2Z7XB

Crystal structure of the tlr1-tlr2 heterodimer induced by binding of a tri-acylated lipopeptide
Total Genus 167
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
167
sequence length
520
structure length
520
Chain Sequence
SEFLVDRSKNGLIHVPKDLSQKTTILNISQNYISELWTSDILSLSKLRILIISHNRIQYLDISVFKFNQELEYLDLSHNKLVKISCHPTVNLKHLDLSFNAFDALPICKEFGNMSQLKFLGLSTTHLEKSSVLPIAHLNISKVLLVLGETYGEKEDPEGLQDFNTESLHIVFPTNKEFHFILDVSVKTVANLELSNIKCVLEDNKCSYFLSILAKLQTNPKLSNLTLNNIETTWNSFIRILQLVWHTTVWYFSISNVKLQGQLDFRDFDYSGTSLKALSIHQVVSDVFGFPQSYIYEIFSNMNIKNFTVSGTRMVHMLCPSKISPFLHLDFSNNLLTDTVFENCGHLTELETLILQMNQLKELSKIAEMTTQMKSLQQLDISQNSVSYDEKKGDCSWTKSLLSLNMSSNILTDTIFRCLPPRIKVLDLHSNKIKSIPKQVVKLEALQELNVASNQLKSVPDGIFDRLTSLQKIWLHTNPWDCSCPRIDYLSRWLNKNSQKEQGSAKCSGSGKPVRSIICP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Toll-like receptor 2, Variable lymphocyte receptor B
publication title Crystal Structure of the TLR1-TLR2 Heterodimer Induced by Binding of a Tri-Acylated Lipopeptide
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 167
structure length 520
sequence length 520
ec nomenclature
pdb deposition date 2007-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13855 LRR_8 Leucine rich repeat
B PF13855 LRR_8 Leucine rich repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 2z7xB00
2P1OB 4FCGA 4Z8GA 4J4LA 2IFGA 4OQTA 2Z81A 3E4GA 2CA6A 5IJDA 2Z64A 1FT8A 3ZYOA 5GMGA 3SB4A 1KOOA 2O6RA 3VQ1A 1M0ZA 1OZNA 5HZLB 3WPIA 4KXFB 3O53A 2P1PB 4Y61B 5AWAA 3RGZA 4G8AA 3M18A 4FD0A 4FS7A 4R6FA 3OGMB 2OMVA 4V2DA 2O6SA 1OTOA 4Q3IA 3P72A 4BSSA 3ZYJA 3W3NA 4LSXA 4IM6A 1G9UA 4M7EA 4R6JA 4KT1A 3C6OB 4K17A 2JQDA 4NKHA 4V2CA 4C2AB 4V2EA 5GMHA 4L3FA 5A5CA 5AZ5A 3CIGA 1H6TA 4C2BB 2Z62A 1A4YA 4R6AA 1OGQA 4BV4R 4WYKA 3W3JA 3OJAB 2A0ZA 2OMXA 1JL5A 3UN9A 1XKUA 4LXSA 4ARNA 3G3AA 4CC4C 3RW7A 1XWDC 1U0ND 3OGKB 2WQUA 2Y5QA 2JE1A 2Z7XA 4LI1A 2O6QA 4ECNA 1FQVA 2RA8A 3VQ2A 1O6TA 1IO0A 1DCEA 1SQ0B 4MN8B 4Z94G 4NKGA 3C6PB 3RW6A 4XGOA 3UL9A 1O6SA 3E6JA 5GQRK 5CMNA 3UL8A 4GT6A 2Q4GW 4U06A 3W3MA 2OMWA 4LSCA 3WPGA 4UFRA 4FHOA 4XOSA 3RFEA 4R5CA 1YRGA 2P1MB 4LXRA 4H09A 2V9SA 1P8TA 3RFJA 4CC4A 4P8SA 4R6GA 2OMYA 1OTMA 3DZEA 4AW4A 5HDHA 2ELLA 2V70A 3CVRA 4Z64C 3W3GA 2OMTA 5B0NA 1M9LA 4LI2A 1M9SA 1H6UA 3PMHG 4PQ8A 4R5DA 3A79B 4CNMA 1K5DC 2RR6A 5AWDA 4BSRA 3W3KA 3WPDA 3W3LA 2UZXA 3WPEA 4CILA 2ASTB 3WN4A 4R07A 3OJAA 5IJBA 2BNHA 2ASSB 4RCWA 2XWTC 2Z65A 4TZHA 5AWCA 3GOZA 2R9UA 2WQXA 3C6NB 1P8VA 4U09A 4L3AA 5GS2B 3G04C 4QBZA 1O6VA 1XECA 3FXIA 1M10B 2OMZA 2JE0A 3KJ4A 4P91A 2XOTA 4CNCA 5IJCA 4U08A 5FTTB 3REZA 4PEQB 4B8CD 2WQWA 3BZ5A 4WP6A 4FMZA 1OOKG 3ZYNA 5LFNA 2Z82A 1ZIWA 2V9TB 2UZYA 1Z7XW 4R58A 3M19A 4FDWA 4YEBB 4XSQA 4ARRA 3WPBA 4ECOA 3G06A 4U7LA 5GS0A 4MQWX 3E3ZA 4Z79A 3G39A 4AY9X 4PKIG 4LSAA 3RGXA 1XCDA 4HQ1A 2Z63A 5CMPA 1KOHA 3RFSA 5D3IA 1LTXA 3WPCA 5GMFA 4R0AA 4EZGA 1PGVA 2OMUA 4I6JB 4QC0A 4Q62A 3E2JA 3UL7A 3JB9j 1DFJI 2Z66A 2P1NB 1FO1A 1GWBA 2WFHA 4PSJA 1FS2A 4RCAB 5B4PA 4Z61C 3RIZA 2FT3A 3CIYA 4RWTC 1DS9A 1A9NA 3ULUA 4CP6A 2WQVA 4J0MA 4Q3GA 2BEXA 3TSRE 2P1QB 1OTNA 3ZYIA 1QYYA 3ULAA 4LSXC 1P9AG 4R09A 1D0BA 2Z7XB 1K5GC 4QXEA 4M7EC 4BSUA 5AWBA 1XEUA 3O6NA 4R08A 5B0TA 3WPHA 1W8AA 5IYXC 3OGLB 2ID5A 1WWLA 3WPFA 3G3BA 4KNGA 3ULVA 4GLPA 3RJ0A 4PERA
chains in the Genus database with same CATH superfamily
2P1OB 4FCGA 4Z8GA 4J4LA 2IFGA 4OQTA 2Z81A 3E4GA 2CA6A 5IJDA 2Z64A 1FT8A 3ZYOA 5GMGA 3SB4A 1KOOA 2O6RA 3VQ1A 1M0ZA 1OZNA 5HZLB 3WPIA 4KXFB 3O53A 2P1PB 4Y61B 5AWAA 3RGZA 4G8AA 3M18A 4FD0A 4FS7A 4R6FA 3OGMB 2OMVA 4V2DA 2O6SA 1OTOA 4Q3IA 3P72A 4BSSA 3ZYJA 3W3NA 4LSXA 4IM6A 1G9UA 4M7EA 4R6JA 4KT1A 3C6OB 4K17A 2JQDA 4NKHA 4V2CA 4C2AB 4V2EA 5GMHA 4L3FA 5A5CA 5AZ5A 3CIGA 1H6TA 4C2BB 2Z62A 1A4YA 4R6AA 1OGQA 4BV4R 4WYKA 3W3JA 3OJAB 2A0ZA 4NZTM 2OMXA 1JL5A 3UN9A 1XKUA 4LXSA 4ARNA 3G3AA 4CC4C 3RW7A 1XWDC 1U0ND 3OGKB 2WQUA 2Y5QA 2JE1A 2Z7XA 4LI1A 2O6QA 4ECNA 1FQVA 2RA8A 3VQ2A 1O6TA 1IO0A 1DCEA 1SQ0B 4MN8B 4Z94G 4NKGA 3C6PB 3RW6A 4XGOA 3UL9A 1O6SA 3E6JA 5GQRK 5CMNA 3UL8A 4GT6A 2Q4GW 4U06A 3W3MA 2OMWA 4LSCA 3WPGA 4UFRA 4FHOA 4XOSA 3RFEA 4R5CA 1YRGA 2P1MB 4LXRA 4H09A 2V9SA 1P8TA 3RFJA 4CC4A 4P8SA 4R6GA 2OMYA 1OTMA 3DZEA 4AW4A 5HDHA 2ELLA 2V70A 3CVRA 4Z64C 3W3GA 2OMTA 5B0NA 1M9LA 4LI2A 1M9SA 4NZRM 1H6UA 3PMHG 4PQ8A 4R5DA 3A79B 4CNMA 1K5DC 2RR6A 5AWDA 4BSRA 3W3KA 3WPDA 3W3LA 2UZXA 3WPEA 4CILA 2ASTB 3WN4A 4R07A 3OJAA 5IJBA 2BNHA 2ASSB 4RCWA 2XWTC 2Z65A 4TZHA 5AWCA 3GOZA 2R9UA 2WQXA 3C6NB 1P8VA 4U09A 4L3AA 5GS2B 3G04C 4QBZA 1O6VA 1XECA 3FXIA 1M10B 2OMZA 2JE0A 3KJ4A 4P91A 2XOTA 4CNCA 5IJCA 4U08A 5FTTB 3REZA 4PEQB 4B8CD 2WQWA 3BZ5A 4WP6A 4FMZA 1OOKG 3ZYNA 5LFNA 2Z82A 1ZIWA 2V9TB 2UZYA 1Z7XW 4R58A 3M19A 4FDWA 4YEBB 4XSQA 4ARRA 3WPBA 4ECOA 3G06A 4U7LA 5GS0A 4MQWX 3E3ZA 4Z79A 3G39A 4AY9X 4PKIG 4LSAA 3RGXA 1XCDA 4HQ1A 2Z63A 5CMPA 1KOHA 3RFSA 5D3IA 1LTXA 3WPCA 5GMFA 4R0AA 4EZGA 1PGVA 2OMUA 4I6JB 4QC0A 4Q62A 3E2JA 3UL7A 3JB9j 1DFJI 2Z66A 2P1NB 1FO1A 1GWBA 2WFHA 4PSJA 1FS2A 4RCAB 5B4PA 4Z61C 3RIZA 2FT3A 3CIYA 4RWTC 1DS9A 1A9NA 3ULUA 4CP6A 2WQVA 4J0MA 4Q3GA 2BEXA 3TSRE 2P1QB 1OTNA 3ZYIA 1QYYA 3ULAA 4LSXC 1P9AG 4R09A 1D0BA 2Z7XB 1K5GC 4QXEA 4M7EC 4BSUA 5AWBA 1XEUA 3O6NA 4R08A 5B0TA 3WPHA 1W8AA 5IYXC 3OGLB 2ID5A 1WWLA 3WPFA 3G3BA 4KNGA 3ULVA 4GLPA 3RJ0A 4PERA
chains in the Genus database with same CATH topology
2P1OB 4FCGA 4Z8GA 4J4LA 2IFGA 4OQTA 2Z81A 3E4GA 2CA6A 5IJDA 2Z64A 1FT8A 3ZYOA 5GMGA 3SB4A 1KOOA 2O6RA 3VQ1A 1M0ZA 1OZNA 5HZLB 3WPIA 4KXFB 3O53A 2P1PB 4Y61B 5AWAA 3RGZA 4G8AA 3M18A 4FD0A 4FS7A 4R6FA 3OGMB 2OMVA 4V2DA 2O6SA 1OTOA 4Q3IA 3P72A 4BSSA 3ZYJA 3W3NA 4LSXA 4IM6A 1G9UA 4M7EA 4R6JA 4KT1A 3C6OB 4K17A 2JQDA 4NKHA 4V2CA 4C2AB 4V2EA 5GMHA 4L3FA 5A5CA 5AZ5A 3CIGA 1H6TA 4C2BB 2Z62A 1A4YA 4R6AA 1OGQA 4BV4R 4WYKA 3W3JA 3OJAB 2A0ZA 2OMXA 1JL5A 3UN9A 1XKUA 4LXSA 4ARNA 3G3AA 4CC4C 3RW7A 1XWDC 1U0ND 3OGKB 2WQUA 2Y5QA 2JE1A 2Z7XA 4LI1A 2O6QA 4ECNA 1FQVA 2RA8A 3VQ2A 1O6TA 1IO0A 1DCEA 1SQ0B 4MN8B 4Z94G 4NKGA 3C6PB 3RW6A 4XGOA 3UL9A 1O6SA 3E6JA 5GQRK 5CMNA 3UL8A 4GT6A 2Q4GW 4U06A 3W3MA 2OMWA 4LSCA 3WPGA 4UFRA 4FHOA 4XOSA 3RFEA 4R5CA 1YRGA 2P1MB 4LXRA 4H09A 2V9SA 1P8TA 3RFJA 4CC4A 4P8SA 4R6GA 2OMYA 1OTMA 3DZEA 4AW4A 5HDHA 2ELLA 2V70A 3CVRA 4Z64C 3W3GA 2OMTA 5B0NA 1M9LA 4LI2A 1M9SA 1H6UA 3PMHG 4PQ8A 4R5DA 3A79B 4CNMA 1K5DC 2RR6A 5AWDA 4BSRA 3W3KA 3WPDA 3W3LA 2UZXA 3WPEA 4CILA 2ASTB 3WN4A 4R07A 3OJAA 5IJBA 2BNHA 2ASSB 4RCWA 2XWTC 2Z65A 4TZHA 5AWCA 3GOZA 2R9UA 2WQXA 3C6NB 1P8VA 4U09A 4L3AA 5GS2B 3G04C 4QBZA 1O6VA 1XECA 3FXIA 1M10B 2OMZA 2JE0A 3KJ4A 4P91A 2XOTA 4CNCA 5IJCA 4U08A 5FTTB 3REZA 4PEQB 4B8CD 2WQWA 3BZ5A 4WP6A 4FMZA 1OOKG 3ZYNA 5LFNA 2Z82A 1ZIWA 2V9TB 2UZYA 1Z7XW 4R58A 3M19A 4FDWA 4YEBB 4XSQA 4ARRA 3WPBA 4ECOA 3G06A 4U7LA 5GS0A 4MQWX 3E3ZA 4Z79A 3G39A 4AY9X 4PKIG 4LSAA 3RGXA 1XCDA 4HQ1A 2Z63A 5CMPA 1KOHA 3RFSA 5D3IA 1LTXA 3WPCA 5GMFA 4R0AA 4EZGA 1PGVA 2OMUA 4I6JB 4QC0A 4Q62A 3E2JA 3UL7A 3JB9j 1DFJI 2Z66A 2P1NB 1FO1A 1GWBA 2WFHA 4PSJA 1FS2A 4RCAB 5B4PA 4Z61C 3RIZA 2FT3A 3CIYA 4RWTC 1DS9A 1A9NA 3ULUA 4CP6A 2WQVA 4J0MA 4Q3GA 2BEXA 3TSRE 2P1QB 1OTNA 3ZYIA 1QYYA 3ULAA 4LSXC 1P9AG 4R09A 1D0BA 2Z7XB 1K5GC 4QXEA 4M7EC 4BSUA 5AWBA 1XEUA 3O6NA 4R08A 5B0TA 3WPHA 1W8AA 5IYXC 3OGLB 2ID5A 1WWLA 3WPFA 3G3BA 4KNGA 3ULVA 4GLPA 3RJ0A 4PERA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P1O B;  4FCG A;  4Z8G A;  4J4L A;  2IFG A;  4OQT A;  2Z81 A;  3E4G A;  2CA6 A;  5IJD A;  2Z64 A;  1FT8 A;  3ZYO A;  5GMG A;  3SB4 A;  1KOO A;  2O6R A;  3VQ1 A;  1M0Z A;  1OZN A;  5HZL B;  3WPI A;  4KXF B;  3O53 A;  2P1P B;  4Y61 B;  5AWA A;  3RGZ A;  4G8A A;  3M18 A;  4FD0 A;  4FS7 A;  4R6F A;  3OGM B;  2OMV A;  4V2D A;  2O6S A;  1OTO A;  4Q3I A;  3P72 A;  4BSS A;  3ZYJ A;  3W3N A;  4LSX A;  4IM6 A;  1G9U A;  4M7E A;  4R6J A;  4KT1 A;  3C6O B;  4K17 A;  2JQD A;  4NKH A;  4V2C A;  4C2A B;  4V2E A;  5GMH A;  4L3F A;  5A5C A;  5AZ5 A;  3CIG A;  1H6T A;  4C2B B;  2Z62 A;  1A4Y A;  4R6A A;  1OGQ A;  4BV4 R;  4WYK A;  3W3J A;  3OJA B;  2A0Z A;  2OMX A;  1JL5 A;  3UN9 A;  1XKU A;  4LXS A;  4ARN A;  3G3A A;  4CC4 C;  3RW7 A;  1XWD C;  1U0N D;  3OGK B;  2WQU A;  2Y5Q A;  2JE1 A;  2Z7X A;  4LI1 A;  2O6Q A;  4ECN A;  1FQV A;  2RA8 A;  3VQ2 A;  1O6T A;  1IO0 A;  1DCE A;  1SQ0 B;  4MN8 B;  4Z94 G;  4NKG A;  3C6P B;  3RW6 A;  4XGO A;  3UL9 A;  1O6S A;  3E6J A;  5GQR K;  5CMN A;  3UL8 A;  4GT6 A;  2Q4G W;  4U06 A;  3W3M A;  2OMW A;  4LSC A;  3WPG A;  4UFR A;  4FHO A;  4XOS A;  3RFE A;  4R5C A;  1YRG A;  2P1M B;  4LXR A;  4H09 A;  2V9S A;  1P8T A;  3RFJ A;  4CC4 A;  4P8S A;  4R6G A;  2OMY A;  1OTM A;  3DZE A;  4AW4 A;  5HDH A;  2ELL A;  2V70 A;  3CVR A;  4Z64 C;  3W3G A;  2OMT A;  5B0N A;  1M9L A;  4LI2 A;  1M9S A;  1H6U A;  3PMH G;  4PQ8 A;  4R5D A;  3A79 B;  4CNM A;  1K5D C;  2RR6 A;  5AWD A;  4BSR A;  3W3K A;  3WPD A;  3W3L A;  2UZX A;  3WPE A;  4CIL A;  2AST B;  3WN4 A;  4R07 A;  3OJA A;  5IJB A;  2BNH A;  2ASS B;  4RCW A;  2XWT C;  2Z65 A;  4TZH A;  5AWC A;  3GOZ A;  2R9U A;  2WQX A;  3C6N B;  1P8V A;  4U09 A;  4L3A A;  5GS2 B;  3G04 C;  4QBZ A;  1O6V A;  1XEC A;  3FXI A;  1M10 B;  2OMZ A;  2JE0 A;  3KJ4 A;  4P91 A;  2XOT A;  4CNC A;  5IJC A;  4U08 A;  5FTT B;  3REZ A;  4PEQ B;  4B8C D;  2WQW A;  3BZ5 A;  4WP6 A;  4FMZ A;  1OOK G;  3ZYN A;  5LFN A;  2Z82 A;  1ZIW A;  2V9T B;  2UZY A;  1Z7X W;  4R58 A;  3M19 A;  4FDW A;  4YEB B;  4XSQ A;  4ARR A;  3WPB A;  4ECO A;  3G06 A;  4U7L A;  5GS0 A;  4MQW X;  3E3Z A;  4Z79 A;  3G39 A;  4AY9 X;  4PKI G;  4LSA A;  3RGX A;  1XCD A;  4HQ1 A;  2Z63 A;  5CMP A;  1KOH A;  3RFS A;  5D3I A;  1LTX A;  3WPC A;  5GMF A;  4R0A A;  4EZG A;  1PGV A;  2OMU A;  4I6J B;  4QC0 A;  4Q62 A;  3E2J A;  3UL7 A;  3JB9 j;  1DFJ I;  2Z66 A;  2P1N B;  1FO1 A;  1GWB A;  2WFH A;  4PSJ A;  1FS2 A;  4RCA B;  5B4P A;  4Z61 C;  3RIZ A;  2FT3 A;  3CIY A;  4RWT C;  1DS9 A;  1A9N A;  3ULU A;  4CP6 A;  2WQV A;  4J0M A;  4Q3G A;  2BEX A;  3TSR E;  2P1Q B;  1OTN A;  3ZYI A;  1QYY A;  3ULA A;  4LSX C;  1P9A G;  4R09 A;  1D0B A;  2Z7X B;  1K5G C;  4QXE A;  4M7E C;  4BSU A;  5AWB A;  1XEU A;  3O6N A;  4R08 A;  5B0T A;  3WPH A;  1W8A A;  5IYX C;  3OGL B;  2ID5 A;  1WWL A;  3WPF A;  3G3B A;  4KNG A;  3ULV A;  4GLP A;  3RJ0 A;  4PER A; 
#chains in the Genus database with same CATH topology
 2P1O B;  4FCG A;  4Z8G A;  4J4L A;  2IFG A;  4OQT A;  2Z81 A;  3E4G A;  2CA6 A;  5IJD A;  2Z64 A;  1FT8 A;  3ZYO A;  5GMG A;  3SB4 A;  1KOO A;  2O6R A;  3VQ1 A;  1M0Z A;  1OZN A;  5HZL B;  3WPI A;  4KXF B;  3O53 A;  2P1P B;  4Y61 B;  5AWA A;  3RGZ A;  4G8A A;  3M18 A;  4FD0 A;  4FS7 A;  4R6F A;  3OGM B;  2OMV A;  4V2D A;  2O6S A;  1OTO A;  4Q3I A;  3P72 A;  4BSS A;  3ZYJ A;  3W3N A;  4LSX A;  4IM6 A;  1G9U A;  4M7E A;  4R6J A;  4KT1 A;  3C6O B;  4K17 A;  2JQD A;  4NKH A;  4V2C A;  4C2A B;  4V2E A;  5GMH A;  4L3F A;  5A5C A;  5AZ5 A;  3CIG A;  1H6T A;  4C2B B;  2Z62 A;  1A4Y A;  4R6A A;  1OGQ A;  4BV4 R;  4WYK A;  3W3J A;  3OJA B;  2A0Z A;  4NZT M;  2OMX A;  1JL5 A;  3UN9 A;  1XKU A;  4LXS A;  4ARN A;  3G3A A;  4CC4 C;  3RW7 A;  1XWD C;  1U0N D;  3OGK B;  2WQU A;  2Y5Q A;  2JE1 A;  2Z7X A;  4LI1 A;  2O6Q A;  4ECN A;  1FQV A;  2RA8 A;  3VQ2 A;  1O6T A;  1IO0 A;  1DCE A;  1SQ0 B;  4MN8 B;  4Z94 G;  4NKG A;  3C6P B;  3RW6 A;  4XGO A;  3UL9 A;  1O6S A;  3E6J A;  5GQR K;  5CMN A;  3UL8 A;  4GT6 A;  2Q4G W;  4U06 A;  3W3M A;  2OMW A;  4LSC A;  3WPG A;  4UFR A;  4FHO A;  4XOS A;  3RFE A;  4R5C A;  1YRG A;  2P1M B;  4LXR A;  4H09 A;  2V9S A;  1P8T A;  3RFJ A;  4CC4 A;  4P8S A;  4R6G A;  2OMY A;  1OTM A;  3DZE A;  4AW4 A;  5HDH A;  2ELL A;  2V70 A;  3CVR A;  4Z64 C;  3W3G A;  2OMT A;  5B0N A;  1M9L A;  4LI2 A;  1M9S A;  4NZR M;  1H6U A;  3PMH G;  4PQ8 A;  4R5D A;  3A79 B;  4CNM A;  1K5D C;  2RR6 A;  5AWD A;  4BSR A;  3W3K A;  3WPD A;  3W3L A;  2UZX A;  3WPE A;  4CIL A;  2AST B;  3WN4 A;  4R07 A;  3OJA A;  5IJB A;  2BNH A;  2ASS B;  4RCW A;  2XWT C;  2Z65 A;  4TZH A;  5AWC A;  3GOZ A;  2R9U A;  2WQX A;  3C6N B;  1P8V A;  4U09 A;  4L3A A;  5GS2 B;  3G04 C;  4QBZ A;  1O6V A;  1XEC A;  3FXI A;  1M10 B;  2OMZ A;  2JE0 A;  3KJ4 A;  4P91 A;  2XOT A;  4CNC A;  5IJC A;  4U08 A;  5FTT B;  3REZ A;  4PEQ B;  4B8C D;  2WQW A;  3BZ5 A;  4WP6 A;  4FMZ A;  1OOK G;  3ZYN A;  5LFN A;  2Z82 A;  1ZIW A;  2V9T B;  2UZY A;  1Z7X W;  4R58 A;  3M19 A;  4FDW A;  4YEB B;  4XSQ A;  4ARR A;  3WPB A;  4ECO A;  3G06 A;  4U7L A;  5GS0 A;  4MQW X;  3E3Z A;  4Z79 A;  3G39 A;  4AY9 X;  4PKI G;  4LSA A;  3RGX A;  1XCD A;  4HQ1 A;  2Z63 A;  5CMP A;  1KOH A;  3RFS A;  5D3I A;  1LTX A;  3WPC A;  5GMF A;  4R0A A;  4EZG A;  1PGV A;  2OMU A;  4I6J B;  4QC0 A;  4Q62 A;  3E2J A;  3UL7 A;  3JB9 j;  1DFJ I;  2Z66 A;  2P1N B;  1FO1 A;  1GWB A;  2WFH A;  4PSJ A;  1FS2 A;  4RCA B;  5B4P A;  4Z61 C;  3RIZ A;  2FT3 A;  3CIY A;  4RWT C;  1DS9 A;  1A9N A;  3ULU A;  4CP6 A;  2WQV A;  4J0M A;  4Q3G A;  2BEX A;  3TSR E;  2P1Q B;  1OTN A;  3ZYI A;  1QYY A;  3ULA A;  4LSX C;  1P9A G;  4R09 A;  1D0B A;  2Z7X B;  1K5G C;  4QXE A;  4M7E C;  4BSU A;  5AWB A;  1XEU A;  3O6N A;  4R08 A;  5B0T A;  3WPH A;  1W8A A;  5IYX C;  3OGL B;  2ID5 A;  1WWL A;  3WPF A;  3G3B A;  4KNG A;  3ULV A;  4GLP A;  3RJ0 A;  4PER A; 
#chains in the Genus database with same CATH homology
 2P1O B;  4FCG A;  4Z8G A;  4J4L A;  2IFG A;  4OQT A;  2Z81 A;  3E4G A;  2CA6 A;  5IJD A;  2Z64 A;  1FT8 A;  3ZYO A;  5GMG A;  3SB4 A;  1KOO A;  2O6R A;  3VQ1 A;  1M0Z A;  1OZN A;  5HZL B;  3WPI A;  4KXF B;  3O53 A;  2P1P B;  4Y61 B;  5AWA A;  3RGZ A;  4G8A A;  3M18 A;  4FD0 A;  4FS7 A;  4R6F A;  3OGM B;  2OMV A;  4V2D A;  2O6S A;  1OTO A;  4Q3I A;  3P72 A;  4BSS A;  3ZYJ A;  3W3N A;  4LSX A;  4IM6 A;  1G9U A;  4M7E A;  4R6J A;  4KT1 A;  3C6O B;  4K17 A;  2JQD A;  4NKH A;  4V2C A;  4C2A B;  4V2E A;  5GMH A;  4L3F A;  5A5C A;  5AZ5 A;  3CIG A;  1H6T A;  4C2B B;  2Z62 A;  1A4Y A;  4R6A A;  1OGQ A;  4BV4 R;  4WYK A;  3W3J A;  3OJA B;  2A0Z A;  2OMX A;  1JL5 A;  3UN9 A;  1XKU A;  4LXS A;  4ARN A;  3G3A A;  4CC4 C;  3RW7 A;  1XWD C;  1U0N D;  3OGK B;  2WQU A;  2Y5Q A;  2JE1 A;  2Z7X A;  4LI1 A;  2O6Q A;  4ECN A;  1FQV A;  2RA8 A;  3VQ2 A;  1O6T A;  1IO0 A;  1DCE A;  1SQ0 B;  4MN8 B;  4Z94 G;  4NKG A;  3C6P B;  3RW6 A;  4XGO A;  3UL9 A;  1O6S A;  3E6J A;  5GQR K;  5CMN A;  3UL8 A;  4GT6 A;  2Q4G W;  4U06 A;  3W3M A;  2OMW A;  4LSC A;  3WPG A;  4UFR A;  4FHO A;  4XOS A;  3RFE A;  4R5C A;  1YRG A;  2P1M B;  4LXR A;  4H09 A;  2V9S A;  1P8T A;  3RFJ A;  4CC4 A;  4P8S A;  4R6G A;  2OMY A;  1OTM A;  3DZE A;  4AW4 A;  5HDH A;  2ELL A;  2V70 A;  3CVR A;  4Z64 C;  3W3G A;  2OMT A;  5B0N A;  1M9L A;  4LI2 A;  1M9S A;  1H6U A;  3PMH G;  4PQ8 A;  4R5D A;  3A79 B;  4CNM A;  1K5D C;  2RR6 A;  5AWD A;  4BSR A;  3W3K A;  3WPD A;  3W3L A;  2UZX A;  3WPE A;  4CIL A;  2AST B;  3WN4 A;  4R07 A;  3OJA A;  5IJB A;  2BNH A;  2ASS B;  4RCW A;  2XWT C;  2Z65 A;  4TZH A;  5AWC A;  3GOZ A;  2R9U A;  2WQX A;  3C6N B;  1P8V A;  4U09 A;  4L3A A;  5GS2 B;  3G04 C;  4QBZ A;  1O6V A;  1XEC A;  3FXI A;  1M10 B;  2OMZ A;  2JE0 A;  3KJ4 A;  4P91 A;  2XOT A;  4CNC A;  5IJC A;  4U08 A;  5FTT B;  3REZ A;  4PEQ B;  4B8C D;  2WQW A;  3BZ5 A;  4WP6 A;  4FMZ A;  1OOK G;  3ZYN A;  5LFN A;  2Z82 A;  1ZIW A;  2V9T B;  2UZY A;  1Z7X W;  4R58 A;  3M19 A;  4FDW A;  4YEB B;  4XSQ A;  4ARR A;  3WPB A;  4ECO A;  3G06 A;  4U7L A;  5GS0 A;  4MQW X;  3E3Z A;  4Z79 A;  3G39 A;  4AY9 X;  4PKI G;  4LSA A;  3RGX A;  1XCD A;  4HQ1 A;  2Z63 A;  5CMP A;  1KOH A;  3RFS A;  5D3I A;  1LTX A;  3WPC A;  5GMF A;  4R0A A;  4EZG A;  1PGV A;  2OMU A;  4I6J B;  4QC0 A;  4Q62 A;  3E2J A;  3UL7 A;  3JB9 j;  1DFJ I;  2Z66 A;  2P1N B;  1FO1 A;  1GWB A;  2WFH A;  4PSJ A;  1FS2 A;  4RCA B;  5B4P A;  4Z61 C;  3RIZ A;  2FT3 A;  3CIY A;  4RWT C;  1DS9 A;  1A9N A;  3ULU A;  4CP6 A;  2WQV A;  4J0M A;  4Q3G A;  2BEX A;  3TSR E;  2P1Q B;  1OTN A;  3ZYI A;  1QYY A;  3ULA A;  4LSX C;  1P9A G;  4R09 A;  1D0B A;  2Z7X B;  1K5G C;  4QXE A;  4M7E C;  4BSU A;  5AWB A;  1XEU A;  3O6N A;  4R08 A;  5B0T A;  3WPH A;  1W8A A;  5IYX C;  3OGL B;  2ID5 A;  1WWL A;  3WPF A;  3G3B A;  4KNG A;  3ULV A;  4GLP A;  3RJ0 A;  4PER A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...