2Z7XB

Crystal structure of the tlr1-tlr2 heterodimer induced by binding of a tri-acylated lipopeptide
Total Genus 167
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
167
sequence length
520
structure length
520
Chain Sequence
SEFLVDRSKNGLIHVPKDLSQKTTILNISQNYISELWTSDILSLSKLRILIISHNRIQYLDISVFKFNQELEYLDLSHNKLVKISCHPTVNLKHLDLSFNAFDALPICKEFGNMSQLKFLGLSTTHLEKSSVLPIAHLNISKVLLVLGETYGEKEDPEGLQDFNTESLHIVFPTNKEFHFILDVSVKTVANLELSNIKCVLEDNKCSYFLSILAKLQTNPKLSNLTLNNIETTWNSFIRILQLVWHTTVWYFSISNVKLQGQLDFRDFDYSGTSLKALSIHQVVSDVFGFPQSYIYEIFSNMNIKNFTVSGTRMVHMLCPSKISPFLHLDFSNNLLTDTVFENCGHLTELETLILQMNQLKELSKIAEMTTQMKSLQQLDISQNSVSYDEKKGDCSWTKSLLSLNMSSNILTDTIFRCLPPRIKVLDLHSNKIKSIPKQVVKLEALQELNVASNQLKSVPDGIFDRLTSLQKIWLHTNPWDCSCPRIDYLSRWLNKNSQKEQGSAKCSGSGKPVRSIICP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Toll-like receptor 2, Variable lymphocyte receptor B
publication title Crystal Structure of the TLR1-TLR2 Heterodimer Induced by Binding of a Tri-Acylated Lipopeptide
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 167
structure length 520
sequence length 520
ec nomenclature
pdb deposition date 2007-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13855 LRR_8 Leucine rich repeat
B PF13855 LRR_8 Leucine rich repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 2z7xB00
4UFRA 3RFSA 1K5DC 2XWTC 4LSXC 3TSRE 1H6TA 1Z7XW 5CMNA 4CNCA 2CA6A 2R9UA 4XOSA 4U7LA 5HDHA 2XOTA 1IO0A 1XWDC 2OMZA 4Z94G 1M10B 1PGVA 4V2EA 3OJAB 3G3BA 3JB9j 4R6AA 3WPBA 5AWBA 1O6SA 2Y5QA 1OTOA 4CNMA 4FHOA 2V70A 1XCDA 5GQRK 4R6FA 1G9UA 2BEXA 1KOOA 3G04C 4FMZA 4PERA 2P1QB 3ZYJA 4LXRA 2BNHA 5CMPA 4C2AB 4XSQA 4U08A 1ZIWA 3ULAA 3M19A 1H6UA 4LI2A 3RFJA 3WPDA 1OGQA 3E2JA 4LSCA 2RA8A 3E6JA 4MQWX 4Q3IA 3OGKB 1P8VA 3UL7A 3W3MA 4L3AA 2V9SA 1P8TA 3OGMB 2Z82A 2V9TB 4I6JB 4GT6A 4IM6A 4L3FA 1DCEA 4RCAB 2WQVA 5IJBA 4CC4C 2JE1A 4H09A 4BSRA 3M18A 1A4YA 4GLPA 3VQ1A 1OZNA 4KT1A 3ULUA 1DS9A 3G3AA 4Z79A 3RJ0A 5GMGA 4R08A 3RW6A 1XEUA 3ZYIA 2P1OB 4ARNA 2UZXA 3ULVA 4NKHA 2JE0A 3PMHG 4FD0A 3A79B 4R6JA 4PSJA 4R6GA 4K17A 4V2CA 5GS0A 4QC0A 1KOHA 1M9SA 2Z65A 4RCWA 3VQ2A 3O6NA 2P1PB 5B0TA 5GMFA 1YRGA 3BZ5A 4LXSA 4KXFB 4V2DA 4OQTA 2WQWA 4M7EA 4RWTC 3RGXA 4BSSA 3DZEA 1QYYA 3UL8A 2A0ZA 1SQ0B 5HZLB 2UZYA 3WPGA 4KNGA 2Z7XA 1DFJI 3RW7A 1FQVA 3WN4A 4Y61B 4AW4A 2WQUA 1A9NA 4P8SA 2OMYA 1OTMA 2Z81A 1XECA 4C2BB 4R09A 4R0AA 4G8AA 4YEBB 3W3NA 3UL9A 4CP6A 1FS2A 4FDWA 3P72A 3W3JA 3C6NB 4PEQB 5A5CA 3C6PB 4U06A 4R5DA 2OMWA 4BV4R 4NKGA 4MN8B 3OJAA 3WPHA 2WFHA 2O6QA 3KJ4A 3O53A 4ECOA 1U0ND 4Z64C 5D3IA 4Z8GA 2Z63A 4WP6A 5AWDA 4ARRA 2Z7XB 1W8AA 1OTNA 3OGLB 1M0ZA 2ASSB 1FO1A 4CILA 3G39A 5AWCA 2FT3A 3SB4A 2WQXA 3WPIA 4FS7A 3GOZA 4XGOA 3REZA 2Z62A 1GWBA 4WYKA 4QXEA 1O6TA 2ELLA 2OMXA 4LSAA 4PQ8A 3ZYNA 3RGZA 3W3KA 5IYXC 5GS2B 1FT8A 2RR6A 3ZYOA 4Q3GA 3E3ZA 3W3GA 1D0BA 2ID5A 1P9AG 4QBZA 3RFEA 4HQ1A 1M9LA 2OMUA 2P1MB 4B8CD 3CIYA 4LI1A 4EZGA 4R58A 3UN9A 3RIZA 4ECNA 3W3LA 3FXIA 4CC4A 3E4GA 4FCGA 5AZ5A 1XKUA 2O6SA 5GMHA 4BSUA 4Q62A 3CVRA 2P1NB 4M7EC 5LFNA 1O6VA 4Z61C 2OMVA 4LSXA 2OMTA 5FTTB 4PKIG 3WPCA 2IFGA 3G06A 3C6OB 5IJCA 1LTXA 3WPEA 4J4LA 4J0MA 5AWAA 4P91A 4U09A 1WWLA 4TZHA 2Q4GW 1K5GC 4AY9X 5B4PA 2ASTB 5B0NA 4R07A 2O6RA 2JQDA 2Z64A 3WPFA 5IJDA 2Z66A 4R5CA 1JL5A 1OOKG 3CIGA
chains in the Genus database with same CATH superfamily
4UFRA 3RFSA 1K5DC 2XWTC 4LSXC 3TSRE 1H6TA 1Z7XW 5CMNA 4CNCA 2CA6A 2R9UA 4XOSA 4U7LA 5HDHA 2XOTA 1IO0A 1XWDC 2OMZA 4Z94G 1M10B 1PGVA 4V2EA 3OJAB 3G3BA 3JB9j 4R6AA 3WPBA 5AWBA 1O6SA 2Y5QA 1OTOA 4CNMA 4FHOA 2V70A 1XCDA 5GQRK 4R6FA 1G9UA 2BEXA 1KOOA 3G04C 4FMZA 4PERA 2P1QB 3ZYJA 4LXRA 2BNHA 5CMPA 4C2AB 4XSQA 4U08A 1ZIWA 3ULAA 3M19A 1H6UA 4LI2A 3RFJA 3WPDA 1OGQA 3E2JA 4LSCA 2RA8A 3E6JA 4MQWX 4Q3IA 3OGKB 1P8VA 3UL7A 3W3MA 4L3AA 2V9SA 1P8TA 3OGMB 2Z82A 2V9TB 4I6JB 4GT6A 4IM6A 4L3FA 1DCEA 4RCAB 2WQVA 5IJBA 4CC4C 2JE1A 4H09A 4BSRA 3M18A 1A4YA 4GLPA 3VQ1A 1OZNA 4KT1A 3ULUA 1DS9A 3G3AA 4Z79A 3RJ0A 5GMGA 4R08A 3RW6A 1XEUA 3ZYIA 2P1OB 4ARNA 2UZXA 3ULVA 4NKHA 2JE0A 3PMHG 4FD0A 3A79B 4R6JA 4PSJA 4R6GA 4K17A 4V2CA 5GS0A 4QC0A 1KOHA 1M9SA 2Z65A 4RCWA 3VQ2A 3O6NA 2P1PB 5B0TA 5GMFA 1YRGA 3BZ5A 4LXSA 4KXFB 4V2DA 4OQTA 2WQWA 4M7EA 4RWTC 3RGXA 4BSSA 3DZEA 1QYYA 3UL8A 2A0ZA 1SQ0B 5HZLB 2UZYA 3WPGA 4KNGA 2Z7XA 1DFJI 4NZTM 3RW7A 1FQVA 3WN4A 4Y61B 4AW4A 2WQUA 1A9NA 4P8SA 2OMYA 1OTMA 2Z81A 1XECA 4C2BB 4R09A 4R0AA 4G8AA 4YEBB 3W3NA 3UL9A 4CP6A 1FS2A 4FDWA 3P72A 3W3JA 3C6NB 4PEQB 5A5CA 3C6PB 4U06A 4R5DA 2OMWA 4BV4R 4NKGA 4MN8B 3OJAA 3WPHA 2WFHA 2O6QA 3KJ4A 3O53A 4NZRM 4ECOA 1U0ND 4Z64C 5D3IA 4Z8GA 2Z63A 4WP6A 5AWDA 4ARRA 2Z7XB 1W8AA 1OTNA 3OGLB 1M0ZA 2ASSB 1FO1A 4CILA 3G39A 5AWCA 2FT3A 3SB4A 2WQXA 3WPIA 4FS7A 3GOZA 4XGOA 3REZA 2Z62A 1GWBA 4WYKA 4QXEA 1O6TA 2ELLA 2OMXA 4LSAA 4PQ8A 3ZYNA 3RGZA 3W3KA 5IYXC 5GS2B 1FT8A 2RR6A 3ZYOA 4Q3GA 3E3ZA 3W3GA 1D0BA 2ID5A 1P9AG 4QBZA 3RFEA 4HQ1A 1M9LA 2OMUA 2P1MB 4B8CD 3CIYA 4LI1A 4EZGA 4R58A 3UN9A 3RIZA 4ECNA 3W3LA 3FXIA 4CC4A 3E4GA 4FCGA 5AZ5A 1XKUA 2O6SA 5GMHA 4BSUA 4Q62A 3CVRA 2P1NB 4M7EC 5LFNA 1O6VA 4Z61C 2OMVA 4LSXA 2OMTA 5FTTB 4PKIG 3WPCA 2IFGA 3G06A 3C6OB 5IJCA 1LTXA 3WPEA 4J4LA 4J0MA 5AWAA 4P91A 4U09A 1WWLA 4TZHA 2Q4GW 1K5GC 4AY9X 5B4PA 2ASTB 5B0NA 4R07A 2O6RA 2JQDA 2Z64A 3WPFA 5IJDA 2Z66A 4R5CA 1JL5A 1OOKG 3CIGA
chains in the Genus database with same CATH topology
4UFRA 3RFSA 1K5DC 2XWTC 4LSXC 3TSRE 1H6TA 1Z7XW 5CMNA 4CNCA 2CA6A 2R9UA 4XOSA 4U7LA 5HDHA 2XOTA 1IO0A 1XWDC 2OMZA 4Z94G 1M10B 1PGVA 4V2EA 3OJAB 3G3BA 3JB9j 4R6AA 3WPBA 5AWBA 1O6SA 2Y5QA 1OTOA 4CNMA 4FHOA 2V70A 1XCDA 5GQRK 4R6FA 1G9UA 2BEXA 1KOOA 3G04C 4FMZA 4PERA 2P1QB 3ZYJA 4LXRA 2BNHA 5CMPA 4C2AB 4XSQA 4U08A 1ZIWA 3ULAA 3M19A 1H6UA 4LI2A 3RFJA 3WPDA 1OGQA 3E2JA 4LSCA 2RA8A 3E6JA 4MQWX 4Q3IA 3OGKB 1P8VA 3UL7A 3W3MA 4L3AA 2V9SA 1P8TA 3OGMB 2Z82A 2V9TB 4I6JB 4GT6A 4IM6A 4L3FA 1DCEA 4RCAB 2WQVA 5IJBA 4CC4C 2JE1A 4H09A 4BSRA 3M18A 1A4YA 4GLPA 3VQ1A 1OZNA 4KT1A 3ULUA 1DS9A 3G3AA 4Z79A 3RJ0A 5GMGA 4R08A 3RW6A 1XEUA 3ZYIA 2P1OB 4ARNA 2UZXA 3ULVA 4NKHA 2JE0A 3PMHG 4FD0A 3A79B 4R6JA 4PSJA 4R6GA 4K17A 4V2CA 5GS0A 4QC0A 1KOHA 1M9SA 2Z65A 4RCWA 3VQ2A 3O6NA 2P1PB 5B0TA 5GMFA 1YRGA 3BZ5A 4LXSA 4KXFB 4V2DA 4OQTA 2WQWA 4M7EA 4RWTC 3RGXA 4BSSA 3DZEA 1QYYA 3UL8A 2A0ZA 1SQ0B 5HZLB 2UZYA 3WPGA 4KNGA 2Z7XA 1DFJI 3RW7A 1FQVA 3WN4A 4Y61B 4AW4A 2WQUA 1A9NA 4P8SA 2OMYA 1OTMA 2Z81A 1XECA 4C2BB 4R09A 4R0AA 4G8AA 4YEBB 3W3NA 3UL9A 4CP6A 1FS2A 4FDWA 3P72A 3W3JA 3C6NB 4PEQB 5A5CA 3C6PB 4U06A 4R5DA 2OMWA 4BV4R 4NKGA 4MN8B 3OJAA 3WPHA 2WFHA 2O6QA 3KJ4A 3O53A 4ECOA 1U0ND 4Z64C 5D3IA 4Z8GA 2Z63A 4WP6A 5AWDA 4ARRA 2Z7XB 1W8AA 1OTNA 3OGLB 1M0ZA 2ASSB 1FO1A 4CILA 3G39A 5AWCA 2FT3A 3SB4A 2WQXA 3WPIA 4FS7A 3GOZA 4XGOA 3REZA 2Z62A 1GWBA 4WYKA 4QXEA 1O6TA 2ELLA 2OMXA 4LSAA 4PQ8A 3ZYNA 3RGZA 3W3KA 5IYXC 5GS2B 1FT8A 2RR6A 3ZYOA 4Q3GA 3E3ZA 3W3GA 1D0BA 2ID5A 1P9AG 4QBZA 3RFEA 4HQ1A 1M9LA 2OMUA 2P1MB 4B8CD 3CIYA 4LI1A 4EZGA 4R58A 3UN9A 3RIZA 4ECNA 3W3LA 3FXIA 4CC4A 3E4GA 4FCGA 5AZ5A 1XKUA 2O6SA 5GMHA 4BSUA 4Q62A 3CVRA 2P1NB 4M7EC 5LFNA 1O6VA 4Z61C 2OMVA 4LSXA 2OMTA 5FTTB 4PKIG 3WPCA 2IFGA 3G06A 3C6OB 5IJCA 1LTXA 3WPEA 4J4LA 4J0MA 5AWAA 4P91A 4U09A 1WWLA 4TZHA 2Q4GW 1K5GC 4AY9X 5B4PA 2ASTB 5B0NA 4R07A 2O6RA 2JQDA 2Z64A 3WPFA 5IJDA 2Z66A 4R5CA 1JL5A 1OOKG 3CIGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UFR A;  3RFS A;  1K5D C;  2XWT C;  4LSX C;  3TSR E;  1H6T A;  1Z7X W;  5CMN A;  4CNC A;  2CA6 A;  2R9U A;  4XOS A;  4U7L A;  5HDH A;  2XOT A;  1IO0 A;  1XWD C;  2OMZ A;  4Z94 G;  1M10 B;  1PGV A;  4V2E A;  3OJA B;  3G3B A;  3JB9 j;  4R6A A;  3WPB A;  5AWB A;  1O6S A;  2Y5Q A;  1OTO A;  4CNM A;  4FHO A;  2V70 A;  1XCD A;  5GQR K;  4R6F A;  1G9U A;  2BEX A;  1KOO A;  3G04 C;  4FMZ A;  4PER A;  2P1Q B;  3ZYJ A;  4LXR A;  2BNH A;  5CMP A;  4C2A B;  4XSQ A;  4U08 A;  1ZIW A;  3ULA A;  3M19 A;  1H6U A;  4LI2 A;  3RFJ A;  3WPD A;  1OGQ A;  3E2J A;  4LSC A;  2RA8 A;  3E6J A;  4MQW X;  4Q3I A;  3OGK B;  1P8V A;  3UL7 A;  3W3M A;  4L3A A;  2V9S A;  1P8T A;  3OGM B;  2Z82 A;  2V9T B;  4I6J B;  4GT6 A;  4IM6 A;  4L3F A;  1DCE A;  4RCA B;  2WQV A;  5IJB A;  4CC4 C;  2JE1 A;  4H09 A;  4BSR A;  3M18 A;  1A4Y A;  4GLP A;  3VQ1 A;  1OZN A;  4KT1 A;  3ULU A;  1DS9 A;  3G3A A;  4Z79 A;  3RJ0 A;  5GMG A;  4R08 A;  3RW6 A;  1XEU A;  3ZYI A;  2P1O B;  4ARN A;  2UZX A;  3ULV A;  4NKH A;  2JE0 A;  3PMH G;  4FD0 A;  3A79 B;  4R6J A;  4PSJ A;  4R6G A;  4K17 A;  4V2C A;  5GS0 A;  4QC0 A;  1KOH A;  1M9S A;  2Z65 A;  4RCW A;  3VQ2 A;  3O6N A;  2P1P B;  5B0T A;  5GMF A;  1YRG A;  3BZ5 A;  4LXS A;  4KXF B;  4V2D A;  4OQT A;  2WQW A;  4M7E A;  4RWT C;  3RGX A;  4BSS A;  3DZE A;  1QYY A;  3UL8 A;  2A0Z A;  1SQ0 B;  5HZL B;  2UZY A;  3WPG A;  4KNG A;  2Z7X A;  1DFJ I;  3RW7 A;  1FQV A;  3WN4 A;  4Y61 B;  4AW4 A;  2WQU A;  1A9N A;  4P8S A;  2OMY A;  1OTM A;  2Z81 A;  1XEC A;  4C2B B;  4R09 A;  4R0A A;  4G8A A;  4YEB B;  3W3N A;  3UL9 A;  4CP6 A;  1FS2 A;  4FDW A;  3P72 A;  3W3J A;  3C6N B;  4PEQ B;  5A5C A;  3C6P B;  4U06 A;  4R5D A;  2OMW A;  4BV4 R;  4NKG A;  4MN8 B;  3OJA A;  3WPH A;  2WFH A;  2O6Q A;  3KJ4 A;  3O53 A;  4ECO A;  1U0N D;  4Z64 C;  5D3I A;  4Z8G A;  2Z63 A;  4WP6 A;  5AWD A;  4ARR A;  2Z7X B;  1W8A A;  1OTN A;  3OGL B;  1M0Z A;  2ASS B;  1FO1 A;  4CIL A;  3G39 A;  5AWC A;  2FT3 A;  3SB4 A;  2WQX A;  3WPI A;  4FS7 A;  3GOZ A;  4XGO A;  3REZ A;  2Z62 A;  1GWB A;  4WYK A;  4QXE A;  1O6T A;  2ELL A;  2OMX A;  4LSA A;  4PQ8 A;  3ZYN A;  3RGZ A;  3W3K A;  5IYX C;  5GS2 B;  1FT8 A;  2RR6 A;  3ZYO A;  4Q3G A;  3E3Z A;  3W3G A;  1D0B A;  2ID5 A;  1P9A G;  4QBZ A;  3RFE A;  4HQ1 A;  1M9L A;  2OMU A;  2P1M B;  4B8C D;  3CIY A;  4LI1 A;  4EZG A;  4R58 A;  3UN9 A;  3RIZ A;  4ECN A;  3W3L A;  3FXI A;  4CC4 A;  3E4G A;  4FCG A;  5AZ5 A;  1XKU A;  2O6S A;  5GMH A;  4BSU A;  4Q62 A;  3CVR A;  2P1N B;  4M7E C;  5LFN A;  1O6V A;  4Z61 C;  2OMV A;  4LSX A;  2OMT A;  5FTT B;  4PKI G;  3WPC A;  2IFG A;  3G06 A;  3C6O B;  5IJC A;  1LTX A;  3WPE A;  4J4L A;  4J0M A;  5AWA A;  4P91 A;  4U09 A;  1WWL A;  4TZH A;  2Q4G W;  1K5G C;  4AY9 X;  5B4P A;  2AST B;  5B0N A;  4R07 A;  2O6R A;  2JQD A;  2Z64 A;  3WPF A;  5IJD A;  2Z66 A;  4R5C A;  1JL5 A;  1OOK G;  3CIG A; 
#chains in the Genus database with same CATH topology
 4UFR A;  3RFS A;  1K5D C;  2XWT C;  4LSX C;  3TSR E;  1H6T A;  1Z7X W;  5CMN A;  4CNC A;  2CA6 A;  2R9U A;  4XOS A;  4U7L A;  5HDH A;  2XOT A;  1IO0 A;  1XWD C;  2OMZ A;  4Z94 G;  1M10 B;  1PGV A;  4V2E A;  3OJA B;  3G3B A;  3JB9 j;  4R6A A;  3WPB A;  5AWB A;  1O6S A;  2Y5Q A;  1OTO A;  4CNM A;  4FHO A;  2V70 A;  1XCD A;  5GQR K;  4R6F A;  1G9U A;  2BEX A;  1KOO A;  3G04 C;  4FMZ A;  4PER A;  2P1Q B;  3ZYJ A;  4LXR A;  2BNH A;  5CMP A;  4C2A B;  4XSQ A;  4U08 A;  1ZIW A;  3ULA A;  3M19 A;  1H6U A;  4LI2 A;  3RFJ A;  3WPD A;  1OGQ A;  3E2J A;  4LSC A;  2RA8 A;  3E6J A;  4MQW X;  4Q3I A;  3OGK B;  1P8V A;  3UL7 A;  3W3M A;  4L3A A;  2V9S A;  1P8T A;  3OGM B;  2Z82 A;  2V9T B;  4I6J B;  4GT6 A;  4IM6 A;  4L3F A;  1DCE A;  4RCA B;  2WQV A;  5IJB A;  4CC4 C;  2JE1 A;  4H09 A;  4BSR A;  3M18 A;  1A4Y A;  4GLP A;  3VQ1 A;  1OZN A;  4KT1 A;  3ULU A;  1DS9 A;  3G3A A;  4Z79 A;  3RJ0 A;  5GMG A;  4R08 A;  3RW6 A;  1XEU A;  3ZYI A;  2P1O B;  4ARN A;  2UZX A;  3ULV A;  4NKH A;  2JE0 A;  3PMH G;  4FD0 A;  3A79 B;  4R6J A;  4PSJ A;  4R6G A;  4K17 A;  4V2C A;  5GS0 A;  4QC0 A;  1KOH A;  1M9S A;  2Z65 A;  4RCW A;  3VQ2 A;  3O6N A;  2P1P B;  5B0T A;  5GMF A;  1YRG A;  3BZ5 A;  4LXS A;  4KXF B;  4V2D A;  4OQT A;  2WQW A;  4M7E A;  4RWT C;  3RGX A;  4BSS A;  3DZE A;  1QYY A;  3UL8 A;  2A0Z A;  1SQ0 B;  5HZL B;  2UZY A;  3WPG A;  4KNG A;  2Z7X A;  1DFJ I;  4NZT M;  3RW7 A;  1FQV A;  3WN4 A;  4Y61 B;  4AW4 A;  2WQU A;  1A9N A;  4P8S A;  2OMY A;  1OTM A;  2Z81 A;  1XEC A;  4C2B B;  4R09 A;  4R0A A;  4G8A A;  4YEB B;  3W3N A;  3UL9 A;  4CP6 A;  1FS2 A;  4FDW A;  3P72 A;  3W3J A;  3C6N B;  4PEQ B;  5A5C A;  3C6P B;  4U06 A;  4R5D A;  2OMW A;  4BV4 R;  4NKG A;  4MN8 B;  3OJA A;  3WPH A;  2WFH A;  2O6Q A;  3KJ4 A;  3O53 A;  4NZR M;  4ECO A;  1U0N D;  4Z64 C;  5D3I A;  4Z8G A;  2Z63 A;  4WP6 A;  5AWD A;  4ARR A;  2Z7X B;  1W8A A;  1OTN A;  3OGL B;  1M0Z A;  2ASS B;  1FO1 A;  4CIL A;  3G39 A;  5AWC A;  2FT3 A;  3SB4 A;  2WQX A;  3WPI A;  4FS7 A;  3GOZ A;  4XGO A;  3REZ A;  2Z62 A;  1GWB A;  4WYK A;  4QXE A;  1O6T A;  2ELL A;  2OMX A;  4LSA A;  4PQ8 A;  3ZYN A;  3RGZ A;  3W3K A;  5IYX C;  5GS2 B;  1FT8 A;  2RR6 A;  3ZYO A;  4Q3G A;  3E3Z A;  3W3G A;  1D0B A;  2ID5 A;  1P9A G;  4QBZ A;  3RFE A;  4HQ1 A;  1M9L A;  2OMU A;  2P1M B;  4B8C D;  3CIY A;  4LI1 A;  4EZG A;  4R58 A;  3UN9 A;  3RIZ A;  4ECN A;  3W3L A;  3FXI A;  4CC4 A;  3E4G A;  4FCG A;  5AZ5 A;  1XKU A;  2O6S A;  5GMH A;  4BSU A;  4Q62 A;  3CVR A;  2P1N B;  4M7E C;  5LFN A;  1O6V A;  4Z61 C;  2OMV A;  4LSX A;  2OMT A;  5FTT B;  4PKI G;  3WPC A;  2IFG A;  3G06 A;  3C6O B;  5IJC A;  1LTX A;  3WPE A;  4J4L A;  4J0M A;  5AWA A;  4P91 A;  4U09 A;  1WWL A;  4TZH A;  2Q4G W;  1K5G C;  4AY9 X;  5B4P A;  2AST B;  5B0N A;  4R07 A;  2O6R A;  2JQD A;  2Z64 A;  3WPF A;  5IJD A;  2Z66 A;  4R5C A;  1JL5 A;  1OOK G;  3CIG A; 
#chains in the Genus database with same CATH homology
 4UFR A;  3RFS A;  1K5D C;  2XWT C;  4LSX C;  3TSR E;  1H6T A;  1Z7X W;  5CMN A;  4CNC A;  2CA6 A;  2R9U A;  4XOS A;  4U7L A;  5HDH A;  2XOT A;  1IO0 A;  1XWD C;  2OMZ A;  4Z94 G;  1M10 B;  1PGV A;  4V2E A;  3OJA B;  3G3B A;  3JB9 j;  4R6A A;  3WPB A;  5AWB A;  1O6S A;  2Y5Q A;  1OTO A;  4CNM A;  4FHO A;  2V70 A;  1XCD A;  5GQR K;  4R6F A;  1G9U A;  2BEX A;  1KOO A;  3G04 C;  4FMZ A;  4PER A;  2P1Q B;  3ZYJ A;  4LXR A;  2BNH A;  5CMP A;  4C2A B;  4XSQ A;  4U08 A;  1ZIW A;  3ULA A;  3M19 A;  1H6U A;  4LI2 A;  3RFJ A;  3WPD A;  1OGQ A;  3E2J A;  4LSC A;  2RA8 A;  3E6J A;  4MQW X;  4Q3I A;  3OGK B;  1P8V A;  3UL7 A;  3W3M A;  4L3A A;  2V9S A;  1P8T A;  3OGM B;  2Z82 A;  2V9T B;  4I6J B;  4GT6 A;  4IM6 A;  4L3F A;  1DCE A;  4RCA B;  2WQV A;  5IJB A;  4CC4 C;  2JE1 A;  4H09 A;  4BSR A;  3M18 A;  1A4Y A;  4GLP A;  3VQ1 A;  1OZN A;  4KT1 A;  3ULU A;  1DS9 A;  3G3A A;  4Z79 A;  3RJ0 A;  5GMG A;  4R08 A;  3RW6 A;  1XEU A;  3ZYI A;  2P1O B;  4ARN A;  2UZX A;  3ULV A;  4NKH A;  2JE0 A;  3PMH G;  4FD0 A;  3A79 B;  4R6J A;  4PSJ A;  4R6G A;  4K17 A;  4V2C A;  5GS0 A;  4QC0 A;  1KOH A;  1M9S A;  2Z65 A;  4RCW A;  3VQ2 A;  3O6N A;  2P1P B;  5B0T A;  5GMF A;  1YRG A;  3BZ5 A;  4LXS A;  4KXF B;  4V2D A;  4OQT A;  2WQW A;  4M7E A;  4RWT C;  3RGX A;  4BSS A;  3DZE A;  1QYY A;  3UL8 A;  2A0Z A;  1SQ0 B;  5HZL B;  2UZY A;  3WPG A;  4KNG A;  2Z7X A;  1DFJ I;  3RW7 A;  1FQV A;  3WN4 A;  4Y61 B;  4AW4 A;  2WQU A;  1A9N A;  4P8S A;  2OMY A;  1OTM A;  2Z81 A;  1XEC A;  4C2B B;  4R09 A;  4R0A A;  4G8A A;  4YEB B;  3W3N A;  3UL9 A;  4CP6 A;  1FS2 A;  4FDW A;  3P72 A;  3W3J A;  3C6N B;  4PEQ B;  5A5C A;  3C6P B;  4U06 A;  4R5D A;  2OMW A;  4BV4 R;  4NKG A;  4MN8 B;  3OJA A;  3WPH A;  2WFH A;  2O6Q A;  3KJ4 A;  3O53 A;  4ECO A;  1U0N D;  4Z64 C;  5D3I A;  4Z8G A;  2Z63 A;  4WP6 A;  5AWD A;  4ARR A;  2Z7X B;  1W8A A;  1OTN A;  3OGL B;  1M0Z A;  2ASS B;  1FO1 A;  4CIL A;  3G39 A;  5AWC A;  2FT3 A;  3SB4 A;  2WQX A;  3WPI A;  4FS7 A;  3GOZ A;  4XGO A;  3REZ A;  2Z62 A;  1GWB A;  4WYK A;  4QXE A;  1O6T A;  2ELL A;  2OMX A;  4LSA A;  4PQ8 A;  3ZYN A;  3RGZ A;  3W3K A;  5IYX C;  5GS2 B;  1FT8 A;  2RR6 A;  3ZYO A;  4Q3G A;  3E3Z A;  3W3G A;  1D0B A;  2ID5 A;  1P9A G;  4QBZ A;  3RFE A;  4HQ1 A;  1M9L A;  2OMU A;  2P1M B;  4B8C D;  3CIY A;  4LI1 A;  4EZG A;  4R58 A;  3UN9 A;  3RIZ A;  4ECN A;  3W3L A;  3FXI A;  4CC4 A;  3E4G A;  4FCG A;  5AZ5 A;  1XKU A;  2O6S A;  5GMH A;  4BSU A;  4Q62 A;  3CVR A;  2P1N B;  4M7E C;  5LFN A;  1O6V A;  4Z61 C;  2OMV A;  4LSX A;  2OMT A;  5FTT B;  4PKI G;  3WPC A;  2IFG A;  3G06 A;  3C6O B;  5IJC A;  1LTX A;  3WPE A;  4J4L A;  4J0M A;  5AWA A;  4P91 A;  4U09 A;  1WWL A;  4TZH A;  2Q4G W;  1K5G C;  4AY9 X;  5B4P A;  2AST B;  5B0N A;  4R07 A;  2O6R A;  2JQD A;  2Z64 A;  3WPF A;  5IJD A;  2Z66 A;  4R5C A;  1JL5 A;  1OOK G;  3CIG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...