2Z7UA

Crystal structure of h2o2 treated cu,zn-sod
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
151
structure length
151
Chain Sequence
ATKAVCVLKGDGPVQGTIHFEAKGDTVVVTGSITGLTEGDHGFHVHQFGDNTQGCTSAGPHFNPLSKKHGGPKDEERHVGDLGNVTADKNGVAIVDIVDPLISLSGEYSIIGRTMVVHEKPDDLGRGGNEESTKTGNAGSRLACGVIGIAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of H2O2-treated Cu,Zn-superoxide dismutase
rcsb
molecule tags Oxidoreductase
molecule keywords Superoxide dismutase [Cu-Zn]
total genus 35
structure length 151
sequence length 151
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2007-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 2z7uA00
2AQNA 2Z7YA 5KBMA 3CQPA 2AQQA 4OJAA 1ESOA 2WZ5A 1KMGA 3L9YA 3HW7A 3GTVA 3S0PA 1SXSA 1JK9B 1SPDA 3GQFA 2ZKWA 2AQRA 3ECVA 2AQPA 2SODB 2Z7WA 3HFFA 1OZTG 1DO5A 3QQDA 1DSWA 1OEZW 1XSOA 1YAIA 2C9SA 3KM2A 2NNXA 3T5WA 1JCVA 3KM1A 3GZOA 1PTZA 3RE0A 3PU7A 2WKOA 4A7UA 4FF9A 3KBFA 1FUNA 3KH4A 3CQQA 1RK7A 2Z7UA 1IBFA 1QUPA 1CBJA 4U4IA 1HL4A 3F7LA 2ZOWA 4A7VA 2APSA 4A7TA 1CB4A 3SODB 2E46A 2WKOF 1F1DA 2WYZA 1F1GA 1UXMA 1AZVA 4A7QA 1E9OB 1B4TA 1OAJA 2AQTA 2GBVA 3MKGA 3H2PA 1MFMA 1E9PB 1N19A 1PU0A 2WWOA 1BZOA 1PZSA 2WZ0A 2WYTA 2XJKA 3ECUA 1JK9A 5KBKA 2R27A 4N3TA 1IBDA 1YAZA 1F18A 2VR7A 1BA9A 1XTLA 4L05A 1Q0EA 2WWNA 3LTVA 4BCZA 1COBA 1OALA 1SDAB 1IB5A 1SRDA 2C9VA 4BD4A 4A7GA 5KBLA 1U3NA 1F1AA 2AQSA 1XTMA 1E9PA 3QQDB 4N3UA 2JCWA 2Z7ZA 4MCMA 1SXZA 2GBTA 4BCYA 1L3NA 1E9OA 1SDYA 3H2QA 3ECWA 1EQWA 1EJ8A 1TO4A 3L9EA 3F7KA 1YSOA 4MCNA 1Z9NA 2AEOA 2ZKXA 1SOSA 1B4LA 3CE1A 3GZQA 3KBEA 1TO5A 3K91A 2AF2A 1N18A 1IBHA 1HL5A 4OH2A 4A7SA 1UXLA 1SXNA 3MNDA 2ZKYA 3HOGA 1OZUA 1E9QA 2E47A 3KH3A 2Q2LA 1Z9PA 4B3EA 1S4IA 3GTTA 2JLPA 1SXCA 1IBBA 2XJLA 2VR8A 1SXBA 2WZ6A 2GBUA 2VR6A 1SXAA 2V0AA 1P1VA 3GZPA 4A7GF 2LU5A 2K4WA 2C9UA 1E9QB 5CU9A
chains in the Genus database with same CATH superfamily
4KHXH 5FW8A 4EUPG 4LCWB 1ZS2A 3PDDA 3RNKB 2OMVA 4CMHB 4XGZB 1KBWA 4JX0A 2QFPA 1K72A 4XN2A 1EGJL 1TEFA 5AW3B 3LNEA 5DO2D 2YAFA 12E8H 3RWGB 4WY7L 1D6EA 5KJRL 4U33A 3CHQA 3RWJB 3MRQB 2DOCA 3FN3A 1JWUB 1CG9B 4FXTA 5INDA 1KGCE 4UQIM 3ROLB 4F8PA 4CL7A 1MH5B 4NN7B 1MFAH 3EGSB 1JZGA 3L54A 1ZLUH 2ISDA 3BEWB 5B3JE 2ESVA 2GPZA 1RUQL 3TPKA 4ZQKB 1YYMH 5E23A 1RK7A 4RDQG 3QG6B 1IBFA 1QUPA 4X5WA 3TA3A 4XB8A 1QATA 1NLBL 4TNVK 5F7MC 1ASOA 1IVLA 1EEZB 3FQRA 3MRMB 4MQXD 3FQ1A 2BIQA 3JVGC 1SDDB 1T1XB 4H20L 1JPEA 3MRIA 2XN1A 3HE7C 1I53A 1UD5A 3EJPA 3ARBC 3BH8A 2LQRA 3KWWA 4K7FB 1OAUH 3K1DA 1NCTA 1NGQH 4LB8A 3HFMH 4K3EH 1R9FA 1CGSL 2F8OA 2NY2D 2O5YH 1PJWA 4DK3A 3QFJD 1S7VA 2BSEA 4BH7B 1U8JB 4HUWB 5EFIA 3ZHLA 1QOKA 4Q58C 3PUCA 4MA3B 1F18A 1FL3A 4TL4A 1Z9SA 3PQYE 4L18A 4IOSD 2ZPKL 5D5MF 2F6AA 4LCIH 1QSVA 2HT4C 3HG5A 1XIWA 2BVPB 4UIKL 5B39A 5D5ME 5GRZA 1E9PA 2FWOB 2ZXGA 3EW3B 3VRIA 5CMAA 4Y5YA 2CK0H 3F6LA 3QO0A 4IU2A 3CFKB 3GGWA 3RTLA 3UIZA 4XE0A 1UENA 1ZSHA 4NZJA 1UM4L 1TEGA 1P84K 4KKBC 1NCGA 1E8YA 3LN9A 3QFJE 1MRDH 2F7QA 5DC9B 4NQXA 3WFHB 3WUWA 3FU0A 4YHKH 1ZVHA 2YIHA 1NGWA 1OT4A 4CDHA 2BLFA 3NSJA 2LVEA 4FQLH 5CJXC 3MROB 1HIMH 5JIQA 3JTTA 4BYHA 4P4KD 1TZGL 5DJAA 4GAGL 3MJ9A 3TN0C 2AZAA 3RWCA 1S7QB 1AD0B 1SXBA 3W1ZA 4ODWA 3WU1A 1WE5A 1DJZA 2NDFA 4FQJL 1MCPL 5JR1L 4A7GF 2R2BB 3BX7C 4DP6X 2CKBB 3MR9B 4WEEA 2OAAA 3SPGA 1F86A 4YO0B 3SOBL 3VFWA 3ZSTA 1WZKA 1ESOA 4LSUL 1RMFH 3SYPA 1IAKB 2XG4A 1DE4A 4P23A 4RFEB 2F8VA 2CO2A 3NABL 4HJEA 3T3MB 4J3WA 3QJQB 4C4UA 2ZKHH 1DLHA 3C8DA 3CMOH 1CQKA 1R3HB 5CP3A 3C60C 2I25N 3CXFA 3D50A 1EMTH 3DV4B 4FMFA 2Y7QB 1EEYA 2LAGB 2XY2A 1USZA 3O6FD 4K4KA 4TVPD 3RJOA 4CGTA 3JV4B 2CDGA 1MOEA 2D0FA 4X4XA 4K71C 1TETL 3EDFA 3KBFA 2R69L 1VSCA 4XHQA 4RBPK 4AK1A 1QHOA 1RIHH 3FUNA 1OM9A 4NKMA 1DVFA 1UM5L 1UVQB 1WBZA 2ATKA 3ATAA 3HLAA 3U2JA 2QELA 3B83A 4X99A 4KH9A 5IOPB 4AVIA 3ISWA 3I6KA 4AYMC 1I1AD 1YY9C 3F83A 1RUAH 4P5TB 4WJ5A 3FCTA 5KZCD 2XJKA 4ZS7L 2FX9L 3LMJL 1I8UA 3MBXH 1P4IL 1LVEA 4N4YB 5DMGD 3T8VA 4XBEH 3FONA 1DEEA 3DX8A 4FG6D 4YDKH 5B8CB 1GGCH 2P5WD 5HGHB 3P4OA 2NY4D 2R15A 2NPLX 3UO8B 1I7RA 5BV7L 4XC3H 2B15A 3RTQB 1IM3D 4HEME 3PAVA 4L9DA 1I1RA 3ME0B 1TYEB 2H6PB 1S9WB 1X5HA 3S3CB 3F5WB 1WISA 2XWRA 4QKXB 5AAPA 2PPFA 2XACC 4YXKH 1OLLA 1O7DE 4LVOB 3DDFA 3NH7H 5DZ9A 5TDNA 2YGQA 1T1YB 4PJEE 2Q1EA 4AXWA 1PZUB 2EE0A 2VDNB 3WIHA 3KCPA 2ZCZA 4YS4A 1M7DA 1OZUA 4FXKA 4JO3H 5L7XL 1GVIA 3EGXA 5F72S 3MYZA 5D93C 3RAJL 3IJ7A 5IB5A 2PXYD 1T04A 2NY3C 5HGBB 3CPLA 4ZX3A 1KPRA 4HLJA 4NQDB 5KG9B 5K9QG 1MQKH 3SBQA 4JLRA 2DQIL 3WN5A 1HH9B 1UZ8A 4Y4HA 2ROYA 3WIIL 1EHAA 4UTCA 5A1AA 3PIQB 3RG1C 3TYFA 3QYMA 6TAAA 1GZQB 1QSFD 2D7OA 2CNZA 4I87A 5IT2H 3VXPA 2C3HA 1YLBB 1KXVA 5FGCE 2J56A 4BINA 4PRIB 4D3CL 2APTA 5T3ZE 1WD8A 4L8CA 4ZO7A 3KPPA 3ZLQC 2DQJL 4P5SA 3BVXA 4H8PA 5BV7C 2ADIA 2BDNH 4J3VA 3OAWA 1AS6A 1EIBA 4U7KA 1I75A 2BP3A 1NSNH 1R5IB 5HI4D 3GSVB 2YA2A 1NC4D 3VTMA 1R47A 3NIGE 3CSTA 4N2HA 2VM9A 4DKEL 3S96B 1ACZA 4AEIH 3IVKA 4XCFL 5DD1L 3QJZA 3ZDXF 3MGTA 5DHEA 4YHIA 3X14B 2CBPA 4JW3A 4YNYB 4V11A 5FUOH 1IGJA 4NQCE 1KY6A 4DKAA 4IHBA 3U9PL 1CQYA 3U2SA 4O2FB 4PAZA 4HJIA 1KULA 3SGEH 2WLLA 2W9EL 4G9DA 4X8XA 1MAML 3CFCL 1JPGB 1U6AH 2DKUA 4X7TB 3UZVA 4J8RB 4TN9A 4Y5VB 4I88A 4XO4A 2FAUA 1KTJA 4GQPH 4ZX5A 3WFCL 1MJ7L 1XAKA 2XETA 3DPBA 1MVUA 3VFSB 3V4VL 5T1KA 4TUJB 4RWHA 4EZLA 3QJXA 1CICA 2F54A 3SCMB 4AK2A 4D0BA 4JFDA 2WWMD 3TH2T 2X2IA 3UPCA 5T1KB 4QHLA 4Z7VF 4YLCA 3KLHC 4ZOBA 1MPAL 1UTDA 5AKTA 3VTTA 2AITA 3IK2A 4GXFA 1A6TA 3IBOA 4WUUE 4IIZA 4JY5L 4GO9A 3D09A 5IJVA 5EOTA 4BCYA 1JPGA 1S8DA 1AZUA 3HG0A 5LUMA 2H32H 2YAHA 3WDIA 4EDWL 4OZHF 2OW6A 5JW4Q 4O2FA 3KYKH 4UQEA 4ZXBB 1IGJB 4K7PY 2KZBA 3QEUB 4TSCH 1Q9LA 2Q3AA 3MGTB 1YEHL 1UA6L 1AOHA 2F7RA 4NN7C 3A22A 1QKZH 2AKRB 3MFFA 4ONGL 2L0DA 4W4NA 2ZKYA 4EZJA 1TNMA 5DD0L 4WNQB 4Y2DB 2E47A 4BUHA 5C3TA 4JUSA 2A6JB 1IBYA 1RK1A 4MGXA 4PJ5A 5FYKD 5HJBA 5T1DH 4QOKE 3QDGD 1CGSH 1MZYA 5DGQA 5GRJL 4EKXA 1FNSL 3DMMC 1AYRA 3C60A 1MLBB 5IKCA 4N87A 2K9UA 3KPPB 3SDXF 1FIGH 4F8TA 3CXDL 2ZP8A 4F2FA 1CK0H 5LGJA 2WXHA 4OQTL 3PIQA 5MP6L 3D2UD 4NIKB 4LOUD 5CIPH 1CLYL 3CD4A 4NDMB 3TGXA 2UWEE 1FFOA 4Y19A 1HWWA 2QPDB 4XBMA 4JRWA 3NPZB 4ZS6C 2WWKT 4CVWA 5AB0A 3QFDA 3IBEA 3RGHA 4WW2B 2YAQA 4N8CL 5IB5B 3QZWG 5F96H 1U3ZA 2E7BA 1XV8A 4Y2DD 1WAAF 3ML9A 1TR7A 3ZDYE 3G5ZB 3HEIB 3BKML 3FU3A 4JCMA 3MCYA 3LJ3A 4OLXL 4ZG1A 5G4MA 2DI9A 3Q2NA 2CD0A 2RQ8A 1UOLA 4QT5B 3V5DB 2EH7L 5B1CA 2QV2A 1E4KA 2E46A 3U25A 3U6RB 3HZKA 3GI9H 4OJFL 1M2VB 2GB2A 5INCB 2XZAH 3PWUA 2FSDA 3N44F 1OAJA 1IJ9A 3V4VA 3MLRH 3IDGB 4AMKH 2F8XC 1YHPA 2NY0C 1MCQA 1TTCA 2WQUA 1I7RB 1Z66A 3HR5B 4JFFE 2H47C 3PRZA 4OJCA 4RMTA 1HN1A 2P49B 4HW6A 2KQNA 4AQ1C 5DF0A 5B8CA 5GZNA 1IBDA 2QZ5A 4J1UB 1JBJA 3S35L 4X7SH 2N4IA 1U41A 4X6CE 1URIA 4HZLB 1D5BB 4KROD 4TUOA 3IKKA 4P07A 3N43B 2J8UE 4YHPA 4MA7L 1Q94A 2P48B 2R2CA 5AZEH 4D9QE 4YDIL 5EWIH 5I26A 3FT4B 1QG3A 4KI5E 4O58H 5CSBA 2XWCA 2E7DA 4ONGH 1IC5L 3IU3A 5EUOB 5L0QC 3KR3H 1F3JA 3SKNB 1JJUA 4MRBA 4P5KB 3ECWA 4OLYL 4O58L 3QDJE 4WENB 3JV5A 3JZ7A 4G42A 2IV9A 2ZCHL 5AZ2H 3MO1B 4HA1A 4J3OF 3WY2A 4V33A 2WNGA 2WOYA 4GKLA 2J55A 1B2YA 4P2QA 3PDGA 2GY5A 4JE4B 4X7DC 4X4XB 4LARH 4YXHH 4NZUH 4PCKA 4PJ9A 4DGYL 4YGAB 4UILH 1BD2E 2JQMA 3DVGA 1PZ2A 3KWUA 5DHDA 2C5DC 3MV9D 5IIEB 1DVTA 4DPRA 5I1HL 1EH9A 3RVWC 2X88A 3COOA 5JTWA 3OGCA 1U8IB 4N2OA 2A83A 3N43F 3O6FC 5KBMA 2OMWB 3AMKA 3SE8H 1PY0A 2EH7H 1IAKA 1O6SA 4ZUSA 2JJTC 3ENEA 1RP9A 5FUZL 3S0PA 1F02I 5J89A 5L8KB 4J39A 4FTDA 4H1LH 3T4AB 2EABA 2JK5A 3CVDA 1QFWL 4M5ZH 2G3ZA 2B16A 1L0XA 2NY1D 2GK0B 4GRLB 1QFUL 1CPUA 5F7YC 1I1AC 3FQUA 3ZT5A 4MB4A 2QKSA 1VFMA 4F7CB 1F11A 3D0LA 3ZDWA 2CJUL 5L4MA 3TTSA 1WFIA 3N04A 3C6LD 2DM3A 4HWEL 3TV3H 4FF9A 1ZSDB 5D2LB 3J07A 5GGRY 1GGYA 1FUNA 2VLRE 3ATEA 5D7HA 4GYBA 1NM4A 1NFDB 1MCOH 2FX7L 4ANKA 2CJUH 3WJLA 4M00A 4L0ZA 2XQBL 5D72H 1S3RA 4I0KA 3PNRB 2CO3A 2DJSA 3VYNA 3FSVA 3QJVB 4P2OD 4F3FA 1KCKA 4PJFF 5CZXD 2ZSVA 1QR1A 5J11B 4HJGA 5B1JC 4RMQA 3IE9A 2MRYA 4ODSL 3KCWA 4F9LC 3B9VA 1UEYA 2XV2A 1E9PB 2FWOA 2ZTBA 3B2UC 2V37A 2VB5A 4YDLC 5EZIL 5TK2A 3RZCC 1FNSH 2VDOB 3BPOB 3IWUA 1ORQA 2ALWA 4X8JB 1CXFA 1YAZA 5D9SA 1NMCB 3GMLB 1RJYA 2MCG1 4MA3A 2A4CA 1PL3A 3LKQA 1ZIAA 2BSCA 4HUWA 2YUZA 5D7JA 4J3UA 3QQ9D 3WIFB 2CSPA 2WSPA 3FUFA 4HJGB 4L3EA 3VXRA 1BAFH 4GG6F 5T5FH 2ZG2A 4FABH 3OSKA 1UM5H 4H8WC 4NNPH 3MRIB 1F8TL 1R3LB 1A8JH 5GS0D 1N8OE 4ZDHA 1FO0L 5AEAA 5LNEA 3OKNB 1EEZA 5D7JC 2DQEL 3ARTA 3MJ7B 3P0VH 4PRHA 2DBJA 1BMGA 3QIWD 5IJDC 4JK0D 2QKIA 3WEXA 3EFOB 4XC3L 2ESVB 3TH3T 5IGXH 1X5AA 4EVNA 4PCSA 3FQUB 3VXMB 3QQ4B 5KSAC 3DXAA 1HJBC 3P77B 3ROLA 5INDB 2B1OA 5C0CB 5DD5H 4JDZA 1JWUA 3MGOA 3RWDA 5C9KA 2NR6A 3M07A 5HP5A 1I3UA 1G7JB 2Z1PA 2LU5A 5EEWA 4M1GH 4H8WL 3F00A 2ZWSA 3OHXA 2GSIA 4KJPC 2A83B 4KV5E 4Y2LA 4Q74A 5L2KB 1TCRB 3REWB 3RNKA 1PCSA 1HL9A 2BVQA 4GBXD 3PQYB 2AV1A 2ENQA 3BMWA 1ZT4B 3ESVF 5E24E 4TPRL 4TUKL 3R7RA 2KERA 4L3CA 3QWRA 5FGSA 3HJEA 4Y16D 1G7PA 1YEHH 2XN9A 1YEEL 4QXVA 3OVUB 4LCVA 5FA3A 1R24A 4IGBB 1AHKA 3CZEA 1BLNB 3X3GH 3MO1A 2JB6A 1LILA 4NLHA 1FYHB 3GZKA 1Q72L 4PJBB 1NDMB 5H35A 4BFGA 3MA9L 2CK0L 4W9ZA 2YWZA 3H85A 2NY5H 2J6EL 2XZQH 2XHNA 5EC1B 3AFLA 1P84J 1W0YT 2ZPKH 3CZFA 4KFZC 5E1IA 4P46A 4XHJC 3NIDF 5HHOE 1MN4A 2WXJA 5KTEH 1CT8B 1FO0B 2WQ8A 4JO1L 1PZSA 1RPKA 4XVTH 5ICYA 3WUZA 4TUOB 2ITDA 4FQQB 2H7WA 5HGDB 1FZMB 2Z31B 1U3YA 5F2FA 1J05A 1RZ8B 2BSRA 2DDQL 2DL2A 1EEUA 3QDHA 4PS7A 1F3RB 3MBWA 2HB0A 4KGJA 4XVJL 1U8HB 5KBPA 3TBVB 4Z1PA 5INCA 3H2WA 1MNUL 2XIIA 5F7AA 1ADQH 3NT0A 2K7PA 5DT1L 1U93A 1J8SA 3DOIA 4GAGH 3O4LD 3P2BA 1NFKA 1TZAA 2J88L 2LFEA 2NTSP 1AGDB 4L4TA 4Z3IA 1BZ9A 5EG6C 5F1OB 2WUBL 1QRNE 3C08H 5EU6E 2FLMA 5DEGB 3CFIC 3EOTH 5GGSA 2FJFB 3RIFK 4WHYH 5ITFA 1RHHA 1OV8A 4HIPA 4HIJA 3PWJB 1LNUB 4Y4KA 5CN1A 1W72A 4HGWA 1UQSA 1UA7A 1BEYH 1AQDB 2UY7A 2XQYA 5AUMA 1YDPA 4L29B 2CDFB 3O2WL 5KS9A 1R33A 3CK0L 4OB5H 1S7TB 2A9NH 1RZFH 2YK1H 2PPEA 5HDBF 3WS6A 5L2JA 3QUYA 2FUQA 4FKHA 3NDZE 1YNTA 1QRND 3FAWA 2WQXA 5A3ID 2J3SA 3CK0H 4OB5L 2EKJA 3QI9A 2C7UA 5JHDE 4LSTL 3ASOB 3MRDB 4KNTA 1I85A 2DD8H 2A9ML 1MLBA 1G7MB 1KWKA 3D69A 3JWDL 2WZPD 4CSSA 3DMMD 4ELMB 3KDPB 3DHMA 3V4UL 1UACH 3PS6A 5DRZA 5FDWB 2A6JA 3K2IA 1Z7JA 2JELL 1TQBB 1SYSA 3FHEA 1SBSL 2V17L 4N0RA 4PRPB 4WNQA 2Y6SD 1RL1A 1BGXH 2YRZA 3LQAC 4GI8A 3ZE2E 4EDXA 4ETQA 4PJ5D 3T5WA 4G8FB 2BERA 4LSSL 2AKRA 3UEZA 2NT1A 2OSXA 3PDOA 3PP4L 4WI7A 2EO9A 4XWGL 5CKAA 3GSQA 1IGIH 5ES4B 1BM3H 1UHVA 2I9LA 3CWGA 2NX5D 4M7JL 2Y07H 5KYYB 3KE0A 3MODL 4BQ9A 3CN0A 4UOW1 4A04A 4KZDH 2JIXB 3IDXL 2IPUG 3FFCE 3TEXA 5HDRA 1T0MB 4M6OH 4YHKL 4LKXA 4PREB 3I3BA 4CADB 4BH8A 2X6AA 1RZGB 3P3SA 2J5WA 1E9OB 2RTTA 4I85A 4AIEA 2OZ4A 3QCUL 5BRZA 5IJKA 1CVSC 4XZUB 1IAMA 5FOBA 1NFIA 2Q0ZX 4IJ3C 4PG9B 4WW1A 2O4EA 1KCLA 1EGJH 5I1AB 3NCEB 2BSTA 5H4YA 3FYIB 4EIUA 4AGQA 3P9MA 4FLRA 4R96A 4R4FL 3KD4A 4W68A 4P8QA 2DN7A 3O6ML 4JDTH 2DJ4A 5DUPL 3AROA 3A4AA 3JVFC 1BAWA 2A74A 3ES6B 3T2OA 1UD4A 3QUZA 5C0JA 2HG5B 3KGSA 3QUKB 2Y36L 5EU4A 4L48A 5L0QB 3BRGC 2EDRA 3QWOB 4G6JH 4MCNA 3PP3H 4M7KH 3DC0A 4TVSa 2FX7H 3W5NA 4PS4L 4LCWE 5JXEA 1FN4A 3Q7JA 4JNXA 3ULVD 2WXIA 1ZHBA 2XKNA 1PNDA 3FO0L 4HGMA 9CGTA 5F9WC 3GSVA 3OXSB 4JE0A 3U9UB 3LAFA 1KTDA 1T7YA 1OAUL 2VAAA 4FFZL 5LLIC 2DLHA 1ECZA 5EF2A 5C09B 2Q2EB 3L4XA 1KJ2H 4XMPH 2GBUA 3QUML 4PJAF 3ZDYF 4PRIA 1ZIBA 3AQYA 1ZCRA 3DO7B 4AKQA 3L4CA 3QDMA 4YDJB 5JMRA 4C54A 3KPNA 1NANI 4Y7MA 4KKAD 1DVYA 4KK9C 1WGVA 2X4PA 4OI9A 1ET5A 3BE1L 2ZNXA 1TJMA 2DI8A 4N2FA 3WNPA 5GRXG 1N7ML 1CGUA 3SDAC 4YSUA 1X9QA 1LEIA 2GABA 4XX1G 4NQDA 4MDIB 5KG9A 1F8TH 5J13C 1HT6A 5E8OA 3U36B 5ENWA 1HKLL 1T04B 1TQSA 1UYWL 1I9RH 4ZFZB 1V54B 3BD3A 4HJJL 5ALCL 3KPQB 2HRPL 5DJ6A 1P9MA 2JCCB 1DDTA 4DGYH 1MRDL 2IMNA 3LKOA 4JY6A 4UTBL 4DPAX 3SYQA 2UX6A 3WMSA 4K5OA 2BH0A 1HX0A 4M61B 4WUUA 5AYUH 5KW9H 4O2CA 4Y1AB 4B96A 3EGDA 4ISVB 1MY5A 2UZXA 1HSAA 1HL4A 1OB1A 4JR9H 2D7QA 3E7JA 5TPWL 2HN7A 1A4CA 2F7IA 3L3GB 1GMEA 2WBJA 3HRPA 2MH4A 5A2IH 4IBLT 3L17A 1OOWA 3O6KL 8PAZA 4TSBH 3UABA 1ZLEA 5HGHA 2XG5B 3INUL 3ECUA 5E00A 4PJCA 1ZVSA 1EAJA 1XBDA 3FONB 3Q2VA 1OLZA 4JRYB 1MF2L 3DGGB 4P3WA 3WXVH 4I9XA 4RGNE 1VZHA 1DHKA 2XNAB 2AANA 4AGNA 2APXA 4DGIL 3IPBA 5E8PB 1L7IH 1BZ7B 3V6OE 3VFNB 3EBHA 5E2VL 3RL1A 3S5LG 5E2WL 4JGMA 3CLEH 3JSSA 1L9SA 3T0EB 5DEFB 1O7SA 1A25A 3RGVD 2EH8H 2BO0A 3B2UD 4YHZH 1UOWA 1T20A 3QUMB 1UVQA 2ATKB 4MJIB 4ATWA 1M71B 1EJ6A 3DYMA 5GRJH 4NKMB 1KN2L 3U4EA 2R29L 4BFIB 1B4LA 4KXZH 3GRWL 2AXGB 2VZ3A 4XMKH 1ET8A 1V8HA 3GSRA 4QGTA 1WYJA 1G9EA 3AITA 4IJTA 2E8YA 3BEVB 2FR4B 4LAQL 3ZTNH 2Y7QA 4MMXB 4PWJA 4DAGL 2NXZC 5B3SB 4HOMA 5GGVL 3GJFK 4CJ1A 3SDYH 1BV8A 5CILH 4BELD 2AABL 2C3VA 2H41A 3L5XH 4NRZB 4HVBA 1DLHB 3EYVA 5F9OH 5IB3A 1CU4L 1JDAA 4BZ2L 3GSXB 1SHWA 4LLMA 4C56B 5CAYB 4B5EA 1BQRA 5D7JD 3B1TA 2EIJB 5IHLB 4IK7A 3WHE1 5EU3B 3QDJB 4KKCD 2DIBA 1QPKA 4ZTOL 5LHDA 4ZMVA 1E9QB 4OLWL 3QFGA 2L3BA 1E2WA 2IFFH 4ZUVB 3F3HA 5E6ZA 4YO0A 3ZDZB 2AHIA 5KYWB 2CKBA 4ZNCD 2Z31C 1IJNA 1TZHB 2D3VA 2QT6A 2J8UB 2C9PA 2P43B 4F7PA 4H0IA 4WK0B 4HQQL 3D3VE 1S7QA 4PEEA 1Z5YD 5E9NA 5ADPH 4YLBA 2YZ8A 3T6QC 1NCBH 3UTZA 2BIIA 2CALA 3HPLB 3ZHKA 2ITEA 5DJAB 1M7XA 4JFYA 1RSYA 2W0PA 3MROA 2AJXH 1AXIB 3CFNA 4PJFB 1UH2A 3ZL2A 3AG2B 4F5CE 3VCLA 1NC2A 3TPUA 5I1KL 4OLEA 2OCCB 2AK4E 5MEQA 5J1SC 4KJPD 5MERB 2COQA 1M3JA 4HKZA 4NHUA 2PWEA 4EXKA 4GMSL 5CCJA 3RJQB 1P7KB 2K6WA 1VZIA 4PY7B 5C0BD 3O0LA 4U1GB 5CCGE 3X2QB 1NCDH 2LTQB 1ZVNA 5AYQA 1I3RA 4U1LA 3GGWB 2OMXB 4HS6A 5CNHA 5E08L 3BFOA 5KN5A 3BFWA 5C3LD 4CMHC 1IFHL 1R3JA 3DJTA 4Y1SA 3I9GL 2K1MA 3IKCA 4JFVA 5DVKA 1NA8A 5JW4N 3AWEA 2PXYB 5EO9A 1B3JA 2DYPB 3NCYP 1IU1A 4WI5A 5E9DA 3FHQA 4D3CH 5EFIB 3QWRD 5GGVH 4LEOB 4S2SA 1S7VB 1UCBH 3SDXE 1DZ0A 4BH7A 4JPWL 2DRUA 2AFNA 4BSWA 3GHEL 4TNWK 4TYUA 4IKJA 3X11A 5I0VA 4HK0B 2F5BH 1UURA 2VL4A 1FO0H 2GW5A 4Z3GA 3Q05A 4OF5A 3WFBH 2VDPB 2WD0A 3SY0A 4BKSC 3MRMA 2LT9A 4HKXB 5J1AB 4BK4A 5D71L 1J1PH 3QG6A 4X5WB 4GKZB 3EKCA 4HUNB 5HVHC 2X89A 2I5YL 2OXGA 3WTWA 4LLVB 4ONHA 3FQTA 2YUXA 1ASPA 5A3IC 5F1NA 2VZUA 5TJWK 1FVEA 2DQGL 4R9HA 2HRLA 1PEZA 2C4FT 1UXSA 2YKLH 5DR5L 5BVJA 1AD9B 5ANHA 1T0NA 6FABL 4WJKB 1A1OB 4RDQF 2K0RA 1U3HD 2Y2YA 5I8EB 4YSEA 4TQHA 1L9MA 3AXIA 4ZK8A 1KGIA 3P4MB 2ICEA 4LT7A 2NLJA 2YAMA 3EZJB 4WIQA 5JW5A 3VXMD 2HRGA 5I17A 4FAAB 1B0IA 4PJ7E 4DHLA 2BY3A 1XGRA 4GAFB 3KLSA 4KK6D 2C3WA 3SKUD 3BUIA 3FF7A 1HTYA 4G1EB 4GP4B 5HVWA 5IFHL 2YARA 3QWNA 4AQEA 5HYJB 1NKRA 5AYTA 4Z77A 1GJWA 1IFGA 2B77A 1H3VA 3GSUA 4RWYL 4LCYB 2LLLA 4TNGA 3OHXC 4NWTH 3UJIL 1TQTA 1W8EA 3D39E 3PAYA 5E4EC 3F6IA 4K7PX 4UM9B 4YWGL 2HVKB 4M3KB 2V9RA 2N1TE 2CGZA 1QR4A 3PXLA 2R4SH 3QWQB 5KUKA 3B9AA 5ID1B 1MRFL 4ACPA 4IMLB 4MDJB 2OFQA 4ZQTA 5DFVD 1D6VH 4ODXA 3LY6A 1A3ZA 1IZKA 2AQTA 3EOBB 4AZ8B 4JQIH 5D1QD 4OCWL 2ZAHA 3H2PA 4OZHB 2VXVH 3CQFA 5D1ZD 4MKMA 3TU6A 2FL5B 3K2MC 1FGVH 1RZJC 5I82A 3SJVD 1ZTXE 1B4JL 4NUJB 3LQAL 1U4FA 1OGAD 3CN3A 2BWQA 3RIFF 3U79A 5F7EL 5JOEA 3M8OL 4AKOA 4M8VA 2X42A 1G9NC 3ILQD 4QWWD 4LCWD 3CN2A 3S8FB 5J3HD 3DHJA 4KPHH 1UM6H 4U1MB 2FIKB 1OARH 5EDXA 2Y7SA 4YDKL 2QVTA 2VLME 4N8UA 1AR2A 1NAMB 4HXAH 5EMYA 4X6DF 2VN5A 1R19A 3HCVB 2NNFA 1GZHA 1YN6B 3B56A 1XEDA 1T7WA 3LYRA 4GP5B 4GW4B 4KXZI 2BK8A 3U7YH 2NY1B 1LDPL 3WO4C 1MFCL 4G3YL 1C16B 2HA1A 3IFPB 4PJCE 3C75A 1MPAH 2EDWA 5DRXB 1LO4H 1NAKH 1JPFA 3UL4A 3L3OC 5F6IC 1G7QA 2ZOLA 3MX0B 1HZKA 1JV5B 2Y3NA 5DEZA 3WEMA 1IAOB 1BMWA 4LMQI 2F61A 2PPAA 3UFIA 3U6XA 1ZXKA 1UXWA 3WIIH 2ZX5A 4ZFOB 3KYNB 4KRPD 4PGJA 1QHPA 4ERSH 3DTUB 3L1EA 2X44D 5GZND 3TO2A 2O6FA 2XVKA 4FTVE 5JOFB 4OZIF 4RMUA 3U0WL 3H9SB 3L3JA 3KLLA 1TIUA 1YG9A 1Z2KA 4ELDA 4ZFFB 3D12B 1MXDA 2ZIDA 3OG6B 4FLOA 3FFOA 4I48A 4IRJD 4KDWA 1S7WA 4U3XA 4AJ0A 4NENB 2Q86B 4HBQA 3W39B 5BQ7A 1WJ3A 2C1PA 1YA5A 3TASA 1CICC 1MIEH 3QZMA 1WITA 2A73A 4ZW5A 1DO5A 2K7QA 1LEGB 4LSSH 1WFNA 4BE5A 2VQ1B 4HF5H 3WYRA 4A63A 4DERA 3VO0A 4JFXA 5IBLD 1MCWW 2EEAA 5F3BA 2B5IC 4Z8FH 4FFYA 2NYYD 4S1QL 3JWOH 5D1XA 4XN5A 2FX9H 3LMJH 4IMKC 3V0VA 3GBDA 2Q8BL 5A2LH 3OLGA 2YFOA 1AXTH 1S9YA 4JCWA 4U6VH 3OM3B 4FULA 5HPMB 3GSNB 3G5YA 4G9FA 3CN4A 2B1AH 3EXLA 1V3LA 3NAAH 3QBTB 2EKSB 3A6OA 3PL6C 1IGCH 3DK0A 4ZOAA 4OVVA 1AR1D 1JNHB 3MKGA 2ZYRA 3RB7A 1ZGLP 5SX4I 1BREA 3JWNE 2OJEA 9PCYA 3E2HB 5F9JB 4WFEE 2XZCL 4QR7A 5EIIG 5IESH 2A77L 1D5MB 1L7TL 3GIZL 4N2KA 4R3SB 3SGKC 2VQ4A 5FECB 3D06A 4GW5A 2FJSA 4JFQA 1R3KA 3FTWA 3ZY7A 4NO5B 1JZIA 4RISL 1A65A 2DEYX 4PW3A 1BOGB 2YRLA 1GAFL 4QKTA 5CS7A 3NP4A 4NUPA 2V2TB 2EIDA 1RZFL 1WFOA 3NEEA 4AIZA 5T1MA 1IEAB 3CU1A 2J1KA 2CWRA 4OTXL 2DI7A 2E76C 1S7XA 1KB9K 3VH8B 3C9NA 2OXHA 1CZ8L 2V3FA 3L13A 5CEZE 2GTZA 3T65B 2J4WH 4HOWA 1H8NA 2WQWA 3F58L 2X4QB 5C0AA 4PS3A 5HHMB 1ND0A 2X70B 1U8CB 1L9PA 3V4UH 2AERT 3DSNA 2ZKMX 3DLQR 3GTTA 1RH8A 1XR9A 3ARFA 2NUPB 4G5ZL 5EN2A 4ZSOE 3CFTA 5J1TC 4D7PA 3DX6A 2EDEA 3CV5A 3ETBJ 1HESA 4WI3A 2PPDA 1IGTA 4UT9H 4P9MH 5CHNA 3SZ6A 4E9LA 4OD3H 3QUGA 2ETWA 4WVRA 1RFDH 1S5HB 4NWUH 4RIRA 5DJ0A 5EBGA 1GA2A 5FR3A 5AVWB 2QQLL 3IDIB 4Z7OB 4GUOA 3QORC 1O9VA 3V2AR 1NWOA 3MCKA 2WQRA 3O45B 4FQXD 5I1DB 2F68X 1WBYB 4JZJA 4PJIF 7FABL 3U1SH 2OJZL 5DVLA 5C8JB 3ASNB 3MFGB 3LSOB 4XAKE 2UY6A 5D7IB 3I75A 4YQXL 1E65A 2J8HA 4WZ9A 1NAMH 1UGKA 1MRCH 4X80H 2HLAB 1T5KA 5ABZA 1JPST 3PHOB 2APFA 5D5MA 2EIMB 4HWBA 5CSZB 3UGXA 4N28A 4EPSA 5AL8A 1N12A 2IF7A 2Q6WA 1JGVL 3RZWA 1EVUA 4LQ1A 5DLMH 4FQCL 4H0GA 3WFCH 5DK0B 4ZT1A 3PGCA 1SY6H 1FV1A 2H2PD 3NVQA 1G6RA 2D8KA 2DQTL 2FX8L 3BSZH 2QVIA 3NEOA 2HG0A 5E2UL 1A7QL 3QNXA 1T89C 3ARDB 4N2IA 4DGVH 3K3QA 4WI6A 1T22B 2OMYA 4GKOA 2X6BA 2BRQA 1H5BA 1WC7B 5KVFL 3CVHH 3TO4B 2J1ZA 2FO8A 4MMXC 5A16B 1MCCA 3MHZA 1GZPB 3MV8B 1T0PB 2R0LL 1JCKA 4WHTB 4ODUB 1GY2A 4JZOA 4PJ7B 3S7GA 3L2LA 4OJYA 1AIZA 1G1YA 2G75B 1MHCA 3TF7C 5DJDB 5IB4B 5D96C 2GCYB 4G8GE 4KGLA 3BGFC 3N3EA 5DZLA 2XZZA 1MJ8H 1SXZA 1QW9A 1LO3H 3BH4A 1TQUA 5GRUH 2NW3A 3QEQA 3KGUA 2CCVA 5LXGL 3FQWB 2HCZX 3ZZ1A 5DS8A 1FORL 4AUUA 1VCAA 3TS8A 3N2JA 3BXNB 1M05B 3DRTB 4CC4C 3TIEA 1LEKB 2J6EH 3DRTA 3EF4A 1M05A 4RGNC 1Y18A 1CIDA 2YSSA 4ZUWA 3CSYA 4G43B 5TE4L 4QUOA 1QSEE 2GUYA 4IGBD 4WWKD 2YPVL 4X5PA 3FTZA 4XPTH 4JDEB 3TNMA 5LDUA 4HU8A 2XWBB 3MKKA 3ATFA 1K2DA 1P4BH 1BF5A 4M48H 2IPKB 1CL7H 4P23D 3ZZSA 5KSBE 2CLZB 2YQBA 4KTGA 5JORB 3ARXA 2GCYA 4Y5XC 4YFDB 2PNDA 3U4KA 3WEBA 2ZNWA 4FNTA 5IB4A 1E8ZA 4LKCA 2LTQC 3MRRB 2H3NB 3H3PL 3VYOA 2C9UA 3MRFB 1O9WA 2V5RA 4OCRH 4Y8DC 1H9DA 5JHLH 1P4LA 1PFCA 4YSSA 2EINB 1Z5HA 4KVPA 5BUPA 1IC1A 3Q6FB 3I50L 3W0WD 5DT1H 1GPOL 1REIA 4LLDB 2G2RA 1NBVH 4NM8L 4GBXC 5AOZA 5I19L 2BVOA 2WLIB 1KYAA 1DVFD 5IGXL 3BUPA 2PABA 3FMGH 5AD0B 1IGYB 5A2JH 4OI7A 1GZHC 2L04A 1J8RA 3OF6D 3ILPB 3VFTB 4IOIB 2UZPA 5DDHA 3T3PB 2IBZY 1MCOL 3DUUB 3UTPD 4TNVF 2VM4A 1WF5A 4FTVA 4DJMA 3LRLA 3VFUB 1W0WA 1IIIA 1U3HA 1IT9H 1I1YA 3SHSA 2UWEF 3PHOA 2G5UA 4HSCX 5L6YL 5CJQH 1CBJA 5IW1A 3ZGIA 1LMIA 3IM1A 3L95A 4YHLL 2W95A 3HUJB 1XHHA 3KW8A 4PJGB 5HY9A 5LQBH 3ULUL 3MBEB 3TFKC 3BVTA 2IH9A 1TQBC 2NDGA 4PUBL 3I75B 1FPTH 1VADA 2NTFA 4N2CA 4NXSA 4F15C 3TP4A 43CAB 3WGUB 4JJ5A 2EYRA 4C83A 1S9VA 4YFEA 3SDDB 5H94B 2R4SL 1OP4A 2J12B 3MCKB 3GNMH 3IE4A 4OM1L 3FH8A 4P3CH 1R3IH 3P3RA 4YXLH 4XP4L 2UUDK 5DJ0B 2BCKB 4H0LC 5BNXD 5J06A 5T5FL 3PV7A 2ZD0A 4M93C 4NGHL 4XC1L 4G6KL 4GSUA 1DN2A 3OLDA 5CHNB 1IGTB 3P9WB 1YMMA 5KOVC 1DYZA 2AQSA 2VRAA 2WKLA 3FH7A 3IJEA 4FQHA 3RWIB 5BZDA 1K5NB 1D9KD 3IN0A 4LGPB 4A2DA 5ITBL 5DWPA 1PQZA 1NL0H 4IBYA 1QLFB 4JANB 2IDQA 2FH8A 3O2DA 4LLUA 5IUSA 1T0OA 3DSNB 2NX5B 4OGAD 3ZTEA 2GJPA 1PY9A 3FSZA 2JWYA 3P0YL 2R23A 5C0AB 2XU9A 1BQHA 1KPVB 3NCBB 3E6FA 1U8NA 5MENE 4XNXH 1UM6L 1HSBB 1UKTA 1Y1UA 3WEAA 2IAND 4BQCA 3AMLA 1AIFB 3OR7B 1S7XB 4QEGA 2OMZB 2CIKB 1AH1A 3GJFA 1C08A 1OGAA 1CD1B 3VWKA 5FFGA 5BRZD 5FUZH 3VFVB 1QI5A 4Q14A 3D4CA 3ZRCC 1KIQA 3TV3L 1I7UA 4KPHL 5LBSA 1R3KB 4JAMB 2K4WA 4FXKC 5CJBA 1HK6A 4D9RD 1NMBH 4OZFG 1PD0A 4TVPH 2R0KL 1MHHB 4B27A 2QBWA 2JTDA 5DZNA 1NMAH 4H26A 4H88H 4J5VA 1XH3A 2IQ9L 2YQ2A 2NZ9D 3WTSA 5B1BB 3QUZD 4L8DB 2DLGA 3MYJB 4JO5A 1NPUA 3GQFA 4WTQA 4MNGA 3GMQA 3JTBA 3RY6A 1WPCA 4XMXA 1ZMYA 1P2CB 2IQ9H 4G9FB 4NWTL 3UJIH 4Q4IA 3QJUB 3CCHB 1AXSB 1OF0A 4OD1H 5CEZL 1XF5B 2P45B 3A5VA 4HJUA 2Y6SC 3D4ZA 5ESQB 4A6YB 1JGUH 3PREA 4A7UA 2PW1A 5EZOH 1KCWA 3B3BA 1ZANH 4K3EL 5F3BB 4WFFE 3BYYA 4QHMB 4ICXA 5GRYA 4QD2E 4AX3A 4O02L 2DWSA 3MNWA 3DOHA 2E6JA 1CWVA 4N9GB 4YEFA 4HCIA 2BRRH 5L4FA 5EBLB 4KZEH 4Y5XB 3FU5A 1M57B 5I0YA 1AZZC 2A6IB 2GBAA 1KB5L 1DDHA 4GG8B 1S7WB 2EC9U 3HS9A 4IS6B 4PJDF 3RWEA 1SHSA 4HV8B 3RB5A 5CN3A 1EO5A 2I26N 4I48B 5C07E 4AJVA 4XXWA 5MP6H 1E2ZA 4YR6A 1J5CA 1CGTA 3D07A 2YPLB 3M1CA 5I5RA 1QW8A 2H0EA 3K74B 3BWAA 3T77B 5H37G 3W82A 3HI6H 4Z7QE 35C8L 3ULSA 1AY1H 2EZ0C 2X4NB 1BSIA 3RVTD 4BD4A 3JUZA 3B6SA 5J57B 1UXWB 3HHSA 1KJ2B 3PWNA 2KZKA 1J0HA 4L37A 3NJJA 1G4MA 1QPXA 3I50H 4GQRA 2OYMA 1EVTC 2YKLL 1X5ZA 4M6NL 1QYGH 2EEDA 5DR5H 4ZMLA 4ZNEE 1MFUA 5I75C 1R5WA 5IV2A 1H3UA 2EXTA 3HZ3A 1UJTA 3FRPA 5DFAA 2CGRL 4YHYC 2DWDA 2CUAA 3HG1A 3TWCH 5IM7A 3IFPA 1C16A 2BNRE 1ZLWK 2EECA 1I9JL 4APXA 4NO3A 3DJSA 4KTEL 1NFAA 1UB6B 4LPTA 4PGBA 5DI8A 5IW3A 5LBSL 1QVOB 2D9QB 2DTML 4QXTB 3LEYH 4EE2A 3WS3B 1HHGB 3BN3B 5D6CA 1TUPA 1PD6A 4ZXBD 1JI1A 1S9XB 3LEXA 1C5CL 2W5PA 3EYFB 3X1BA 3OR6B 3ZR6A 1NINA 1MHEA 2I85A 4PUBH 1VJSA 2PN5A 1FA4A 4UQ2A 1E43A 1L0QA 3PWPA 1Q0XH 2GSGA 3BUTA 4PS8A 3F12A 4OLVL 2AEPL 2A5UA 2B20A 1SJVA 3GWJA 3UMNA 4HKJA 4JFZL 2VE6A 5L4IA 1BZ8A 1KGJA 4FQ2L 3E2HC 3GKZA 1H3PH 3ZE2B 4M5TA 5C08B 2PYEA 3S4SA 1LGVA 4MA8L 5HDWA 3PP3K 2EC8A 4F1SA 1XQ4A 1DQTA 4LASH 3FUKA 5ID1A 4AJYV 1ORSA 1N2RB 5D7SH 4U2YA 1F90H 2BDNL 2ZQKA 3IAQA 3MJWA 4EKJA 2EE2A 1JI2A 1QI3A 1TOXA 1A47A 1UASA 1JL8A 3BLPX 1LK2B 4XBPA 1A3RL 1FFTB 1AVAA 1E27B 1KB5A 2GITB 4LCYA 1X5LA 4Z7IA 7CGTA 2ZOWA 5JDSB 4AQOA 5C2BL 4OIFA 2BNRB 5F9DC 2OQJA 4N85A 3EOAB 2F54E 5ESAB 2AW2A 4PRPE 1F4YH 4DKDC 1FL6A 5EBMA 1XGRB 2EVHA 3CZNA 2EDTA 2JB5H 3FJTA 4LK4A 1ZE3C 1F4XL 2AQ2A 2DWEB 4LEBA 2QLYA 3MRKA 5JHDB 3QDJD 3GI9L 5F96L 2BIHA 4UAHA 3ZSSA 3CDCA 4KVCH 4FG6C 2HX9A 3RHWK 4HDIB 1TSRA 2DS4A 2G30A 3VXUB 1JHKH 1P5UA 2EDBA 1JD7A 3V0JA 2AK1H 3A4DA 4G8EA 4NX0A 1FJ1B 2VJXA 4P23C 1E3ZA 2FWUA 3T2PA 5I9QC 3FQTB 4FYTA 4OF3A 5LBGA 3Q3GB 2VZOA 5AZEL 5E1HB 4JFEE 1P7QB 4PG2C 4C47A 4A2FA 5EF0A 1IM3A 1ZA3A 5KANG 4XMPL 5E94A 4B0MM 4W9JC 3DURB 4OZFH 1EV2E 1E8WA 4GXUN 3UBFA 4B3EA 3O8XB 1AR1B 4XNZC 1MCBA 1ZWIA 4NN5C 3B9KA 3B8SA 2D0GA 2O5NA 3ZO9A 1YEFH 1PLCA 5DUMH 2DD8L 3F7QA 3VXSE 3VRLF 2Q20A 1ZWIB 4KI5D 4IRSA 3DURA 4APQA 2ZP9A 5AOKA 5KSUB 1KCBA 4CGUB 1TJGH 4S1RH 3VXUD 3KEDA 4IGBC 3SPVA 3ZRSA 1CGXA 5BO0D 2PXYA 4Q9RL 1EO8L 3TV8A 1CU4H 2R7EB 2BP8A 3BGMB 3WLWC 2Z31D 1UG9A 4R26L 4QHUA 2OULB 4JFFD 3QK0A 2CIIB 4YAQA 4AKPA 4BQ6A 1RK0A 2D3JA 3P3YA 3NJIA 1JZHA 3T0DA 4UUJB 1FG2B 3CDFA 3U9WA 5LBVA 5KYUB 3BKYL 2EVIA 4JG9A 3TIDA 3MNVA 1N64L 5EBWB 5J6GA 1KJVA 4QJ5B 1P7KA 2K3HA 4XXWC 3MUJA 4KZCA 5IROC 4N26A 3GBNH 3R8QA 2W9DH 3MRKB 3QB7C 5MEQB 1MJ7H 4BFFA 3EIFA 1J0IA 3VXQB 4JZNA 1BD2B 4PJFA 2X9ZA 4N0FB 2FEDC 3DHPA 3IB4A 4HXBL 3EO0A 1EJOH 2WUBH 3C08L 1UWYA 4HPYH 3FCSA 2F53E 4WFED 2CBMA 4EEEA 2WYIA 4DT2A 3ULVL 2HKAA 1KFAH 1M2OA 3K72A 2X2JA 2X2UA 2QSTA 4XB7A 2EVFA 4MD0B 3ZKSD 2MPAH 1BZOA 3BSGA 2IPTL 3A6BH 1E27A 3WTTA 5LG1A 5GGRA 1ZA6A 2BPBA 2D3LA 2ZX8A 2R59A 4G70B 4J8QA 3KPRB 3OF6A 3LIZA 1DQQB 5L2KE 2E5EA 4ZAKA 3FFCA 2DQCL 3MREB 4F9LA 2J4WL 1IILE 3L3OB 5F6IB 3T8MA 4TS6A 3D18B 3EADA 3KLHD 1YEJL 3EYVB 4P5TD 4NKIL 4GXVH 4PI0A 3WXWH 3G6DH 4F8QA 5A2BA 4A37A 4MMXA 2FEEI 4Z76A 2XRAH 5C0CE 3IRPX 3E0GA 4KQ4L 1W15A 1I3VA 1JMZA 1LQSR 4UIKH 1WLHA 3OKKA 1A6PA 2ESVE 5F0MB 4W4OA 3FTXA 3MJ8A 2AEIT 3AU0A 2BVUA 1T20B 1J9QA 2OI9B 3QUZC 1XCQA 1OPGL 2MIZA 4ALAC 3OR6A 4W70A 3EYFA 3HN3A 3QJFA 1MDTA 1EO8H 2XJLA 1G7LB 4N2NA 3X1FA 3HNVL 3UTQB 2F74A 2TRHA 2DJUA 3WS3A 3ARBA 1QX1A 4QXTA 1R6VA 2FEJA 1SVZA 3VFOB 5KYNA 2XNAA 4L1HA 1IGCL 4H4NA 2OPCA 4Y16A 1KF9B 1A9EA 5A6IA 1ZVSB 4LQFL 4CJ0A 2D31A 4FP8L 1SBBA 2NR6C 4OKVA 4IM8A 2DWDB 3HG1B 4LIQH 5DZOA 5IQ7L 2WQVA 1GR7A 3S36L 3MU3A 2PMZA 2N7SA 4OFIA 4X2UA 1A66A 4AVHA 2MCAA 3NSFA 3ARZA 4PLJD 1MFAL 1KJMA 3B2PA 1VFUA 3HZYA 4U1NB 2I07B 4M7LH 1OB1B 1L9RA 2NW2B 1OW0C 4YK4B 5F1KC 4K3HA 1LE5A 5T1LB 3D0VA 3DVNA 4X6EB 1NJ9A 1UGNA 1FC1A 4A1RA 2QFRA 1ZLUK 2DQ6A 3MMEA 5ESVA 1N0XL 3PJLA 2NZ9C 3UJTH 5GS2H 3OQRA 1MY7A 4L1TA 2BY2A 3MLVL 4MJ4A 4O9HL 4UT7L 1MCJA 3O4OB 5C6TH 3HZVA 3VD0A 3CFEA 1ACYH 2YPLA 4X0NA 2V6HA 5D7EA 2EZ0D 4G7QB 3SO5A 1ZS8A 4P06A 3T0WA 3KPQA 1RUML 2VZTA 4ZFZA 4QRRD 1CJYA 4XNDA 3FRUA 3AACA 3BW9A 4GEJA 4PV9B 3AXLA 2JQZA 3QUHA 1I8KB 4FE9A 1MCNA 2CR3A 3E38A 5C09D 3V4PL 1IEBB 3KLQA 1IBZA 4TOYH 2RCSL 4WSGA 4XB3A 5DURB 2MHAA 1HEZB 2K6ZA 2IWEA 3IF1A 4UILL 2R2EB 3VXOB 4MJ5B 3BPCA 5IF0B 4QF1B 4DQOL 2C9RA 3QIWB 4E0RA 1EZSA 4L4TD 3DO7A 2ICEC 4YSQA 3NMEA 3L3HB 5E6IA 4QWWC 1UZ6E 1KT2B 2CE6A 3O9WB 3QRBA 2EICA 3LH2H 1XF5A 4J3OH 5C1MB 1XGYL 4KVNH 5TDOB 1FFNB 3OKMA 4RRPA 1GCFA 1WWAX 3C5ZD 4WV1A 1P2CA 3W2DH 3LQAH 1NUDA 4EI6A 3RX9A 1FI8C 2IWFA 3U1PA 2AEOA 4GIOA 4MJHA 1GW0A 5D1XD 1N4XL 4MXWL 3SQBA 2XKNB 3H6AA 3VUAA 4OCWH 1FN4B 4H26B 5E9DE 4Z7AA 1U42A 3JYBA 3O3EB 5DTFB 5FB8A 3STLA 1EJFA 3U2IA 3QWOA 2PO6B 3ZR5A 1B4JH 1BJ1J 4JPQA 1SLWA 3CFJA 1A7OH 2DDQH 3E1ZA 5I1GL 4PI2A 4FP8H 1G84A 4IKKA 1KIQB 3AADB 1XGUB 4PYGA 2QZQA 3GTNA 4GSQA 4PCYA 1GIGH 3CC5B 1TNNA 3ALWA 1OGAB 1LP9F 3PHAA 4G6FB 4WFFD 1NUNB 4PRAA 3SJVE 3QPXL 3QIUD 1UWFA 3FZUC 3MLRL 2B4CH 1QWHA 4P5RA 1IE4A 4GG6A 5C2UB 5LCVH 4EXPX 4PJ8D 3SO3C 2DKMA 1BEYL 3V5HA 1C8QA 4MD4A 5BRZB 2Y6TE 2X2HA 2LAAA 2GQHA 1JN6B 1T6BX 2NX5A 2VDQL 3UGUA 4J27A 5HI5C 3AGWA 2WQSA 2YEZA 5EUKA 2YXVA 3L6FA 4NUQA 1FE8L 2JKXA 1N67A 3NJLA 3IJEB 3RWIA 1UCBL 1Q72H 3P3TA 4AYEC 3STBA 1PTZA 3VG0L 2B8OT 5KANI 3PDOB 3WKNA 2BCKA 5AWNH 3UBXI 1J10A 2VZVA 4N5EC 3SBWC 1JFQL 1OQXA 2E8ZA 3T0AA 1SYSB 4UTAA 3TVMD 4ZMPA 3LX9A 5HYSA 1Z9LA 3LEVL 2EYRB 2BNQB 2ORBL 4WW2F 3VD5A 1OP5H 5JNYB 1C7TA 3IGFA 4IIQB 3ZZLA 43CAA 2FO1A 4I9WD 4U31A 4KZEL 3VI3F 3MRBA 1MFMA 4OJEH 1U3JA 4XNXL 3BWZA 3ARGB 4HMDA 4HYTB 2D7NA 1BIIA 3MZTA 1RKRA 4NI3A 4JQIL 3TEZA 5DVNA 2NY3B 4ELKA 1I1YB 4UNTA 4WUKH 3AAZB 4XVUC 5IFJB 4HHAB 3UDWC 1IQDA 3U30C 3DUUA 3LH9A 2Y7OA 1JK8A 4TQIA 4UB0H 3QZWA 4LLYA 4FERA 4NCC2 3FB7A 3T4YA 4HJSA 5GGTA 4L5FE 3WE1A 3H55A 3QHFL 4AEFA 2E75C 4BFRA 2YPVA 2W80C 4N9OB 3ARYA 1I1AA 1SDYA 4XNYL 2QTVA 1U8QA 5FA4B 2FJFA 5FDYA 2G2RB 3RKPA 3BJLA 2I7SA 1VGKB 2NCEA 1QABA 3Q6FA 5E8DH 4LL4A 3SOTA 2NUTB 4HIIA 3K71A 3SPCA 4L4TB 2OBGA 4DW2L 3V79C 3ZE1E 4XN8A 4WO4A 2WC7A 3SKOA 4TVUA 4YE0A 1YNTF 1J0YA 2HT2C 2E7LC 4NOBA 3L5WB 1U93B 3CSFA 3VQLA 2H3NA 1UA3A 3CDYA 2CMRL 1KBGH 4PGZA 2H4EA 4HWUA 2CBTA 3LZPA 3QA3B 4K9EH 1AAJA 2OP4L 3HAEH 2R1YA 2G3XA 1K2DB 1DBJL 3F6JA 1OTUC 3WIHL 3VXNA 4R8WH 4PW4A 3FK3A 5J8OA 3ORJA 3RBGA 1UEMA 4H5SA 5E2WH 3LS5L 3C2AL 2Z6FA 1BXUA 1CF8H 5IROD 4MS8D 3LEVH 3EZ8A 5E70A 3UIYA 4CMMB 3HB3C 3ESNA 1PLAA 1JRHH 3T3ME 1JIBA 4FJ6A 2CM5A 1KYFA 1IE5A 3L3KB 4OLYH 4UINH 4OU3A 1CF8L 2OMUB 3FKUS 3VXSB 4GAAA 2RIKA 3LV3A 4XNBA 1AGFA 5EPMA 2VDPH 3UC2A 2BRRL 2P1YA 1YPZE 5AVRB 3KM2A 5CUSH 3QQ3B 4CRPA 1B0WA 5D4IA 1MHCB 5KVDH 1GKEA 4LPUA 4PJ7F 1CFVL 4IGBA 3L1GA 4C58B 4S0SD 1H3TA 1QSFA 5C09E 3V6OC 1J5OH 1YEGL 4WHTA 5I9QB 3NIGB 1WBXA 1WAAA 2YMOA 1AZCA 3C6SA 3ABLB 5KVGH 1MNNA 3FYEB 3H3PH 3FNKA 1G9HA 4LLQB 5E8DL 5EOCL 3EBIA 5HDLA 1H6TA 1T22A 2OMYB 2H32A 4P3DA 5DD6B 3R4DA 3ARDA 4R2GC 2A1WL 4QHKJ 4IEFA 5K59F 2CGYA 3I6SA 4QDGA 2N01B 4ZYKA 2X4TB 3MACL 4TRPL 5F1SA 1G6RB 5FYLL 5FGCB 1MFVA 4M6NH 1KCRL 1T7XA 5DK0A 1PG7L 4F93B 4P9HC 4UDTA 1T83C 2FBJH 1E67A 4N2AA 2B4CL 3WD5L 1G7JA 1OE1A 4U1HB 5D5MB 4UQCA 2MJWA 2Y2TA 4F33B 5TQ0H 5FHBH 4HJ0C 1W91A 1NCCL 5E8EB 2KDYA 4K94H 4Z7UA 4UIMB 5CD3B 2ODHA 4PBVC 1AGCB 3FU9A 3FPYA 1MF2H 3QQ4A 4OZHE 4EVNB 3ABKB 2N7AA 2PYFB 3UJTL 4GMSH 1G9NH 3BVDB 4JQVC 1U2HA 2BJML 2WQAA 4B7LA 2QKIB 4OBSA 5MI0B 4PGCA 5T1KD 1AKPA 1L9TA 3RI5K 2DM2A 5EWIL 3DROB 3QEHB 3RRQA 4Z3HA 5DD3L 3IDIA 3JTSA 4AYBA 3GMOB 2VO8A 1XVSA 4MJ2A 4RIRB 3SDCA 3E8VA 3MLSH 3B9DA 3QUMH 3CX5J 3ZTCC 1U91A 5DGRA 2JXMB 1DBAL 4QHNA 3TBSA 2OA9A 3QIBC 5AOIA 2ITFA 3UGEA 1E6OL 3NJGA 1JFQH 4CVZB 5DD0H 4JN1H 3BZFB 3NFNA 4J3XA 2AEQL 4UM8B 4YDIH 4R7LA 2MPVA 3ARFB 1PZCA 3U4BH 4UZGA 3EFFB 5JHDD 4OT1L 3LKQB 1Z3GH 3FUEA 3LN4A 1ZPLA 1I4FA 1NIEA 1RLWA 1RJYB 5IJCC 2LU3A 3MRLA 4YE4L 5JO5A 1FQ9C 4K5NA 2WIIB 4BUGA 4OCYH 2NY6C 1VGEH 4Y4KD 1CR9H 1A21A 4P5MB 2H8PA 3K4AA 3L5XL 4XH2B 4M48L 3P73A 3WDHA 4YSCA 4KOBA 2C34A 1RIVH 4M4RA 1X7QA 4NQVB 1N5YL 2GUOB 2Z7WA 2CBQA 2EYSA 4MCYB 1QR1B 5TE4H 7FABH 4ZUTB 8FABB 4OLWH 3NA4A 1AZRA 5AYUL 1ODAA 2ADFH 5IHHA 1JG9A 1SJEB 4J3TA 4K8RD 4YDVA 3O3BA 1I9RL 1DVQA 5CINL 2LR4A 3ZE0B 4NO5A 4DKTA 3U7WL 2BC4B 2FT7A 2XUWA 4XNYH 1PY4A 3BKJL 4JY4A 5JPNC 2WZPA 1E0OB 1JPSL 3VD7A 5AB2A 1PX8A 3S37L 4X0KB 5CEYB 3TM6A 3VXSD 2DPKA 2BIOA 2WOBA 5F9JA 4F1ZA 1XF2B 4LVNB 1K6QL 2GK0A 2I69A 4F58L 1RZJH 3QORB 4FHBD 2V9QA 5ACZA 1HEJC 4HCGA 4OFYA 3GLZA 3VFPB 3F58H 4KOCA 5D93B 1O6SB 3GB7B 3AWFA 3EYOA 4DZBA 4HIXH 3REVB 5E5UB 1T2QH 4RA0C 4JM2F 1RERA 4TQEL 3OGCB 1Q0EA 1NCHA 5D1XB 2OK0L 4QRQB 4HAGA 3S2AA 2AC0A 1V7MH 4ODTL 1SM3H 2AJYL 2BOCB 3L4ZA 3IJSA 3MLXL 1J8KA 2RJMA 2CZNA 4X7SL 2V7HB 2WLYA 4DGIH 4NI6A 1VACB 1WTLA 4RGMB 3N91A 3DVGB 3WKMH 3LZNA 1QBMH 2QPUA 5B7EA 4ESKA 5MENA 2VISA 4JRLA 5E4EB 1XGTB 3CX2A 4PJ9B 1CE1H 3DX9A 3GYRA 4YXLL 3K5RA 1I3GL 1XGQA 3MCG1 2CHWA 3T6VA 3V6BR 2BP0A 3U6XS 4HWNA 2IGLA 2YC1B 4MNQE 1Q9KA 3VX1A 4G6FD 3ZTNL 3FU7B 1RAMA 5FK9A 5EU6D 2ZOKA 5EOCJ 4Q9QH 2J8OA 3L3JB 3F05A 3HAEG 1QP1A 1D5IL 2AVGA 2VO5A 5AVVB 4I1RA 3I2CH 1R3IL 3B2VH 1N68A 4NAJA 1T5XA 2ICCA 4X6DA 5MHSE 1HE7A 4XPBL 4BHUA 4G9FE 1P1ZB 3UAEA 1Z9OA 4DZ8A 5I18H 3IPEA 2OMNA 1A6UL 4MYPA 1IAOA 2G60L 3WFDL 2UUDH 4GRLD 1QFHA 1HCZA 1SQMA 2P8MA 1CFMA 5ILTH 1D5BA 1G7QB 3K2UL 4M7ZC 3V6FA 2R1WB 3G6JB 1SJHA 2XVLA 2NQDA 4BRVA 1AKJB 3H0TA 4IBZA 3OBAA 4B3VA 3BH9A 3Q06A 5IMMA 5DO8A 3V5KA 2CJSA 5ILTL 1XFPA 1V3KA 3FT3A 4MXWH 2E9IA 1SPDA 4V1DD 3SDAD 3ECQA 4W9GC 2BOLA 2GC4C 4PV8B 3IDGA 2XBTA 4PJ9D 4MZIA 5DRWA 5H2BB 4JFUA 2X4OA 4G71B 3SKJL 1F56A 3PWUB 2PTUA 3VG9B 2R0LH 1CFQB 1YMHB 5J5EA 3OAZK 4X6BB 5BS0B 3IJYA 2GFBB 4GRWH 1MW3A 4P2OB 4QT5A 5E2UH 5D2NE 3MV9A 4HPYL 4L1BA 1A6VH 3ARWA 3VB9A 4F58H 3HMXA 3IMUA 1QLRB 5IOKA 3H9HB 3ARQA 1NGYA 1B9ZA 1PW3A 1IBGL 3HRZC 4BZYA 3KZ8A 1NGXB 2P24A 5BW7A 4NPYB 5HJGA 3C8HA 5I0XA 1KIUB 1XGPB 2HFGL 4RNRA 3CFBB 5C0AE 2PLTA 3SJVA 3OAZH 4XVUD 1RZIB 4UQ3B 4DH2A 4CU6A 5KJ7E 5T5NF 3GT6A 1UA6H 4EN3B 2W60B 5K9JL 1HHKA 1KIPA 3NGBC 3QFDB 4QRPD 4NEHB 1MI5D 1AO7D 2A9NL 2IALA 5T5FA 3N44B 5I1IL 1CDYA 2XWTA 5E99L 1NCIA 3LB6C 4I2XA 1XCWA 4NDMA 4MDJA 3DNKA 5LO7A 1N8ZA 4NQSA 3WFEH 4MXVE 5CGBA 2G3NA 2V2XB 2VXSH 4QRUB 5LGJB 4MXVF 1KPUA 4XBGA 2DIEA 1U58A 1IC7L 1YPZB 4MBRA 1X3DA 3Q2WA 2WBJD 2HUHA 3H6JA 1AO7B 3I9AA 5BOZG 4UNIA 1DQJA 2DIJA 3V0EA 2AXFA 4Q6KA 5BPPA 2KS0A 4NZTL 4YFLI 3WSQL 4LDOB 5CEXB 3W0WB 1D7FA 2F2HA 4S1QH 2VDRL 4AEIL 4P4RA 3WJMA 4MAZA 3TT3L 3TZVA 2FJUB 2AGJL 1B0RB 4WO0A 3EYQD 4XVJH 5FO9A 3QEUA 4OD2A 5CGTA 1QEXA 1ADWA 4WK2B 4XOEA 2YLKA 5CBEA 2AGJH 2ICEB 4MS8C 4NKOA 3P4MA 4B9JA 4YDLB 5JIHA 1NCNA 3RA7L 5KSBB 2NYZA 1MCPH 3ATBA 2Y06H 3QS2A 1ES0B 5FM8A 3UROR 3S37H 4PWEA 4CBZA 1BFVH 1SFDA 4UOJA 5BMFL 2BVYA 2OX5B 5ICZA 2EDDA 4K15A 3UYPB 5FYLE 1T0NB 1HXMB 1TJHL 4D0BB 1FCCA 3QXAB 4L4TE 2FHBA 3F7YA 2HLFD 3L2MA 4Y19E 4HFUL 1J8HB 4KVCL 2D0HA 1PKOA 1TMCB 5I71C 3CBRA 2Z8RA 4M5YL 4XXDB 2J5LB 3QHTC 1G0DA 3DPBB 2QDWA 1IV8A 2HT2D 3VFSA 2PO6C 1CBVL 1E3XA 4NRXA 4X4KA 2R0ZL 3PGFH 4OTXH 4GKZA 4KNQA 4X7TA 3UZVB 2BSED 4B9PA 2SODB 2OL3A 5J1AA 1V05A 4HKXA 3J2PA 5TF0A 2OMTB 3QW9A 3FH5A 3S5LB 1OTUD 3C5XA 4L23A 2SEBB 1ZGLM 1XT5A 4MNHA 3TBCA 4LSPL 2A9AA 2RFXB 3CMOL 1UUSA 3X11B 3MV11 3RE0A 4FKEA 2NNAA 5LXGH 1WFMA 4E5XB 2AMUA 4LEXL 4S2SB 1NM9A 4I8DA 4MA8H 3O41A 5HI3D 4G5ZH 1KXQA 1YEIH 3EUDA 2IVFC 4EOWH 2ZT9C 4JPIA 5E7BA 1U8PA 3SODB 3N1MC 3QC5X 3S6CA 1SEQL 1ZHKA 1J7VR 2X4UB 4BQ8A 3KPLA 3QYCA 4IU3A 5DEJA 1YJDC 1U8MB 2OMBA 4GSXA 1ZHLA 4IMKA 4MDRA 2OSLB 3C6LB 2XN9D 3CLFL 3VXTB 1R0AL 3VXPB 4U1LB 2QADC 4MJJA 1A6ZA 5FF6B 2VXQL 5EU5A 2HJKB 3AQZA 1F2QA 2J1YA 3TWYA 1BGXL 1V5JA 4Y4HB 2JJSC 3OWRA 5CLZA 5HXMA 3WOVA 3KMDA 3U0TB 4KHXL 1J5HA 5AOJA 4FQJH 1OWWA 4LCCC 4LSVH 3VCLB 3VMNA 1PPIA 2FNWA 3DXAE 2ZXEB 4PTUB 1HHJB 2YSTA 3F65A 2WHVA 5CD5D 2I32A 2YXWA 1TZGH 3UTZB 2A77H 5LVEA 3NZUA 5DC0A 4PV1C 2EDQA 2MNJB 5GS3A 2GVYA 4PJAE 4OLUL 1IAIL 3E80A 5TE7H 4KTEH 3ZUNC 4EN2A 5E5MB 5TDNB 2NY4B 4E9VA 3ISRA 3LNFA 4GPVA 4LGRB 1LWHA 4XNAA 1FVDA 3NN8B 2CGRH 2KUTA 3FF8A 1E9QA 1NEZA 3SBPA 2Q5BA 1L5GB 3GSWB 5AKSA 4PJBF 2VSDA 4KXDA 4AITA 5CBAA 2RD0A 4TVPE 5EF3A 2B4CC 1L9OA 4LLMB 1NCDL 3F8UB 5I5IA 2QV4A 2JFCA 2QSCL 3DMMB 4K9JA 4NRZA 3P4OB 2C3VB 3DUHA 2NT0A 1DANT 1Z1WA 1L0PA 4OQTA 4KI5C 1D7CA 3DX8B 2PCYA 2X3CA 1SM3L 2AJYH 4YHMH 2FR4A 5C6PB 4LFHG 1U33A 2K78A 1UWEL 1YC8A 4KI5F 5C92A 3FTGB 2VZSA 1YEFL 4NT6B 1SXSA 1H8LA 4JN1L 4P5TA 2N3JA 4WJ5B 5D55A 5DURD 2CRYA 1NGPL 2HKFL 5SWSE 2VN4A 3N55A 5E9AA 1OWRM 1RPQA 3SGJC 4JO1H 5E8NA 4JHUA 5D1XE 1C1EH 2F7PA 2Z4TA 3FUDA 5DEFA 5HYIA 1MI5B 4PJIE 5E8NB 5CLYA 1LM8V 2JLLA 2ED7A 3L4TA 1EERB 1TZ8A 1B2WL 3LHPH 2DM4A 2VWEE 3BKCL 1FRGL 1QRNA 2KH2B 1PIGA 2R1XB 4U3SB 4KITB 3CZUB 2CDGB 4LIQE 4CU8A 4AG4L 5A2FA 1HDMB 4XNMA 1GS8A 4XCNB 2CXKA 1OW0A 4PH8A 4QOKB 4Z7NE 5E00B 1JHLH 1KN4H 1A6UH 2WKOF 4Z9KB 3ELAT 1QTYT 1MWAA 2EIEA 5HHMD 2WGXA 2ENYA 3DMMA 4N8VG 4XT1C 4RSYA 3MTXA 4MS6A 1CGYA 4I2XE 3JWDC 1KN4L 3A21A 3E9UA 2HN7B 1NBZA 1PGRB 4WCYL 3H9YA 1JZ6A 4JPSA 3EUUA 3NN8A 3UMTA 1TLMA 3QIBB 4ISVA 3RPBA 4AL8L 4L05A 2WMPA 1IQWH 3MRNB 4Q56A 1SDAB 4N6QA 3NIGF 1BFOB 1F1AA 3KYMA 4PRPD 4QXGL 2ATPA 1RIUH 5I1KH 4NNXB 5JXAH 4Y88A 1YECH 1XD1A 2GJ6A 4ONOA 3UBXA 3ZDXB 5J12B 2OCFD 1XZ0A 5F7LB 4UU9B 4WWKA 3ARRA 3K6IA 2VIRB 5HHNA 1HHJA 1MFBH 3AM8C 2GG1A 4ZMOA 1YCSA 4NQCD 3JXAA 5C0RL 2WBKA 1TPXB 4G80B 2V9TA 4GQ9H 3EO9H 2XN2A 4FQ2H 3U0TA 3WFHA 4PRDB 1NIFA 1NICA 2RGSA 5A7BA 4OFYD 3OLEA 1GYVA 2FVNA 2X4PB 2VC2L 3MNDA 3NIFB 3PHQA 4R8WL 5CP7B 4HIXL 3HOGA 5B4MC 2AAVA 4GP8B 5I76B 1A6ZB 2IAMC 1SOQA 4YDJA 1ODUA 3EXJA 1BFSA 4Y5YB 3SYOA 1GGTA 2OR8A 3VRIB 3C09B 3TYGH 3OZ9H 1KG0A 4QCIA 4HS3B 2BVPA 3NGBB 3L5IA 4P3CL 5C09A 1YY8A 3FTSA 2X4UA 4FLSA 3H54A 2H0FA 5CU5A 1D5RA 1BBJB 5F0LB 3VD1A 4N20A 4RX4D 5HDOA 1DQVA 1FL3B 2LE9A 4JPIB 2K8QA 4AQ1A 5I1JH 1L9QA 4G6KH 1FL5A 1UWGH 1KTKE 5H37A 1CGVA 4NCDA 3P54A 4UTBA 3T2LA 2ZX9A 4G6MH 1EHLL 1M6UA 2WYHA 4MAUL 4E5XA 4CN4A 4GNKB 4XP1H 3KWWB 2ZE0A 1LO5A 3BIBX 3LZQA 3FTYA 1DQML 1QNZH 4DP7X 1AG6A 2P5ED 3FOLA 2CH8A 2A1WH 2AQPA 4GO6B 4RZKA 3IXTA 4XTRD 4N22A 1PKQB 3IFNL 4NZUL 1CICD 2F54D 2OMTA 2WJ5A 4JS7A 2ARJQ 4ZMNA 4GRLC 5IB2B 4ZD3H 2H26A 4Q9BA 3T0ED 2PWHA 1JCVA 1MW1A 4HJJH 5ALCH 1BIHA 5DU7A 4DVRL 3QG7L 5J7CC 4YGVA 1H3XA 1PJ9A 4L9LC 2BSSB 1QYGL 4P4KB 2VLLB 2L7EA 3P9MB 4XXDA 3EGSA 4JREC 4URKA 1QO3A 3QZNA 1OE2A 2Z7UA 3B34A 6FABH 4PJ9C 2BW4A 3F7YB 3AG3B 4JHWL 2N1KA 4AVJA 3RVXC 5FCUL 5GS1A 2XXMB 4LDLB 2WVVB 3UACA 4TSBL 1M7IB 2R9HC 2XDHA 2ENSA 3HKZA 3M46A 3RWJA 4TLTA 3F7PC 5FUCC 4A39A 3HNSH 2KZ1B 3O8XD 3WXVL 4PREA 4BH8B 1NBVL 1G5GA 2E4FA 1QFWH 3CX5K 5D1ZI 4CADA 5IEKB 4UM9D 4APQC 1PDKA 2ICWI 4G8IB 1AC6A 2I9LB 2EUZA 3ZL4H 4JM4L 1CFNB 4G9FD 1Q0XL 2YBRA 3B5TA 3TZVB 2KLRA 4ILDA 4QHPA 4PWKA 4I89A 4DKFH 4E9YA 3G9AB 1MUJB 2NY2B 3QZLA 3NZ8A 3GNML 4OM1H 4QXWA 5CEXA 3FUJA 2YWYA 2RCSH 4JVUA 5EZOL 1RZKL 4U0QB 3C5ZC 3D2UA 4RFOH 3VWKD 1VGEL 4ALAH 1PNCA 2HZHA 4JFHE 4Q2ZA 1DQJB 2Z64C 4WK4B 1QASA 1AO7A 3O11A 4NAMA 3TN0A 4X4YB 5C0EB 4Z5RA 2F5BL 2J6WA 4DAGH 4V2CB 3U30B 1KTBA 3NZSA 1USQA 4XBGB 3G5VA 1TYJA 4Z7VB 3IEAA 4NN6C 5KSVB 1GS7A 2PCFA 2C3GA 1KENH 3N40F 4MAUH 1P5UC 3FQXB 4X83A 4I2XB 1YDPB 4L29A 2H45A 2VKXA 2XKUA 3U1SL 1TZIB 4AUYA 2NCMA 2PKDA 1WICA 2XPGA 3LKNB 4IJ3B 4DN4H 1L6ZA 1W72B 3KL5A 2EAEA 1OKEA 2ENPA 3TZVC 5EB9A 5I0WA 1BW8A 2IOIA 4UQ3A 5ITFB 1QFWM 2VGLM 2AQQA 2X6UA 5FYKE 4BE6A 3TA3D 4KK5D 4DGVL 2P24B 1NCBL 4GUPA 3TT3H 3OMNB 2HSIA 3ZPDA 3RFRA 1NGYB 3CC1A 1HS6A 2WO2B 2NZ1A 1YYLL 4PJIB 2AAAA 5JHLL 4NNYA 3MV9B 4MVBD 2MPAL 1GSKA 1A3LH 2JKWA 1YYCA 2GFBA 3HI5H 4FZ8L 1CFQA 2C1OA 4CNIA 5DK3A 5HGAB 4WGWB 4OIIL 3SDXB 2IANE 4GUPB 1AMXA 4FQXA 3WMPA 4FG2A 4KUCF 1U8HA 3MVSA 1MFBL 4PM1A 5DJYB 4G7VH 1DJXA 5IMMB 1UADC 3BH9B 2Y3AA 5EIVA 2EE3A 3CFUA 5J6HB 4AT6B 3VU1A 1SJHB 2ITDB 4FQQA 4LNRA 1DCEA 4GKNA 3FTUA 3LNDA 3WTYA 4QYOA 3TO4C 4YHLH 2HTKC 4LDCA 1TVBB 2G9HA 3IDNB 3RKDC 2E9WA 1DR9A 5LN4A 3FFDB 3ULUH 3NK4A 5CFHA 1E5UI 3G5VB 3TH4T 5C9JA 2JI2A 4OIBA 3C09C 2F1AA 1YUHA 1JMXA 4M9PA 2Q7YB 1GOHA 3SKMB 2IDFA 5GQBA 5HI3C 3TN0B 2FTAA 5IBTH 3FN0H 2YC1A 1IGFL 1OE3A 5B38G 2D03L 1IAII 4BFOA 2CLVA 5ANMB 4LSRL 5EA0H 3KJ6H 5IEHB 5LG6A 5F7WC 1CLYH 4N2GA 1Q9WB 2E6PA 4XOAA 5DJ8B 1KCSL 4B0MB 4JFFB 1JZ8A 1BM3L 2MOQA 1N70A 4MJ6A 4RFNC 5DYOB 1CFNA 3HC4L 5I73B 1MCEA 3JZYA 3W11C 2BOCA 4BHUI 1KCSH 4FFWC 3N85H 3ZGHA 3QR1A 4RMVA 1RUAL 4CVUA 5CO1A 4QRQA 4P57B 2Q9OA 5TE6H 1WAEA 5ADPL 1HILA 5F89A 4CN6A 3OHXB 4KO5A 5IFAH 3L3DB 3ROOB 1FZOA 4GI9A 4XXCA 5EV7A 3TEYA 4FQIH 4JQXC 3IWVA 2XLLA 4W9KC 3DIFB 3GS4A 4DCQB 1RCYA 2F18A 4MXQD 2WVVA 4LVHB 2ZXQA 5F71A 5B1JA 1JXDA 1EFXD 4IBSA 4BFNA 5C08E 4YBHA 3WY3A 2HKHL 5C0CA 1A0QH 4I0PD 1I8IB 1HH6B 4K5PA 5I8CA 3DXAB 3FT2B 1IVTA 3G08A 4TV3A 4BWWA 3FUMA 4TXVB 2BSSA 4HK3J 2VXTL 2WLNA 4AGOA 4YGVB 1N26A 5K9JH 3WEXB 2CCLA 3VFMB 5KAQG 1RUMH 3ZXAC 4X6CF 2Z91B 5FW6A 3BVNB 1KCVL 4P99A 4DWHA 2AQRA 1FE8H 3VFGL 5GSRB 2EEXA 3FB8B 1XBRA 1PKQA 1CBVH 4PJDB 2UVFA 4MB1A 5K93A 1CGWA 3ZMRA 1U92B 4JO3L 5EO0B 2ZG3A 4H7VA 4PBDA 1CIUA 1WWCA 3G04A 3KXFE 1XB6A 3HNTL 3NFSH 1UUNA 3K8MA 2ZKHL 4N5UA 1U2CA 1A6WL 4BKTC 1I7TA 4RGNB 4DEPC 1NCAH 4G7YH 1NFDF 4ZFOL 4O2EB 2RH0A 3SDCD 2O5YL 4AQ1B 1P69B 3IMVA 5D9SB 2P5WA 3NCCB 5JO5B 3S98A 4TNEA 4UDUB 3ZT6A 1GJIA 5DVPA 2V17H 3SGJA 1E4JA 4M6AA 1E8XA 3EHBD 4Z78B 3BT2H 2ZOUA 5J0BA 2D03H 4NQEA 3ZHDA 2MQCA 3K7UA 2FJHB 5L8LB 2LOEA 3WS6C 4XCFH 5DD1H 1W2KT 2R56L 2W9LA 3MODH 5FCSH 4KZDL 5D70H 4L1DA 3SDCB 3VAEA 5KBDA 1KGUA 3S8WA 1HIML 5KTEL 1DJIA 2Q8AL 3WFZA 1BA9A 3TCTA 3WNNA 3QEHA 1YO4A 3ZQXA 1UKQA 1JZDC 1ZT1B 2HX8A 2RAMA 3NCFB 1N4XH 3O3DB 2YAPA 1VLXA 4WRLA 4W1TA 4XCCL 2W81C 2VIRA 3KPOB 4GW1A 5HDBE 3PNWA 3UERA 4AE0A 2XWDA 1AGCA 3GMRA 3LNGA 2XPZA 2XZCH 1BFOA 3KYMB 4POZD 1NTDA 4H8HA 1W0VB 1XMWA 2OYPA 3ZYJA 1EQWA 3NA9L 4MHHG 1NIAA 2EYTA 4ZX6A 4Y4HD 1TPXC 5D1ZA 4GBXA 1K8IB 4FI6A 1URLA 1OP9A 2AF2A 4J28A 2QDVA 4GMTH 4UDTB 5E0FA 3WDJA 2VLJA 2Y1YA 1NBZB 1U8IA 4JM2D 2VMJA 3GLAA 5FYLD 2YS4A 3GIZH 4NPJA 3NFPB 1I9EA 3F84A 1A4AA 2B0SL 3GUFA 4YBLB 4LF3B 1TVHA 4P3DB 5DD6A 2AJUL 3LPGA 1MCIA 5EUOF 1OK0A 5IJKC 1LXMA 1KY7A 1P1VA 2CA3A 4GSDL 4P04A 4XNMB 4NRYB 3IU4L 1LK3L 4OZGB 4EAEA 2UZYA 4WWNA 2PR9A 4HJTA 1QSZA 2AV7A 1MFEL 3CG8A 3GM0A 3OKLB 4IKLA 5M94B 4F5CA 5AFAA 3E6HB 1ZV2A 3PFQA 4L4VB 4AIXA 1FVCB 3QQ3A 5AW9B 2G2NA 5MEND 2NY1C 3T2NL 1HOCA 4F27A 4LSTH 3SKNA 5BS0E 2Q3XA 1AGFB 5DJXB 1X5XA 1F6AB 2VW6A 3TNNA 1ZLVH 1AZBA 1TJIH 3IU3B 4F8LA 1IM9B 4AENA 3WHXA 2MCMA 4C56E 3KNBB 3GJEB 2PP7A 4L4VE 2EVJA 3I02A 3K8LA 1KNOB 4R26H 5F88B 4HZLA 3T6XA 4JFDD 3AU1B 4G83A 4XPBH 4P59L 2WXOA 5BZXA 3EBGA 4Q97A 3S88H 5L88H 1WV7T 3BQUA 3TBYB 1MRCL 1FFQA 4OF0A 5BV7B 3ELQA 1N64H 4BV1A 1RUPH 1JXFA 4OZIB 4ETYA 1KLGB 3ARVA 4JKPH 1A4JA 1L5GA 4XOCA 1I7ZB 3MV7D 3KPMB 3F7RA 3QA3A 1NEZB 2PWFA 4Z6AT 1L7TH 1M2VA 1UWXH 2WV3A 3Q6GL 2LU7A 3B43A 3NCYS 4R7NA 1OM3H 2WVUA 4N1HB 1EX0A 1ZT7B 1G6VK 5E5MA 1FBIL 1QQDA 2ZAGA 2X53A 4G6AD 3G5ZA 3V52H 1JYVA 2V4LA 4KV5F 3WTUA 1FYTD 2WCGA 2ZCKH 1IAIH 1FNEA 3SOBH 4ZW3A 5GS1C 1T6VN 2R9HD 1DLFH 1CD0A 1T7VA 2FLRT 1XH2A 1GGBH 3MOBH 5FA4A 3OKDB 3ESMA 2BJMH 4N6RA 2H6UA 4M6MH 2WXQA 1Z5LA 2NY2C 3QI9D 3GPSA 3N42F 3WKPA 5D4HA 1FFOB 3FQNA 1YYML 4FNPA 1JHKL 1F4WH 4KKPA 4OFVA 5TFSH 2VOTA 1CD8A 5BOPA 2DLIA 3NJHA 1QNIA 3CUPB 3MLSL 4TKWA 3AAZA 3WAJA 3HNTH 4P2RB 3NTCL 4E41E 1N10A 4ORZC 2VN7A 2IPTH 4QRPA 1G9MC 3TA3C 4JKLA 4QTFA 4AYSA 1X9RA 1BIIB 4MKTA 3T08A 1VAHA 4IU3B 2NMSA 5G2NA 1FAKT 3MRHB 2VR8A 3VGHA 3PQYD 2WZ6A 5KVMC 5LGHH 1JPTL 1T1ZA 4L8SB 1ROCA 1QSEB 4DTGH 2BNQA 3MUHL 4P46C 1CXEA 3POHA 4KKBD 3ZKMD 1J9RA 2BS9A 3OLIA 1BBDL 4PVLA 4Y2DA 1SZNA 3RWFB 3U0PB 4G7RB 2NNAB 3BP4B 1JV2A 5CWSB 5B1KA 2WNWA 3C5JA 4HSQA 1JWSB 5SWZB 5I6OA 2D4FA 3PJSB 2IAMA 3NRFA 4MNHB 3DX2A 4BZ2H 5I66B 4UV4H 2A6KB 5DQDH 4ZXBA 3VXRE 3S5LA 3KXFB 3TN0D 4E42A 1MEXL 3H42L 4S1RL 4QJ4B 2ODIA 1UD3A 4IRZH 4YXHL 4Y16C 4LAQH 4X98B 2QMKA 3EDEA 4X9GA 1JZFA 3WJLC 1LL1A 3BD4A 1JF5A 1AGBB 4QRRA 1QA9B 2XBDA 4AW4A 1P4UA 2K8MA 1HWGB 3V5HB 3L48A 3SZKC 3UTSB 2WCSA 1SMAA 3H56A 3S3DB 3SCMA 1OTSC 2HWZL 2ZCLL 3MV8E 3QXAA 4W9FC 3ZT7A 3T0VA 3ATDA 4NFDA 4YSOA 2VNCA 1MVUB 3DO4A 2XXGA 1QA9A 2BOBA 2OX5A 5B8CC 1EWHA 3HI1A 4AM0B 1LO0L 4WNJA 4Y5VA 3W3BA 1EXHA 4HT1L 5F7BA 4IBWA 4G9DB 4K5MA 5CKGA 2WLLB 4MX7B 3HE6C 3S35H 1EXUB 3KXFA 2WWOA 1OP5K 4PIRF 2BNUB 1F6FB 1RURL 1VFBA 3VFRB 3LN5A 1GJUA 1FAIH 1GS6X 2C4FU 4N25A 3TBBA 3O3EA 3INUH 3MN8A 3SD5A 3WENA 3NBNA 1PSKL 4F20A 3FO2A 5KBLA 1Q90A 4GI6A 3RWFA 2KT6A 2J72A 1P5VA 1NGZB 4OD1L 4R4BA 3QQDB 4RWYH 3MLYH 2H1LM 1PSKH 3QH3A 3HE7A 3RKDD 4KKNA 5GZOD 2C4XA 2DZEA 1O6VA 3B1UA 2LU4A 4X6FA 5LQBL 3O9WA