2Z7UA

Crystal structure of h2o2 treated cu,zn-sod
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
151
structure length
151
Chain Sequence
ATKAVCVLKGDGPVQGTIHFEAKGDTVVVTGSITGLTEGDHGFHVHQFGDNTQGCTSAGPHFNPLSKKHGGPKDEERHVGDLGNVTADKNGVAIVDIVDPLISLSGEYSIIGRTMVVHEKPDDLGRGGNEESTKTGNAGSRLACGVIGIAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Cu-Zn]
publication title Crystal structures of H2O2-treated Cu,Zn-superoxide dismutase
rcsb
molecule tags Oxidoreductase
total genus 35
structure length 151
sequence length 151
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2007-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 2z7uA00
1PTZA 5KBMA 3GZOA 2Z7UA 2AQPA 1XSOA 1L3NA 1SXAA 3HFFA 4BCZA 2WWOA 3GZPA 1OALA 2Z7YA 2ZKYA 1CB4A 1PU0A 2AQRA 1JCVA 2ZKWA 1RK7A 1U3NA 1COBA 1KMGA 1SRDA 1YAIA 1E9PB 1CBJA 1EQWA 2AQQA 5CU9A 4A7SA 1XTMA 3QQDB 2C9SA 2R27A 3ECWA 3GQFA 2AQNA 2E46A 2ZOWA 2Q2LA 4N3TA 1BZOA 1N18A 1TO5A 3MNDA 2AQTA 1SXBA 1E9QA 2VR7A 4A7VA 2WYZA 1SDAB 4B3EA 3KH3A 1IBBA 1SXZA 2WYTA 2AEOA 4A7QA 1EJ8A 3GZQA 3PU7A 1OEZW 5KBKA 1PZSA 3ECUA 4L05A 1SDYA 3ECVA 4OJAA 1DSWA 1MFMA 4A7TA 1E9QB 2AQSA 2SODB 1OAJA 2GBVA 2C9VA 1Z9NA 2K4WA 1Q0EA 4MCMA 1SPDA 3KH4A 3H2QA 3MKGA 1QUPA 3L9YA 4U4IA 3HW7A 2AF2A 2VR8A 1UXMA 1OZTG 3CE1A 1UXLA 1YAZA 1IBHA 2E47A 4BCYA 3S0PA 2GBTA 1F1DA 5KBLA 3CQQA 1F1GA 2XJKA 4MCNA 1IBDA 2LU5A 2VR6A 2JLPA 1SXNA 2ZKXA 1SXSA 3HOGA 1E9OA 2NNXA 3GTVA 1E9PA 2WZ0A 1N19A 1P1VA 3KBFA 3LTVA 1SOSA 1F18A 1AZVA 3RE0A 3T5WA 1Z9PA 2WWNA 3H2PA 1IBFA 2WKOF 1DO5A 2WKOA 1HL4A 3K91A 1XTLA 2JCWA 3KBEA 1JK9A 4A7GF 4A7GA 1B4TA 3F7LA 3L9EA 4N3UA 1S4IA 4OH2A 1IB5A 1TO4A 2Z7WA 3KM1A 3SODB 4FF9A 1BA9A 1SXCA 3F7KA 2C9UA 1FUNA 1E9OB 3GTTA 1F1AA 4BD4A 2Z7ZA 4A7UA 2APSA 2V0AA 3KM2A 1YSOA 2GBUA 2XJLA 2WZ5A 1HL5A 1OZUA 1ESOA 1JK9B 3QQDA 3CQPA 2WZ6A 1B4LA
chains in the Genus database with same CATH superfamily
3SY0B 4GG6B 4YHKH 4AIZB 3V0VA 4FKHA 3LDBC 5BV7C 4QT5A 4MQXD 5HSFA 3TBVB 3TS8A 4ZMWA 4LSDA 5AYUH 1G0DA 4O5LH 2H1PL 5CP3H 4F58H 1OQOA 5KS9F 3D69B 4XAWL 2VXTH 3FOMB 4OZHB 4EOWH 3QEQA 3KPPA 3GBEA 3N2JA 2J3SA 5C0RH 4XXDB 4G42A 4JM4L 5DD3L 3NZSA 4NCDA 3FQ4A 5GZOC 3ZQXA 2VDLB 4S1SH 4BH7A 1L0XA 4HA1A 1DFBL 1R19A 4BM7A 1DLHA 2X3BA 1XSKA 4JZOA 2YD7A 5H2BA 3ZT6A 4HOZA 5GZND 3PU7A 4ODTL 2D2CC 3BKMH 4GW5A 1YY8B 1C8PA 1KUMA 4HUCA 5AKTA 1P4BL 3GSRA 5LBSA 1FHGA 1N2RB 3SKUD 3TYFB 2GJ6D 3FCUB 3VXUE 3ZDYF 4LLYB 4NOBA 4D9RD 4KQ3L 2A9AA 3VFMB 2AABH 4BYHA 1PYWA 4RWYL 4YDLB 1AGFA 1KYOJ 3EBIA 3DBXA 4B9ZA 3GI9L 5E00B 1D7DA 5D9SA 4TLSA 4KXZH 4J28A 3FSZA 3DGGB 3GMQB 1HL9A 3DYOA 4A66A 1PZUB 4JRYB 5FHAH 4ZX5A 4JREC 1DFXA 1GJUA 1HSBA 3MLYL 4W9GC 3L1OH 4LIQH 4GXUM 3B1TA 4DGIH 1OKEA 2ITFA 4ZW8A 3AFLA 4Z7UF 2B0SH 3CZGA 1NGXA 1FZKB 2VZ3A 4DUXA 4UQ3B 4QRQA 2G2PA 4W9EC 3VFWA 2EJ1A 1A4JB 2D03H 4L4TB 5DA0B 3ZRCC 2FQFA 1WO2A 4ZXBC 3ULUL 4QXTA 4CJ1A 4BZ2A 3IGLA 3ABMB 4YR6A 2AW2A 3V0HA 3R4DA 3RVTD 3TVMC 3HTLX 3VFPB 4BUGA 5GRZA 4XXDA 4C47A 4JHWL 4XCCL 1I9JL 2IOOA 2WUBL 4TOYL 4FFZH 1TQCB 1HSAB 4Y4HC 2I7OA 5J13C 3KPRB 4N3UA 4AC4A 4OH2A 4JFZL 4RMWA 3Q1SL 4E42B 4JFPB 4NP9A 5FO7A 5GJSH 4Z3EA 1FORL 1J1XH 3T08A 2JB6A 1FFOA 2VN3A 1NQBA 2Z8VC 3QUYC 1KBPA 4H8WH 4UZSA 2JQMA 3G5WA 3JTSB 2QTEA 3M1CA 4J8QA 4Y9BA 2VDLL 4G7QB 4PS7A 3MCG1 3NIFB 3NPZB 3SJVE 3QEHB 4ZX6A 3ALWA 2X9XA 3CLWA 1N2RA 3R0NA 5BV7H 5F72S 3SBWA 3HG3A 4OFYA 3HBPA 1JWSB 5EB9A 1U8MA 2AJVH 2Z7UA 3CPLA 5B7EA 3ZYOA 2J57A 5IT2H 3SPGA 3IJ7A 4CC4A 1IGYB 4NO2A 2VABB 3FO1B 1RZJC 3A4EA 3KPNB 3LQAC 4GG6E 3MTXA 3ZDXF 2O5YL 3FCBA 2KPNA 3HE7C 2IF7A 4KNQA 4FYRA 1VPOH 4JFWA 2HFGL 2JB5H 2AQQA 2BOLA 1R5IA 3L3KA 2WIMA 3BP5B 4L4TA 1A4JA 4OZHE 1BCIA 4GW1B 2FWUA 3S6CA 3KLLA 2WMPA 4YE4L 1V54B 5FA4B 5D1ZB 3DX6A 3U6XS 1J10A 3GSUA 3V0IA 3QIBA 5EUKB 2EDQA 1SQ2N 3UTSA 1AZRA 3OG4B 4YDKL 1F11B 1HDMA 5FGRA 1MQKH 3J8F7 1KNOB 5IUSA 3QWRA 5FLVA 3T6ZA 5D7IF 4BSJA 5D55A 5HGGS 4P4KA 1IT9H 1NBZA 3ZDZF 3RGBA 3IGKA 3FF7A 4J3VA 3EYQC 1D5BA 3Q6FA 4I0CC 3RL2A 3CN2A 1UD4A 1OP5K 4YSAA 3MJ9H 3JWDC 4M4PA 3P73B 2KH2B 2MCMA 1JPSL 1PD1A 4XXCC 1Z9LA 3UYRH 2Q6WA 4J27A 2WWKT 1MNUH 4QOKB 2Y7LA 4KKLD 3HUJF 2C9QA 3C6SA 3RHWK 3KEHA 2PW1A 4LHUG 3H3KA 2XV2A 3HZMB 1VADB 3MLUL 1IGYA 5KBLA 1MCEA 1N7MH 3RFZC 5G5DB 2XJKA 2D7PA 1YVLA 2F8OA 1FZOB 5F9DC 2ESVA 4Z7QB 5BCAA 4DO4A 4RMUA 1EGJL 3WYRA 1DBJL 4EZJA 3NABH 3G08A 1QRND 4XBEL 4Z0XB 3UH8A 2D7TH 5CKGA 3H42L 4DFHA 3DIVA 2K7QA 4GSDL 4WWKC 3CXHK 5FKAA 5FA4A 2VLKE 5D1ZA 1TCRA 3MYJB 3BKJL 4RCAA 2K6ZA 2WCPA 3EYUL 1UFUA 4DEUA 4ANUA 5FUOH 1PZDA 1UCBH 2CAKA 2R69L 4PLJC 1GOGA 2C4XA 2I26N 1OAQH 1C5CL 1NGQH 1UQSB 5AVQB 4OLWL 4BHUA 3F04A 4HAFA 3QQXA 1CYGA 3C08H 5E8DH 3UADA 5T3ZE 3KM2A 5H37H 3ZSTA 5MENA 1MCFA 1EEZA 3Q5YA 2PR4L 1I8LC 4NWTH 5T1MB 4O02B 4HMCA 2HX8A 1RZJH 3LQAH 4L3EA 1ZA6A 2B39A 4H4NA 1GGBH 4JUSA 3PDOB 2ENYA 3OX8B 2JKNA 4IBSA 2DAVA 5HXMA 4XHJC 3WFEL 4PGCB 1WA0X 3WNLA 5F3BA 5C07B 4NYLA 3L4CA 3ZTJG 3N42B 5IHBA 1ET8A 3UG3A 4AYID 2XWBA 1DL7L 1AQMA 3HI6H 1KCUL 2DKUA 1BQHB 3ARUA 3W82A 3GMRB 4S1QL 4PR5A 1MLBB 4QHLA 1BQLH 2B20A 3BESR 5DZJA 1AXSB 2FEDD 4TVPD 4P23D 3IDGA 3I6LD 1IZKA 3UJJH 3L3OB 4UV7H 1IGIL 1QUNB 4FXKB 3LD8B 4DVBA 2BP8A 5E6UB 3BVTA 1AHWC 4RAHA 1CK0H 2YQ3A 1OLZA 2QPUA 3UTOA 1ZGLB 1ZS8A 1JPTL 3PWLA 4XPGL 4K3DL 5C0NC 1I82A 1MFBH 4RGNE 1AC6A 1A7QH 3D9AL 3JWDH 4OJAA 2EYSB 2IQAB 3JYBA 2V6HA 3BH8B 4IGBC 2V37A 2JK5A 1FGVL 4OUUB 2XBDA 5IROC 3BCFA 1ZDQA 3EKCA 2DL9A 2ITEA 2F15A 4X7SH 4UYQA 3DARA 1SPDA 3AROA 4G5ZL 4F80A 3HHMA 5I9QB 5C08B 2OCCB 4ES9A 3ETTA 2EZ0C 1NFIA 1UOKA 1MAMH 3P4OB 1F4YH 2H6PA 1HXKA 1NL0H 3N06B 3BN9C 4PWHA 4FQXD 3PHOB 4NQCD 1AKJD 4Y2DC 4N0CD 3FBKA 4TNVK 3KMDA 3OX8A 3TNNB 3ZE0B 1PKQB 2QDWA 5E5LA 2ADGA 1LDPL 2X0VA 3QFDA 2J72A 3QJFB 4PJCB 4O02L 7PAZA 1WUZA 2W38A 5L88L 4R7XA 5E2UL 4LSRL 1YN7A 3CSFA 4FP8H 3B2DC 4HGMA 1T0MA 2I07B 2Y23A 1OCRB 4Z7QE 1AXSA 3GJFK 2Z91A 2EXYD 4NO3A 1KCWA 4Z7OE 4UM8B 2J6WA 3O3AB 2MPAL 5DD0L 3LSOB 5DD5L 3CU7A 1J8KA 5FF6B 2VDQB 2XQ0A 4GBXA 5I82A 5FO8A 1KGIA 1RJYB 4FQJL 5CF3A 5F7HA 3ZHFA 3S4SA 1SQMA 4IEFA 3EZJB 4AMKH 3R18A 5DK0B 1CT8A 1X9LA 3B3IA 2EXWC 3HEIB 3HS0A 3HC3L 4HEPA 5IESL 2DIBA 5EO1B 5KN5A 4MA7H 3BPCB 1JAEA 3QJZA 1J18A 1WBXB 2P3YA 4FQCL 4I8DA 5DHMC 5GS2D 5IMLA 4IKIA 4K8RL 3ARFA 2FLBT 5AG8A 2BFVL 1T2JA 4PY7A 5FECA 5DRZA 4PTTA 4O2FB 4NNPL 4WUKL 1XF3B 3C8KB 4I48A 2R1WA 3AWGA 1MJJA 1LXMA 5D7EA 3WEXA 4QJ5B 5KVEL 1SDDA 3O6FB 3GMOA 4LSTH 2ILLA 1J8HE 1CFVL 1JUFB 3A67H 4GMTL 4KI5D 4XNBA 5C07E 1KGUA 1F3JB 2VO8A 3RLSA 4NGHH 4G8FB 5GRVL 2MMXA 2HT4D 4LVOB 1AE6H 1A6TB 4YOKA 5EZLB 3OKKB 2FJHB 5EORH 4EI5C 3ELQA 1BFVH 2ICWI 3VXNA 5JW5B 3DX3A 4N2AA 1I8IB 3VFSA 3ELAT 4XP5L 3TA3B 4BGLA 3H6JA 3D34A 2DYSB 2UYLA 2Z31B 1NA8A 1VIWA 2ATPB 4L05A 5CD5C 1NDMA 3VX0A 3EUUA 4OGQC 2QHLA 4B60A 1JERA 3P9LA 1H9VA 1O9WA 1P7HL 2I60L 5DK3A 3F64A 2YEQA 5DLMH 3Q13A 1YEIL 2EO1A 5D2NB 1RLWA 1NC2D 2VDQL 5FYJU 1E4KA 5KVEE 1SVCP 1A7PH 3UDWA 3SDCB 2C3VB 4NFCA 5DHYB 3ARGA 1T21B 4YGVA 4HDIA 1M7DB 2UWEE 1KBGL 3K6SA 1MRDH 4WJG3 4E5XG 3VRJA 1ZHNA 3ZE0E 4R2GB 5F2FA 4G5AA 4NC1C 1MCBA 1UWGL 2P5WB 4KFZC 2QQQA 1EV2E 3DK0A 3T0EC 2WWKO 4HZLA 5IBUG 1KEMH 2AXGA 2P8LA 5FA3B 3T5WA 4ZOAA 4MCYA 2AP2A 1IRAY 2GJZB 1UWFA 3EO1A 5LBGA 4FQLL 4B0MM 4AVKA 2FIRT 4FJYA 3LH2L 1F90H 3E8UL 3K5RA 2YAQA 2ZYHA 3TIEB 4AQ1C 3OV6A 4N5UA 5I8EB 5I73C 3QULA 4R26L 2VT0A 3CFDB 4LSPL 5I17A 3IMVA 1T04B 2Z0UA 3L5XL 5E1AB 5F7LB 1TPXC 4CSSA 2Z31A 4FNLH 4IRSB 1C08A 3IGFA 1BAWA 4FGMA 1BPVA 3KWTA 4PS4H 1WIPA 2H2PD 3RGVB 3T3PE 1G7MB 5IM7B 1D2OA 4X4XB 2X4QA 2JKRM 1U3HD 1FVEB 1TNNA 1NKOA 4XGZB 5DRNB 3WHE0 1UENA 3BSZL 5IUCA 4PJHF 2FT7A 3FSVA 3SDCA 3ZKSD 1WT5A 5CJXC 2HG0A 3NUKA 5DS8B 3NVQA 3UAJA 4P2OC 1VFMA 3DUHA 4AEHL 1YUHA 4NKMA 3E6FB 2ROXA 1XF4B 4WI0A 4G1EB 2NY2D 1J5IA 1BZEA 1JL8A 4TPRH 2H9GA 2L7UA 3UPAA 1Y1DA 3UJIH 1I85C 1N18A 1GYVA 5GGVH 5JOPD 2AK4A 4K23H 4BFRA 2FX8H 3OZ9H 3APCA 5LGHL 4PJAA 1U91A 3WD5L 5HHQB 2JV6A 5AW9B 4Y5XB 1OO2A 3PHSA 5GS0D 4Q9RL 1N8ZB 3BFWA 1MREH 5E6IA 4NIKB 2FSEA 4M7ZC 2DBLH 3LKNA 1WZAA 1I3RB 1PZSA 4LKCB 3O4LB 4Y9EA 3VTMA 2YHGA 4ZFFB 3D08A 1E9QB 4HK3N 3CFDA 3QAZB 4H13C 1ROCA 1AGCB 5TE4L 5FX3A 4UIMB 5DR5L 5E1AA 3SE8H 3QDHA 4QTIL 4KKBD 5J1SC 3VXRB 4D9LL 4HWNA 4XNYL 1DQQB 4E9VA 1W72H 1T5XA 2GQHA 3EO0A 5ITBL 4OTXH 4P9MH 1CTOA 2V9QA 3OAYK 3FT2A 3EJYC 4K3EH 4JKLA 1H0DA 4OCYH 4S0HA 1NANI 4JFOA 1E0OB 5DD6B 3FU7A 1YEDA 3QNXB 3QFGA 5HY9A 5B3JF 4GMSL 1CXHA 1K4CA 3HZKB 5KSBE 1OARL 4JFED 2CJUL 4JGUA 4GEIA 4PJ9D 3WKML 1N64L 3P3SA 2IBGA 3ZKXC 4DTGH 1ZEAL 5D7JA 2DYPD 2H0EA 1VSCA 1W91A 2KHAA 3HG2A 3KBPA 2Q3XA 5JPMC 5C0AD 1JHKL 1E6OL 5ALBL 1H6FA 1AGBA 1XEDA 2GJRA 1H6UA 4G1EA 4IKKA 4P3DB 3SBQA 3KL0A 2P5WE 4M7LH 3AT9A 3GLDA 3T0VA 4K3HA 5L2JA 1CICB 1ZHLA 3LZRA 2Y07L 1EHXA 5H37G 2MNJB 1XGRB 4D0DA 1NMBL 3DVGB 2NT0A 3P9MA 2BRQA 2VKXA 8FABA 1KB9J 4XZ4A 2Y7NA 3OKDA 4XTRD 1C1EL 3NIDF 4N0FB 4CU7A 1MVYA 3K3QA 2B2XH 1H5BC 3DV4A 1VGEL 4PWJA 5EZOH 1MFCL 4MS6A 1JGEB 1WK0A 4WI8A 3CHPA 2C26A 5KJ7E 4JB9L 4YSOA 2VLRE 1XSOA 4LQFH 3NN8B 2Z8SA 5AFAA 3HFFA 5HYJB 4OZIF 1X9RA 3NRQA 3MUGB 1C8QA 1B9ZA 1MWAH 2AQRA 1VZIA 3MRGB 1ZHBB 3I84A 4AGOA 1G1KA 1UURA 1YYCA 3GSOA 4GAJH 3GXIA 3U36B 3FK3A 4U3CA 3MZGB 1E3ZA 1XH3B 2YXWA 3PFQA 5E9DD 3QK0A 4NKIH 1MAKA 2QQLH 3L7EA 4OLUL 1B4RA 2ICEB 4Y1AB 3QNFA 4PRPB 3SGEH 4K71C 2FO8A 4IKJA 3O0LA 4ZT1A 1P4LB 3QPQD 1MLCA 2VZOA 2EYTB 4I9WD 2X4PA 2VH5L 2WNXA 3LZFH 4V1DA 1BFOA 4DP6X 1GXEA 3NPSC 1ZANH 4U1JA 1H19A 4ETYA 1UT1A 3TONA 2AMUA 1XGRA 5JDSA 3L1EA 5EF3A 4FG6D 3FU9A 2UX7A 3ZBMA 3AITA 3L7FA 5GSRB 4BZ1L 3POCA 4N8CL 1NGYB 1L5GA 4GRLB 4R97C 3AMKA 3FUIA 4WUUA 1BSIA 2ZIDA 1QBLL 1UZGA 3GRGA 3NCWA 3MJ7A 3T1WA 4G2AA 5DSCB 3K72B 4HYTB 4AT6B 1T4WA 3VA2C 1KGCD 3HC0B 5ESVB 3RVXC 1JGEA 3VXRE 4N26A 2FECI 4Y7MA 1TFPA 5FCUH 2VXUH 4IK7A 5D1QD 4EAEA 5I74C 3BP4B 2ZXCA 3SGDH 4H26A 1FGNL 2WN2A 3DURB 1N5AB 2DICA 1JZIA 2K7PA 5IKCB 1OSYA 2JKSA 3DO3A 1VLXA 1BZ8A 4XXWC 1BQSA 4G9FA 2BS8A 4KNUA 1UM5H 4WKXA 3LTVA 2IC2A 2DH3A 5LG1A 1GYAA 3W3BA 4Q0XH 3RUGF 4DGYH 1I3VA 4JFFD 4G59C 1W16A 5F88A 4OCWL 4UDTA 2Y36H 4JO3H 1QVOB 1S9YA 2Y2YA 3QDJD 5I1EH 2R4RL 4FTDA 3B9KC 3CN4A 1IB5A 3FQRB 5ID0B 5EOQH 3F3HA 4YHIB 4XCFL 3VD5A 5JW4N 4DOHE 4LDCA 1I4FB 3RWEA 2VQUA 1CGYA 1GKOA 5F9WB 5ICYB 4MAYC 1JTOA 4EN3C 2EC9U 4KQ4H 5CLZA 3L5WA 1R5VB 4POZD 3QQDA 5C09A 3D09A 2DQHL 4W9IC 5C0JB 3RP1A 4XO3A 2CCVA 1FFTB 2FTAA 3MBEB 1EFQA 2NW2A 2X12A 3U0WL 4FTVD 3UTQA 1ZXQA 2AJSL 2GTQA 2DEWX 2GI0A 2F1AA 5TE7H 4G9DB 3QEQD 4I3RH 3B2UD 5HYJE 4PB0L 5AAWA 2G5UA 3BP4A 4N2KA 3TPUB 1OOWA 3FZUD 4JM2C 1XGPB 2IOIA 3IJSA 4O4YL 2BNRA 4J6IA 3TP4A 4NAJA 3IU4H 5IKCA 2ZXGA 2KLTA 4N2DA 3ISRA 4XMWA 1PG7L 2DQIL 1Q0XL 3GK8H 4DQOL 4RZCB 2GJJA 3L8QA 4PJ7A 5FB8B 2O93L 1X5GA 3PL6B 4PRPE 4Z7VA 2WXIA 4ZUTA 3MR9A 2AEOA 2EAEA 4PGJA 4PYHA 1VERA 2XNAB 3SJVD 1MEXH 1WBZA 1T0OA 4BKTC 5ID0A 4X6FA 4KTEH 1QW9A 3CXDL 5C0EA 5IVXA 1UA6L 2R59A 1ZPLA 1BIIA 5I6XB 1NAMA 2VE6A 1L9SA 2SODB 4N8VG 2DLEA 3BAKA 4W6WB 4YSTA 5EC2B 2W9EL 2WVTA 1OCZB 4NRZA 3QHFH 4H20L 1ZT7A 4HJGA 1R3HA 4LRNL 2Q7YB 3ULUD 2V8LA 1INQB 1YYMH 5GJTH 1N4XL 5DT1L 4MWFB 1M9WA 1QLFB 1UJ3C 4HPYH 3FKUS 4Y19B 1HH6B 4YX2H 5C0JA 2NY3B 4MJ2A 1RL1A 3AS0A 3HN3A 2Z6FA 3I50L 3T8XB 5KZCB 5E9AA 1JZ6A 3EAKA 1U8NB 4WU7B 1VJSA 2ZKHH 4M6AA 1HHJA 2J88H 3BEWA 3PNWB 4M48H 1CDGA 2OR7A 4HUVB 4I18B 5A16B 2X88A 2UXVA 3MV8B 3L3JB 5G4OA 5AOLA 2IPKA 4AG4H 1RHFA 1CQKA 1IGFH 2B59B 5B1JC 2F18A 1LLAA 1DN2A 5EU5A 3IMSA 1JK9A 3P77B 1CBVH 3MRMB 1H3PH 3T2QA 2J1YA 3EGXB 4RMRA 4PJIB 4NHCL 4IOIA 3D39A 4P2RB 2WXPA 4PJBF 3RWDB 1QA9A 4HIHB 2AGJL 3HI5L 2DL2A 3UO8B 3J27A 1FNLA 4OFYD 1BGXH 3B5GA 3AB0B 3OHXA 3L1GA 5HPOA 1GJWA 4KHXH 3GBML 4U1NB 2GITA 2AANA 2DTSA 3FFCB 3UBFA 4KMTH 1L3NA 1SXAA 2VDMH 4JRYD 3TCLB 1OALA 5BJTA 4QGYA 2F54A 4HIIB 4XRCA 5EF0A 2Y24A 1RPUA 5T8IA 3IDNB 3ML8A 1O75A 3KYAA 4CU6A 5HHXH 4TTGA 1HH6A 1IEBA 4IJ3C 4CDGC 4GXUN 2O6PA 4L4TD 2P7TB 2EE0A 1DZ0A 1BHGA 4OFIA 2W95A 1FDLL 4P2QB 2DQMA 2Y2WA 5AD0B 2EVGA 3T77A 1XV8A 3KR3L 4HIEB 4JPWH 1NMCC 3LKRA 3QXWA 2IQ9L 3QWRD 3V5DB 3KPRD 4J5VA 4GPVA 3GIVB 3WJLC 2OJ1A 3B83A 5DEGA 4RIRB 1DUZA 3SZ6A 4P4KD 2LLGA 3CZFA 3MA9H 1SHSA 5JPNB 1OPGH 2GSGA 1MSPA 3MLTB 5AW2B 3KPMB 5IOKA 2HMID 2FDBP 5K9JH 2BWDA 5FDYA 1P7BA 1GS7A 1LO5B 3FAWA 4JZJB 4LT7A 2BVPA 5FYJH 4HIHA 5LB1A 1FO0A 4OZGA 2EH8H 2WAHA 5HJ3A 2NY5L 3DVNA 1HEZB 2C3XA 3NH7H 1MJ7L 5AKRA 1UEMA 1Z9MA 2KQNA 4LKXB 4BHUI 2ZWYA 3GWJA 4ODUB 3I9IA 3D25A 2EEFA 4HG4K 2BC4A 4CMHB 1D6EA 2VR3A 3I75A 4ZMOA 4M8RA 3O3EA 4PAZA 3ARPA 5C0GA 1A1MA 2XZZA 3BGFC 5DWUL 3L54A 4PJXB 4DP2X 2ESVD 4N68A 1BEXA 2WBWB 4M93C 1LP9F 2X4UA 2WLLB 1SMOA 4OM1H 1S7SA 4M62L 4ORGA 1UD5A 3FH5A 2CLRB 2ZXWB 2FNBA 3F7YA 4DP7X 2LVCA 3P2TA 5D1ZD 1E50A 2HFEB 2E9WA 1MCHA 4FXGB 5C0FB 4YN3A 2VAAA 3MV8E 3K71A 2EIDA 3SE3A 4H0GA 4U3SB 2WUCL 2K0RA 4A7GF 2JF1A 3PIQB 1I31A 4KXCA 4BXVA 4AZ8B 5ALCL 2XRAL 1SXCA 1Q94B 2XXGA 1DP0A 5MEND 1JPST 1I9IL 2W8CA 3R06B 5AVSB 3UC2A 4BD4A 4P2RE 3OZKA 4FMFA 4NN5C 2LTQC 3MLTA 4HX1B 2FQEA 3GSWB 1LO0L 3L3IA 2XJLA 3FU8A 4HOXA 4L3ED 2ZUYA 3Q01A 4BKLA 1T03L 3SOTA 4N86A 1TJGH 5JW4Q 5IQOA 3S37X 2P8MA 4QOKD 5CNHA 5DI8B 5EOTB 3WEMA 4N2FA 1SY6H 2XQYK 1QFHA 5AW4B 1JDCA 4NNYB 2YQGA 2H6OA 3FFCE 4LKXA 4HCFA 2YZ8A 1NKRA 4B50A 1YMHB 4A2FA 1U8LA 2A1WL 2G2RA 2X3AA 4P5TC 1VAHA 2BP0B 1WD8A 5JO5B 1DDHB 1JIBA 4ENZA 4OZFH 1FE8H 3W39B 3VUAA 2BO0A 5D1XC 5JLZB 2Y0SA 1DBAH 4WENB 3JWNC 3VACA 3WUWA 4DZBA 3MA7B 4YBQD 1KIUA 2HRPL 5E8NA 3HBGA 3CSBA 4JHAL 1U2HA 2ARJB 1KGWA 5LDUA 5C0FA 4HSAC 2ODHA 3AMLA 3HHSB 4U3SA 3SPVB 2YZ1A 1BM7A 4ONFL 2Q7AA 4G1MB 4QKTA 2ZXAA 4XBMA 3WXVL 1F6AB 2V2TA 5DFVD 5CM1A 3WJMA 2WXRA 4JY6A 5HDBB 2NX5E 2DN7A 1DE4B 2HKAA 4HJIA 4F33A 5IJDC 5J57B 1MCPH 2X6CA 1RV6X 1KN2H 2UVFA 4MMZC 4OJFL 5F7EH 4YHYB 4KH9A 2CIKB 3KH4A 4PGEA 3MRQB 4KKZA 4GB9A 3B6SB 4JO4L 3T9WA 3LKSB 1FN4B 3QA3B 2LLNA 4XWOD 1XH2A 2EH7L 2IH1B 2IBZY 3D2UA 3M1BA 1HVXA 5AZEL 1UYWH 4WI3A 4BWTA 1VHPA 2ZX7A 3L5IA 5D2LF 1XMEB 5CLXA 2OK0H 2NTFA 2BSTB 4PGZA 1E7UA 1ZVSB 1DEEA 3DMMC 3CFEA 4WY7H 5JO5A 1VESA 1QPXA 4WO4B 4K7PH 3FN0H 3FRPG 4DWHA 3EJRA 3QNZA 1E2ZA 3OKLB 2CBMA 5JLZA 1ED3A 3V6FA 2WNWA 4GBXD 5GGQL 3T2NL 3FUEA 2BSSB 3BZ5A 3MA7A 3QQ4A 3OAUL 4HJJL 2J8HA 1NUFA 3AQXA 3OXRB 4H0LC 4MNHB 2W9LA 2A9NL 1FUNA 3CZUB 3BRDA 3RY4A 1JRHH 3CCHB 4I5BB 2APWA 4DCQA 5A2IH 1P5VA 3DOSB 3X3FL 5DUJA 1DJWA 5I23A 3MTRA 5EWIH 3QDMA 5I76B 5IOPA 5C08D 4M5ZH 1KPRB 5DWPA 2ZAGA 4LMQE 5DHVH 2EUXA 4XPHH 3AU1B 1BLIA 1S6NA 3ARDA 4MXQC 1AZZC 3IJYB 3LKSA 2ZKWA 4K94L 2RR3A 4RX4D 4U7KA 2X4NB 3UEQA 3KPQB 3JUYA 5KVFL 5K69A 1F00I 2EDDA 2OLDA 1YAIA 1WA2X 1ZGLM 3RJDA 3JWNH 2VW6A 1T20A 5F1OB 1CBJA 1MKFA 1PD0A 3KNBB 4Y5YC 5EO0B 1KLUB 4MDJA 3V6BR 5FYLH 2Y6SC 3AG4B 1QTPA 3RNQB 3OWEA 2QKIB 2R29L 4HPOL 4PRHA 4ANKA 5C6PB 1FVCB 4MD5B 4OFVA 2V2XB 2EIJB 3HIZA 4GQPH 4K2UL 5I1LB 2WYTA 4KDTC 4X6CA 3HNTH 4F7MA 3I9GH 1RPKA 2WBKA 4MX7A 1U8PB 1LGVA 1Z3GH 2YK1H 1WD9A 5HI4C 3RVUD 2BSSA 1INDL 3V0AC 2LGNA 5HVHC 1F4HA 3ZW3A 1G1OA 4N22A 4ZDHB 4MNHA 5EN2A 3MCYA 5C6TH 1O5PA 1CFNB 3BUYB 1XGZA 4Q6IA 2ENQA 1TU2B 1NGZB 2H6UA 4K07A 3WLWC 3TH2T 5HDBE 2X09A 4IU3A 4EUPH 1HE8A 1U92B 4FQ2H 5I8OL 2LAAA 3BE1H 5KVFE 1PQZA 2VL4A 4KPHL 4ZTOL 4Q97A 3ARGD 5I76A 2J1ZA 1L0QA 3V0WH 1TEYA 4HAKA 4XP6H 2KC0A 4LBEB 1ASQA 3E1ZA 5EZJA 2EKJA 2ITDA 2CKBA 2DZEA 3FTWA 3QUZB 2DQFB 4FQPA 1OGTB 3W2DH 3FT4A 4A68A 2VR4A 4Z3JA 4HT1L 3VSVA 3VFTB 2DIEA 1NAKL 5DA4A 5DF0A 2COVD 4GRMA 2GT9A 2VMFA 2WPGA 4PRDB 4WSJA 4HLEA 2DQTL 2XWJB 5ISZB 4L1TA 3U4EB 1XR8B 5K5YA 5ERWA 3MO1A 4KJQC 3ZR6A 2DIJA 5F93C 3QIUA 4J3WA 3BKYL 3KPOB 2YRBA 4QNPF 3FT1A 3WGUB 3QWOA 2DDQL 2Z31D 3S2AA 1B4JH 2ID5A 1CFSB 4OIIL 5FGBC 1RUQH 4JJ5B 5DJ8B 1WC7B 3VNYA 4L2LA 4JHUA 2G3NA 4FYQA 2OYMA 3IWUA 4ZDHA 1CFNA 1QZNA 1QNZH 3BUYA 4U6HB 1T3FB 1NGZA 2F2HA 2P26A 4Z78B 4IBWA 4RAVA 4XB3A 3SDCD 2NY7H 1MPAL 4QXGL 1DO6A 1E4WL 3BT0A 3GI8L 4IS6B 4RISH 2YMXL 3HNVL 3GMLA 4NCC1 4WKZB 4JFDB 4XC1L 3UG4A 2BDNH 3HG1A 2PKDA 3I85A 3N3EA 3OKOB 4X7TB 4FG0A 3H3PH 4MAUH 2YUVA 4R2GD 1GZQA 1ETZA 3DK2A 3TTYA 2NDFA 1BAGA 1N0LA 5HHVH 3VYOA 4AGMA 1O6SB 3CJJA 3LS4L 3CQFA 4IKNA 3RYMA 5D71H 3U6RB 3WS3B 3LRSB 3NJMA 1HHHA 3MKKA 1W0YT 4UM9A 3ISWA 4JLRA 1S9XA 1X9UA 5E6ID 2GIYA 2V7NA 5H94A 1PZ5B 1A4BA 1S5IL 4R0LB 4HF5L 1JBJA 2Q2EB 2UXTA 4G70B 1WFTA 3EJZD 1CL7I 1JXKA 3I02B 3RY6A 2CM5A 1BAFL 2Z34A 4KRMB 2E7BA 4F8LA 3K6OA 5GQBA 3VJ6A 5EA0L 1GGIH 1RULH 1E42A 6FABL 3DDFA 1JGIA 4PJEF 4AQ8C 3HE6A 1VFAB 3VWJC 3BVNA 4JPVL 4WCYH 3H0TA 3N9GL 4N5ED 3RIFK 1QUPA 4WFED 4RDQG 1AQDA 3DECA 1EHLL 4UTAA 2FYYA 4U6HA 1AYRA 1R24B 2VITB 4LAQH 2EADA 4HLZH 4TL5A 4U1GC 1XXFC 1EO8H 2CIIA 1NZRA 1XD1A 5SWZE 5D7JD 4NC0B 1CDJA 2CMRL 4TQ8A 1Z0MA 3QHTC 2I9TA 3SSGA 3K80A 2YD9A 1AY1L 1HT6A 1ZK5A 4UOW1 2GUYA 4U2YA 5L4MA 1TFHA 1JNNL 1VZGA 2CO4A 5EU4B 4FYSA 2A9MH 2HN7B 3U6RA 3RZCC 1LILA 2D31B 5FM5O 4KK6D 4JAMA 1J12A 1BF8A 3S8WA 4N1EA 1PX3A 3SODB 4HJTA 1HHKA 3LRHA 4Q9BA 4PS3A 5FDWB 1LE5B 2WXJA 4N9OB 1J1OH 1X4YA 1CLOH 4WI9A 3MRIA 5ICXB 3O4LD 4Y4FB 5LAXB 4TQEH 1F0LA 4Q6KA 5C6WH 4J2QA 2OA9A 4J4PD 2EE3A 3O2DL 3O3BA 4LGPB 5HI5C 4RDQF 3HG4A 3POHA 5KYYA 3MOBL 2J2ZA 4NRXB 4YAQB 4LAJH 5F3FA 5F1NB 5C0BB 4J3BA 3V9EA 2ZX5A 1DVZA 1YNTA 2UZYB 1EEUA 4WTXA 4XH2B 3VXRD 3C60A 3EW3B 4OGXL 1M1XA 2HVKA 5FYKL 3BFOA 5BZWB 4L8DB 1KWGA 2OMVB 3BAYA 4IIQC 5KSUA 4OZFG 3D3VE 5E2VL 1N6QH 1RIVL 2Y5QA 2DRUA 4YK4C 4JPQA 4U6XB 4PJ8A 2FBOJ 1XXDC 3EG9B 2AQ1A 1I7TB 2O26U 3WY4A 4APXB 4FLQA 4Q6YA 4TRPL 3N43B 2N0KA 2DV6A 2VIRB 3TBBA 3RL1A 4HFUL 1TOXA 5CEZD 1LK3L 2QADB 3KWXA 3NJNA 1GGCL 1BOGA 2PO6C 3IFNH 5AW7B 4YHOH 1XT5A 1A7RH 2ZWSA 2W07A 4JRXA 1F4AA 5IJKC 4I0KA 4UTBA 1E3XA 3ARWA 4Y5VA 1CICD 4JFYA 4V1DD 4AQAB 1MCRA 2R8SH 2DF3A 3UAEA 3WO4C 4HEMA 3IKKA 4RRPM 5GS1B 5MERB 3DPBB 2WSPA 1HE7A 5EU6A 5AVVB 2AV7B 1V7NH 4NNXA 4AVJA 2NY1C 2PYEB 4FA8A 3G5YB 3PWPB 4JDVB 2ZICA 4M03A 3RTLA 1LE5A 2PCFB 1NGWB 2IFGA 2ALAA 4UZUA 3ZHKA 4YMPA 5F8QC 5IB3A 1KXTA 3BGMA 1FL5A 1XAKA 1T2QL 2PPDA 4KX8A 4NXKA 1RP9A 5KYUB 3IJEB 2BSCA 4NRXA 4PB9H 4KMQA 3O8XC 4MASA 2LAGB 5A3ID 3VI3E 4NQSA 4PMFA 2AJXL 5CHNA 1UH2A 4Z7WB 1CFTB 3A6BL 4G9FD 1ZTXH 1Y0LB 4L1BA 4KROC 5CR8A 4N9GB 3SGJC 3V52H 4OD2B 4ZJ9A 3KYKL 2QR0B 2J5LB 3T4YA 3CVHA 2ZOKB 4PI0A 3FUMA 2PXYB 4GKLA 4LSUH 2OKMA 4Y1AD 1TTFA 1YJDC 5C8JA 1YG9A 1VFOA 3LPFA 1KC5H 1RUMH 4JG0L 5BS0B 4P4RB 3TBWB 2BERA 4IRZL 4Y4KA 1C9SA 2AQ2A 2YGVA 4OQTL 1FNGA 4LCWA 2O5ZH 2VLKA 3BPLB 2ZYIA 4P59L 4S0SD 2ZCHH 4LCCA 1B2WH 1DQDH 2EEXA 2M26A 2O5XH 5EU3B 3LXUX 5IMOA 2B08A 3B8SA 5FW7A 2QSVA 4OGYL 4WSGA 1KXQE 1UZ6E 4IBLT 5IHZB 3P4NB 2PYEA 5C09D 1M53A 2RJMA 3GD1C 4HHAB 1UGKA 1I1CA 4P46C 2D9CA 3LJ3A 3Q5OA 5J3HD 4G7VH 2RGSA 3U25A 5C70A 1BVLB 1CVSC 1EEQA 5FOJA 1KDIA 3CDGA 3JWNG 1ETB1 5AZ2H 4BQCA 3IVKB 2DKSA 4PLKD 4MMXC 3VD4A 4U31A 2CHZA 1RK7A 4LF3B 2NNAB 1SJHA 1TCMA 2WO3B 4FYTA 5JHMA 5IW3A 4B9YA 2HUHA 4TULH 4Z7WA 1KFGA 4G6JL 4MQXC 4AIOA 2AZUA 4UANA 3V0JA 4NWUH 3LNIA 4JN1L 1HILB 2AQTA 1NM4A 3EO9L 4NI6A 4WV1A 5E4EC 4QGTA 3S34L 3SKJL 4A1RA 1SHWA 1WZKA 2XUWA 4PP1D 4XVUC 2WQVA 1JTPA 4X5RA 4L1DA 5BS0A 4HHGA 5F7NC 5IG7B 4Z3TA 2IAMB 5SWQA 2Y5TA 4XO5A 2EIMB 5HPMA 3NG5A 4HXAL 3IBEA 4EUPG 3VXTB 2ENSA 2VWEC 3P1VA 4IOSA 3U4KA 2AJUH 4AK1A 4M7JH 5CS7A 5MEQA 2V9TA 1A3RH 5EU3A 2XA3A 4MXVF 4HV8B 2FO1A 1CLVA 5JHLH 4GAGL 3BIAX 3JV6B 1SBSH 1UCTA 2FLRT 3KPLB 1GS8A 1H8SA 4G3YL 1MF2H 4NQQA 4LCVA 3FS9A 5CJQH 2EUVA 1JNHA 2CUMA 3MBED 2YD8A 5T1KA 3D87B 3GHEH 1FL6B 2UY6A 2H3NA 4LLQA 3S35H 5EOCL 2CXKA 2B4CL 2ZWZA 1RXLA 1CXFA 4HGKC 3EGSA 1KT2B 1WGOA 2X1XR 1F1GA 4W81A 1YJDH 5AWNL 3D51A 4LLUA 4O58H 3MFFB 1J5DA 3UZVB 1O9VA 1ZVNA 4GQZA 4F92B 1G9HA 2BVEA 1YEGL 2RB8A 1QFWI 3CXHJ 4YXKL 4BSVB 3NJHA 4WAFA 4EEEA 2WXQA 3H7BA 4JO2H 2BIOA 2R56L 3CX5K 4KRPD 2WVVA 1HILA 1XCXA 5C0IB 2IDCA 3B2VL 3QUGA 3RVTC 1D5MB 3NFSH 2IWKA 3NP4A 4ODVL 4MB1A 2CRZA 4W4NA 1ND0A 2XWZA 4ENEC 1IARB 4X0KB 1G7LB 4NC1E 4XOEA 4MTMA 3FW6A 43CAA 5IG7A 1BMWA 2YD5A 3OLDA 2IDTA 5CN1A 2QMJA 4DUWA 3VXTA 2DQDH 2FWLB 3T0EE 2LE9A 3NK3A 4HWEL 4WFHD 2ICES 3TO4B 2WLIA 4YPGA 3ZVVA 1O7SA 3FHQA 1UA7A 4NQTA 1Z2KA 4X6DA 2WK2A 1KTDB 4F7EB 2HJLA 1PF3A 3LN5B 4G6AD 1BMGA 5PCYA 4GQ9L 3EJSA 3U9PH 4Y19D 3MXWH 4HJ0D 1PU0A 4S1RL 5IQ9A 2NY3D 4EDWH 1ORSB 3I74A 4EQ3A 5D70H 2QPFA 5KZCD 4QY8A 3US0A 4ZQTA 2NYZA 4ZFOA 2NSMA 1J8HA 1K2DB 2C3WA 3ECBA 4KAQH 3QDGA 3BFQG 3EOBB 3CAFA 1A6WH 3M88A 4XB8A 3T8VA 1QLEB 3GJFA 3UBXA 3S8FB 4NO0A 3OXSB 4ZI8A 4AI7A 1D9KA 1XR9A 2VR9A 1QAWA 3FUKA 4WEEA 5T5FH 5BQ7B 4RH4A 3FQNA 3O6LL 1G7JB 4NJAH 2A74C 3TO2A 2EEDA 4YWGL 2IJ0C 2VN5A 4JN2B 3QFJB 4HS8H 1Q4NX 4LP8A 4WGKA 3QUXB 4F2MA 1P69B 2WZPA 4DN3H 2KDYA 2JWYA 4JQVA 3ORJA 2C5DC 1A2YB 5JW3L 2WOBA 1FC1A 4M6NL 3GGWB 2IIJA 4HLZG 4NPYB 1M7XA 2G60H 1B90A 4FDWA 2YAFA 2OL3B 2J8OA 1A47A 4HIPA 3IGUA 3CTTA 3C87A 1FVDA 5F7KC 3VB9A 3F65A 4NQXA 4F7EA 1S9KC 1QSEB 2AVFA 5KSAB 1SGKA 1KN4H 2QQKL 3L81A 2UX6A 4JG9A 2A9DA 1A9EA 1E4XI 3LH8A 3LPOA 2UWEA 1ORSA 4LOUD 1VCBC 2BK8A 3NGBB 3CZEA 4LRIA 2WLKA 1UACH 3TH3T 3WGVB 1T7WA 4CUCA 2IDQA 1P7KA 2VERA 4LEXL 5EEXA 4QF1A 3OHMB 2BHFA 4P2QD 3NCJL 2XZAH 2HPTA 1LNUA 1RK1B 4YNYB 4Z95L 4CVUA 1T0NB 5ELIA 1EO7A 3LRLA 1TZGL 2R0ZL 3RX8A 3TM6A 1RZ8B 3WHE1 1WEJL 3SE4C 4XNXH 3WLBA 4AMWA 4JHZA 3NIGF 4N0UB 1AD0B 5HYEA 2BMKB 3BUBA 4WHCA 2DQUH 3AS2A 2ZSWB 3CFQA 1QLEL 5DJ0A 4R7DA 4FABL 3WTSA 3DTXA 4QWWD 4XVTH 1A14L 4OCSH 2ZUVA 3BAEH 3AM8C 4QYAA 5CR1A 1M56B 4GXVL 4D2NA 4CW1B 3VFUB 1JGVH 3VWKC 1RPQA 3HS8A 1F4WL 3VQLA 3PABB 1V10A 4U1SB 3WS6A 4XPTL 3MJGX 2FZ3A 2OL3A 4JFHD 5D6DA 4O00A 4GEJA 3FMGH 4ZMTA 4XE5B 3WG7B 3EOTH 2YBRB 3CFIC 4OJEH 5AW5B 3ZU8A 4H1LB 5I26A 4QYOB 2JMRA 1HK6A 1QWNA 1MHEA 2XTJD 2OL3L 2X89A 2VAJA 1TSRA 1WIUA 5D6CA 2W0PA 4I9XA 4L8SB 3FCTB 3LEYH 3QSKB 4K0OA 5TDOB 4YXHH 4L3AA 5L7XH 1I7UB 3IT8D 4F8TA 5I18H 1HKLL 3IAPA 1AZCA 3FT0A 2E9IA 1ZA3B 1IKOP 1G94A 3HB3B 3LIZL 3RWHA 3FO2A 4XX5A 1AR1B 2Z8RA 5JUEL 2PETA 1E5YA 4YNYA 2BWQA 3QWQB 3TJHD 4N2EA 1QHPA 2DQGL 2DQ6A 1IGTB 1GZPB 3W57A 5FOBB 4OZ4B 5CJOL 2C9PA 1XEUA 5E5MA 2K4AA 3QFJE 4N0UA 2F0CA 1J87A 2X4RB 3IDJA 4CILA 3BXNA 3GDCA 3NEXA 1NIDA 2Y2TA 2BXYA 2YEVB 4U4IA 2Q87A 4HU2A 5I1JL 1R3JB 1I1AC 2LVEA 2XCMC 1UXMA 1WITA 2X53A 3ARBB 2QGBA 1XD0A 3D2UD 1OK0A 3EYOA 1A3QA 3L3GA 1BW8A 3TEZA 3T0DA 3CFBB 5KSBA 1J86A 4AUYA 4CADB 4FQXC 2MKLC 4H1LA 2A6JB 4Z8FL 1AIFA 2PTVA 1KV3A 4ZAKA 1UM4L 5ADPL 3O9WA 3MU3A 3MI6A 4DK5A 3MLWH 2RQEA 4E41E 1UTDA 1L7TL 4UNTA 2Y22A 5I1DB 1MFAL 2VOTA 3JV4A 3SKMA 1Q72L 5TF1L 1VCAA 4NUGH 3F7RA 4QHMB 1KJ3L 4ZMQA 5BZZA 7FABL 1A6ZB 1EVTC 4AOFA 4BUQA 1TMCB 2WQ8A 1REIA 2B14A 4N85A 3NACL 4Y8AA 3ISYA 4QRFA 2EXYC 2HKFL 1IFHH 1ZOXA 3IGAA 3ZDYB 3DJSA 4AH2A 4TLTA 1J0IA 2Q76B 1YNLL 1QSFB 1NSNL 2X44D 3CLEH 4XT1C 3TYGH 2BW5A 4OZ4A 2BLFA 4X4KA 1UM6L 3SDDA 3EJQA 4OFPA 5JXAL 5E8OA 3WV0A 4Y89A 3VH8G 4W1TA 3TCTA 3P3RA 4XMLH 3NRFA 2K6YA 1PCXA 5K39B 3ARDD 1F3RB 4HUWA 4DAGL 3PE9A 2D3LA 5TDPB 4HH9B 5I0YA 2X10A 4MDIB 3GC3A 2VLRA 1MHPL 5IV2A 4HC1H 4HKZB 4JE4B 1EJOH 1FNAA 1RZGB 2JI1A 4MQ7B 4PG2C 1WISA 3GFUA 1GC1C 2PMZA 3K2IA 1YHPA 2X5PA 1M2VB 4FULA 3QZMA 1HOCA 1WPCA 1T89A 5KS9A 1T1YA 1EQWA 5B39B 2XKUA 3TT1L 1G5AA 3MRLB 1C16B 4XMUA 3FUDA 1WWCA 1ZVYA 1D2PA 2VXSH 3CFBA 4HKXB 5TPWL 3BAWA 4CN4A 3D4ZA 4LSQL 3TZVA 3U1SL 2P1YA 2GIMA 4MKMA 4TVPH 1G9NL 2Z9TA 4RFNB 3W1ZA 4KI5C 4KHTH 4M4RB 3N44F 3L4UA 5LCVH 1ES0B 5LNGA 4G43B 3NJKA 4AJVA 3GYRA 3Q05A 4N8UA 5KBPA 2E75C 4BK4A 1PEWA 5IFJB 1JN6B 3VD0A 5ADOH 4A6YB 1A4KA 2J71A 2VQ4A 4RFOL 3BSGA 3T6WA 2B1AH 3N6YA 1A6ZA 3ZYJA 1UVQA 1F58L 1ZLDA 1R47A 4J6RL 1KLGB 2Q3ZA 4CGUB 2C1PA 2WSKA 4MVBD 2VM9A 1RU9H 3JZ7A 3T3ME 1CI5A 4TUUA 5DJYB 3GINA 3SQOL 5ID1B 3UX9B 5CN3A 2XBTA 3N0AA 1EAPB 3QIWB 3GMNB 3CE1A 4HETA 4OBSA 4MA8H 1VZHA 2BSEA 3EYVB 2SEBA 2WBJB 1U8HB 4U4BA 1XCQB 4U6YB 4Z7UA 4FRWA 2CO7B 3HMXL 1S7RA 1OF2A 3SQBB 5I28A 4HUKB 1CYXA 2KZBA 4N28A 5IHUL 4FXLA 3RDTB 5DMKB 2MOQA 2Z8WC 4FS0A 3HOGA 2CLZB 1YC7A 2W60A 1X5XA 1WDAA 2EDJA 5E8PA 1F18A 3MRLA 5FYJE 1NEPA 2FUQA 4L5FL 4XAKD 1CGXA 3QIUD 3WO3B 2ADIB 1XH1A 4HCRA 3WTXA 1L6XA 4KKRA 1UKTA 4GOSA 5D7IB 3ARXA 3NCEB 4GKZA 4OM0H 4HGWA 4JQXA 4R4BB 2AK1L 2QGCA 5DEFA 4Q9CA 4EXKA 5DD1L 1J5OH 4L4VE 3ZDZB 5BW7A 3KLHD 2G0LA 5FUZH 5TK2A 5TQ2H 2FWOA 4M8VA 3ZHDA 1OM9A 3H7LA 3PUCA 5CMAB 4P3CH 3X1FA 4EIBA 5D5MF 2O4EA 1QSFE 2V3EA 4MA1B 1MJUL 4XNUH 3WIAA 4L2YA 3JVGA 1LE9A 3GMPB 4BFOA 2ZCKH 1OGSA 3HUJB 4FZ8H 3ZRFC 4A6YL 4YSUA 1Y18B 1GC1H 3GSNB 2A99A 1C5BH 1QFPA 5DUMH 2OI9C 4JY4B 1T4KB 3HG1D 3PAYA 1AFVL 5I66A 1F41A 2W65B 5FC9A 2EYRB 4HXBL 5F89B 3S3CB 4MNGA 3IMTA 3S36X 5DJDA 1U3HC 2PF6A 3KJ4B 4L5FE 1FYTE 4M9OA 3LKQA 1AXIB 3IDIA 1NLDL 1HXMA 2DI9A 3CV5A 4UM9D 1K85A 5EO9B 2Z92B 3U0TB 1CE1L 4NQEB 5ISZD 3II3A 3KVQA 4MQTB 2WCSA 2YQ2A 1BJMA 3NDYE 4NO5A 2YIHA 4QHNA 3N55A 3WL9A 3BUPA 2ZAIA 4WWNA 3GS4A 4JVPA 4BSWA 1QG3A 4GO8A 2OSLB 2FYVA 1WHPA 3HC4L 1V05A 5KVDL 3ZQWA 1UADC 5BMFH 1NCCH 3OF6A 3BQVA 4FI8A 2V5MA 4LPXA 3ATEA 1ZK9A 4NQDB 4OAWA 2BCKA 3FFOA 5GHWL 4EF3A 1O6VA 4B6ZA 4MJ6A 2FBRA 2IADA 2HRHA 1HQ4A 5DFAA 4CVZB 2ED8A 4KUCD 3THMH 1CC3A 4JJHA 4ODSH 1EMTH 3W81A 1DQTA 3AAZB 1H6TA 1AD9B 1QKZH 1CPUA 3VCLA 4B9IA 3QEUA 1IMHC 1A1NB 4IRJB 1FZJB 2OCJA 4OFQA 5F8RC 1LL1A 1A7OL 3TN0A 4KKBC 3QRFM 1CE6B 4JFDD 5T1DH 3FC8A 1DQVA 3NSYA 1OAUL 4UAOB 2BSRB 3MV9B 3PXHA 1DANT 4NZRH 3GSNL 1T83C 1CDHA 3QO1A 4DESA 4G7RB 1VB9A 3D18B 2WZ0A 2ZUTA 2QVIA 3TV3L 1EXUA 5ETUB 4WIQA 1DDTA 1X3DA 4FNSA 4AQOA 3H2PA 2BFGA 3MBXL 3RVWD 2FEEL 2GCYB 2OMXB 4PLNC 3R1GH 3A47A 1JD7A 1DJXA 1SHMA 3D4YA 1OCOB 5FYKD 1U9KA 3KXFB 1TKWB 1NMAH 1EAJA 1CGSL 1V55B 4R3SA 5GGTL 1IAII 5EBMB 1SBBA 1ADQA 2XV3A 1XGYH 3MCLL 1U58B 3TL5A 4W4OA 4TV3A 3DV6B 3QUMH 3QPXL 3RDJA 3WFZA 5B38B 3RWGB 2GVYA 2Q5BA 3INUL 1Z5YD 3X1BA 3HRZA 3QO0A 3VFOB 3ZE1B 1C5DA 2IO5A 4LHUA 1ADQL 3MRBA 5EIIG 3F05A 5JORA 1A02N 2ZNWA 3CIAA 1KCVL 3MVSA 3Q48A 1DVFA 2ZWNA 1UEYA 4PJ8D 4S1DD 1E6JH 1SJXA 3F84A 5JIIA 3P69A 1A1NA 2PYFB 5IB2A 2YPVH 5DO2D 1TTRA 3ZYIA 3ZUNC 1JNLL 1KFAH 2EDWA 2Q0ZX 4U05A 3M07A 3C09C 4XNQB 1P4UA 3QI9C 2DWTA 1JFQH 3L17A 4XPFH 2BNUA 5IK3B 4LHJB 2DMHA 4JRXD 3L5JA 4XO8A 3X11B 3MLXL 1QOKA 3QJRB 4HIQA 5JIHA 1I7ZA 5FLUA 3F5WB 3FO0L 3N41F 4C56E 1LEGA 2YSSB 3BKCL 5HI3C 2UY7B 3IFOB 4J3OD 4P57A 1A4CA 4EN2A 2GK2A 2WANA 2FGWL 2H32A 2CA4A 4ISVB 5EU6D 3EHBB 5HYSG 5CUSH 3QYNA 2DBJA 3BHBB 1FJ1A 5ACLA 4OKVA 4JO1L 1FFQA 3QZWG 2IGFL 4M43H 4N6RB 4Y4FD 2VUKA 2XN0A 3QPQC 5IMMA 1QTSA 1U93A 2K8MA 3FQUA 4Q58C 1BM3H 2BY0A 3JWNE 4NJ9H 5CD3A 1ASOA 5C0BD 3VFVB 1CR9H 2OR9H 4FG6C 3WFBH 3G6JE 2E7CA 5FYLE 3W0WE 2AEPH 3E6HA 3CFCH 5KG9B 1E40A 3B56A 1AACA 4N2NA 3ZIYA 1HH9B 1JF6A 2VZTA 2NY0B 4NHUB 2ISDA 1HZHH 1AS6A 4WU5B 1VEMA 4QD2E 1K4DB 4L1HA 1FNEA 3V4UH 1MUJA 3UO1H 2COQA 2XIIA 2CGYA 5D1QC 4J3UA 3WFDL 1QPKA 1KY6A 3OKNA 3MV9E 1ZPUA 3VE0B 5DQJB 2QADD 3QHZL 2E4FA 5K9QG 1A9BA 1G9ML 3IF1A 2JJSA 5IK3A 3APNA 4Y9CA 1ZWIB 1T6WA 5PAZA 4LCWD 2WTRB 3K6DA 2VXQH 1AYOA 3GF8A 4XNZB 4UIKL 1SOKA 1KTKE 3TNMA 1BEYH 1NDGB 5J6GB 1FI8C 4CBPA 2EILB 4D3CH 1BA9A 3CFKB 1FFPA 1BVKB 5CGBA 1AI1L 3C5ZA 2PYED 3PWPD 3REVA 1EFXA 2ZXEB 2R7EB 3EYSH 4U33A 3KXFE 3SCMB 2V3DA 3I2CL 4A04A 1HHGB 12E8L 5I1AA 2G9HB 4NQVB 3PF2A 1CJYA 1MCWW 4R6UA 1NFDB 4LSSH 5CWSA 4B9KC 4HWZB 1K8DB 2E76C 4HS3B 4PJ7F 1EWHA 5I8KH 3PHQA 1BZ7B 2HP4A 1E2VA 2IANB 2VKWA 1P5UA 3SKNA 3ZE1E 5K9OA 1YO4A 4Z18A 5FWRA 5AB2A 4RZKA 3K1KC 5H4ZA 1WFUA 2QPEB 1B0RB 3UPCA 3SKOB 1I1FB 3SY6A 5B1BB 1XSIA 2PWEA 1F2QA 3J2PA 4WU5A 3T6XA 5IVXF 2HG5B 2A73B 3EFOB 8CGTA 3MGOA 5F96L 3CVIL 3CHRA 3HZVA 4MSWB 4KITB 1QBMH 3B2UC 4O2EB 2DEXX 1N5YL 3FTGB 1NOFA 3GTNA 3LXCA 3P11L 5BS0D 4RESB 3C6LA 4FQ1L 3T1FB 1ZV5A 3STZB 1G7HA 1ZWIA 4OLYH 2WTRA 3RX9A 2YBGA 4OT1H 2N59A 4IOSD 2DJSA 3ATBA 1CLYL 1FFNB 3BAJA 3MLZH 5J6GA 2WC7A 2YPLE 2E7MA 5CSZA 5LNDA 4Q9QH 1RIUH 3ZTNH 3GMMB 3ASOB 3NQKA 2JJWA 3BZEA 1DBBH 1MWOA 2NX5A 4G6MH 5CP3A 35C8H 5J89A 5GISL 3VXSA 3H9HB 4FQQB 2FWSA 4N25A 4L0YA 2F1EA 1YEFH 3BEVA 4KU1A 4HG4J 2NPLX 2QV4A 2W1NA 4ZW6A 5E95B 3V9CA 3ROOA 1NJ9A 1JZ4A 2DPKA 3S7GA 2X42A 2XQYA 4G6FD 2FLMA 3MGTB 4HS3A 5E0FA 5B8CA 4QO1B 4ATWA 3Q3GA 5AOKA 2ZCLH 3G5VA 4M7KL 3S0PA 3B2MA 4N20A 4YIQB 3ULUC 3KDMA 4ONHB 2WVSA 1TZHA 3PWJA 5DQDL 2BIIA 3GPEA 1N9PA 1LD9B 2CDFB 3BVWA 5IWLA 3AY4A 4HBCH 5AALA 3ULVF 1S5HB 2IDUA 4XMPL 2C7UB 2CG9X 2HG5A 1MCOL 2A73A 3MRJA 4F91B 1QQDA 1NOAA 2IG2H 1F3DJ 1JYWA 1R46A 3DC0A 4IU2B 2XFXA 1OSZA 5E5UB 2J6EL 1YEKH 2IV9A 3P4MB 3WFCL 4EI6B 4TQPA 2JCCE 3NESA 4LPYA 1JNJA 3MACH 3QCTL 3SOBH 3UGXA 2IAMD 3PJSB 1SMAA 2NQDA 4AJWA 2XG4B 1MCJA 4R5XA 1ORQB 2ATKA 3KYNA 4K9JA 2DMCA 3W11D 1CD1B 1PD6A 3OGCA 1GH7A 3FL7A 4UT7L 1HC1A 2XZQL 3IETB 3NDZE 2H1PH 3RA7L 4XAWH 4PPTA 2BNQE 4LEEA 1IGML 1NFDE 4Z3HA 1E28A 2AQPA 5ESAA 5TE6L 3WTWA 2NUTB 4JM4H 4GAFB 4YDLC 5DD3H 1BVZA 4Z76B 3T6VA 2O6EA 5ILTL 4PJHA 4E5XA 2IANE 2E9JA 4FFZA 5ANHA 3VI4E 3ZZSA 1C7TA 3SE6A 5DC4B 3UIZA 1YC8A 1DFBH 2XG5B 3QDGD 4AVHA 1KENL 1A3LL 3HI1B 2V5SA 1LEKA 1SLUA 1ZV2A 4ODTH 4ELMB 1PZ2A 2ZOWA 4L3CA 1FL3A 1XIWA 4WHTB 2OW6A 4Y16A 5E6RB 3IMRA 2MHAA 1U6AL 1P4BH 4YGAB 2OSYA 2JJTC 3FFDA 3ESPA 4Y2NA 4KQ3H 4L1SA 3VFGL 4OBRA 1NCAL 4RWYH 4L29A 2D0FA 3MGAA 3GSXB 4G6KL 3P54A 2WZPD 2QZQA 1R3LB 4ZXBB 4POYA 3GI9H 2W88A 2QVFB 3MRDA 1NBYA 4QRRB 1TQCC 4QAMB 1L9QA 2HB0A 3O41A 2R51A 3MLYH 3Q8AA 3CMGA 2EIBA 3UTTB 1H3XA 5GZOA 5CZXD 2NZ1A 3EFFA 2NY6D 3WXWL 2FR4A 3DUUB 2PP8A 4MXWL 3IETA 2R9HD 4OZIB 5JTWA 3ULUH 1SYVA 4KK9D 5DUPL 4UILL 1ZCRA 1SYSB 3HAEB 2AEWA 2DMBA 4LPVA 1ILSA 2NUTA 1FNFA 4R96B 4JHWH 4HH8A 3NAAL 4XCCH 1DLFL 1I9JH 2WUBH 2B7DT 4TOYH 2A7BA 5IB5B 4Z76A 1N10A 4L8CB 3VXME 4P5KB 4JFZH 4MAZA 3Q1SH 4AIXA 4MNQB 5DC2A 3OMZA 3R7QA 1XO8A 1FORH 5LG6A 4GO6B 2VRQA 4C83B 3P9WB 1X5LA 3S97C 3FQTA 4FQIL 4O51A 4QHKI 2VDLH 2FJGB 5HGHA 1NPJA 3MJ9A 5L2KA 1T1ZB 5F0MB 1U2YA 5DEZA 4YL4A 4YO0B 2W0FA 4F9PC 2G5BB 5LN4A 2E7DA 4NM4L 1QSVA 5EIQA 5HHPA 3PHAA 3VYPA 3KYMA 1R3LA 1CZ8L 4RFEB 4ZXBA 5I16A 2G4EA 2X28A 1IL1A 1QR1B 1ZTXE 4QRRA 4XO4A 1U21A 2O5YH 3TVMA 1F02I 1UB6A 3OAZH 4MCZB 1XB6A 3QJOA 4PWGA 2HFGH 2JI3A 3H3BC 4Y4HA 5B21A 2Z64C 3QPKA 1M71A 4NM8L 4QXWA 5IEHA 4PRBB 1E67A 3PQYB 3QJXA 4FCAA 1JYVA 3CFMA 4QRTB 1QSED 3QXDB 4YE4H 3JTTA 5KSAD 5D8JL 5K1JA 3VDBA 1U8OA 4ALAL 3QUYA 2KMWA 1TG8A 3RURA 2OULB 2JKTM 3LNGA 5DCCA 2CK0L 5HGAB 1M05A 1WICA 2OYPA 5IHLB 4AENA 1WS8A 3CHOA 4FD0A 5BRZB 5IEKA 2PCYA 3RUGB 2QJDA 4PSRA 4P5KA 3EFDL 5K59E 2XN9E 3MLRL 3QYMA 4ELME 5H37A 4X7FC 3KLAA 4PGBB 4ODHL 3INOA 4JFXB 2GFBB 4FNPA 2FJGA 2YSTA 4M00A 1EJ8A 1JPSH 2CDEB 3HE7A 4FQHA 2G5BA 4YBQC 1MVUA 3EUDA 1B9KA 4QJ4B 1WSST 3OR7A 2Q7NA 1YEJL 2X7LB 4DKEL 2HJFB 3MLUH 3RPIA 1QR1A 3HC2A 4JQIA 5DFVC 1EDYA 5HYFA 5GPRA 4QDGA 1XCTB 2PABA 4RQQB 1BDYA 3QRLA 1EGJH 1MCNA 1DBJH 2YAMA 5HJDA 4XBEH 5BZDA 3NQIA 4JQIL 5J6HB 4KI1A 5AAMC 3H42H 2EVIA 4GSDH 3EJCA 3KCPB 3B3BA 3OKEB 3O9WD 5SWZA 1ID2A 3Q06A 5L4FA 3BKJH 3EYUH 5ITFA 1FNSL 2R69H 1AP2A 4XWOC 4F1SA 2ED6A 1N19A 4X4ME 1JF1B 5T3XD 1C5CH 4IIZA 4XXCA 5DVNA 3TIDB 4KK8C 5IFHL 3PREA 2WWNA 4OLWH 4HZ1A 4C58B 1F13A 2AJ3A 3HB3D 1BG9A 1AR1D 2E7LC 5A2AA 2PR4H 4OUOA 1YZZA 3L3OC 1T5WB 5KANI 1QO3A 4FXKC 3RFZA 2GFBA 3LD8C 4BFJA 3SDDD 4N2BA 2Y1VA 4I0PB 4XX1G 4PREB 2J8UF 3ES6A 4N8PA 4R7NA 3BQUB 2VYRE 4ZPVB 1V8HA 4K8RC 3GBDA 5D5ME 1YSOA 2PPCA 4CU8A 1DL7H 2X7LA 1KCUH 5IFAL 3ROLB 3HCVB 5DZVA 4WWKA 2ZSVB 4PRAB 4S1QH 4WW2B 5E9NA 2NXYB 2WJ7A 3ARBD 5D7SL 1M7IA 2J4WL 2X2YA 1JZHA 2ADFL 1CB4A 4K73A 1JK8A 4J3XA 1I7RA 2Z4QB 3CFJA 5I9QC 1A0QL 5JMRA 1XCTA 1IGIH 2JQAA 3D3VA 2NCMA 4MZ2A 4F15B 2ZF9A 5J6HA 5D93B 4E2OA 3TZVD 3EYFB 1JPTH 2OMYB 3KPSA 4XPGH 4K3DH 4HISA 2QT6A 3GRWL 1A7NL 2R0LL 1I8LA 3D9AH 3GPSA 4JPKL 4DKFL 5BRZE 1MN4A 1FGVH 5FKPA 3A3YB 4NCC2 3G9VA 2WIIA 2AFNA 4CAGA 1DQLL 4X8XA 4Y9GA 3T4AB 4G5ZH 1U8KB 2JNZA 2VDPB 4GFXA 4M3JA 1E27B 4ADGA 4RETB 3CZLA 3RKDD 1UWEL 5ABZA 2B77A 1INEL 2BY1A 3ECVA 5HBBA 1QSFD 1JGUL 4ZS6C 5C1MB 3EOAB 2EDLA 15C8L 1KBWA 2WINB 4XOAA 3FU0A 1EDHA 2BW4A 4TXVB 5KYWA 4ZPTB 1LDPH 5F7AA 2EDOA 3W56A 2ZG2A 3AWFA 4HWUA 4KTDL 3BO8B 4O02H 1AHWA 2A2QT 3CG8A 5L88H 3S36L 5E2UH 4LSRH 1YPZB 5EC1A 4XCEA 5HGDA 5E94A 4EIUA 1PJ9A 3DROB 3VI3A 5F70A 3K81A 2J1KA 3T6QC 3C5JA 5HYQA 2BZDA 4IGBA 1KJMA 2HLAA 2IOMA 5EBGA 5IROA 1TQWA 2MPAH 3DXAA 1I1YA 1PY4A 2ZT9C 5DD0H 5DD5H 5LWYL 2R83A 5CFAA 2WO2B 3W5NA 5F0JB 1FCCA 2FHCA 1ZHKB 4WEBL 2EDYA 4FQJH 4RLDA 5E24E 3O6FC 2GJ6E 3F6JA 4K7PX 4D9RE 1U8IA 4YHML 4X4YB 1QZ1A 5C7XL 4GINA 3HC3H 3V5KB 5IESH 1HL4A 3FQWB 1BXUA 4LVOC 4Y2DA 3DHPA 3KW7A 3KHOA 4FQCH 1MJ8L 4IHOB 3SYOA 2X87A 4K8RH 5JOFA 4PVMA 1RMFL 2BFVH 4PJBA 3LEXB 4N8VA 1C12A 3X1GA 4U1MA 2F08A 1NEZB 3WIHL 4NNPH 3WKYA 4WUKH 2X3CA 1S7TB 1RSFA 2ENPA 3WCYA 3QXAB 2OMNA 3TA3C 1NCBL 1WQVT 2W94A 2APXA 5KVEH 2Z31C 4RMVA 4MQSB 3GSQB 1QRNB 3JZYA 3PP3H 2VDPL 2HJKA 3K4AA 3B8YA 4KKNA 2B9BA 1CFVH 4GMTH 1GOHA 3QXUA 2VLJA 5CINL 5EDSA 4G8EA 1N3NB 3QIWD 3K8MA 4LESA 3VD7A 4WWID 3BO8A 2ZKYA 3GUTB 4JKWA 4GW4B 5D2NC 3EIFA 1MFNA 1LP9B 2P44B 4UBDD 4ZSOA 2MOGA 1A6UL 2JXMB 2ZCZA 4HUNB 1YMMA 3GKWL 4LLMB 2FT8A 1R34A 2XXFA 3RDTD 5DS2A 2IH9A 2J25A 4XP5H 5BQDA 1IAKB 1UOWA 2A38A 4LCIL 2HWZL 2YN5A 1I8AA 2VDOB 4R2GC 1F86A 5CFHA 4GQQA 5KEZA 3GLEA 1WH0A 3U2SB 2I60H 4X4YA 3DTDA 1XGQA 5HDOA 1YEIH 4PBVC 3MNMA 1UD2A 1RJZA 1MW0A 4NEHB 4C4KT 2VDQH 2OQJB 2X4OA 5IB4A 1BWMA 2XWTA 3FN3A 1ILUA 3P30L 1TTGA 1WVZA 3D48R 4ZX4A 1ID5I 3LEXA 1RD6A 2ZJSL 5DJ2B 2VB5A 5GS3A 3EJZC 3TWYA 3VXPB 5KVGL 2Y9RT 4H5SB 2DY2A 4P23B 3RVVC 1KBGH 2H26A 3MODL 4EI5A 3BCDA 2KI6A 4ANWA 3DO7A 4Q2ZB 4IRSC 1JPFB 3P3TA 1UWGH 4ZQKA 1NBQA 4X4ZA 2CD0A 1NCGA 3RGVC 3V4PB 1KB5B 2GB2A 4GAAA 4N5EC 3S5LB 4NSKA 4YE0A 4EJ1C 5ACZA 1Z32X 2HTKC 4I2XB 4ZMYA 1YPZE 4FQLH 4JL2A 2X1OA 3ZDWA 3AXLB 2GJPA 1LP9A 4JPIA 1SXSA 3E8UH 3LH2H 4ODXB 3ILQD 4FCHA 1XZWA 4U1HA 3KBFA 4R26H 3PGCA 4LSPH 4ELKB 3G04B 5JNYB 2PUQT 1JGLL 4NQED 1ADWA 3L5XH 2WOYA 4EO5A 2IWGA 3UPRB 4HAGA 5CP7A 4A7GA 1W0WB 2WYIA 1UXWA 3GBNL 2ZOOA 4LU5L 1AKJB 5JQ6L 3ULUF 1W72A 2J20A 5KVGE 4GG6F 4XCNA 2V7HB 4LEOA 4F57L 1IGCL 4AYSA 2ZUWA 5CLTA 2QZ5A 4NZTL 1L0YA 4Y5XC 4NQDD 4KK6C 5DDHB 1MY7A 2VDOL 3BSZH 1EZSA 2BZ7A 4GAYB 4Z0BL 5CZVL 3T0EA 4JDTL 4OZHF 1PDKB 4L1LA 4J4PC 2B5IB 4AEHH 2Q3AA 3DJ9A 3PGFL 4MS8D 1RUKL 3QAZC 1QRNE 4QRSB 4U1IA 4IRJD 3BZFA 3GB7A 4XP4L 3IAGC 3QT2A 1WWWX 1XZ0B 2R1XA 1JCVA 1JPFA 1YRKA 2IEPA 4AQ1A 4NZUL 2OZ4A 2VLLB 5LGHH 4WK4B 4P9HC 3MV9D 1MY5A 3WD5H 1U33A 1DSFL 1MFVA 4I2XA 4Q9RH 3P3UA 4JRFA 4BELD 5G4NA 2X4TA 4XZUB 2OZ4L 3AXLA 3IS1X 3TF4A 4TM9A 2W0KA 3IXTB 3KG5A 4OCLC 1KB5L 1TO5A 3V4PL 2FEJA 5ICZA 1WWAX 3U2JA 1KCKA 1SF3A 2WLNA 3OR6A 4XMXA 5B4MD 2GTZB 2QLVB 3L3DB 5TE4H 1TVBB 2W0LA 5DR5H 4XI5C 1GYUA 5EEYA 2YMTA 4QTIH 1QRKA 5DTFB 3FOLB 3BD3A 4D9LH 4XNYH 5HDWA 5EUOB 2WQUA 5ITBH 4P2OA 2NOYA 4E9QA 4UDUA 2O6FA 1CICC 1MWAA 5FS5A 5GSVB 4FMKA 4HS6A 4A2LA 3LEVL 2VDNB 4XOCA 3L9RB 5IVNA 4GMSH 5I1IL 1I85A 4FHJA 1ZLSL 1MG2C 3MUY1 1OARH 3H2QA 2CJUH 2EDNA 3WKMH 1N64H 3HG0A 1HWHB 3I6LE 5LXGL 1ZEAH 1ONQA 1AH1A 2CLVB 3TH4T 1N8OE 3ARSA 1E90A 1JHKH 1E6OH 4AEFA 4QMEA 5ALBH 3O0RL 2MTPA 5E6ZA 3WIFB 5A43C 2GBTA 1YQVL 4IMLA 3RWCA 4ZMXA 5IY5B 1OL0A 5A3IC 4DIXA 4KK5C 4MA3B 2A77L 2Y07H 5D2LA 1PSKL 2GSMB 1NMBH 1OTTC 4XNAA 3TA4D 3CH8A 3EGDB 3GTVA 3CX5J 3NSCA 3B7YA 4Y2OB 3RE0A 2JIXB 4R90L 3D52A 5EFIA 4QCIB 3AREB 1C1EH 4UT6L 2ZX8A 4NKDB 3SN6N 1MCQA 3LV3A 4M6ML 3C5ZD 1VGEH 1WAAF 3CH1B 2ICEC 3L3HA 2GUOB 1MFCH 3QJHA 1EFXD 2ICWB 1BZDA 3ZMRA 2HT2C 5E8EB 1A6VL 1I8MA 4JB9H 3BWSA 4NQCE 2MIZA 1DQKA 3K0YA 3RWJB 1BBJB 2P9RA 1RY7B 2CPCA 2X6BA 1FG2B 5JPMA 5GSVA 2CBPA 1JYNA 4GIAA 4PWKA 2V2WA 2V5RA 4HKJA 3N0PB 1ESOA 4WEMB 2HRGA 2BOCB 3L9RA 5DVMA 1F8TL 1NKGA 3VMOA 3E3QE 3MLPA 2PW2A 3N1QC 5AOIA 4GRLC 1A1OA 4TSCL 4QTFA 3O2VL 4Q89A 5C0CB 2YO3A 1QFOA 4OLUH 5J3HC 2YA0A 2VDNL 1P7QA 3LCYA 1QASA 3KLQA 3H6AA 32C2A 3DI3B 3CK0L 3R19A 3STLB 3ABKB 2XIBA 5DZOA 2VH5H 3FRPA 4H25A 2A6KA 4NKOB 1H5BA 3OMAB 4GI8A 2QSQA 3C6LD 3V4VB 9PCYA 4XN1A 5H35B 4I1NB 4E9YA 2DW5A 3L9BA 3PWVA 3QJUB 1NC4A 2GIXA 4BZ1H 4N2LA 4N8CH 5DJXB 4Y2OA 2CK2A 4IBZA 2DEYX 1QBLH 4NZDA 4XBGB 5I8CB 3HFML 3FCSB 3LNHA 3OMNB 3ESNA 1IQDB 5C2BL 4JKNA 1ZLEA 2GUOA 3SCMD 4BCXA 3VXSD 5D4IA 3HMWL 1C7SA 2EKSA 1HJCA 4X6BB 4UQIM 2NY2B 4MGXA 4KI5E 1FGNH 5GGRA 4KXZI 4YDJB 4PJFE 1OP4A 3D0VB 5GIRA 2W81C 4NT6A 1J8SA 5F9WC 4Z7QF 1MH5B 2J55A 5SWSB 1VA9A 1BD2B 1BQHG 3VX1A 2YAEA 3NA9L 3QR1A 4KOCA 4C4KO 4AGQA 4YHLL 3MAWA 2Y7MA 4L8BB 4MJIA 5AKVA 3X13B 2HVJB 4OCWH 1J05B 1HQRA 3MBEC 4BINA 4IDJL 2R4RH 4LMQI 3M17B 3MNVB 1S7QB 3KHQA 3GNML 4XCFH 1J9QA 1IE5A 3G6AA 4FI7A 4WW1A 3S4SG 1ZGLP 4M56A 3KLSA 2XY1A 1FFRA 3BWAB 3MRFA 3ZL1A 2MTAA 4E41A 2OJZL 4PJGB 5H35A 4S2SB 1JZ7A 6PAZA 1JV2A 1S4IA 1BFTA 2QL1A 4FL4B 1BX2A 1CIDA 2NYYD 3DETC 5J7CC 1QNIA 2DQHH 3ABZA 2E9GA 1OE3A 3OKMB 5GGUA 4HPHA 3V4VL 4UOQA 5JQHC 1YEWA 4JFEB 3U79A 5IIEA 1GW0A 3PL6C 3TBSA 2IV8A 4XXWA 4PJEB 3U0WH 2VJ0A 1VGKA 3N42F 4NRYB 5TK4A 1N70A 4KJWC 1KJ2B 2AJSH 4UINL 3ZL4L 2DYPB 3RTQC 3UROR 4PB0H 2E9BA 1JWMA 4YDIL 4X6BA 4U1KA 1KWKA 3B9EA 3BVVA 5I6XC 4AYFB 4O4YH 5DHXB 3D0VA 4FNTA 5G55A 3B9KA 4F7TA 2A83B 2Y6TE 1MHHB 4PYGA 4RNRA 1CF8L 5CZRA 5SWSA 1PG7H 2DQIH 1BD2A 1Q0XH 4DQOH 1FC2D 2FSDA 4NOFA 4G6AC 1EX0A 2AJYL 3RNKB 4KJYA 5BUAA 3ILDA 1XIWD 1NPNA 4MAYA 3TBYB 2IGTA 4HJ0C 4APQB 3MOAL 4UT9L 4EN3A 2KZWA 2NY3C 4PFEA 3DIFB 1DANU 1OE1A 1KTRL 5GS0L 3KZ8A 1S7QA 3FB5A 3CXDH 3QG7L 1KPUA 3DRTB 1UA6H 1OB1B 1KPVB 3WHXA 4ZOEA 4FFYL 4I18C 5F9JB 1CU4L 5IGXL 2EUZA 1RHHB 1QWUA 4C4UA 2W9EH 1CG9B 1YEEL 2VRKA 1A25A 3QNYA 4QRPA 4H20H 2ZX6A 1CQYA 1GIGL 4JFUA 1D7FA 3F7VA 4LRNH 3QYCA 4WJKB 2UWEF 3GJEB 4ZO6A 1N4XH 5DT1H 5GZOD 2EDFA 4GUPA 1KG0A 2EE6A 2NY5C 4A7TA 3ZE0F 2OJEA 1U3ZA 1GAFL 3I3BA 2AXJA 3LOWA 4DT2A 4OV5A 2WXFA 3W38A 4ONGL 2AEQL 3I50H 4PJEA 1CXEA 3O11B 1KJ2A 3FQXB 5T1LA 2QTVA 2D0HA 3MLVL 2YC1A 4M5TA 5AVXB 4U2ZA 4N0RA 5JOPE 2FVNA 3UCQA 2G75B 1FPTL 5JW4R 2X40A 3AB0C 4Z23A 1IM9A 1JTTA 4LNVA 1KJ2L 3S35X 4TL4A 1X5FA 4OW6A 1MHHA 4TTDC 1JHTB 4RVBA 4ZOBA 1YYLL 4HCGA 3OAWA 4ZFGL 2E5EA 1KIQA 2LT9A 4NHCH 3DOHA 4F27A 3SDXB 1QTYT 2NNXA 5CIPB 3WI9A 4EMZA 4PRNB 5TDNA 5D96B 5L2KD 1JZJA 2AGJH 3HI5H 1G6RB 4HUMB 1GHFL 1S7WA 2ZPKL 4LOUC 1O6TA 3T3PF 3BW9B 3BI9X 3OQ3B 4G8GB 4GNKB 2WKOF 4OGAC 1OIOA 2MQGA 4R4NC 4I1PA 1UJ3A 1G7QB 3IDYB 4B9CA 2W92A 3RI5F 1OB1A 2P80A 4D9QD 3MRRA 4PJGE 1MDAA 5F9JA 4EIGB 2K3TA 4ZXBD 1NUDA 1RHHA 3GBMH 1E5UI 4QRRD 2A4EA 2CR0A 2YKLL 4L4VA 1FV1B 3G5ZA 4TUJB 5I2IB 5FYKU 1EA9C 3FTXA 4JFEE 3UTTD 5JPNC 2GBUA 5EEWA 4Y4HD 3AZUA 4BFBD 1QI3A 5B1JA 3D0AA 4NLHA 4PTUB 1PTZA 3GHBL 2VISB 5HHOB 4QWWC 4JZJC 1UFGA 1Q9KA 5C0AE 5HVFB 3HPJB 4AM0B 2CR6A 4YQXL 3QDJB 1UT9A 3H53A 1FDLH 3QUYD 3MRKB 5DJZA 3OC5A 3KR3H 1E43A 4FG4A 3S88L 2GSIB 4O9HL 4UF7C 4ANXA 1Z5HA 2Y7QB 3WELA 2IQ9H 2KT6A 2Z93B 4L37A 3V5HA 5C0DB 3IFPB 4CMHC 2VJ8A 2AHIA 2NR6C 4MNQD 2XX0A 2XZCL 1BZ9A 4NUJA 4PGDA 2K3HA 5IREA 3VGDA 3V0VB 5CIPA 2ZQKA 4QT5B 1P53A 5ABDE 4B3EA 3BGFB 4HZAA 2ZKMX 4HIJB 1DUYB 2G3XA 4JKMA 2NY5H 5LXVA 4FXGC 1OAZL 1MJ7H 3QEQB 3KPPB 1SY6A 2MCPL 5KSBF 1HINL 1I9RL 2HT3C 1JWUA 3BGAA 2FBJL 5IMKA 1G6RL 1S7VB 5E5RB 2WWMC 5A2FA 4FHKA 3TJHC 4BH7B 4DP0X 4TUJA 5DWUH 1Q0YL 3Q44A 1RZFL 1ITCA 1NEUA 4X6EA 3A6CL 1DLHB 5E9DE 3I3EA 4OZFA 4JZOB 4R8WL 1ZAGA 3AG3B 3WJLA 1OZTG 3D06A 2IPTL 4M62H 4GW5B 5E4OA 4Z3GA 5MI0B 3PQYD 2FB4L 4FOMA 3GSRB 3OTTA 3EYQD 4WI5A 4I9WE 3O6ML 1HAUA 3MNWB 1R1CA 2WUCH 1GCFA 5DYOA 3T0WA 2VW4A 3DBXB 4QEGA 5MEPA 5IQLA 4ZUUA 4PJDE 2XA8L 4PWFA 5ALCH 2OSWA 2XRAH 2B15A 4FZEL 4FE9A 3PWUA 5D9SB 5I0VA 1TYJA 3NSFA 1I9IH 2HKHL 1HSBB 1IBFA 2FECL 2OTWA 1CD0A 1LO0H 1NGXB 4JFQA 1O5DT 4QRQB 1MFDL 1T03H 3VFWB 1KGCE 2C4FT 2TAAA 4HIJA 4QXTB 1DUYA 2F74A 5D1QE 4YJZL 2YUWA 3VFNA 4RRPG 2H4EA 4GIOA 4YR6B 2LOEA 1AO7A 3GT6A 3QG6A 5C97A 2NZ9C 5HYIA 3ZOAA 1S7VA 3DSFL 5GRUL 2A1WH 5INCA 4K94C 5CBEA 4PLJD 2I9LB 5TGBA 4OQ1A 5FO7B 2WXNA 4YHYC 2QVMA 3B9AA 4JFFE 1RZKL 4JJOA 2JB6B 5D7KD 1FFOB 2NT1A 3QCVL 2K9FB 5ES4B 1JZ2A 1COBA 3QDJE 1SN5A 3BOVA 4X98A 3KPSD 2HRPH 3UMTA 3SZKC 4YDMA 2Z1PA 4JHAH 5LGJA 4B53A 4WWOA 1KLFA 4ZFZA 1F4XL 1ZVHA 3WOVA 5I0XA 4WDIA 3MNWA 1XX9C 3S8GB 2K8QA 4KVCL 5EN3A 1U8MB 1P0SE 3CPLB 4HBQA 4ONFH 2LABA 4XN2A 3WXVH 2QQNL 4XN9A 4AGNA 5LBSL 4GG8A 5F0PB 5CGTA 4NO2B 3DRQA 2MNUA 2LW3A 4PJ5A 4OJFH 4PG9B 3V6ZA 3QZPA 4JO8A 1TZOA 4WO4C 4OFKA 2HFFA 2XY2A 1DHKA 3AC0A 4DKTA 5DHVA 2NW3A 2DOCA 4OF0A 3ILPA 4JO4H 4LVHB 4FTVE 1R5IB 2G9KA 3L3KB 4P5TA 4PW9A 2R1YA 3BT2L 4I0PD 2GTWA 4G72B 4KJPC 4R5TA 1MFMA 2FJFA 3QEQE 3BQUD 1VFBA 2WMPB 5F44A 3VGAB 3DX6B 5F1KC 2YD1A 4FFWC 5D1XA 3GSUB 1WA1X 2EH7H 4UV4L 1FP5A 1L9NA 4KZDL 4G80A 3QIBB 5AZEH 1AZBA 3MKGA 3K4ZA 2Y06L 3UTSB 2XVLA 2AJZA 3LN9A 3OZLA 4KDVA 1P2CB 1HDMB 2OXGA 4MHHG 4ODBD 2NXZB 5CO1A 3W0WA 4BZ2L 2NXYD 1J5HA 2HA1A 3QGVA 4IGBD 1U8QA 2P5PA 2D4FA 2I9LA 4M1CC 4P4KB 5IVZA 1JV5A 3DXAD 4HQQL 1NBZB 4N0YL 2YPKA 4F8OA 5T5NG 3Q6FB 1D5BB 3RL2B 4LASL 3MRCA 5GGQH 3MRHA 3T2NH 1GS6X 1WFIA 4MMZA 4UOW0 3FO9A 3FB8A 2EZ0D 5DURB 4ABQA 4R9HA 3ECQA 3OAUH 5BO1L 1E9OA 4HJJH 2Q6WB 3LNDA 2DD8L 2A9NH 3AS3A 1TJXA 4ZMPA 3C6SB 3F2LA 3APMA 1EHAA 3QZLA 4NDMA 3V8OA 3MOQA 2PW1B 2VC2B 3X3FH 4XVSH 4FFVD 1S9VB 4U0RB 4L0PB 3ULUE 1KELL 2DQCL 1WG3A 4GYBA 3P3YA 2QKIC 4PG9A 1HHIA 4M9PA 2ESVB 1M6UA 2XV0A 1AANA