1N75 A;  2P6U A;  2HSZ A;  4DUZ M;  5J0Q A;  5J2K A;  3NWL A;  1DGS A;  2F3N A;  8ICU A;  1TGU A;  4DQS A;  3WKD A;  1IY1 A;  2VDB B;  5DB9 A;  1H38 A;  1WJ7 A;  5ALG A;  3TAP A;  2ZIV B;  3JPS A;  2YNM D;  4DSK A;  3ED5 A;  4YVZ A;  4Y2S A;  1D8Y A;  2A19 A;  2H1R A;  2KZS A;  3M8S A;  3PMN A;  4F1I A;  2ASD A;  2UVR A;  2JA2 A;  2XEP A;  4O3Q A;  1V85 A;  1IXR A;  2PI5 A;  3LWM A;  1ZMU A;  4L6V 6;  1N2X A;  9ICA A;  5EP2 A;  2H3Z A;  3ETR A;  3HHX A;  4RQ3 A;  2KTQ A;  4UAV A;  3R9K A;  4CDG A;  4M6W B;  3BZK A;  2M5Z A;  4I28 A;  3NS1 A;  2LNH C;  5J0P A;  4LG2 A;  8ICH A;  3MAB A;  1SXJ D;  2W04 A;  5EWF A;  2FH0 A;  4YFK A;  1T43 A;  2ZG6 A;  5DBB A;  3KHH A;  1Z4O A;  3UMM A;  2KZZ A;  2QEN A;  3CF2 A;  1KEJ A;  1D9D A;  2Z8Y M;  4MFC A;  3OHB A;  1BGX T;  4QNM A;  3AL0 B;  3M0E A;  3DZD A;  1ZET A;  1PK1 A;  4DQP A;  4AYB C;  4Y2T A;  3DFZ A;  4EEN A;  4BB9 A;  4R7G A;  2ZBK B;  3GLF B;  3GRR A;  2D3D A;  4Z8X A;  3F5E A;  4BDP A;  4JI1 M;  3G6X A;  2V4R A;  3FRI A;  3J27 B;  3SBJ A;  5EE1 A;  5KFR A;  4MEY A;  4NLB A;  2OQ4 A;  1B4F A;  2J6T A;  4KLT A;  1PK3 A;  1S76 D;  5KFW A;  3KOO A;  5ALN A;  5KFS A;  2CN1 A;  2R0I A;  2A1A A;  3I28 A;  4ED3 A;  4DSL A;  5ALL A;  1V9P A;  5ALO A;  2W55 A;  1HEK A;  2LYB A;  1NZP A;  5ALP A;  4QZ9 A;  1X9M A;  3B0X A;  4TQS A;  2EZZ A;  1IY0 A;  2DI0 A;  1DOQ A;  2LI6 A;  2H5X A;  2Y0S C;  1RDF A;  2RRU A;  1SG9 A;  2KIV A;  2HHX A;  2Y0Q A;  5KG5 A;  4NXM M;  4DV2 M;  2XCA A;  4RQN A;  3NRW A;  1ZQD A;  1ZQE A;  2RRD A;  3UGJ A;  1MQ2 A;  1K3W A;  1XS9 D;  2I9G A;  4ACO A;  3GU3 A;  2K8A A;  3BS5 B;  2CHG A;  4RQ5 A;  3SMP A;  4KLE A;  3T6P A;  4MM3 B;  3SD7 A;  5KT5 A;  3DV9 A;  4DFK A;  2AGO A;  2HAK A;  1UHU A;  2KKV A;  3ISC A;  9ICU A;  1VDD A;  2WZJ A;  2JY7 A;  3OTO M;  7ICJ A;  4FS2 A;  4D80 A;  4QNL A;  3FTE A;  5F9L A;  1L8L A;  4KX3 A;  2GOL A;  1T3N A;  4YMN A;  2R18 A;  2FPL A;  4EEY A;  5IIM A;  4WW0 A;  1PZN A;  1ZD3 A;  3QAU A;  3PW0 A;  3F2B A;  3IM1 A;  3RB3 A;  1BPB A;  1X2I A;  3SAR A;  1X37 A;  3RAQ A;  4QHS A;  3SAS A;  2HOF A;  2WF6 A;  1SXE A;  4CF3 A;  4M9Z A;  2BQR A;  2YFQ A;  1KW4 A;  4J9Q A;  4KIT B;  5KFZ A;  1NJX A;  3AFH A;  4DV0 M;  2W9C B;  2XIC A;  9ICP A;  4LJ9 A;  2MSN A;  3AJI B;  3FRH A;  5KPT A;  3GLH B;  1X9W A;  2JEG A;  2WSF F;  4F50 A;  1RG6 A;  5AKI A;  3WK4 A;  2BJV A;  4D81 A;  2OWO A;  4DOA A;  2YTU A;  1KSP A;  4HLQ A;  3A42 A;  2CV0 A;  1NNU C;  1T3Q A;  3C3E A;  4BBA A;  1NKE A;  2HW3 A;  4IQW A;  3SAV A;  2L4F A;  9ICE A;  1BPY A;  1QZE A;  5CP2 A;  1NK4 A;  2KZM A;  1WWU A;  4FWG A;  5EWG A;  4UB3 A;  1F44 A;  2E8N A;  1SXJ E;  3GQ4 A;  1SWW A;  2DKZ A;  4Y28 F;  2VJ5 A;  1ZQG A;  2QBY B;  1R4G A;  4WJ3 B;  3QWL A;  1OAO C;  3GRV A;  3AKZ A;  1GLN A;  3IN5 A;  2Z7J A;  4C8K A;  5KPR A;  4IBD A;  1QAO A;  2DWZ B;  4M47 A;  3KZX A;  4RPZ A;  4DR3 M;  4J9K A;  3FM9 A;  4HL4 A;  3D8L A;  5AM0 A;  1Z1B A;  3PX0 A;  2FS1 A;  2IA6 A;  4QNR A;  4GMQ A;  4EEK A;  1X40 A;  3V6H A;  2KEY A;  1V38 A;  3M7D A;  3WK9 A;  4DSE A;  4Y2Y A;  4Q43 A;  5ALF A;  4DV3 M;  4ECR A;  4Q45 A;  1IN7 A;  1KBU A;  4Z6F A;  4DL4 A;  1Q3U A;  4LZG A;  4RF1 A;  2W8K A;  1B0X A;  2NV3 A;  2XF3 A;  2DNA A;  3KFU F;  2KZU A;  3Q8G A;  1GO5 A;  3H8J A;  4I2A A;  2V1C A;  3L2A A;  4KHP M;  1QQ7 A;  4RQ7 A;  4KLG A;  1OIZ A;  4EBD A;  4XK8 F;  5HP4 A;  2C99 A;  1SIJ A;  1S8O A;  1T8E A;  1I4W A;  4P17 A;  5ITT A;  1ZQV A;  4AYB F;  2W7P A;  1OQY A;  3T5H A;  3B9P A;  1QSL A;  4LJ8 A;  2HWJ A;  4NOO B;  1UQV A;  5AKJ A;  3JPT A;  2XI9 A;  2WHE A;  3RTV A;  3MMP A;  2HBM A;  2KHQ A;  2EO2 A;  4FCT A;  5CB1 A;  3HWT A;  2KHV A;  3VDP A;  4DSJ A;  1QAM A;  2R8K A;  3SHG B;  3N7P D;  3K1J A;  2KRU A;  3J7B A;  3BQ2 A;  1MU5 A;  1GJS A;  5DB8 A;  3EPI A;  3HU1 A;  2KSO A;  5DKW A;  1Y88 A;  4F5Q A;  2R4E A;  3LDA A;  3J2P B;  3DEE A;  3VLF B;  3GIL A;  3QU7 A;  3GLI A;  3R8F A;  8ICA A;  1TTE A;  3EZ5 A;  4DO9 A;  5ALK A;  3Q8K A;  2Q0Z X;  2KNA A;  4LFA M;  3M6A A;  2AQ0 A;  3JPN A;  1B22 A;  4PJ0 U;  1DK3 A;  2AJQ A;  3TPZ A;  2CV1 A;  1ZMV A;  2HL7 A;  4MGI E;  4O5K A;  2R65 A;  3M9O B;  1TKD A;  4LJA A;  4AQY M;  1KL9 A;  3JR4 A;  2D7H A;  2ASL A;  5FTL A;  2UXC M;  4DOC A;  1SL2 A;  4R3D A;  3I4V A;  2RQ5 A;  1Z3E B;  5ALW A;  2E5L M;  1NY5 A;  2BWE A;  3FYD A;  4JUZ A;  4Z6C A;  3PV8 A;  4QHT A;  5ALS A;  4LZZ A;  3TWL A;  4C80 A;  5AIA A;  3MR3 A;  3ONN A;  4KX5 A;  3K2L A;  3KFU G;  7ICU A;  4LF8 M;  1S0M A;  3G6Y A;  1ZXI A;  1L2B A;  1S0V A;  3AV0 A;  2WF7 A;  3BQ7 A;  3RJF A;  2Y9U A;  4I4L A;  3AL0 C;  1XHB A;  3KOY E;  1OTR A;  1ZQC A;  1N33 M;  5KT3 A;  1EIJ A;  4PT5 A;  2PXI A;  1D0L A;  5B66 U;  1FJG M;  4NL9 C;  4OJP A;  1D0M A;  1O08 A;  4G3O A;  1WIV A;  1DGJ A;  4ITQ A;  2OM6 A;  1NOM A;  3UQ2 A;  1HUZ A;  3A0H U;  2GNO A;  1C7Y A;  9ICH A;  3H8W A;  2JZB A;  3WHL A;  2WB1 C;  4UAU A;  3PFI A;  2AGQ A;  5C1B A;  4KMO B;  4EBE A;  2YMM A;  3U6C A;  2GO7 A;  3MGI A;  1Z00 B;  2KEB A;  2K9D A;  2DWL A;  2GH1 A;  1ZQY A;  3PSP A;  1GKI A;  4B7F A;  4OJ6 A;  1G59 A;  4PD2 A;  2DZL A;  2W3S A;  2B6G A;  3CP8 A;  4P0Q B;  4RQM A;  5KAF U;  2K4E A;  4GC7 A;  2LBC A;  4AG5 A;  1Q46 A;  2G5H B;  2XID A;  2LM4 A;  3TAQ A;  3KVW A;  3PSI A;  2AH5 A;  1DO2 A;  1QUT A;  3AEV A;  4FO6 A;  3U6E A;  1JXL A;  4B9M A;  8ICG A;  3V7K A;  2BGW A;  5LMN M;  3C28 A;  4B6J A;  4KLI A;  3H0M B;  2X8A A;  2XGN A;  3W0F A;  2F76 X;  4NRW A;  5ITQ A;  1SGG A;  3VC8 A;  3JPO A;  2R46 A;  5FSW A;  4USA A;  3RAX A;  4FZN A;  1TH4 A;  4YHH M;  7ICN A;  3ZI4 A;  1UT8 A;  1QLN A;  5AM4 A;  4S12 A;  5KFE A;  4PGY A;  3A45 A;  3FTF A;  2QNJ A;  1NKB A;  2HHT A;  3K8Z A;  3M8R A;  3SAU A;  4F4Z A;  1CRX A;  5L1J A;  4M9H A;  2HKJ A;  2BPC A;  4YCX A;  4M9X A;  2P5T A;  2HOQ A;  2FE9 A;  4TUW A;  1IXZ A;  4MEX A;  4R63 A;  2HI0 A;  1G8P A;  2E5S A;  4G9B A;  5DDM A;  1N32 M;  2XO7 A;  5KTQ A;  1ZQO A;  2UVW A;  3H0R B;  4B9T A;  3I01 M;  3ZQJ A;  3C3D A;  3CF0 A;  1OW5 A;  3GPX A;  1N63 A;  2UVU A;  3RJJ A;  2ISP A;  4ECV A;  2R4J A;  1BPE A;  1EXN A;  5KFC A;  4ECY A;  3ZDB A;  1WCN A;  4NY8 A;  2F1J A;  4M6W A;  2NRZ A;  1IM2 A;  3LW5 F;  1U9L A;  2ATL A;  2W9M A;  4O3M A;  3V6J A;  4P4P A;  4J9N A;  2JY8 A;  5AKY A;  2UU9 M;  3HU2 A;  3PNV A;  3O0F A;  4AI6 A;  2JGA A;  4UB5 A;  3IP4 B;  2W9B B;  2CP8 A;  3RR7 A;  2C28 A;  2CEA A;  5JI2 E;  3QZ8 A;  4DR7 M;  1RPL A;  5AKE A;  3GV7 B;  5ALM A;  5AI0 A;  4DR2 M;  8ICI A;  1DO0 A;  3GLF A;  3L26 A;  3WK5 A;  5A0L A;  3BBZ A;  5J2C A;  2F44 A;  4NL9 A;  3RJE A;  2G0A A;  5AKH A;  4PGQ A;  1R2Z A;  4OJL A;  9ICI A;  3UXP A;  3PW2 A;  5ALU A;  2ZJ8 A;  4EEL A;  1XXH B;  5KT4 A;  1C20 A;  4DR4 M;  3JAM S;  4CGY B;  4F5P A;  2WSE F;  5DBC A;  3KS8 A;  3TAR A;  1SZH A;  3B89 A;  5HML A;  4QWE A;  3HT3 A;  3LWL A;  4EX7 A;  4K4H A;  3AU2 A;  3FDS A;  2JEJ A;  2EKF A;  4YXM A;  4JB3 A;  4JWN A;  1N36 M;  1RQL A;  2LHT A;  4UB6 U;  2RDI A;  1HT1 E;  3B74 A;  5F3X B;  1JI7 A;  3GLI B;  3QXG A;  2ZTC A;  1MX0 A;  4UN2 B;  4YG2 A;  1TAM A;  1W5S A;  3BQT A;  1S77 D;  3SHF A;  3KD3 A;  1K1Q A;  4AKH A;  2BZF A;  4M0A A;  1DRG A;  2AXT U;  4J9P A;  2MUT A;  2UXD M;  2PI4 A;  5KFT A;  4M9J A;  4R64 A;  3KOW E;  4FCV A;  3KW6 A;  5EP4 A;  4JI8 M;  4UB8 U;  1HR0 M;  4ECU A;  3HKZ F;  4KN4 A;  3SAH A;  3U6S A;  2DPJ A;  2DAG A;  4RQ1 A;  2IHM A;  1F5S A;  1RQN A;  4RNO A;  4OX9 M;  3BZC A;  2LKY A;  3K4G A;  5A2Q S;  1UM8 A;  3PX4 A;  4YD2 A;  4OW0 A;  3FKE A;  1LV7 A;  2VIX A;  3ORY A;  2WB1 F;  2WAQ C;  3QUB A;  1PGY A;  1XNR M;  3SMV A;  5HHI A;  4QJF B;  4FCW A;  1D0K A;  1NVM A;  2C2D A;  4A8E A;  2R8J A;  1Q39 A;  1JR3 A;  4IR9 A;  1DGG A;  2NYV A;  4IC9 A;  3W67 A;  1OUQ A;  1QAQ A;  1U49 A;  3L25 A;  5J2A A;  2YX8 A;  5KT2 A;  5DQG A;  2ISO A;  5DB7 A;  3GPU A; 
#chains in the Genus database with same CATH homology
 4AZF A;  3T1H M;  1H6U A;  5IT9 S;  4NV0 A;  2DWN A;  5LMU M;  2CN1 A;  1XWI A;  3U5Z A;  3U6L A;  1ED1 A;  1Q3C A;  2CHV A;  1EE8 A;  1HEK A;  4B3T M;  2LYB A;  2QCU A;  2F5P A;  3GLH A;  1IY0 A;  3F5A A;  4X65 M;  2X4A A;  2Y0S C;  3FUX A;  1E94 E;  2KIW A;  4JMU A;  1IQP A;  4JI3 M;  3L3F X;  3PSF A;  2Y0Q A;  4JYA M;  4NXM M;  4DV2 M;  4IBC A;  5E6J A;  3NRW A;  1IN6 A;  1NHW C;  2RRD A;  3T15 A;  3SYL A;  3LVW A;  3ZC7 B;  3UGJ A;  3U60 A;  3KXE C;  1K3W A;  2ZXI A;  4PL2 A;  4ACO A;  2D7E A;  4NL4 H;  3GU3 A;  2K8A A;  1KSF X;  3MGV A;  3LMM A;  2CHG A;  5ITY A;  3SMP A;  3J7A S;  4MM3 B;  2W7O A;  4NWI A;  5KPZ A;  3UK6 A;  4DV1 M;  3TWK A;  3D8B A;  2KKV A;  2KVC A;  2BJW A;  3I4Y A;  2F5Q A;  2QBY A;  1VDD A;  3LYS A;  4P16 A;  5DNY A;  4B3R M;  3SAG A;  2K47 A;  4NRV A;  4JI5 M;  2YQZ A;  3OTO M;  4LGM A;  4YY3 M;  1URJ A;  4D80 A;  3C29 A;  4QNL A;  3FTE A;  4JI6 M;  4KX3 A;  2GOL A;  4X66 M;  2R18 A;  4ICA A;  4OJ5 A;  2ZM6 M;  4L4U A;  2Z4R A;  4WW0 A;  4LJ7 A;  3L29 A;  3QAU A;  3ALR A;  4CIS A;  2H3I A;  4CHT B;  4B3M M;  3F2B A;  3GPU A;  4OO1 J;  3SAR A;  1HQY E;  1X37 A;  1R2Y A;  4MGZ E;  4QHS A;  3SAS A;  3M6Z A;  3F2D A;  1PVQ A;  2HOF A;  4DV7 M;  2AHM A;  2H3Q A;  4M9Z A;  2RHF A;  2QPA A;  2YFQ A;  1HNW M;  1L2D A;  4OJO A;  1L2C A;  1R7R A;  1K3X A;  2D7G A;  2L7H A;  5DYG A;  4MGH A;  5ITX A;  2PMZ C;  3AFH A;  2ZIX B;  3T79 A;  2MA1 A;  3NBI A;  1SXJ C;  2KIC A;  3GRY A;  4DV0 M;  3VFD A;  3FUU A;  1E9R A;  2XIC A;  3U5Z B;  4PL1 A;  1W5T A;  3MJ5 A;  1HIW A;  2C5R A;  4LJ9 A;  3TL4 X;  3AJI B;  1IN8 A;  5KPT A;  3GLH B;  2H3F A;  2G8L A;  1DGF A;  4M0W A;  4G4R A;  1D8B A;  2BJV A;  4D81 A;  2KW0 A;  2FFJ A;  4BJQ A;  4HLQ A;  3A42 A;  2CV0 A;  4U6P A;  1NNU C;  4U7C A;  7CAT A;  2M60 A;  4BBA A;  3AOE C;  4MGY E;  1J7K A;  3VCB A;  3SAV A;  2KNJ A;  1NNJ A;  3MHV C;  4NSO B;  2XZU A;  4LGY A;  5EP3 A;  1L6N A;  4FWG A;  1ZAE A;  3HKZ C;  1F44 A;  4FWH A;  1SXJ E;  3GPP A;  3GQ4 A;  3SAT A;  4M9S A;  2VJ5 A;  4BLC A;  2QBY B;  4M0D A;  4LY6 A;  4B08 A;  2V6Z M;  3QWL A;  3GRV A;  3DA1 A;  4GC5 A;  3AKZ A;  1GLN A;  3GLG A;  3PVS A;  2G07 A;  4L16 A;  2CFO A;  2VII A;  3IN5 A;  2Z7J A;  2ERC A;  4QOZ C;  1WUD A;  1TDZ A;  5KPR A;  4IBD A;  4RNA A;  1QAO A;  2DWZ B;  2KA6 B;  1TH2 A;  1PJJ A;  3LVV A;  4LRS A;  3KZX A;  3SMS A;  5BPV A;  1P7D A;  4DR3 M;  3IG5 A;  4HL4 A;  3D8L A;  4I8O A;  2YR0 A;  1Z1B A;  1YT3 A;  4GHL A;  2KJ5 A;  4IBK A;  4QNR A;  2HMX A;  1NSF A;  1TH3 A;  4GMQ A;  5C18 A;  3SFZ A;  4IBE A;  1E9S A;  3GQ5 A;  2KEY A;  3M7D A;  3H0L B;  4GKJ M;  4DV3 M;  2L6O A;  2X49 A;  1IN7 A;  2LBO A;  1ZQ9 A;  1IBL M;  1KBU A;  5C0Y A;  1Q3U A;  4JXJ A;  4RF1 A;  1J09 A;  3J80 S;  2NV3 A;  4IBB A;  2XF3 A;  4IBG A;  3KFU F;  3SQI A;  3OPX A;  2KZU A;  1GVN A;  2XSZ D;  4RF0 A;  1HNZ M;  2YB1 A;  4FZM A;  3LQR A;  4FW9 A;  4XGI A;  1XNS A;  3JR5 A;  4EIW A;  1UPH A;  2V1C A;  4B7G A;  3L2A A;  4KHP M;  1MA7 A;  1PM5 A;  1GL7 A;  3KDS E;  4W5W A;  2Z3X A;  4X64 M;  3VKH A;  2C99 A;  2XVT A;  2K4H A;  3A98 B;  3SYK A;  1I4W A;  2NQ8 C;  3FD9 A;  4C0Z A;  5ITT A;  3MK6 A;  1L1T A;  2G08 A;  1Z19 A;  2DHR A;  2WAQ F;  4OVZ A;  2VJ4 A;  4AYB F;  2W7P A;  2HHH M;  2KRK A;  2G5I B;  3B9P A;  4LJ8 A;  1G41 A;  4CRX A;  4NOO B;  4Z6Y A;  3C58 A;  2Q4T A;  2G06 A;  2C9O A;  2ZIW A;  2XI9 A;  1FNN A;  2XFS A;  1PVR A;  3KS4 A;  1GO3 F;  1T94 A;  2HBM A;  1T3T A;  5IWA M;  2KHQ A;  3ICX A;  3KSX A;  5FTK A;  4IBI A;  4FCT A;  4LF7 M;  3E0F A;  3AQE A;  3WHK A;  2KHV A;  3VDP A;  2HBL A;  1QAM A;  4LCB A;  5EXX A;  3SHG B;  2XLJ A;  2ZIV A;  4LJ4 A;  3K1J A;  3N7P D;  3NUQ A;  2KRU A;  2I7P A;  3J7B A;  4FWD A;  5KL8 B;  5CRX A;  1MU5 A;  4PDG A;  4XBO A;  3GLG B;  4B3S M;  4QOS A;  1QQW A;  2VKQ A;  3HU1 A;  2ZIU A;  2R4E A;  2DXI A;  3J2P B;  4NLC A;  4DR1 M;  3DEE A;  4KO8 A;  3VLF B;  2RGH A;  2F5O A;  3PNY A;  2QZ4 A;  1DGH A;  3DOA A;  5KO3 A;  3GLI A;  4IBF A;  3R8F A;  3HHW A;  3T38 A;  3FTC A;  3HHZ A;  1OJL A;  4LFA M;  3M6A A;  4JI4 M;  2KJ8 A;  3HJQ A;  2W03 A;  2UUA M;  3TPZ A;  2ZAM A;  2CV1 A;  3A46 A;  1SXJ A;  2HL7 A;  3ZH9 B;  1NJF A;  1Z5C A;  5BR8 M;  3PST A;  1ZQ1 C;  3U6O A;  3CRX A;  4MGI E;  2R65 A;  3VKG A;  4P0Q A;  2Y20 A;  2KKP A;  3ILK A;  4FZL A;  4LJA A;  4AQY M;  3JR4 A;  2D7H A;  2RP5 A;  2UUB M;  1QZM A;  1JR3 D;  2CPR A;  1KYI A;  4AW4 A;  4IBJ A;  5FTL A;  2UXC M;  2LYA A;  4R3D A;  1WXQ A;  3HU3 A;  3I4V A;  2VQE M;  3U61 A;  2BNK A;  4DUY M;  5IZ7 D;  2E5L M;  4I5S A;  1NY5 A;  1OFH A;  2A3V A;  3FYD A;  1Q3B A;  3HGI A;  3AOE A;  4DV5 M;  4QHT A;  2KOB A;  3FUW A;  4LZZ A;  3TWL A;  4LJ5 A;  1TDH A;  3K92 A;  4GRI A;  4L15 A;  3ONN A;  4OVZ B;  3I51 A;  3K2L A;  3KFU G;  4KX5 A;  2DZN B;  4LF8 M;  3D2Q A;  2ZAO A;  3RGP A;  2C98 A;  5ITR A;  1L2B A;  2DF4 B;  3AV0 A;  2FE8 A;  1NHG C;  3Q8X A;  5FTJ A;  1NY6 A;  2DZO B;  3U60 B;  4I4L A;  3GRU A;  3TQS A;  4OU7 A;  4G6Z A;  4GIP A;  2EUC A;  1XHB A;  3KOY E;  2XH9 A;  1JQJ C;  4GHA A;  4QIW F;  1N33 M;  2OYY A;  4PT5 A;  5EXS A;  2PMZ F;  3F2C A;  1NZB A;  1FJG M;  1YUB A;  4OJP A;  3CTW B;  4DV4 M;  2OM6 A;  3GQ3 A;  4ITQ A;  2C96 A;  2J7O A;  1C1K A;  2ZIU B;  4FE3 A;  2LXE A;  1IN5 A;  1QYR A;  1DGH B;  3WHL A;  2H3V A;  1DGB A;  2WB1 C;  3PFI A;  4JV5 M;  4GC9 A;  3CYM A;  5C1B A;  4KMO B;  3M6K A;  3E9S A;  3U6C A;  1J5E M;  1HQC A;  2HBJ A;  2KEB A;  2CE7 A;  1OFI A;  2DWL A;  2GH1 A;  3FUV A;  4G4N A;  2F2A B;  3K1Z A;  3PSP A;  1GKI A;  4B7F A;  4OJ6 A;  3T1Y M;  1SXJ B;  1G59 A;  4PD2 A;  2EA0 A;  2BDU A;  4L78 A;  2A5Y B;  4I81 A;  2L7I A;  4II7 A;  2CUZ A;  1Z5B A;  2K8C B;  3CP8 A;  5KL1 B;  3THG A;  4P0Q B;  2E1F A;  4D82 A;  5HR6 A;  2J7N A;  2K4E A;  1Z6T A;  2QP9 X;  1IXR C;  4AG5 A;  2G5H B;  2XID A;  3KVW A;  3HJS A;  3PSI A;  4BX9 C;  3SC3 A;  2ZXH A;  3PZP A;  4CGZ A;  1DO2 A;  2YB4 A;  4GFJ A;  3U6E A;  3R9X B;  3PXG A;  1GL6 A;  1IIP A;  4P0P A;  4FD2 A;  3H4M A;  4L8R C;  5ITU A;  4AG6 A;  4JI2 M;  5LMN M;  5DYI A;  4DV6 M;  2I7N A;  1KFV A;  2KJ9 A;  3C28 A;  4LF6 M;  3KSJ A;  2F5S A;  4LFB M;  3RFA A;  3RE8 A;  3FYC A;  3H0M B;  2X8A A;  2XGN A;  3W0F A;  2F76 X;  4NRW A;  5EJC A;  4A3V B;  5ITQ A;  1A6S A;  2JMG A;  3VC8 A;  1G3I A;  2R46 A;  2L09 A;  5FSW A;  4PCZ A;  4FZN A;  1HT2 E;  1TH4 A;  4YHH M;  4GKK M;  2DVW B;  3EIE A;  3ZCB B;  2F77 X;  3HKP A;  1XNQ M;  3BOS A;  4S12 A;  2OPF A;  5F3W A;  1QAN A;  2N1R A;  1XXH A;  3W0L B;  4REZ A;  3A45 A;  3FTF A;  1D2N A;  2ZIX A;  4NSR A;  2M0N A;  3K8Z A;  4B7H A;  3EIH A;  4MB7 A;  3SAU A;  4MGK E;  1NJG A;  1CRX A;  3GP1 A;  5H37 D;  1XMO M;  2HKJ A;  2Y21 A;  3L28 A;  3CF6 E;  4M9X A;  5KQD A;  2P5T A;  5FLX S;  4X62 M;  1IBM M;  2HOQ A;  4FVM A;  3AL0 C;  4AKI A;  3U6D A;  3N7R C;  4TUW A;  1IXZ A;  2Y0T A;  4JI0 M;  1N77 A;  2D6F C;  2UXB M;  3D2S A;  3IG8 A;  2E1E A;  1G8P A;  2E5S A;  1N32 M;  2RGO A;  3GZF A;  5KQ8 A;  3H0R B;  2UUC M;  4LF4 M;  2G5G X;  2DWM A;  3CF0 A;  3VDU A;  2Y0S F;  4DR5 M;  1Z5A A;  1IBK M;  4AKG A;  3GPX A;  4G4O A;  1G4A E;  4WUR A;  4LRT A;  2R4J A;  3GO8 A;  5EXT A;  3TWM A;  4LF5 M;  2V1U A;  1HNX M;  4KLN A;  4LFC M;  1Z59 A;  1IM2 A;  5HR7 A;  4BUG A;  3F53 A;  4O3M A;  5FTN A;  1XMQ M;  2FOI C;  1K82 A;  1PVP A;  5E26 A;  2UU9 M;  3HU2 A;  3PNV A;  1E32 A;  1QVR A;  3HHY A;  3TE6 A;  3O0F A;  1XO0 A;  4K0K M;  4G4Q A;  3VK7 A;  4JI7 M;  4AI6 A;  4P0P B;  2VQF M;  2JGA A;  4IJE A;  3IP4 B;  4DR6 M;  1YE9 A;  2CEA A;  5JI2 E;  4KOD A;  1A0P A;  2CHQ A;  2KXE A;  4DR7 M;  1R6B X;  2CV2 A;  1ORY B;  5EXP A;  3VK8 A;  4DR2 M;  1PJI A;  1DO0 A;  3GLF A;  3L26 A;  3RF9 A;  2F8L A;  5A0L A;  2XSZ A;  5EP1 A;  5EQT A;  2Z4S A;  3GPY A;  1N75 A;  2G0A A;  4QIW C;  1R2Z A;  4MH0 E;  2KD1 A;  4DUZ M;  3LQQ A;  4OJL A;  2ZIW B;  4LZJ A;  2G09 A;  3KOX E;  3RFW A;  1XXH B;  3UJN A;  3NWL A;  4DR4 M;  3JAM S;  1TGU A;  5T14 A;  4CGY B;  3E4R A;  1IY1 A;  4GIT A;  3FTD A;  3FUT A;  3KS8 A;  2LH0 A;  2ZIV B;  1SZH A;  4IJF A;  3HWS A;  2YNM D;  3KP1 E;  2JH1 A;  1L8Q A;  4NXN M;  2H1R A;  2KZS A;  3HJ8 A;  1N36 M;  1YSY A;  2LHT A;  2RKO A;  3RGS A;  2HOI A;  1XC8 A;  1HT1 E;  2JA2 A;  2XEP A;  4PDI A;  3U6M A;  4JN6 A;  3GLI B;  5IRE B;  2R45 A;  1MX0 A;  3UZU A;  1TAM A;  1W5S A;  2HBK A;  2MRL A;  2LWX A;  3N7S C;  1ECW A;  3SAF A;  3AQF A;  2OXO A;  3SHF A;  5EP2 A;  3AOG A;  2H3Z A;  4AKH A;  3HHX A;  1IN4 A;  1Q3V A;  2Q2E B;  2XZF A;  1DRG A;  2UXD M;  2HCB A;  4CDG A;  2OH2 A;  5JI3 E;  4LJ6 A;  5FTM A;  3M7G A;  2JHD A;  2M5Z A;  3KOW E;  4FCV A;  3KW6 A;  5EP4 A;  2LNH C;  4GH9 A;  4JI8 M;  4LF9 M;  2ZAN A;  4LG2 A;  4WJ3 B;  1SXJ D;  2W04 A;  1HR0 M;  3SAW A;  3HKZ F;  3SAH A;  3U6S A;  2ZG6 A;  2DGZ A;  3KOZ E;  3UMM A;  2C9C A;  2QEN A;  1IXS B;  1N34 M;  1S3S A;  3CF2 A;  2XFT A;  4ZPX A;  4OX9 M;  2F4V M;  8CAT A;  2LKY A;  3U61 B;  2O5R A;  5A2Q S;  1N78 A;  1UM8 A;  5ITX E;  4OW0 A;  3FKE A;  1LV7 A;  4QNM A;  5GKN A;  3AL0 B;  3M0E A;  3DZD A;  2VIX A;  2CRX A;  3J81 S;  2WB1 F;  2F5N A;  3U6Q A;  2WAQ C;  4AYB C;  2K8B B;  3DFZ A;  2W82 A;  4IIW A;  1XNR M;  2R62 A;  2JH7 A;  4BB9 A;  3KP0 E;  3L27 A;  4R7G A;  3SMV A;  4QJF B;  4FCW A;  2ZBK B;  1NVM A;  3GLF B;  2KV2 A;  3GRR A;  4Z8X A;  3F5E A;  1L1Z A;  2FNA A;  4JI1 M;  4A8E A;  2K89 A;  1Q39 A;  1JR3 A;  2DQN B;  1DGG A;  3J27 B;  3SBJ A;  4IC9 A;  2K4I A;  1IY2 A;  3D2N A;  4NLB A;  2OQ4 A;  1OUQ A;  1QAQ A;  3L25 A;  3U6P A;  1I94 M;  2YX8 A;  2EO2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...