2Z7UA

Crystal structure of h2o2 treated cu,zn-sod
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
151
structure length
151
Chain Sequence
ATKAVCVLKGDGPVQGTIHFEAKGDTVVVTGSITGLTEGDHGFHVHQFGDNTQGCTSAGPHFNPLSKKHGGPKDEERHVGDLGNVTADKNGVAIVDIVDPLISLSGEYSIIGRTMVVHEKPDDLGRGGNEESTKTGNAGSRLACGVIGIAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Cu-Zn]
publication title Crystal structures of H2O2-treated Cu,Zn-superoxide dismutase
rcsb
molecule tags Oxidoreductase
total genus 35
structure length 151
sequence length 151
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2007-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 2z7uA00
1SRDA 4A7QA 2Z7UA 4BCYA 3L9YA 1SDAB 1E9OA 1E9PB 3GTTA 1DO5A 1YAIA 4A7GF 1UXMA 3CQPA 1F1AA 1L3NA 4U4IA 4MCNA 2ZKYA 2VR7A 3CE1A 1FUNA 1SXBA 3F7LA 1MFMA 2VR6A 1RK7A 2SODB 4B3EA 1S4IA 2WWNA 3L9EA 3QQDA 2AQTA 1AZVA 1N19A 2AQRA 3K91A 3GTVA 1F18A 3GZOA 1B4TA 1XTMA 4N3UA 1EQWA 1COBA 2C9UA 1EJ8A 3KH3A 1N18A 2AF2A 3ECWA 1E9PA 1YSOA 3ECVA 1SXCA 4A7SA 3CQQA 2C9SA 3HW7A 2AQSA 1SOSA 1OALA 1IBDA 3MKGA 4MCMA 1SDYA 1Z9NA 3GZQA 1OZTG 1PU0A 5KBKA 1BZOA 1SXAA 4A7VA 1YAZA 2GBTA 2JCWA 1IBFA 2WZ5A 3H2PA 3SODB 1U3NA 3KM2A 1JK9A 1SXSA 2V0AA 1XTLA 1SXNA 2WYTA 2C9VA 2Q2LA 4N3TA 3H2QA 2R27A 1PZSA 4A7GA 1OAJA 2WYZA 3S0PA 5CU9A 2K4WA 4L05A 2WZ6A 2Z7YA 3KBFA 4BD4A 1SPDA 3LTVA 3KM1A 1HL5A 3MNDA 2WWOA 1E9QB 1F1DA 1B4LA 3QQDB 5KBMA 3F7KA 1Q0EA 2AQNA 1HL4A 1QUPA 1CB4A 1UXLA 5KBLA 1PTZA 1CBJA 1XSOA 3RE0A 2WKOA 3GQFA 2LU5A 3PU7A 2GBVA 1IBHA 3GZPA 2APSA 3HOGA 2AEOA 1E9OB 1F1GA 1BA9A 3ECUA 1P1VA 3KBEA 4A7TA 1DSWA 1ESOA 2Z7WA 1KMGA 1TO4A 1OZUA 1JCVA 3KH4A 3T5WA 3HFFA 4BCZA 2NNXA 2XJKA 2JLPA 4A7UA 2ZKWA 2GBUA 1IB5A 1IBBA 1OEZW 4OH2A 1E9QA 2AQQA 2WZ0A 2E47A 2VR8A 1JK9B 2XJLA 1SXZA 4OJAA 2AQPA 1TO5A 1Z9PA 2ZOWA 4FF9A 2Z7ZA 2ZKXA 2E46A 2WKOF
chains in the Genus database with same CATH superfamily
1FV1B 3MLUH 4HOMA 5JHLA 3PL6C 4N6RA 1JPTH 3GMRA 1OTSD 4DGIH 3DX6B 3VG0L 4AW4A 1LO4L 4P9ML 1N5AB 1KULA 3FFCE 1HESA 2VL5A 2CGRL 3CZGA 4CMMA 2QPFA 1SBSH 2O6CA 1SY6A 2CBOA 1ZT7A 4B5ZA 4QRRB 2AXHA 1PL3A 2XZAH 4IOIB 2SODB 1A3LH 1U8PB 3LKOA 3Q5OA 2BX5A 5JPMB 1AVAA 3QORA 4JVUA 3QPKA 3DGGA 1CDYA 3ATAA 4FLOA 1D6VL 3EDKA 4NGHL 4F7MB 5T3XH 1Y6NR 3GMQB 3L81A 3MGTA 2ADYA 3NCYS 3UBHA 1WS7A 1VPOL 4WI7A 2VJ8A 4AQAB 1EFXA 2VO8A 4DGYL 2AK4B 4TOYH 1P5VB 3DDGA 4K8RL 4MB1A 2OR9L 1B2YA 3LNFA 4CN4A 2DQJH 4JKNA 4RGOH 2HG5B 3UTZB 5IGXL 1RU9H 3MUGB 1H6EA 3TJEH 3FUFA 4N8CL 5F0LB 3SJVD 2GUOB 2XUWA 3FSVA 4JDVB 3UP1A 5CBEA 5CP7B 5A2IH 4BZ2L 5HD8C 1JIBA 5J57B 5GXBB 4AV4A 1C08B 3T2OA 1YN7B 3EIFA 4BH8B 1LO0L 1IU1A 1WZLA 2VZUA 2YC1A 1FHNA 2ICWJ 5IJDC 2ZKHL 4YLCA 5KUKA 3HC2A 4PJXB 1UC6A 3CN1A 3NZSA 4E9VA 3GXNA 2YPLA 4NO3A 4W9ZA 3ARTA 4Z0BH 1BVZA 1NCWH 5IHHA 3TN0C 5KYUB 2BSTB 4R8WL 1IRAY 4R4FL 1IAOB 5F9JA 3RWDB 1JZ2A 1XFPA 1A6UH 4LT7A 1SLWA 4KUCD 3US0A 1SOKA 2PWFA 3WFDH 4QTHB 5IBLD 1ACCA 2H8PB 5HHOE 3HS8A 3UADA 1CLZH 3G5YA 1I1YA 3FRPB 4P3CL 3VFUB 4ZRGA 3INOA 3WY2A 2F54D 1FVDB 2HJLA 5F89A 1J05A 3MNMA 4EI6A 3V7AE 1F5WA 3Q3GB 2ZF9A 4N87A 1MFCH 3P3YA 4YQXL 1J12A 4M9OA 3X13A 2J12B 1JWUA 2WZPD 4JFED 3UTQA 5GZOD 4ETQB 4EIBA 4MXQC 3LVTA 4OCWL 4BWUA 5KZCD 4FTVB 5KVEE 2QELA 1NC4A 4XN5A 1QFWM 3O6LH 4TVPD 3BZ5A 4QMEA 2XQYK 2DTMH 2CLZA 1DVQA 1T6VN 2ZOLA 4KJWD 4LFHD 1HAWA 4FQ1H 2IWGA 3HIZA 3MKKA 1MF2L 4E5XG 5E8EA 5ADOL 1TETH 5BCAA 4GJTB 2H2PD 4Y16C 3HE7B 4HPOL 3VFWA 1WISA 4WFED 3T3PF 3DVGA 3UTPD 1SJHA 1YN6A 3Q8EA 3UZVA 3SHSA 4JEGB 3T0EE 1QBMH 2A38A 5GZNA 3RFZB 2AQTA 4JG1H 4GI6A 1CXFA 1QLFB 5FFLA 5EWIH 4J3UA 3K91A 3QQ3A 5HHPB 2F74B 4FP8H 2QV4A 4JO3L 1FJ1B 1OE2A 4JHVA 1SJVA 4UDTA 2IAMC 2RH0A 2EUXA 4P9MH 2DQUL 3ZE0B 2YD2A 3A24A 4KV5F 2CGRH 1M42A 4G8GA 4KGJA 4RFEB 3OX8A 4OCXL 5A2KH 1CDCA 3FFOA 5CEXB 1THAA 1OB1A 3RNKA 5HHME 5E8PB 2UZYB 1ZTMA 3D18B 4MCMA 4YHKL 5KANG 2NUTA 4TUOB 4RNRA 3DX9A 3OB8A 3KVPA 3O6FB 1E5AA 1X5JA 3UTSD 2VXTL 2JCCE 1XEDA 1I7ZA 3WV0A 3TH3T 4BH7A 3RPIA 5KSAA 4DGYH 1N7MH 1ZVYA 4AOFA 3V10A 5F7WC 4AI7A 4TNWK 1JK8A 4WZ9A 1R24B 4K8RH 1ZHKB 2OR9H 3HNTH 2ZZUT 4PJ5B 3RL1A 1B0RB 1K72A 2AEWA 3EFFB 4EDWH 3L3DB 4C4KT 1E5BA 3NZUA 3UJTL 3GSOA 4G6AD 1XBRA 2LVCA 2X4RB 2H32A 4MXWH 3AAZA 3EO1B 2W07B 3DJSA 3EG9B 3R18A 3RWGB 2B1AL 2HMIC 3N44B 4UM9A 3MBWA 4ZBJA 5IJKA 1AZRA 1T1WB 1BVNP 5EZLA 4AE1A 1EBAA 3MRJB 1L6PA 1JZHA 2A9BA 2ZKHH 1CT8B 4PJGE 1NBZB 4S10A 3ZL4L 3WLWC 3WIAA 4K55A 1B0GA 3CUPB 5MERA 1XF2B 2X10A 3VXUD 3D7PA 4QY8A 4LLDB 3GMPB 1UD5A 1RHHB 2XTJE 4R4FH 5C0NC 3NK3A 4M5SA 4PFEA 4PJ9A 1PQZB 4X4MA 2IBZX 3OJDA 4IMKC 5D7EA 4QRUA 4E9XA 1BLIA 2VMEA 3ZKXC 3B37A 3TWCL 3BP7A 1W0YT 2EO9A 2HVJB 2YSTA 2AXJA 3DJTA 1UOLA 3WELA 4P3CH 1P69B 2ORBL 3MNWB 3TF4A 5C0EB 1FFOB 2H0EA 5DHVH 4HWNA 1GGYA 1KN4L 1BQUA 4UT6L 4FA7B 3JWOC 1SJXA 4TL5A 1KPRB 4K7FB 2Z92A 1RCYA 2I07A 4MJIE 4QJ5B 4V1DA 2GJ6B 3HEIB 4YQXH 3K3QA 5AZEL 3UCRA 4TM9A 5C0GA 4AIZA 1IC4L 1E65A 1IZKA 2JB5H 2VGLM 4GBXA 3T4YA 4YSCA 1GXEA 3RY6A 4HKZB 4CILA 5GGVL 2BW4A 2BJMH 2BSEA 4M4PA 5AW0B 1DVZA 2R7EB 5FUOH 4OCWH 4AQZA 2UY7B 4I7ZC 1INQB 1UCTA 4NDMB 4Y2DA 4TLSA 3GSNH 3O3BB 3DSNB 1MF2H 4UAOB 5JHMA 1QFWH 1LO3L 3WE6B 2J56A 3VMNA 1OCCB 5MHSE 2VLME 2CO6A 1OHQA 2E8ZA 4CSSA 4F9LC 4U6HB 1LGVA 3VRJA 1NZRA 4J8QA 3ULVL 2VE6A 4ORGA 5C0AA 2Q87A 3VD1A 3QNXA 5TFSL 4JO3H 1HNYA 4LKCA 1ZANL 2Z8VC 1AGDB 2DQUH 1HHHB 1RK1A 4A6YL 2P43B 4LB8A 3ESOA 3MUUA 1VZGA 43C9B 5FXCH 4ONOA 4OCXH 4XN1A 3WS6A 3I6LE 1RZKL 3OGCB 3M1BA 2BIQA 3LEXB 5I19H 3T1WA 2WVVB 3ULAB 1W72H 3GIZH 3I9PA 3CFEB 1KTKE 1Q8MA 5EOCL 1T04B 1WCBB 3QWOB 5DEGB 3ASOB 3SGEI 3V6FA 4PM1A 3L7FB 2D3NA 1NH6A 1ZVSB 4KAQH 4YZFE 1LMIA 1LK2B 3EUDA 4XC1L 1X9RA 2GTWA 1F3DJ 4JFFB 3PWNA 4GRMA 4ZXBD 2YOCA 5BO1L 1B0IA 3JYBA 3OSVA 4HA1A 3A5VA 5D7LE 5DK0A 5DMKA 4MNQA 4GKSA 4Y19B 4KJYA 4ZPTA 2Q0ZX 3WIIH 4W9FC 1FL5B 4YDJB 2VLJD 3LKRA 1FL6A 3QXVA 4M29A 5AL8A 4IEFB 2UXFA 1U8MA 1UOKA 1V3MA 1IB5A 1T20A 2AXFB 3DRTA 3D25B 5GRVK 3RDTD 2YZ1A 1KJMB 3RWEA 1GL4B 4ANWA 1BAWA 1E40A 3APNA 2MKWA 3DETC 5HYQA 1NUNB 3X3GL 2EJ1A 4OZGF 4KVCL 4Y1AE 5DZNA 3PHAA 4PRHD 4KMQA 4BHUA 2HVKA 1SJEA 1QR1B 1NEZA 1TTGA 1A6PA 2E8YA 2NY7L 2OXGA 4PJAA 1A25A 2BVQB 2IFGA 2B0SL 4G8FA 3MGOA 3RUGA 3ZL4H 4KH2A 1O0VA 1RLBA 4HUUB 3WHE0 2FZ3A 2YBGA 4XT1C 2X9YA 4KZCA 3HLAA 1Z9LA 1BD2D 5FFOA 4CNIA 2JNZA 3F00A 4DKDC 3B7TA 1GY1A 2C1OA 3FB5B 1UB6A 5D4JA 5GPRA 1ONQB 2YJQA 1Q9WB 4LOEA 3QIUD 4EN3C 1IM9B 2E27H 1MUJB 5EC1B 4ELDA 1CFSB 2ORBH 3SDAB 4AK2A 3T2LA 1OQOA 5D7JB 4U0QB 3AC0A 2Z91B 4N90D 2IPTL 4OSUL 1SJMA 1YEDB 1U8IB 2ZWLT 3VXMD 1KN4H 4G5ZL 1A4JB 1BJ1J 3K8LA 3I9GL 4UT6H 4I48B 5FKAB 1DJGA 1R5WA 3PDOA 3NAAL 4Y4KA 5D2LB 2HKHL 5KSBE 2YMXL 3QO0A 4Y4HD 3P0VL 5EU6B 5BVPL 1IC4H 1FI8C 5HGAB 3UYOD 2IH1B 4Q9RL 4P5TC 4QWWC 1N3NB 4WTQA 1IM3B 1JGUL 5EO1B 1CFQA 4WEMB 1LLAA 1NFIB 1OP5K 3V52L 2YGPA 4L9LC 4ACPA 2JE8A 2UYLA 3E3QC 3FQUB 2PO6C 4Y5VC 5FYKL 4GG6E 4KQ4L 3BO8A 2R9HC 4MA3B 3PUUA 1I1AB 2WWMD 3DTDA 3BP6A 5KVFE 3EOBA 1HOCA 2EIKB 4PJDE 2G3ZA 4QO1B 1HZHL 1K4CA 4JM2D 1YNTA 3H0TA 2FL5B 1R3KB 2H5UA 3OKLA 4ZO8A 4OI7A 1JZ5A 5TFSH 2G5BA 4BUHA 1TCRB 1ZANH 3G04B 4XH2A 3ARBD 3C12A 3DTXA 4RGMB 1BBJB 3K5SA 1J8HB 1OF2B 1WZMA 4J12A 5CINL 3ECUA 2IANA 3NGBB 5EF1A 1RZKH 4PTTA 4XXCC 3VTTA 3VTAA 1CIUA 3AS1A 1J9TA 1QWUA 4IJ3C 3AGVA 4RMVA 3QCTL 3ARGC 4P46B 4M3KB 5EOCH 5GSVB 2F58L 3MA7A 4AJWA 3LDBC 4UAHA 5DO8A 4P4KB 1U0QA 2P3YA 2ZSWA 2FO8A 4XC1H 3P77B 1E3ZA 2BSBA 1T21A 3MRCB 4W70A 1MCPH 2DYPD 4FG6D 1MI5A 4FAAB 3S8GB 5JMOC 2CKBB 4U1GC 1AGFA 2WLIB 3CFJB 3CHPA 3P11H 3TM6A 1P2CA 1KWKA 1WH0A 3JV5A 4DK3A 3EOTL 4RAUA 1A1NB 4JFVA 1OAQH 4FG4A 3NRQA 2J2ZB 2NDFA 5I0VA 1KYFA 4DKFH 1N4XH 3BUYB 3GMOA 2B5IB 4C56B 2ARJQ 2VO5A 5HGDA 2GJPA 3JWNG 1IBGL 2P24A 4FD0A 3TIDA 5MEPA 2NY7H 1X5IA 2B0SH 3LRSA 4E41D 1J1PH 1I75A 3D8MA 2AQ1A 1IL1B 2I27N 1I7TA 1NFDB 4P5KA 4WWID 2FH8A 1U8CB 2B9AA 4B9FA 1E9PA 2QPSA 1S7UA 4GH7B 5B7EA 1J0HA 4ONGH 2X0VA 4OGAC 4OM1L 1J9QA 3JUZA 1KWGA 3GJFB 1UHVA 4JBSA 3RJQB 2JQZA 3GZQA 1U58A 5I0XA 3QAZC 5ICZB 4LLUB 5L4IA 4P2OD 3SPGA 1DFBL 1PKQA 5HDLA 1P7QD 1EVTC 3LKNB 1CCZA 4LSTL 3QJZA 4Y2LA 1U2CA 3ZOAA 2IPTH 4OSUH 5DD6B 3EYOA 5DQDH 5IHBA 4JG0H 4YFLI 3I9GH 2OMZB 2PCPB 3NAAH 5I6MA 2HKHH 2YMXH 5BVPH 3P0VH 4K7PY 3MA9L 3MUY1 2JMRA 2BCKA 4L4TA 1G84A 3MLZL 3DKHA 5IR1B 4Q9RH 4HF5L 2FVNA 2Z64C 4DEPC 5IFAL 1JGUH 1FN4A 2A73B 1QUPA 4LCIL 4PLJD 5CF3A 2WIIB 3KGRA 4Z7UB 1QMUA 3B9KC 3GBNL 5I1GL 3GIVA 3BSHA 5FYKH 3UZEA 2PTVA 4A39A 4KQ4H 3RKDD 1SLVA 3PWPA 5K9KA 4G1EB 2D0FA 4YVNA 4BK5A 3MODH 2X7LA 2ZOTA 4ODSL 5EBWA 4CUCA 5F1KC 1DLHA 2YPKA 1OGAA 1VRSA 4XZUA 2CIIB 3QJTB 1I31A 4AUJA 3GJFK 3FTVA 4EIGB 1TTAA 5G5DB 3GSUB 4M1CD 5DMGC 5DHYA 1CS6A 4Z7AA 3CHRA 3GGWB 5DD0L 2ENPA 4FMVA 2ZG3A 4NEHB 3VI4F 1KCUL 4P8QA 5ISZE 5E9DE 4E9QA 4G7VL 3UAAA 4M93C 3QJRB 1M3IA 3FU9A 4MAYC 5FO8B 1YNKL 2HT4D 5DJ8B 1OPGL 3IMRA 1YAIA 3MRQB 3CIQA 1CF1A 2A9DA 1DEDA 3K2KA 1QFWI 3BFOA 3P9MB 4KNSA 3QCTH 3MFFB 2ZXWB 1LP9B 2F58H 1JG9A 2EIZB 5JPNA 4OCYL 5E2TL 1O7VA 4F7TB 4IOSA 12E8H 3FFDA 3J27A 1FNSL 4AEHH 1JFQL 1QEWA 5FLUA 4OZHF 4P23A 4XVOA 3PP4H 1FZMB 4MDJA 1FG2B 4HX1A 1T3FA 1XTMA 4ODBD 4GP8B 5AB9A 3QG6B 3LZQA 3PYCA 1KJ2B 2VQ4A 4Z7WA 3OSKA 3CC5A 4XHQA 1F3RB 2VT0A 4YAQB 3EOTH 4FFWC 5JQIB 4GKNB 4NKDA 3UBXB 1K5NB 2ETWA 4JFDB 4NC2B 3S3SA 4TLUA 5CKGA 4JKPL 4ZQTA 4AYDC 4KXZH 3BWAA 3OXSB 1TPXC 4G8IB 3AB0C 1EO8L 1A6ZA 1NPUA 2OJZL 5I8EB 1IBGH 1PVHA 3QR0A 3N1MC 2GFBB 1CVRA 3IEAA 3MJGX 4LDEB 1CFMA 1XTLA 1E6JL 2CJUL 3NCJH 4N5ED 1I7RA 1JV2A 1KGUA 2CWRA 5JORA 1QZ1A 2KYIA 2QQKL 2ROYA 3QPXL 4FQHA 2BS8A 2K4WA 3MN8A 4JG9A 4YHYC 2L7QA 5GS2H 4P2RB 4YR6B 5H4ZA 3DX8B 4OM1H 1DQJB 3OQ3B 3P3RA 1XDTT 2ZUSA 1N5AA 4AYFB 3JWNC 2HRHA 5BS0B 1LEGA 3HMXL 5M7QA 3SQOH 4AQEB 1OTSC 4BKSC 3ZHFA 1JYVA 4LCCB 1UD4A 3V0AC 4QRRA 3Q05A 3BQUB 5K1VA 3KS0J 4M48L 5JPMA 4P59L 3SE8H 3B5TA 2MQGA 3QNYB 1U8JA 4I3SL 4M7KL 1I8IB 3FTUA 3DHUA 5DJXA 1O9ZA 3O9WC 5DZVA 5HVHB 1TO4A 3WDHA 3ZIMA 1GJWA 3IFPB 4NFDA 5KJ7E 3MA9H 5J1AB 1CGYA 1SN2A 2AK4A 3ABLB 4YLQT 1HDMB 1QPXA 4DPRA 4AJYV 5E56A 3K4ZA 3OB0K 4X4YA 3LNIA 4HALA 2HG5A 3UTZA 1QSFE 3QUXA 1L9SA 4LF3B 4XPHH 3GBNH 1XGPA 3HE6D 5I1GH 2GUOA 2Y7QB 4JDVA 4LGRB 4ZMAT 4RMWA 5KYXB 5EUOB 3S5LG 2RTTA 3QDJB 2VW4A 5CP7A 3TBSB 3BRFA 1C8QA 1EERB 1TJXA 3B43A 3OAZK 1C08A 1II4E 4ODSH 1YN7A 4ZODA 4BH8A 4FNLH 2VMJA 1A9EB 4KRPD 3QIBB 3PCYA 5ADPH 2P5EE 3L3OB 4PJXA 2FQDA 4R0LB 4FNSA 4OLYH 4LBAA 4Q6IB 5IROD 3BKJL 4OQ1A 5AAMC 1BWWA 3NIDF 1F45A 1INDL 5AG9A 5LGHL 1IAOA 1M1XB 2BCMA 3L5WA 1F2XK 3RWDA 4BFNA 5SWZB 1W16A 1YNKH 1OPGH 4HDIB 4ZYKB 5J4MA 2JIXD 4QTHA 4X5PA 3RX7A 2H8PA 2FJGB 1T89A 1DJIA 1FFPA 1RPQA 2AC0A 3QQ4B 3MJ9L 3FRPA 3SDDD 3BPOB 3UEZA 5LCVL 3STBA 4OCYH 3UO1L 1PLGL 5FK9A 1PD1A 5IBLC 2ARJB 3G7TA 4HWZB 1FNSH 1XEUA 1JFQH 3B3IB 4QF1A 4NZFA 1ZEAH 3Q3GA 4PGEB 3O8XC 3BVNA 5F1IB 3VXQA 3FU7A 1MFVA 4PPTA 1PZSA 3QYNA 2J43A 2MCG1 4DEWA 4OB5L 1CXLA 5E2JA 4XNXL 1GZQB 2NNCA 3OAWA 1Z6JT 2Y23A 4FTVA 8FABA 1FZKB 4JKPH 3KPSE 2NY6D 2FLBT 1JHLL 3D50A 1G9NL 2YS4A 2D4FA 4KUCF 1EO8H 2OJZH 5DVPA 3HE7A 4PP2B 1QX1A 2HYMA 4OZIB 5F3HB 3FL7A 3RFZA 3FUEA 4A2HA 4Y9GA 3BPLC 3LHAA 1QLFA 1J7VR 4ADGA 5JW5B 4DTGH 4ZUVA 4N2CA 1E9OB 15C8L 1BGXL 1TYJA 1XB6A 2F74A 4LRIA 4HOXA 5HHPA 3TZVA 5DQJB 5EOTB 4HOZA 5JIKA 3UO8B 1KMGA 3E8VA 4PJFA 1M71A 4O4YH 2KL6A 5J9PB 4RFEA 2IPKB 3B2MA 1OLZA 3ARFC 3GXUB 5CEXA 1S7XB 3SZKC 4CVZB 2OJ1A 1MHHA 1G7QB 1U91B 3D18A 3LVEA 3M88A 3N1QC 5CAYB 4C4UA 2HRPL 3IJ8A 2QMJA 2QADB 4HXBL 1XMEB 2Q86B 3TO2B 1SBBA 3CZJA 1ZLDA 2XZCL 3L3JA 4JZOB 4M7KH 3FT9A 3KPRB 1QASA 5D7IE 5HHOB 3R7RA 2IIJA 2ICES 3IBEA 1R24A 3Q48A 5E7BA 3QUMB 3ZX1A 1QZNA 3R4RA 4PJ5A 1B0RA 2YQBA 3EFFA 2H45A 3RVTD 5CD5C 3KXFD 4Z6AT 1XF3B 3T0XA 1A6VH 2O6EA 2EKSA 2YK1L 2R59A 3DX7B 1JMZA 3EO1A 3VB9A 2W07A 3RQ3A 3EG9A 3RWGA 5LBSH 4U33A 2VDML 3B7UX 1SVBA 3GC3A 2R1WB 4UNUA 1IJ9A 3VGFA 1M56B 1ZDSA 4G6AC 4MMZC 1COBA 2JELH 3ARDD 3U82B 4EIZC 1A4KB 3MRJA 1P6AB 1M6OB 3VVVA 1CT8A 2V17L 3BW9A 3OGOE 1GS8A 4UYQA 2A9ML 5D71H 4KROC 1J8SA 1G7HA 1KPVB 4UTAL 2ZCHH 1XF2A 2Q5BA 3BKJH 3FH7A 1M7IA 3GMPA 5KS9F 1RHHA 1KELL 2A6DA 5I1DA 1C8PA 3QFJE 3P3TA 2DMCA 5C7XL 5DI8B 4X98A 2FJSA 5D9SB 3H1ZA 4DO6A 4QAMB 4RMQA 1ID5I 3ZDZB 5ESVB 3V9CA 3ZR6A 1MWAL 1CTOA 2HVJA 3QA3B 5AZ2H 1XGUB 2G2RB 4IKNA 2CAKA 4IKJA 4AQ8C 2NXZD 3MNWA 1NAML 1ZLUK 3UO1H 4HUXB 1FFOA 3EADA 4PJEE 3LB6D 4F5CA 1A9VA 3OKMA 1Z2KA 5TF1H 2YWZA 4WK2B 1F3DH 1WIUA 2NR6D 4JHAL 2GJ6A 1BREA 1NMCB 4HPYH 4RZKA 2XN0A 1JDAA 3JWNH 3ZDXF 4HKZA 4JKWA 3C60D 2R7EA 3OMZA 1U3HB 1SYSB 3QULB 3QDGD 3KL0A 4MAUH 5F9DC 1HQ4B 1KB3A 1INQA 2CMRL 3DURB 4H8UA 4NDMA 5FGBC 3D06A 4JKMA 4L1DA 2FTAA 3T6XA 3HG1D 1JHLH 3K5RA 1IILE 1G9NH 2HUEA 3DSNA 3DHJA 3O3BA 4JN2B 4PHXA 3OG6B 4YHPA 3WE6A 4XRCB 4CVUA 4U6HA 4O58L 4LLMB 3FQXB 2O6FA 2WAQA 4JPWH 3NRPA 1SMDA 4F33B 6FABL 2VDNL 5KVDL 1AGDA 1HHHA 3OAYH 5J56B 2TRHA 2X87A 4PJGB 2P8MB 4B41A 5C9KA 4JFTA 2BSDA 2YARA 4MQ7B 43C9A 1IO4C 1TTBA 3WNLA 5H35B 4KXZI 3OGCA 4ZTPL 1JF5A 4TRPL 3LEXA 2AXGB 5BZXA 5I8CB 1Q9KA 2WVVA 3G6AB 5ECGA 3F7LA 5HGHB 3CN3A 1GGUA 5I74C 2HRPH 5FGCE 2A74A 4J6IA 3WJLC 3S96A 1SEQL 1MCSA 1T04A 1WCBA 3IJ9A 3UOAB 2X6VA 3L7FA 1ZVSA 3O0RL 4JHWL 5B39B 1LK2A 3BVUA 3AG3B 4GFXA 4PJBF 1JPEA 1TLKA 3X1NA 1XL6A 3D33A 3ZYZA 1SEBB 2X3AA 4DUVA 2V4LA 4MMYB 2V5SA 1MG3C 1SYVB 4O02H 3IGAB 4Y19A 1ZLWK 3SKOA 2VLRA 3MBXH 1FL5A 4YDJA 5J12C 4JDTH 3UZQB 3SYPA 3MNVB 2AXFA 3B5HA 4R96B 2EE9A 2BVPB 2LQRA 3SDCB 1I1RA 3L3GB 3LCYA 2VDMH 5E6RB 2ITCB 2XN1A 2ODIA 1NQBA 3BWSA 5ALBL 3F7VA 4JY6B 4WW2B 4FQXB 1C16B 1FNFA 2UUDH 4OLVL 4BCXA 1QR1A 4X83A 3S97C 4UB0L 2X40A 2ZXCA 2V17H 2VZ3A 5DJ2A 4AV5A 4HJIA 1A4AA 2WLLB 3DJZA 3WFBL 2A9MH 3TYGH 4Y5XC 1AQKL 3PQYA 4HUUA 3SDXF 1N9PA 1E4XL 2EEXA 3NPSB 2XC8A 4FLHA 4W9HC 3VNYA 4H1LB 5DA0B 1KELH 3SYCA 2OZ4A 3ZUCA 1SF3A 1QW9A 2YEQA 2F9BT 3PAUA 3EJPA 3MRIB 5C7XH 3WIFB 1YJDH 2FJHA 2AZUA 1MCRA 5ESAB 2GJRA 3FB7A 4NZRL 3FB5A 5C2UB 4GNKB 1B0WA 2C1PB 3NTCH 1ONQA 5I2IB 1Q9WA 1IM9A 1MUJA 1YYLL 3EFOA 1CFSA 4TVPH 1GHFL 1NAMH 1PJWA 4IDJH 3X1GA 3ZVVA 2NNRA 3Q1EA 5D7JA 1FE8L 3FB6A 4N8VB 1YEDA 2VISB 4W6YB 2CK2A 5TQ0H 3QEQD 1A4JA 5IQLA 4NXKA 4I48A 4YDNA 5BPPA 1QOKA 3FZUD 5EA0H 5EN2B 5FKAA 3DGCR 1DVFA 5F7LB 5D2LA 3VXSE 4AZ8B 2AW2A 5DR5H 5EU6A 4UNIA 3UABA 3NFPB 1KIPB 1TVDA 2F53E 5KN5B 5HGAA 2IH1A 4H88L 3AU0A 4GAGL 4ILDA 1IM3A 3QZWB 5EO1A 2QKIA 4Y4HC 3QRLA 1DP0A 2CMRH 2X09A 2Z7UA 4R7NB 2RMNA 5KYWB 2CUIA 2FDBP 1MFDL 1AO7D 5D7LB 3W2DH 3T3PE 4A7GF 5EIIG 2VN5A 1LNUB 2D3VA 4WSJA 4QLWA 2CSPA 5JUEH 4LHUA 1I1AA 1R19A 2ZF8A 2OK0L 3BN3B 2O5YL 3EF7A 4NWTL 4QO1A 1KXHA 1RULH 2MOVA 3N06B 4O58H 2I60H 2BSRA 4I9WE 4ZAKD 2FL5A 4JO1L 2Y5QA 5C7ZA 1R3KA 4FCAA 4Y1AB 5CMAB 2F7QA 2NSXA 4KFMA 1Z3RA 3G04A 4PU2A 4XO4A 2ID5A 4W6XB 3FT0A 4UIKH 2ZWYA 3VQ2C 1J8HA 1MREL 1MCQA 3EBGA 3IMUA 1AE6L 2XQ0A 1OF2A 2VL4A 4X7CC 4ZG1A 5FCSH 3KYAA 2K70A 2F8VA 1WFNA 4JQXA 3SN6N 1O7SA 3C9NA 3VSVA 3LS5L 4OD3H 4ZFQA 1K3ZA 1RZIA 4K5PA 4BXVA 5C97A 3U6RB 4JRYE 1F4WL 2IDTA 2EEBA 3M6DA 1TJHH 3FU8A 2P52A 3D3VB 4P4KA 4HWEL 1GYAA 3A6BH 2APTA 3P77A 4YDMA 1RJYA 4GUOA 2ESVE 1OAJA 3TASA 4MD0B 5JDJA 3J7HA 4MZIA 5LXGH 4JM2F 1VADB 2EXWC 3RA7L 2VRKA 3CFJA 3KGUA 3V6BR 5A7EA 3BAKA 1VCAA 1TYEB 5C0RH 2H1XA 1A1NA 3QUZD 5DT1H 2J2ZA 3S9DB 2XN9A 3JT2A 3QQDB 4X7TB 1TNNA 1I7UB 4MASA 2QL1A 4JO4L 3KD4A 3BUYA 3WTXA 3L4TA 4JFXB 4NN6C 4OLVH 4DGVL 3H6AA 5I15H 2JB6B 3CMOL 3IFLH 3ULVE 2F7OA 4UB0H 3HOGA 3F5WB 5HPOA 1Q9OB 1VDGA 4HJTA 3WFBH 4ODXB 3IU3A 1CTMA 1YC7A 1IL1A 2NY1D 2AJXL 1E4XH 2PKDA 3V6OE 1ORQA 4IYKA 2JTYA 4ZO6A 3CHXA 5DHXB 1NUFA 1S5HB 1QSED 1IGIH 4XX1G 1CPUA 2ZWNA 4QUOA 4EKJA 1I3UA 2JKSA 4AL8C 1O7DC 4LLQB 2H0FA 2VLLA 1A7PL 4K3JL 1YMMB 4NM4L 5AW1B 5ICZA 3ZW3A 1CD0A 2DQFB 2A4ZA 2R0LL 3ULSB 3LKNA 2PWDA 2GQHA 3OD3A 1FE8H 2FK9A 4OQTH 1CXIA 1R3LB 4J3OH 3TYFB 2PWHA 4N2IA 2OMZA 3VCLB 4Q56A 2VR7A 3KPPB 4W6WB 2BO0A 4P04A 5CJOH 1D5MB 3AG4B 4XVJH 2YN3A 1I3VA 3CK0H 4RBPK 4U1NB 3MYZA 4H88H 2N3JA 4GAGH 1R6VA 3SYQA 2A73A 1ASOA 5DLML 2J5LC 5J6GB 1AJ7L 1IGCL 2J1XA 3PABA 3WTYA 2Z8WC 3OLIA 1MFDH 2W9EL 1LEKB 3NPZB 1MCKA 2KPNA 1ZSHA 2CK0L 2Y72A 3N41F 1OLLA 4MB5A 4OJYA 4IKIA 2YJLA 4PLJC 4FI8A 3P3UA 4TNVK 1QRND 4G1EA 5AEAA 4MJHA 1XHHA 3BN9D 5TD4A 2OK0H 2IO5A 2KDYA 2OMBA 2O5YH 5B38A 1L7TL 4NWTH 3BCFA 3EJCA 4G82A 4X5XA 5KWYC 3RKDC 1BX2A 3B9VA 2FSEA 4GQRA 1Q90A 3I6GB 2X5PA 4PS7A 5G5DA 4DVBB 2E56A 1Q9LB 2WV3A 1XO8A 5DUPH 3KLQA 5CSZB 5B4MD 1A7OL 3Q8AA 4DN4H 2G4EA 1AE6H 2WHVA 3L95B 3NVQA 3KYMB 1XZWA 4X8JB 1U33A 1HXYA 2YLKA 4NJAL 4P2QB 2P44B 5INCA 5FO8A 2G0LA 5DHMC 3LTVA 5DJ8A 3LRGA 3MRQA 2KERA 2Z35B 3LS5H 4ZFOL 2DJ4A 4XMWA 2DD8L 1DUZA 1M05B 3P9MA 3KS0H 1NGPL 4OLWH 4OTXL 3WHXA 3MFFA 1F4WH 1LP9A 4G59C 2HT4C 3VXRA 2EIZA 3E6HA 4HT1H 4EUPB 2V7NB 2DQGL 2OTUB 4X7SH 1U8KB 3VGGA 4B9JA 5BW7C 5GHWL 1AXSA 2ZUQB 4QHPA 3D0LA 4NBYB 4W4OA 1CURA 1FZMA 4ZO9A 1B3IA 4U1KB 3MI6A 5DS1A 4ZW5A 3RA7H 3QXUA 1AXTL 1KJ2A 2B77A 3O11A 5K9JH 4IGBC 4N9OB 4YSTA 2GAZB 2XFXB 5G4OA 4HSQA 3IXAB 3M17B 4OZGE 1MCNA 5F9WC 2NY0C 5FYKE 1XGZA 4GKNA 2JFCA 4GLRH 3UBXA 3PP3K 4QRBA 4HIXL 2V37A 3H9SD 4LGPB 4Y2OB 2WINB 2MEJB 3TNMA 1E4WL 3OXSA 3TO4B 4CJ1A 5DDHB 3DI3B 4F9PA 1U8HB 4MA1C 2OXHB 4G8IA 5JW4N 1ZY9A 2MCMA 3CMOH 3VAEA 2VN6A 1BFVL 1XX9C 1JXKA 2GFBA 1F4HA 2OSLA 1MDTA 4OFYA 2BNQB 3QJXA 5E0QA 2EDMA 2D3LA 2EIEA 2Q8BL 4LBEB 4U6YB 4KI5D 1E28B 2QBWA 4V2BA 1CICD 5C3TA 5LLIC 1T2JA 1T0NA 2VXUL 3P4MB 4WWPA 4P2RA 4YR6A 4KKNA 1N0XL 4H8VA 2LABA 3DX8A 1G9MH 1DQJA 1BVLB 4N5EC 2O6DA 3OLDA 4NQDB 3SKUD 4A6YA 1JYWA 3TURA 4AYFA 4CMHC 4DGWC 1CGVA 5IUCA 2MJWA 2Y3NA 5BS0A 4FXTA 3KMDA 4K3JH 4NM4H 1FLTX 3ASNB 2P5WB 4LCCA 5IVXF 5E9DB 3GTVA 3ARWA 4N2OA 3K8MA 1MEXL 2K6WA 2N0MA 5EFIB 3WFHB 1T1YB 3P30L 3EJYD 2J1KA 4FXKC 4Z7QF 3K6FA 1T1XA 3P4LA 4KK6D 1I8IA 3B9EA 5CCGE 4R2GD 4HLZG 3ZHDA 1H3XA 1ILUA 2VDLL 5FF6B 1T5XB 5J1AA 4APXA 1TFPA 3BUQA 1BZEA 4PRIA 3ILPB 1HDMA 3VI3F 3U7WH 1P53A 2XQYG 4WAFA 4EMZA 2OTWB 5FB8B 4FFZL 1IGCH 3U48A 2CUAA 1TQCC 5HYJB 3NJLA 3ILDA 4LF3A 3SPVA 2W9EH 5KBNC 1J88A 4H8WC 3UZEC 2CK0H 2Y7QA 1ZSDB 1S7RB 5FCUL 1AD0B 5KYXA 1AQMA 3QDJA 2NNAB 4D8PA 2D8KA 1W8NA 2HPTA 5TGBB 3H8NA 2EDQA 3NCYP 3SZ6A 2H9GB 1USZA 1VLXA 1WWCA 1L7TH 3HB3D 1K4DA 3TPUA 1QD0A 2O72A 3CX5K 3ARYA 2C3XA 1A9EA 2N59A 3RVVC 2A4CA 1JNNL 3QIBA 4HAKA 2DTSA 1SHSA 1M7DA 3L3OA 4XBEL 4YHZL 2DLFH 1FYTB 2XPGB 4R0LA 1AHWC 4G1MB 3RWCA 5C08A 3AVEA 2X1QA 3AQYA 1CBJA 4KRPC 1PD0A 4JJ5B 3AG2B 1QHPA 3PGFH 1F11B 1M1XA 5DEFB 3KPOB 5SWZA 4NJAH 2NT0A 4HK3N 2IMMA 3MROB 5IROC 2BOLA 1E4JA 4HDIA 4ZYKA 5KJ4A 5HYJE 5KVGL 4P05A 2DWXA 2FJGA 3TA3A 4RSVA 2DD8H 1BIIB 2VN3A 2CE6A 3BC9A 4OTXH 2JSFA 2AJ3B 5DURD 2YXVA 1H0DA 4IKKA 2DEYX 5I1HL 4I1PA 2ARJA 1MNUL 4HWZA 2MCPL 5DC4B 5GHWH 2H2SD 1IBZA 3QCVL 3B3IA 3SDDC 2PETA 3QUYC 4CBPA 5F7FA 3BEWB 4PGEA 4GINA 4AH2A 2DYSB 1AXTH 4JN1L 5D72H 2DM2A 2DQTH 2QVIA 1KXQE 4CRPA 3D51A 3CVBA 4R3SB 5E6IB 1GZQA 3AM8C 3NCCB 5L2KE 4EDXB 2Z31D 3PPSA 3OAUL 1FZKA 4ZW3A 3SBPA 4PJCE 1E4WH 4FJ6A 2RFXB 3O6KH 5L4JA 5D1XD 3C5JB 3HG5A 4X8CA 4JANB 1CDGA 1BFVH 4PP2A 4HEPG 1KZYA 1RIVL 4OZIA 2E5EA 4Q9BA 1I85A 35C8L 1YNLL 4HISA 1HE7A 3AWFA 1ZGLB 1G87A 5CJBA 1N67A 3F12B 5JW5A 1NAKL 2VXUH 4LIQH 3S3DB 5DVOA 4PG2C 5IMMA 2YAFA 1KIQB 1HYSD 4PTUA 1S7SA 1XF5A 3BWUC 3QWNA 5EOTA 3V4VB 2FAUA 3MV9E 4AENA 1XR9A 3KLKA 4K0OA 3PXHA 2KS0A 5J9PA 4WFFE 3WS3B 1UM6L 3MRGA 5ITFB 2IPKA 2IQ9L 1S7XA 2NX5E 3D48R 5EU3B 1J1XL 1EIBA 4HJJL 2JKXA 4DVRH 3QEGL 2Q86A 3QXDA 4AYBA 4FYTA 3P30H 5D1QE 4HJGB 4JZOA 1NFAA 3H53A 1IFHL 3KPRA 1ES0A 1E4XI 3MV7D 4G9FA 3BI9X 1LILA 1FORL 3UJIL 3PAYA 3BKYH 1WHPA 2ZX6A 4MGXA 4Y8AA 5JA8B 3MYJB 3BWUF 2QZQA 3QUMA 1JVOA 1NC4D 2ITEA 4YZWA 1WAEA 3PV7A 3MLRL 4WF7A 5MI0B 3RTQB 2OYLA 3T0DA 5JQ6H 1UYWL 4WSGA 2R2EB 4YBLB 2PW1A 4OV6F 4HD5A 4FI6A 2R1WA 5D2NC 2IG2L 3FSOA 3AT8A 3MCG1 5DRNA 3S5ZA 3DLQR 3NEOA 1MW2A 5GZND 1MCBA 5J1SC 1E8YA 1A4KA 3QRGH 1M6OA 3KPSB 1K8IA 3PWVB 4TSBL 4XBEH 1HHJB 3ARDC 4B9YA 1H6TA 3CDGB 1H19A 4AGQA 5IKCB 1UURA 4YWGL 1KPVA 2VR8A 1UJ3B 3KJ4B 1KGYE 4G8GD 1Z9PA 1Z9SA 3K4DA 3FFCD 2VKWA 2IFFL 5DI8A 3G6JF 5D9SA 4YHOL 5KVGH 5ESVA 2GTQA 4AIXA 2D7PA 4WIQA 4H44C 5F6IC 2NOYA 3NJIA 3U1QA 4NJ9L 3L3IB 4OZHE 2GC7C 2OR8A 4HUXA 3H9ZA 4N1HB 4PRPE 5FFGA 2PF6A 4X6CB 3KCPB 1TJGL 2VXVH 4G6KL 1T66D 5KSAD 3BD5A 1JZFA 5BOJA 2YD8A 2EH8H 4FHJA 2WQAA 2G75B 1DN0B 4KKBD 3SGDH 4ODVL 3RURA 3LB6C 1VF5C 1D9KB 2E9WA 1OTTD 3US9A 1R46A 1B90A 4HGWB 4KC3B 4CSZA 2FBRA 3CVCA 1PFOA 2UWEA 1SYSA 1HIML 3QULA 5D5ME 1HQ4A 3H9HB 1IGYA 3OAUH 4UM9D 5JXAL 1R75A 4PWJA 2P7TB 4UZUA 5IW6B 3H2WA 3D9AH 2R0ZL 3C60C 5D7KE 1PLAA 5I9QB 5D93B 1BZOA 4JQVA 5F7HA 4AM0Q 2YPVH 2YAMA 2D2CC 1RIVH 1HH6B 3FULA 35C8H 1XCXA 4PRAB 4JO2L 4L18A 2OYKA 4XRCA 5JIDA 5CLTA 3KPQB 3QE5A 2WLMA 1MRFL 4N3TA 4LLMA 4JAMA 4Z76B 5F96L 3G9AB 1IZJA 3JWOL 4PJ9D 1YEHL 3FH5A 4F33A 5E2WH 4JVPA 1QFPA 1WFTA 2GVYA 4PJGA 2P8MA 1K8DA 3PWLB 4FKEA 1E9QB 1UM6H 4N2AA 2NSQA 3ECBA 1KV7A 2DM3A 1L0XA 2AXGA 2F2HA 5I8CA 3U46B 3DVNA 2J8UB 1Q72L 5HGHA 2E76C 3O6FC 3QFJB 3QEGH 7PCYA 2PLTA 1QBAA 3OHXB 3P9WB 4M6AA 3C6SA 2WLYA 1IFHH 3MRMA 3W9EB 1A2YB 4AGPA 5B39A 4UANA 1P1VA 4R26H 3WAKA 3UJIH 4OF3A 4GBXD 1RURH 2FIKA 1X5GA 3ZQ9A 1OSYA 1SEBA 4ZX4A 1JERA 1H5BA 4Z77B 2BSED 1SYVA 4H8QA 3IGAA 3FO1B 3GDCA 3I2CL 3MLRH 1IFRA 1NBQA 3SQBB 2WXHA 1UYWH 4CU6A 1IGTA 1KV3A 2ICEB 2K3TA 3BVWA 3NEEA 5DYOB 5CP3H 4LCYB 1MQKL 3L3GA 5DS8B 4JGNA 2DY2A 4WWKD 2IG2H 1B4JL 2NY2B 4WUKL 4A2EA 2OAAA 4JY6A 4WW2A 4FQXA 3AXLA 5I18L 4EF3A 2NQ3A 4G7QB 2RQEA 4IS6B 4NB7A 4GSRA 4NQCA 4TSBH 1X5XA 2PWEA 3ZDYF 3NIDE 2YR3A 4U4IA 2WLLA 4AV0A 1FFTB 5I5RA 3ZZ1A 1S9WA 4M3HA 4NCDA 4KK5C 4JFYB 3W0WE 1A1MB 3NN8B 2Y2YA 4KFZC 4UQIM 4LVHC 5FHAL 3CQFA 4HV8B 2H6OA 2XPYA 1J5DA 1THCA 3OC5A 4HIJB 4MWFB 4YH6A 5CBAB 3HAEB 3TGXA 3WIFA 4X8XA 3CZNA 4MBRA 3SJVE 2C4FU 3ALPA 4URTB 1GS7A 4XCCL 5HHMD 2C1PA 3CTTA 5I2IA 2WO3B 3IETB 3WY1A 3NZHL 1BAFL 4C83A 4NJ9H 4H20L 4L29A 5AB0A 2Z65C 5FYJL 4L3EE 4N8VA 1TENA 1KN2H 1TJGH 3UC2A 4HXAH 2J20A 4GYBA 1CL7L 5EN2A 1ZTXL 5CR1A 1EHLL 1JPGB 4HCRL 4AZ8A 4ODVH 2KQNA 4JW3A 3NFPA 2QEJA 4NUPA 4HU2A 3PL6B 5KN5A 3FZUC 4PV1C 3L4XA 5AVXB 1HIMH 4ZI8A 1D7CA 1H9VA 4N2MA 4X6DF 4R7NA 5JXAH 4XCYB 5AOMA 5AALA 4UAOC 1BV8A 2R0ZH 4NZTL 2YRLA 3NCFB 4KI1A 4JRFA 1TT6A 3GSNB 1KLGB 2F54E 3MLWH 4JO2H 1DN2A 1S7WB 1MZYA 1MRFH 4BFOA 4PB0H 2NW3A 1DR9A 2BP0B 4U0RB 1UB5B 5CMAA 4ECNA 2OYPA 4HYTB 3MJ8B 1KJ3L 4U1SB 3B9AA 4NPKA 4JLRB 2DYRB 3HNVL 1R5VB 4ZAKC 3EJZC 4JUSA 1YPZF 3I85A 3V79C 3V5DB 4TVPE 4IK7A 1N64H 1NGZB 1UG9A 4Z5RB 3C08L 4N9GA 3MJ9A 2X4SB 4ZO7A 2A6IB 1IEHA 3U6RA 4WFEE 3UTPE 1KIUB 1W72B 3NSJA 5GGVY 3D3VA 4Y4KD 1MRDL 1EANA 5M95B 1ZT4B 2ZXAA 1QWNA 4DO4A 5C07B 4MJID 4WU5A 4XO3A 2WBWB 5FDYA 1RAMA 5HHQB 2CXGA 4XAWH 3U2JA 5E4EC 2DJMA 5I75B 3II2A 3JVGA 4RWYH 5F0JB 1I53A 5CGBA 4F24A 5EIQA 3RAJL 5MENE 3QQDA 1FAKT 3OTTA 3QVAA 4X7TA 1I7UA 1IKFL 2F53B 1ORSB 1MDAA 2KHAA 4PN6A 1VJSA 4RGNE 3DUUB 3KLDA 4WUKH 5FPIA 4LCVA 3UTSE 3BFWA 5I18H 2JB6A 1EVUA 2CGZA 1N18A 3F5WA 3F7YB 4GRLA 1Q9OA 1VFAB 5KS9E 4ODXA 3JTSA 3FRUB 3L5IA 5KVDE 4WNJA 2AQSA 4G6JL 4XBPB 4M7ZC 1MJUL 5FHAH 3APMA 5FC9A 4G9DB 4F91B 4OJFL 3O81A 4XB7A 2MSPA 2IAND 2NY1C 1IBYA 4QHUA 3SCMA 1IBFA 1S9YB 3TCXA 1H15A 4GKOA 4LLQA 2VYRE 1JPST 3EYUL 5DS2A 1YMMA 3I6LD 4ANKA 2UXVA 3F84A 1G4MA 1S6NA 3BPNC 3SDAC 3TIEB 4ZNCD 2XPZA 2I5YL 3NZHH 4TVSa 4H20H 1KDIA 2IGLA 1N8OE 1P84K 2BERA 4R83A 1T1ZB 1S3RA 4LVOC 3K7UA 4Y16B 1R3LA 5T1MB 3MNDA 2ZXQA 2ZWSA 5I6KA 5FYKU 3VCLA 5EO9B 3ZDXE 1CL7H 1MI5D 4AM0B 1ZTXH 3NK4A 1EHLH 3KPPA 4PH8A 1U2HA 4NN7B 1RJCA 3VXUE 1D5MA 4ELMF 4WSKA 2WKOA 4KZ0A 1XB3A 3G08B 2IAMB 4JVWA 2DLGA 4P4RB 3KWWA 5J6GA 4UT9L 3LIZA 1MHPL 5E2VL 3OXRB 4FQJH 4CSTA 3GDBA 2EICA 1MHCB 4YLBA 4JL2A 3WO4C 2JQMA 4FCHA 3VXOA 4OAWB 4R97C 2OSYA 3K46A 1A02N 3SGDI 4XOBA 2OFQA 2PCFB 5L6YH 3BN9C 3I6GA 4HHAA 4UTAA 3U4KA 2G4GA 1HINL 3CSTA 1KJ3H 2XYBA 2XG5A 4RGMC 1Q9LA 5CLZA 3OC8A 2BWDA 3FH8A 3F58H 2I26N 2W8CA 5CSZA 2XWZA 3L95A 1HL8A 1NCNA 3QZMA 3NGBC 4JCLA 3KPLA 1EZSA 3EF4A 2APWA 4R84A 1ZLVH 4LARL 3V0VA 3R1GL 3D85D 2WXKA 4P2QA 4X8JA 1MWAA 5IHUL 2N56A 3S37X 3FOLB 3ILQD 5B4MC 1JRHL 3FT3B 4NAQA 3NIFF 1CVSC 1MHEB 2MOQA 1RH8A 2EXYC 1RUKL 4DEUA 4P46C 3VRLF 2ED6A 3RJOA 1M05A 2MPVA 2WO2B 3NEXA 2XBDA 4EUPA 2V7NA 2OTUA 1MRDH 2DQDH 2AABH 3NP3A 1FGNH 2PP7A 3BYTA 4LL1A 5IT2L 2C9QA 3FMGL 3EYSL 4F2ME 5A6IA 1C12B 4LLVA 3ZMNA 3SE9L 5T1JA 3HJ0A 4XNYH 4ZT1A 1UVQB 2XA8H 2ZX7A 2BIOA 1EAOA 3AG1B 1OAZL 2GAZA 1QNZH 4ZNEA 3MKGA 4FQ2H 1ZXQA 2MNWA 1XZ0B 1IKFH 1X4ZA 3D69B 3PWPD 4QLRA 3ZKXB 2JVUA 1TMQA 4Y2OA 5D1ZD 3VJ6B 1TIUA 1RUQL 1ZHBB 3PAVA 4JQIL 5DZ9A 4JJOA 5DDHA 1RZGB 1U8HA 2IJ0C 1OD7A 4FLSA 5C70A 3NSXA 3SDXE 1L5GB 5A2FA 1YMHB 3P2TA 1DSFL 1HI6B 2DLEA 2BNQA 3R06A 4U6YA 4IRSA 2ZWZA 4G6JH 2EE6A 1HWGB 4OD2B 1MJUH 4ZX5A 3VD2A 2GIXA 2QQLL 3IKCB 1P4BH 3AMLA 2X1WL 1DBAL 1VHPA 3P4MA 4IW4C 5CGYD 3VQLA 4NQDA 4W9CC 5HDOA 5BRZE 1BVLA 1OY3B 4PUBH 5GJSH 3W37A 3ARPA 4QYOB 3W5NA 2C5DC 2JJVA 1DBBL 4XCEB 5E8OB 4R7VA 2Y22A 2DBLL 3R0NA 4BBWA 3TX4A 1RZJL 1I3GL 2P5WA 1DQMH 2I5YH 3H3PH 1AZNA 3KGTA 4KVPA 3CZSA 1YUKB 3ARXA 4PRHE 3RU8L 1X5LA 4K94L 3VFMB 2HJKB 1T1YA 2C3WA 2GBAA 1KTBA 5IJVA 1KBBA 1KB9K 1OXYA 1IBBA 1WICA 5E1IA 4NM8H 4WCYL 2HJFB 3NDZE 4KK6C 3ILPA 3OKEB 4KI5F 4N0UA 1BD2E 3HI5L 1G43A 1VFMA 3LKQB 4E5XB 2A0LC 5DJYB 2OTWA 1E3XA 4UT9H 5AOKA 5IQ7H 2V2WB 5DRXB 5FUCC 1A7NL 3HMWL 4RISL 5FUZL 1MHPH 4ZUUB 3FF7A 1AD0A 1IARB 2N0KA 5HYFA 1JDDA 2JJTA 5JZ7D 2NNAA 3ELQA 4MBOA 5GSRA 1T83C 1I9IL 4HC1L 4JMXA 3IJHB 2H9GA 3HZVB 4HD9A 4OZGB 4P3WA 1ZXKA 1FZJB 3EGXA 1JHKL 3V4PL 2E7LC 3VXME 2HVBA 4F8OA 1UWFA 2R29A 4KVNH 1T4KA 3O4LB 4LZKA 4UU9B 4XVTH 3KLAA 5DMIL 1FYTA 2WXPA 2XPGA 4ICWA 4G1MA 5ID0A 3Q44A 2HRLA 2A5UA 1OP9A 2A9NL 1D2OA 4OZFG 3S36H 1GCFA 4J23A 4ZQKB 5DEFA 3LAFA 4RQQB 5I73C 3CBRA 5IESL 1E7UA 4MKTA 5BOZG 5IHUH 4KZDH 3MROA 1JRHH 3SE4A 3LN9A 2WN3A 1DE4A 1GPOH 1LWHA 2EDOA 4M7LH 2K4AA 5GIRA 5HI5D 4DUWA 4Z3HA 3U9UB 2AJ3A 1MCCA 1UKTA 3PJSB 3GINA 3REVA 3Q0HA 2TSAA 4J1UB 5EBMA 5C8JB 3TEZA 3VU2A 9CGTA 4F15C 2JI2A 2XZQL 2FEEI 5IT2H 3EYSH 3BP4B 2OL3B 2IDFA 2YXMA 2XNAB 4OUUB 3SE9H 4L05A 4CC4A 1OF0A 1UD8A 4A63A 2KZKA 1TXKA 3MBEC 3QUXD 1IIKA 1OAZH 3EH2A 3BGMB 4XBGB 1EAJA 3QPQD 5HGBA 4R3SA 2Z3FA 4NCC2 5E6IA 3G9VA 2GY7B 2DZEA 5EH1A 1QLEL 4MDIB 4EDXA 4CKQA 1CFTB 1RUQH 3CFNA 4HOWA 1U3ZA 1NJ9B 4JQIH 2FH6A 1SVCP 3T0BA 4HMEA 1FAIH 3I6SA 1FGVH 1FCCA 2F8OA 1A0QH 2IAAC 2Z31C 3I74A 4Y1SA 3ROLB 4N1CA 4D9QE 1TEFA 1WF5A 4XB3A 4Z0XB 1HEHC 4K5NA 2HFTA 2CA4A 1OD9A 5D1XC 3TEYA 3L54A 3F12A 1EDHA 2BOBA 5IBTL 4BSJA 5E9AA 1A5FL 3KWTA 1BEXA 1DBAH 4N22A 4UQ3B 5T1LB 1KIQA 1LD9B 3LXBA 4LQFL 3V4VA 5L4FA 1OWWA 1T2QL 4QRAA 4P5TB 4ZS6C 3RWFA 4YSUA 4JS7A 3GM0A 3WKQA 2PTTA 2DBLH 3GS7A 4AT6A 1RZJH 1X5HA 3BQUC 3KNBA 4HIEA 4YXKH 1ECZA 1RY7B 5DVKA 5EU3A 3ULUD 2YOAA 5DC0A 1OCZB 3ISWA 4Y5VB 2PO6B 3V7AG 1CGXA 3UYPA 2D4DA 1DLFH 4HJGA 4QXUH 3FAXA 3FU3A 4NO5A 5CS7A 4XC3L 4E41E 2V9QA 1JUFB 2AHIA 2HFFA 2ZOUA 4JE4B 4NKIL 3WD5L 4ZUTA 5T3ZL 1X9QA 3L1OL 3A4EA 5IB4A 3HRZB 4GI8A 3MYJA 1ZVNA 2YSSB 4K3DL 1N5YL 2O5XL 2WKLA 3CMGA 5LKNA 3TVMD 3FQTB 2R1YB 1TQBC 4A2GA 2VIRA 3DGDA 1MFEH 1Q94B 2V7HB 4RISH 3HMWH 5FUZH 1JZ8A 2CO1A 3G5VB 2R2EA 4IBSA 2C9UA 3P4OB 5T1DL 1KYUA 1WC7B 4GIPD 3NJNA 4IBVA 4OW6A 3AREA 2ZG1A 4HC1H 5SX5H 3WJJA 1JHKH 1QI5A 1SXCA 2FWOA 3QHZL 3ARGB 4XI5D 3WAJA 3BUDA 1TZGL 2R56H 3DMMD 1KC5H 1CL7I 2KMWA 2Q7AA 2Q3AA 5SX4H 3KPSA 1F90H 1IBDA 3EH1A 3O41A 1OARH 3Q43A 4LIQE 1JPSL 1HHJA 2E9BA 1Z1WA 3D4CA 1GW6A 4M02A 3TZVD 1OP3K 3WFEL 3KZ8A 4Q6IC 5HI3D 4DWHA 2R69L 1UT1A 3AQDA 2A9NH 3QIWD 2AS5M 5GQBA 4WTZG 4WENB 1YEWA 2NPLX 3QZNA 3C8KB 5B3JF 2MHAB 3SBWC 2YWYA 3MLXL 4BUGA 3FUNA 1V5JA 2BMKB 4OKVB 2EDEA 3QISA 4QXGL 4RMTA 5AOZA 5H94A 1F86A 3G3LA 4LSUL 5T5NG 5IB1B 3JV4B 4ZMXA 5DD5L 3A23A 2VDQL 1EZLA 3FQWB 3L3IA 4N2KA 3QWRA 5IZ7A 4W9LC 2XVBA 4X6CA 2G0KA 3KCPA 3L7EB 5GGQL 1QNIA 4KJPC 3GMNB 4PBDA 3FT1A 1K6QL 5DZPA 2FT6A 1JL8A 1IMHC 2G75A 3H42H 4D3CL 3L5JA 3DJRA 3WIHA 1XH1A 4I5BA 4DJMA 3W38A 2NY4D 5DZOA 5KW9L 3INUL 1YC8A 4GB9A 4NKMB 1BQLL 4KKBC 3P1VA 4B9CA 3H9HA 1OTTC 4L5FL 5C3IA 3QAZB 2P7TA 4PIRF 4GMSL 2DQMA 5IW6A 3QC5X 1DDHA 2WVSA 4FNQA 1T5WA 2AVGA 4UUJB 2GUYA 4GUPB 1HH6A 1DL7L 4M62H 4PRAA 1CZ8L 2XTSA 2P5ED 2X4TB 2WMPB 4IU2B 4L1LA 4Z76A 4J27A 2X4UB 3MLSL 1FC1A 2Q8AH 4MAZA 4DCQA 1A5FH 3JV6A 5AOIA 5CKAA 4NQXB 2D2OA 4PJHB 1T2QH 5CEYB 4F37F 2LV4A 2O1AA 5KVGE 5IVXE 3VI4B 4DEPB 5I1AB 3PWLA 2FHCA 2PW2B 4N8PA 4OM0L 3E7JA 2GT9B 1JNLL 5B1BB 3WMPA 4HEMA 3N1GC 1VERA 3C6LD 3B9KB 4TQHA 5JHDA 4J2XA 4Z7QE 3ECQA 3U46A 3US1A 2J8UA 2QADC 4G11A 4E68A 3BT2L 3DXAB 4CGTA 3L17A 1OM3L 3OHXA 1EJFA 5H2BB 5HYSB 2GTZB 2CR0A 1A2YA 4XC3H 3W9EA 1AGCB 5EG6C 3WD5H 3ECVA 2IC2A 3O3UN 1RZFH 2RA1A 1FO0H 2WPGA 4NPYB 3GXFA 2GITB 4YUEH 4AMXA 5JHLH 3RX5A 1N5YH 2O5XH 2YGNA 3A67H 4PRPB 2HT3D 1P7BA 2EXTA 3EGSA 4BINA 1CBVL 1QLRB 3FO1A 2RBLA 5LDUA 1UWYA 1MKFA 2X2JA 4M93B 3BDYL 4EI5A 3SQBA 1LDSA 1SY6H 3LD8C 2AMGA 4MAYB 4PR5B 4XX1E 5IFHH 5BV7L 25C8L 4H1LG 4CW1B 3GXIA 2P42B 1BVKB 2H3NB 1O9WA 2YKKA 5DS8A 2FWLB 4PWFA 3B83A 5G55A 5ENWB 3QHZH 2F1EA 4JGMA 3MACL 1AQ8A 1TZGH 4MJ2A 4WEBH 1I9RH 4WWKC 1S9XB 1ZE3C 3CDYA 3M8OL 3WFEH 2X6BA 1B4LA 1OK8A 1Z66A 2Q1EA 4D8OA 1TOXA 4B5EA 2EDKA 3LKPA 3K6OA 2YEZB 3HUJF 1A1MA 4G43A 3WEXB 1MAML 3OLEA 3T0EC 1QR4A 4ZSOE 1V3KA 1U92A 3P0GB 3QC6X 4HV8A 1D5IL 4ALAC 1I8AA 2FO4B 3CZLA 4MWFA 5I71B 2WGXA 3P2BA 4HIJA 5CCJA 3HAEA 3MLXH 2BW5A 1E4KA 4NUJB 3IWUA 2NXYC 3MO1B 4K7PH 4QXGH 4X0NA 3KWXA 4U1LA 5I1LA 4LSUH 4PRBB 5GS0L 1FA4A 2CJ3A 4HUMB 5DD5H 3IETA 2R0WL 3GS0A 2VDQH 2OULB 3JUYA 1NC2A 1TPXB 2Z4QA 1XMWA 3AB0B 4JPQA 3MTXA 2WXMA 3QUKB 5CJXC 2QLVB 3TWYA 5D6DC 2Z8RA 5C09A 5C0BE 3U0WL 2X3CA 1JPGA 1JTPA 2PUQT 3D1MC 4D3CH 1E43A 3EFDL 2VLRD 1Y18A 2VDPL 3PL6A 3C5ZB 4LAQL 1U3HC 2CNYA 4R5VA 1GJUA 2PPFA 3ZIYA 2NW2A 1JRHI 4GW4B 3REWA 1U8OB 1BFOA 4L5FH 5ERWA 3LMJL 4XCYA 5LHDA 4X5WA 3CG8A 4H2CA 3V8OA 4UQEA 4RAVB 2JWYA 3T65A 4AX3A 5LNDA 4YHIA 4B3EA 2WQXA 2WWNA 4Y88A 3FTWA 1DL7H 2ZPKL 2X88A 3GYRA 3QB7C 4HH8A 3PQYD 3ABGA 3ZE2F 1B4TA 1FCGA 3GHBL 1ETZB 4QHNB 2BP0A 2JCCF 3BZDA 5TQ2L 4OLXL 2WWKO 2J6EA 1LK3H 3MJ8A 4JLRA 1KCKA 1WQVT 2WBKA 2F5BH 1R5VA 4N5UA 5ANME 4YBQD 3NIDB 4OM0H 4WU7B 3WENA 1JNLH 3IF1B 3V5DA 2XTJC 2YUZA 4F80A 3JWDC 3LQZA 1NCDL 1UZ8B 5B3SB 3R8BB 3FTXA 3KPNB 2VW7A 2X4SA 4PMEA 3RHWF 4DQAA 3BT2H 4G6FD 3IM1A 3LKSB 1HJCA 5E99L 3RPKA 1KIUA 3C2AL 3SJVB 5E8NA 1FZOA 1DVFD 3OPUA 1WAAE 3VDCA 5CJ5A 5EU6D 1UZGA 2W9DL 4H25A 4K8RD 1ZT4A 4PJAF 5FV2A 4MMXC 5E5MB 5C07A 3HPJB 3FCGA 2FB4H 4W68A 4LSSH 2P5PA 3EXJA 5HHQA 3KG5A 4TQEH 3TN0A 3NSCA 2WAHA 4HMCA 1ZS2A 2GK0A 3VU1A 2N7BA 4O02B 1M7UA 2AGJL 3BDYH 4QGYA 3SDCC 4FJZA 5JO5B 5BV7H 25C8H 1UZ6F 4NRZB 4G7RB 1ORSA 4XNDA 4LHUD 2QVMA 1T22A 3U79A 3JV0A 4GY4A 1JNHA 2CQVA 2WLHA 3MACH 1XF1A 4O51B 4X6FB 5KAQG 4AVIA 2VN7A 4RZCB 3F7YA 1A8ZA 1VFAA 3NPSC 1DQQB 3NFNB 2WXLA 2CLVB 2O6PA 4WK0B 2D7TL 3FUDA 4LGSB 4Y7OC 3OAYK 3WI9A 4XBPA 1I1CA 2F54B 1XIWD 4G9DA 1LVEA 1R1CA 4K9EC 1IE5A 4LNRA 5FA4B 3MLYH 3QYMA 1KZQA 2AJZB 4DAGL 2BIIA 1KXTA 4QTFA 1D5BB 3KXFE 2CHNA 1L0YA 3P73B 4O5LH 3HA0A 4FG0A 3SY0B 2BY3A 1QTYT 1TEGA 2H32H 4E9WA 3U25A 1JHTA 2OW7A 3ZT6A 5GS0H 3TIEA 2EINB 1KYOJ 4JFEB 3UC0L 4P9HL 1TZOA 1GJIA 2G5UA 5DU7A 1ROCA 5EEXA 3LJ3A 5SX4I 5C6TH 3FO0L 5KZCB 1T1ZA 3U7YL 1KENL 2B8OT 3BAWA 3O2WL 4Y16A 4AGLA 1NFKA 3VWJD 1I8LC 4XXWC 3K6IA 5EO9A 2F15A 4AM0A 1YNTF 1UT9A 5IHLB 3BPLB 3WTUA 4MRBA 3CLWA 3SO3C 2WB7A 5ESQB 2LFGA 4N3UA 1KXVC 2IAMA 3G08A 4LSVL 2XN9D 4NUMA 4P4RA 3H7BA 4PCKA 2CBPA 5H37A 4H0GA 2FX9L 2I85A 4JFSA 3S37L 3ZTEA 3VFVB 5HGGS 3OXRA 3FCTA 2UUDK 4QRPE 1MHCA 4B9KC 1G7JA 4QXTB 2P28B 2GCYB 4XPTH 1PU0A 3IAGC 4F8TA 1OTUD 2ZPKH 2O5ZH 3V6ZB 3KM2A 4E0RB 4ZFGL 5DFVC 2DWDB 5TQ2H 2PCFA 3Q7JA 4OLXH 3MOBL 4MA8L 3UTSB 3WY3A 3GI9H 1VGKB 3QS3A 5IW1B 4BSVB 4M6MH 5KS9B 1PGRB 2X41A 4TUUA 1QSVA 1KT2A 2IH8A 4YDVB 1HEZA 4XVUD 3BSZA 2ZD0A 4XR8C 3MREA 2Y07H 5F8QC 4N0FB 1MHEA 4OY9A 4N24A 2ROXA 3C2AH 1ZTXE 2MQCA 3LPOA 4XP5L 1O9VA 3HHMA 4BFEA 4HJEA 2W9DH 3ZJAA 1G5GA 4LKXB 4ZTEA 3GHPA 2Y36H 4N0RA 1AP2B 2OMYB 3VXSD 3CDZA 1F56A 1WUZA 2CPCA 1G6VK 3S5LB 4OCSL 2JKRM 2NYKA 2ZONA 3B7RL 3ZDXB 2AGJH 2OZNA 4IMKA 5F2FA 5IFJB 3K6SB 3VXUB 1XZ0A 2WLKA 5KJRL 1LXMA 3D69A 4R90L 3GBEA 4Q58C 3RILA 2H41A 1ZHBA 4WW1A 2P80A 3ZDYE 4H26A 5GRZA 2W0KA 3VD4A 4OF6A 2XRAL 5D1ZC 1LMKA 1A6TA 1YMHA 1R47A 1DQKA 1HI6A 5IVOA 5IQ9B 4E9SA 2D7TH 2CHZA 4TLTA 3UTTE 4W9KC 4OD2A 1VAHA 2ZUVA 1MFMA 1WAPA 2GPZA 2AI0L 2KKQA 3IKCA 3V4LA 3D0AA 1DO6A 3M07A 1KB5B 4OLZL 4ZK8A 2Y2WA 4BGDA 3VD3A 2YD4A 4XCEA 3W5MA 2QZ5A 3TH4T 2HLEB 2PN5A 1AR1D 3D5OF 5CEZL 2L4OA 1RI8A 4F2EA 3WDJA 3N1FC 3UC0H 4P9HH 3V4UH 3VXRD 4M5ZH 4ZW6A 2Q7YB 3VYPA 3Q2VA 3GO1L 3NJGA 1QSZA 2J88H 2LU3A 4JRYD 4NYLA 4P3DA 1KENH 5IREA 2CU9A 4NNPL 4XWGL 2ZP8A 4GG6F 2WYIA 1H8LA 1ZV9A 3IPBA 4LOUC 3FDWA 4F9LA 2CO7A 2H7WA 2ESVD 4PJBB 4AK1A 1E5CA 3RY5A 4X9YA 2IADB 2HJFA 2MPAL 2XT1B 4X6DE 4KXDA 1A22B 2VR5A 1E8WA 1ZHLB 2V0AA 1UTDA 2PXYC 3OKEA 4LSVH 1PKOA 3F6IA 2FIRT 4E5XA 1BMZA 1GC1C 3NDYE 1VESA 3D08A 4IIZA 4UIMB 3RY4A 3POHA 4RH4A 2V2WA 1GYWA 1AZUA 2J73A 3FKUS 4XPBH 4XWOD 5DRXA 4NO2A 4ZUUA 1NGWA 1CLYL 1RJZB 3W3BA 3QNZB 4LASL 4PGJA 1MIML 5I74B 3S4SB 3AY4C 5ALCL 2CIKB 3IJHA 5LQBL 1B6UA 2FATL 3RGVD 4DNLA 3ULVD 1JXGA 3RYMA 2HWZH 3A4FA 4HWBA 3QEQE 5FM5M 4YSSA 2Y3AA 5JZ7C 3DVFA 4ZFGH 3O4LA 4Q97A 4LCWE 3PF2A 5DVLA 4X80H 3FO2B 4MA8H 3PXLA 4C58B 1H9DA 4LLWB 1YPZE 3BJ91 4HH9B 4U6VL 3SDXB 2FNWA 3QXAA 4APQC 3LRMA 5D8JH 1L7IL 4LEOB 1V55B 5AD0A 4ZQKA 3FB8B 2DDQH 5HJ3B 4H0HB 4ZXBB 2F19H 5J12B 3UAJC 4RQQA 1K9TA 4FHKA 1WFUA 3SGKC 1O6SA 2GYSA 4QHLB 4CDGC 1BZ7B 3FU0A 1J9SA 2TRYA 1PZUB 1L9PA 4TSCL 4H8WL 2VLJB 1A9BB 1QQDB 1I8MB 1U8LB 4Q9QH 5FV1L 3RDTB 4FQQB 4YL4A 3PJSA 2EDFA 2Z7ZA 3TJPA 4J1UA 1MFNA 5C8JA 5F3BB 2Y2TA 3HZYA 4HCRA 3C5XA 4QD2E 4PRID 5EU7E 4CVXB 4PRHB 4Y5XB 3BP4A 1H3TA 4FXLA 4BK4A 2OL3A 4TMPA 2VZSA 2XNAA 3CU7A 1NBYB 5HYIA 1EO5A 5F0MB 2Q6WB 3X12A 2JH2A 4AXWB 1YVLA 1AKJA 3BGMA 4GO8A 1N6QL 4PB9L 1UACL 5MEQB 5HI4D 1F4XL 3PHSA 3FUKA 3GXTA 1TQSA 5KJRH 2R51A 2A9AA 3L9BA 5DK2B 3TO4C 4KITB 3QPQC 1BD2B 4XCNA 4EN3A 3V5KA 4D0BA 2XRAH 3ASWA 1IEAB 1RPUA 1FVCB 4M7JH 4Z7IA 3STLB 5C08D 2O26U 3QIUB 2XIBA 5AKVA 4I77L 1JD9A 1J8RA 3IDYC 3G5WA 1DJWA 4ZMWA 4UQ3A 3T8XA 4OLZH 1LD9A 3VXMB 3MNZA 5CSGA 2ZOKB 4J3XA 1GYVA 4LSQH 3L9RB 1UFGA 4P5TA 5DVMA 3NSYA 4Y4HB 3TA3D 4AQOA 1B2WH 1NM4A 3LN4B 2V2XB 5GRYA 4BFIB 4L9LA 4HKBA 3AXHA 3Q9QA 5DHEA 4Y5VA 2PO6A 2XWEA 3UTOA 2VC2B 4BD4A 2WYHA 3HKFA 1NUGA 2BVEA 4FKKA 4ELME 1JUFA 1BWMA 4K2UH 5ELIA 4M6OL 4KKAD 3L4ZA 4RMUA 4HK0A 1XCTA 2XWCA 4L4VE 2MPAH 3RVUC 3D39A 1QSEE 2YSSA 3E9TA 4WGKA 4MJ6B 3QQ9C 4JM2B 5F6HI 2WCSA 1IBHA 5JW3L 3FQTA 4AQ1B 1MVYA 5FYKD 1XXFC 3T6VA 1EA9C 1Q94A 4FQCL 1PG7W 2V7HA 1HHGB 2UVFA 1MW3A 3G5VA 4FXGC 3VWKD 5B8CC 1HVXA 3ARBB 3PV6B 4XXCA 3TVMC 1AOZA 1WC7A 4UOZA 4LASH 4KMTL 4KTYA 4MQXD 3QZPA 3JZ7A 4YE0A 1KGWA 3HHRB 3VFTB 3ARGA 4ENED 1TQVA 2WZ0A 3ULUF 5CU5A 1JZ4A 2IALB 5HDQH 1YO4A 4WJ5B 3QJHB 1T7YA 5E95B 4PY7B 4XI5C 3KBPA 3DMMC 3DWTA 1ED3B 1CF8L 4S1RH 1MLCB 1L7IH 2QT6A 3MXWH 4M5YL 1PIGA 2OCJA 5F1NB 3NIFE 2DIBA 4I18C 3C8KA 3VRLE 1LE9B 2MHAA 3ABKB 2JJSC 3QIWC 2DYPB 2BMKA 4YPGB 3HS0B 1LQBC 4OKVA 3SKNA 5DD1L 5CCKH 5C9JB 1Y1UA 3UEQA 4EEEA 2XCMC 3CFKB 4QCIA 1CR9L 1X5AA 4Z1PA 3FCUB 1YZZA 3ARUA 2OP4L 4NN6B 3QARA 1R3HB 4G9FD 2AV7A 4EBQH 2IV8A 5GGSA 2NY5L 2P8PB 3GMNA 5L9DH 4BQ9A 5C0IB 1X7QB 1EJ8A 4X2UA 4B0MM 2ATAA 4KK9D 1JE6A 2B4CL 2EZ0D 4ABUA 4E41B 1N6QH 1UACH 4WO4D 2WK2A 1CU4L 2JK5B 4F58L 4PJFF 2NRDA 2NY4C 1M4KA 4P0DA 3IU4H 4L0YA 1AHMA 3OKDB 2PYEE 2WXFA 1DVTA 3N41B 5BZWB 4NZUH 2A3TA 3QS2A 3O6ML 1U4FA 1YEFL 2KZBA 1XV8A 1UA6L 2AP2A 5H4YA 5LWYH 3UGUA 3ULUL 1TTUA 1QI3A 2V33A 4P2OB 2ERJB 3CFBB 2WMPA 1P7QB 4KKLD 4I77H 2NZ9C 3HI6L 4XP6L 5F72S 2CLRB 3B6SB 4R6UA 2DJSA 1ZVHA 3RWJB 5KBPA 5LG6A 4NQXA 3BXNB 1MW1A 2PCXA 4PJHA 3QDMA 5CEYA 5I0YA 4JZNB 4GAFB 5K9QI 3VI4A 3ESNA 5I1AA 2PW2A 1LE5A 1G7IB 5DLLA 4JL1A 4N2EA 2GT9A 1A7QL 3H9SE 2NTFB 2HKFH 3TP4A 5K5YA 3VRIB 5I17B 3B9KA 4OI9A 5CIPB 1GIGH 1MVUB 4W9DC 4HS6B 2VLKE 4HSCX 5JMRA 4OJEH 3WEMA 4FG2A 3DXAA 4E2OA 2K9FB 4OUOA 5MP6L 5TDPB 3C6LC 1KJVA 5H2BA 1L0PA 2GTZA 3BLBA 3T5WA 1AGCA 1OAXL 2E6JA 2O61B 4P99A 2G9HB 4KI5E 3ZKSD 4IOFD 1ZPUA 1IUZA 3FQNA 2ITDB 1EX0A 4NXSA 3FQRA 1SN0A 4FRWA 1IGJA 4HHGA 4NHUB 4PJ7A 2CBMA 4OLUL 3ZTDC 1DZ0A 1QLRA 5IHZB 2H6UA 5JW3H 3RTQC 5MI0C 5KG9A 1OAUH 4LHUG 2YQ3A 2Q2EB 4FQCH 4YBLC 5ILTL 5L2KD 3G5ZB 2KLRA 4MAYA 4G80B 1J5OL 1IQWL 4R4BB 4CW1A 3Q6GH 4N0CD 3WUWB 3VFPA 4GAJL 4BHUI 4UTBA 5ENWA 1EHNA 1DUYA 1NDMB 4ERSL 1WBZB 3ATFA 2XWTB 4JDZA 3N0PB 2YKLL 1UXSB 2DQEL 2OMTB 4HU8A 2WQUA 4WHTB 2EYSB 2D03H 5FM5O 1UJ3C 1ACXA 1ZK9A 3U0PB 3KJ4C 1AZVA 4NKQB 5HHVL 3GNMH 5FUCE 4FLQA 4XGZB 3WEXA 4YSPA 2I69A 4QTIL 1UM4L 2CBQA 1G6RB 3MV9D 3EH3B 4UM8B 1ZA3B 2FO4A 1AGBB 1UKSA 4ZMZA 3QJQB 2X6AA 2XWJA 2C3HA 3MO1A 3C8DA 2FHFA 2VAAB 4N2NA 2NX5D 3MVSA 4KUZH 5JDSA 2A77H 4PRBA 1XGRB 5KUMA 4JFHD 4BZ1L 1IIIA 4J4PC 2OP4H 1U42A 4MA1B 4BIKA 5D1QD 2AJUL 1UWGL 5E1QA 1CXKA 3QUKA 5AZUA 1U93B 2NY5H 2YUWA 5EEUA 1OCWH 2VXQA 4HP5A 3ROOB 3ARVA 3SD5A 1AOHA 3FT2B 1D9KC 2B9BA 5DTFB 3MX0B 2YAEA 3HZKB 4AYGA 5HHNB 1MG2C 3W81A 4H5SB 2MKLC 1KFAH 4NO0D 4F7PB 1JI2A 3DPBA 4X99B 1YDPB 1KSRA 4ODUB 5HTSA 3VI3B 4C4BA 1AI1L 4F58H 5CILL 4CMHB 1RIUL 1FVEB 2VDOB 4GIAA 3WOVA 4OFQA 2X9WA 4GW4A 2MRYA 3M7FB 3CXHJ 5L88L 1J10A 2W0FB 4PRNB 1XWVA 5I9QC 5J5EA 4H8HA 5I6XC 2FJFA 2VUKA 3K71B 4RAVA 5FDWB 3KR3L 3V4PA 1YEFH 5JW4M 4NQCD 3H6JA 1UA6H 3WL9B 3ULUH 3V55A 1EXUB 2O93L 2XQBL 3F64A 4N2DA 4IJTA 1CO1A 4FXKB 1P4LA 4QHNA 3HC3L 4PQXA 4XP6H 5JYLA 1VEPA 3S34L 4DGUA 3O9WA 3HR5B 3QEHB 4GP4B 3F8UB 1BM3L 2JV6A 2UZPA 3JTBA 5HP5A 4CL7A 2A6KB 1S3KL 3D2UD 5I76B 4Z3GA 1L9TA 2VJ0A 3T77B 1BBDL 1NIDA 5DFWH 4XMXA 2LHAA 2RD0A 3VGAB 1YUHA 4WU7A 5GISL 3IF1A 4WUUA 3TTSA 5L8KB 1DBML 4YBQC 1WYJA 4BQBA 3KPNA 1GGBH 1EFQA 3MRRB 3LY6A 4FX5A 1XD0A 3IDMB 2DI8A 4MNGB 2BP8A 3HE6B 5K93A 3T3MF 2YPLE 1Z7JA 1PG7H 4Q14A 2OW6A 2BNUA 3HPJA 2XV3A 4XP4L 1AHWB 4KXAA 4AG4L 4OJCA 1W9XA 5BQDA 1IKNC 1YY8A 1F58L 4GI9A 4KRPB 3BUPA 4K8RC 5CWSA 5AAMA 4L5FE 4UOW1 4KO5A 5DZLA 2TSBA 3P9LA 1NBVL 1ODAA 4IBZA 3DA0A 3TNNA 2ICEC 1PZ5B 5B38G 5ILTH 4P5SA 4D0DB 1RVFH 3MRFA 5AB2A 5JO5A 1J5OH 1IQWH 2EIMB 4J28A 3ZYJA 3NJFA 2NY2C 4GAJH 5D7KD 3NFSH 1M2OA 3RVWC 5GGRB 3HVNA 1YSOA 4AZUA 2NNFA 1F13A 5AVSB 1IC0A 2NY3D 4X6FA 1MJ8L 3WKYA 1BXUA 3ZSTA 1ZPLA 2JIXB 4PCSA 4RZCA 1JOIA 4NQEA 5AL0A 2GHZA 4RIRA 5HHVH 3SDDB 4PJEF 2WQ8A 5D2LF 2SEBB 1N0LB 3O8XA 3GEWB 4FNPA 4KKZA 2VDRH 2F8IA 4J39A 5FA4A 2AMUA 3K6NA 3CXDL 2JXMB 2BC4A 2VW6A 3DUSA 1CG9B 4XN8A 1DYZA 4UQDA 2OX5A 3NZ8B 3P73A 4X7FC 4PJ8D 3IJYB 3SY0A 1XIWC 5TPWH 1NGYB 4WK4B 1FRGH 1SPDA 2BRQA 4MCZA 4JHUA 2WZPA 4Z7VA 3FBQA 4JFEA 1N6UA 2YD7A 4BZ1H 1WFJA 1EEZB 2V5YA 4GPVA 1MFAL 2D7OA 1UWGH 2NDGA 3DV6B 3OMNB 1DANT 4MJ4A 1EEYA 2E9JA 2NY6B 3W39B 4QJ3B 1LQSR 2VZVA 1PTZA 3ABZA 4FQPA 2AERT 4CU7A 2JKJA 3FHEA 1QA9B 3SPJA 5CZKA 4OV5B 3JTTA 4G8GE 2APBA 3VWJC 1A1OB 4H0LC 3ERXA 4UT7L 1DSWA 2OZ4L 4Q2ZB 1AI1H 3CFDB 1NCGA 4LPYA 2F18A 3JYCA 3D87B 5L88H 2AEPL 4E9TA 1QBLL 2LU7A 2XBZA 4A1RA 5LO7A 3MRPA 1EZUA 1NGQL 3SKJL 1UWXH 3ARFA 5A3ID 5D1ZI 4DERA 3BCDA 2EDRA 3KR3H 3QEUB 3AS3A 4QXTA 2L7UA 4ELKB 2DQ6A 2GCYA 3LZFL 2VH5H 4GRLD 4PAZA 2BP5M 2AJVL 3MLVL 4DFHA 1ZLSH 1J9RA 2XI9A 1P9MC 4U0RC 4E0RA 5C2BL 4PJIF 1YEJL 1MRCL 2DWDA 2R69A 2WP3O 4KJQC 4LSRL 5DEJA 5K1JA 3S34H 2NYZA 3TPKA 5C3LD 1R3IL 3WXWL 3W0WD 3P4NB 3SCMD 5DJ6B 4CAGA 1BM3H 3IDXH 3VFRB 4RMBA 2WBJD 2FEDD 3H85A 3HFML 4PWIA 1BBDH 5IW1A 5CJQH 2HFGH 2FUQA 1HTYA 3DVIA 2HLFD 2ZAIA 4YDVA 5FECB 1RLWA 2B39A 5T1KD 4FZ8L 1JPFA 3G6JB 1DBMH 2RAMA 7TAAA 3CFTA 3GBDA 1ID2A 3BAYA 5J7CC 5DJDB 5D2NB 4XVUC 3KXFB 1DHKA 4MMZA 4L3ED 4U7MA 5I5JA 3BAXA 3CX2A 3SY6A 4Q7DA 1CLVA 4N20A 1H3PL 3IJSA 3V5HB 4FFVD 1JI1A 2XX1A 4LKXA 1AP2A 3ARDB 3BKCL 3GFUA 3HW7A 2MFNA 3T0VA 4X4ME 5I75C 5G2NA 1A3QA 1F58H 3DOSB 1JTTA 3OPZH 5IK3B 5SWQB 3IGLA 3VXTB 1AXIB 1NBVH 2YFOA 3CN2A 3CHOA 4P57A 3U6XA 2WZ5A 1DFXA 5I1KL 2XDHA 1HH9A 3V0HA 4HQQL 1YQ2A 5IFJA 3NP4A 1JXFA 3WCYA 2BSSA 1SXNA 2HLAB 4HPHA 3K6SA 4L8DB 4LPCA 3E38A 2OQJB 3MRBB 4MSWA 1UA3A 2K45A 3GHEL 4I2XB 3K0YA 4AQ8A 5F6IB 1MJ8H 1A7BA 1QO3B 2H1PH 2WUCL 2WQWA 3HUJE 5BZDA 2TAAA 5IQ9A 3O3AA 1ZT1B 3VM7A 1S7VB 1EUUA 4WHCA 3EO0B 2NXZB 3WUZA 3L2LA 3ZTCC 1HNFA 3RI5F 1AG0A 4ZJ9A 3QI9D 2CKBL 1GSKA 1RUMH 1KB5A 2XACC 2FT8A 5T33L 1MCFA 2VDKL 5JXEC 4ZD3L 3OMIB 3HN5A 4AJ0A 1A3ZA 1ZWIB 2QSQA 4MNHB 4R7DB 1AZBA 1ESOA 5FGBA 1UM5L 3K2UH 3U0TB 3GRWA 2WXGA 1P7KB 3C60B 3S35X 1TNMA 2GBUA 2LLLA 3QDGB 3S2AA 1AR1C 3ARQA 3N04A 1ILSA 1HILA 4HS3B 5C0AE 3HG1B 5AENA 2KC0A 5FM4A 5C92A 4XMKL 4NN7C 5IF0B 1NEUA 5AWNH 3IDUA 4PJBA 2IADA 3TBWA 2C9XA 3VG0H 1LO4H 2RQ8A 1ZHLA 4JY4B 4KO7A 4LNVA 2OZ4H 3UDWC 3HPLB 3AADB 3ZO0A 2QR0A 5BMFL 3DPDA 3IFNL 3Q2LA 3BRDA 5DMJB 2AEPH 1BQ5A 3OKYA 1QBLH 5J3HC 5MEND 4IBWA 1IEBA 2RALA 4ZOCA 1NGQH 3SKJH 3THML 2F68X 1RJZA 1I8KA 5EZPA 3ZE2E 4RGND 1MCLA 5BRPA 4PHZA 2CIKA 4NENA 3FO9B 3MLVH 2Y25A 3WJLA 3QW9A 1D6VH 4IRSD 4NGHH 4YVUA 5EF0A 4O2EB 2UY6B 3QCUL 1MRCH 2BOCB 4LSRH 4YSDA 4MNQE 1VPOH 3IPEA