2Z8EA

The galacto-n-biose-/lacto-n-biose i-binding protein (gl-bp) of the abc transporter from bifidobacterium longum in complex with galacto-n-biose
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
401
structure length
401
Chain Sequence
DDGGVVNITYMHRLPDSEGMTLVNDIVAKWNKQHPDIQVKATKFDGKASDMIKKLETDVKSGEAPDLAQVGYAELPEVFTKGLLQDVTQYAEQYKNDFASGPYSLVQVGGKAYGLPQDTGPLVYFYNKAEFEKLGITEIPQTADEFIAAAKTAAAAGKYIMSYQPDEAGNMISGLAGASGGWYKVKGDSWVVNTETDGSKATADFYQQLLDAKAATTNPRWDPSFDASIKDGSLIGTVAAAWEAPLFMTSSGGTGSGEWQVAQLGDWFGNAGKTGPDGGSAVAVLKNSKHPKEAMEFLDWFNTQVPDLVSQGLVPAATTEDAETPSEWSTFFGGQDIMKEFKTANNNMGDFTYMPGFSAVAAKMNETAAKATDGSGKVADIFSDAQTTSVDTLKNFGLSVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Galacto-N-biose/lacto-N-biose I transporter substrate-bindin
publication title Structural and thermodynamic analyses of solute-binding Protein from Bifidobacterium longum specific for core 1 disaccharide and lacto-N-biose I.
pubmed doi rcsb
source organism Bifidobacterium longum
molecule tags Sugar binding protein
total genus 142
structure length 401
sequence length 401
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2z8eA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2z8eA02
5AA2D 3IOVA 3W15C 2RF1A 4TLMB 3FZVA 1OMPA 1JW5A 4U23A 3L6HA 1MS7A 1S50A 3C9HA 4BDLA 1FTJA 2DWAA 4R9GA 2I4BA 3VVDA 2RINA 3IB0A 3THIA 3LR1A 4U2RA 3U72A 3TTNA 3IOWA 3EHUA 1OQHA 2FNCA 2R9JA 3GLBA 3TDJA 2H4IA 5JTYA 3O6HA 4LONB 1IXGA 1DTZA 2ZYOA 2XX9A 4G68C 1RKMA 2Y84A 4X9TA 4R74A 5DTBA 3H6VA 1B4HA 4ND9A 5AA3A 1L5TA 4TQUQ 1FTLA 1B0HA 3OMBA 3IR1A 3VE1B 4EQ9A 3LSXA 1IZ1A 3T96B 5B70A 4OYVA 5H8SA 1EZPA 5H8NA 1M5CA 1MY0A 5KCJB 4LZ8A 2OJTA 4ELPA 4Q8RA 5ITPA 4DCXA 1FTOA 4NE4A 4QSEA 2M8CA 1LBBA 1Y3PA 2Y7IA 4U4SA 1QW0A 3H3GA 4KCDA 3T22A 3KN7A 4N13A 4GVOA 5I2KB 3M8UA 1D4NA 5IKBA 1NH7A 3K6UA 4G8HA 3B6TA 1LAFE 1PC3A 1A54A 4QRZA 4NF6A 3VLWA 4KYDA 1JVYA 3SEYA 5K2XA 3EN3A 2QL3A 1MRPA 3V8XB 1EZ9A 1H3DA 1XVYA 4H65A 5AA4B 4R6YA 4YICA 3RTFB 3ILUB 2H5YA 1KWHA 3C35A 2QS2A 1B58A 1OLAA 3TPAA 4ISUA 2PT1A 4F1VA 3QAXA 3H03A 4BLAA 4OMBA 4GOTA 4R6KA 1VFEA 4Q30B 2V84A 2AIXA 1N7WA 3FVOA 1TT1A 4F39A 1Y4TA 2ANJA 3K1PA 5H8QB 2CMOA 4PFUA 3JV9A 2PYYA 2O6AA 2Z8DA 2D3IA 4PFWA 4F22A 2G93A 5L9SA 2XXHA 2THIA 1O64A 5I2NB 2X26A 3E13X 5FHMA 3OENA 4GLIA 4QSDA 3ECRA 3CFLA 3D4GA 3PMVA 2OCUA 3MP8A 2BJJX 4R9FA 2AL5A 3MVWA 3LSLA 1SQYA 4KCCA 4OENA 3OSQA 2RC7A 3UN6A 1D3KA 2R71A 3IO6A 3FJ7A 3O28A 2XX7A 3MUQA 3OSRA 3HN0A 4NTLA 1QULA 5I56B 2ONSA 4BDMA 1B4ZA 2DVZA 3CFXA 2E1SA 4E0WA 1TFAA 3N26A 1Y1MA 4WXJA 3KSXA 1B1HA 1DOTA 1MG1A 5I59A 2Z8FA 4FEBA 2P0SA 3KSJA 1TXFA 4AB5A 2YLNA 4F31B 2XXWA 3ODBA 4YKKA 4EUOA 3OEMA 1R1NA 3T9UA 2AYSA 2DS9A 3MWBA 5I2KA 4R2BA 1PB9A 3K1MA 2GHAA 4NMYA 2XXXA 3E9XA 3K6VA 2DP8A 4U22A 3UK4A 4LZ5A 1B3FA 4G4PA 3C34A 1Y3NA 1A7LA 2H25A 3KBRA 3OEKA 1FQEA 4U1OA 5CMKA 4DCYA 1NL5A 4EXLA 3TCHA 1LB9A 4IB2A 1NNPA 1DSNA 1N7XA 1DPEA 4F29A 4Z7EA 1LFGA 1USYE 1JEVA 4JWYA 1QUKA 4OHNA 4DXCA 2PT2A 5HPQA 5CMBA 3FD3A 2NVUB 4PFYA 1MXWA 2ZYMA 1Y1ZA 3AXFA 1SW4A 3ZKKA 3UORA 5JTYB 1UQWA 1QJMA 4F3GA 1MY4A 1IXIA 4M1VA 4XKPA 2FYIA 5H8QA 5ITOA 3Q28A 3KOSA 1XHYA 2AL4A 2HZKA 4MFIA 3A3UA 1YAEA 4FAJA 2DWHA 4NEDA 3UP9A 1H44A 4ELOA 3EQ1A 4EQ7A 1OIBA 5I2NA 1MXZA 2UXAA 5DVJA 2RCAA 3DP6A 2V25A 1LBCA 2Q9TA 1LCTA 5B7DA 1PBQA 4ZZEA 2UVGA 2P2AA 4F3SA 4WEPA 1QVSA 5H8NB 2F34A 2O1MA 3FATA 4YKIA 4IO6A 4BDQA 2Z23A 2XD3A 1SYIA 3BBRA 3UGWA 2G29A 3K0VA 4KI0E 2ZNTA 4PETA 3V5AA 3HO7A 4OTEA 1URGA 5I56A 5I57A 4I1DA 3IORA 4ZE8A 1B7ZA 2ONRA 3E4RA 1AOVA 3JYRA 2Z8EA 2IA4A 3HHGA 4NF6B 1BP5A 3KGCA 1MM6A 3FGSA 5KDTA 5EYFA 3S4UA 4IO7A 1US5A 3H6WA 5H8HA 4OERA 2YJPA 3FASA 5ICQA 3GBBA 3U92A 4QF9A 1A8EA 4LATA 4ESWA 3T9VA 1GGGA 4IO4A 1DTGA 1LFIA 3KEIA 3HCQA 2D5WA 3QYTA 3TKDA 4LQ5A 1Y3QA 3H7MA 4UACA 3IJOB 4NF8A 3MZ9A 1JW1A 3FXRA 3T66A 3RLFE 5ELVA 2OZZA 3CRBA 1FQBA 4YZZA 4WEDA 3EPEA 2IEEA 2O1LA 4Q5TA 3O2AA 5H8FA 5HM4B 4YB6A 1WVJA 3TTMA 1MQGA 1SW1A 4HS7A 1Y20A 2QMWA 1USYH 4GFRA 4LUBA 1B5HA 2Y7RA 4ZZAA 5FHOA 3EHSA 1POY1 1PDAA 3VLUA 3CG3A 1JW4A 1H45A 1J1NA 3ZSFA 5CBSA 4DLDA 1MQJA 4JWXA 3LC8A 5BWJA 1WDNA 2Z22A 1IITA 2I4CA 4QSCA 5I58A 3K2DA 3PUYE 4DE8A 5EHMA 1GTKA 3W9VA 3EHTA 3K6WA 1BTJA 1N3WA 4U21A 4DXUA 3VDFA 4X1DA 2B65A 1PB8A 3BFTA 4U4XA 1B3EA 4IY6A 1T0KA 3CR9A 1Q35A 3IO4A 2A5SA 4O3AA 1FQDA 3KJ7A 5I59B 1JVXA 3CI8A 2OK2A 3GXAA 3IX1A 1AIVA 1MM7A 2RKMA 2F8DA 3BFUA 3IJXB 3G3IA 3FJGA 3Q27A 3E3KA 4G68A 3CG1A 2XXVA 2UVHA 4YB5A 4H6DA 3K02A 1MDQA 4JDFA 4PE5B 3U94A 4KYEA 4IY5A 2D21A 1B32A 3Q29A 3V83A 3RTWB 5TPAB 2QS4A 5CI5A 4YKPA 2O7IA 2HXWA 4OWDA 4ZECA 3TTKA 1P99A 4GIZA 2F97A 2ZNUA 1Z7NE 2Y7KA 2H98A 3M3LA 2Q88A 2V3TA 4OESA 3SESA 1EH3A 2XXIA 1B51A 1H76A 4NF4A 3MP1A 3O97A 2I6EA 3KOTA 4GL8A 2DE2A 3CSBA 1B1XA 3FXQA 2O68A 3UA8A 4I9DA 4POWA 3K1NA 4U1ZA 2GFEA 3Q26A 2F7CA 3S9MC 5A5XA 1POTA 1QKBA 3H4ZA 1MQHA 1B40A 3BKIB 4KR5A 3MAMA 5CMCA 3T9HB 2ZMBA 3UIFA 3IL1B 4QFKA 1ZMGA 1DPPA 1B3GA 4ZEIA 3C36A 4RK2A 2X7PA 1GR2A 3R6UA 4FIMA 2HQ0A 4FE8A 4F18A 1LCFA 3VFJA 4RA1A 3MBPA 4ZEFA 3O6GA 4IO5A 1OVTA 4EXKA 4XXUA 3V89B 4HTGA 4G8MA 5I57B 1Z7ME 2GHBA 3FVNA 3A09A 3P7IA 4ELRA 5ICTA 1II5A 3MVZA 3TZAA 3OO9A 4AB6A 3SDFA 5KDTB 1MPDA 1PEBA 2QMXA 2Q8JA 4EF2A 2GRVA 4QFLA 3U1OA 3RN8A 5H8HB 4RPOA 4LZ7A 4JXIA 3N6UA 3M3KA 4P11A 4QFOA 3KJTA 2XXUA 4GWOA 3SEXA 2HAUA 1VSOA 1YTVA 1Y9UA 1MQDA 4XKQA 4BDOA 2DSFA 4YMAA 3SEUA 1B46A 2I3VA 1ATGA 4OXVA 4GXAA 1MH3A 4R72A 4C0RA 4GRKA 3JZJA 4RK9A 1ZKBA 5CM6A 3TYHA 4RJZA 3KN8A 4M4GA 5TPAA 3FUZA 4NF8B 3ZS6A 1OQGA 3D4CA 3PMWA 2YPNA 2F5XA 2XXPA 4GD5A 1BLFA 5H8FB 3KZGA 4NWCA 3OD7A 3DELB 3C31A 4K3FA 2NWJA 2OWTA 5F1QA 3RPWA 2I58A 4OFJA 3H6UA 4OEVA 3OXNA 3TAJA 1UTBA 4H67A 1ANFA 3RY3A 1HSLA 5TP9A 3TQWA 3QIMA 2R6GE 1N76A 4OQOA 1LB8A 2VOZA 3L6GA 4ZEKA 3FVKA 3S9NC 5I58B 2DQVA 1MDP1 4PP0A 2XXYA 5FTHA 4FATA 1I6AA 2ONKE 2DE3A 2XHDA 3DM0A 5L9OA 1OVBA 4KFQA 2F35A 4X48A 2X7QA 5DVIA 2RCBA 4ZEDA 4RY1A 2NUVA 1R9QA 1A55A 3DP8A 2HFBA 2Q2AA 4TLLB 5AA1A 3RNNA 2O84X 1FQAA 5DEXB 4ZE9A 4KD5A 1DMBA 1SI0A 3O66A 4F3BA 3RGYA 1MY2A 1ZBMA 4JSDA 2B3FA 3SETA 1P1OA 3QUJA 4G68B 5DYHA 2GH9A 3O9PA 4DZ1A 3U8QA 2PX1A 5AA2A 1URSA 4IGTA 2E0SA 4QFPA 3DLNA 5K2YA 4MLQA 2I0CA 1XS5A 3O29A 5LOMA 4JB7A 1GV8A 4FORA 1LAHE 4H8IA 3VXCA 4JSOA 4OFLA 3VVFA 4DIGA 1MH4A 1MXXA 3MVXA 4GXSB 4XKRA 4H8JA 4QFNA 2A5TA 4XTCQ 3MPLA 1LAGE 4OETA 1QUJA 2QJEA 2VHAA 4KYSA 2Q89A 3LSWA 5CRYA 3M3FA 4NF4B 5CC2A 1CE2A 1P1UA 4QHQA 1XVXA 1M5DA 4GQOA 3PUZE 1FW0A 1JEUA 3K00A 4THIA 4MBPA 3B7DA 4YMBA 1EU8A 3HSTA 2H9BA 3ZKLA 5A5XB 4NWDA 3PPPA 4JBZA 3IOTA 3GZGA 2W7YA 1AMFA 3TEPA 3KN3A 3HHFA 4F2QA 4C1UA 1LFHA 4NF5A 5ISUA 1ELJA 4F1YA 3W9WA 1H43A 4G8NA 3N5LA 3RQTA 4EDPA 3LSFB 1M5BA 1B52A 4EF1A 3SKPA 4LA9A 4OEUA 3VV5A 4O3CA 5AE4A 4MLVA 2O51A 3MPKA 3VVEA 1AL3A 5BUUA 4ZEBA 1AH5A 1P1QA 4YKJA 1NNFA 1ZTYA 1MXUA 1M5FA 4KHZE 2OBGA 3C4MA 2F36A 3T9XB 1O7TA 3G3KA 3C32A 2O69A 3KFMA 5IAIA 3B6QA 3FV2A 2DXYA 5DVFA 1PBPA 1FQFA 3K01A 2I0BA 1SBPA 5TU0A 4H5FA 3S9LC 3PV0E 5DEXA 3QUFA 1A8FA 2QSXA 1Y4CA 3I6VA 3S2VA 4Q0CA 2NXOA 3B6WA 1OLCA 3QK6A 4I62A 3MP6A 1XOCA 1MPBA 3OELA 1JETA 5FHNA 4IO3A 4C1TA 2PVUA 3IAZA 4OZ9A 1MY1A 1MXYA 2ZNSA 5M2VA 2DXRA 2VD3A 2V3UA 4DDDA 2Q2CA 4H5GA 2F6PA 4O3BA 1B5IA 4DXBA 4XIGQ 1YCJA 1F9BA 3PUXE 1B7UA 3PPRA 1B3HA 5I84A 4HCWA 5FTIA 1HSJA 1IXCA 2DYXA 2VGQA 3QXMA 2ZYNA 3FXUA 3H6TA 2XD2A 3TODA 1ZU0A 1NKXA 3TTLA 2ESNA 1UTBB 1B7HA 2HZLA 5TP9B 1B6HA 3G3JA 3CSGA 3PD8A 4FEDA 2WKYA 1VFDA 1B2HA 4P0GA 1XT8A 1NNTA 1YPNA 2F7AA 3K4UA 2I48A 2PBWA 1JNFA 4IO2A 3RT8A 3PPNA 2PMSA 1TFDA 4H0WA 3Q25A 1MXVA 4N07A 3G3GA 1VR5A 5CMMA 4HW8A 1TWYA 1B05A 4FECA 1SD3A 4R73A 1HSEA 2LAOA 3IOUA 4RXLA 3S9EA 5F7VA 1P1WA 3OO6A 1IUDA 2RC9A 1R9LA 4JWOA 2VP1A 2XX8A 4ZDMA 1LGBC 3LBSA 3I5OA 2I49A 4R6HA 4IGRA 4AQ4A 4PFTA 2ZXTA 1FQCA 1UTHB 3HPIA 3CVGA 1N84A 5JEIA 3TTRA 1S9TA 3MC2A 3PGFA 2Y7PA 1GVCA 1SW5A 1N3XA 4L17A 5AA2B 3ONMA 1MQIA 1CB6A 5EHSA 2HCAA 1SVXB 3K6XA 3MQ9A 2DOJA 1B0LA 4TOZA 3PD9A 3WAFA 4ZS9A 4POXA 4PQJA 1JQFA 3TMGA 4XKNA 2DWJA 3TCGA 2OLBA 4YU0A 2O7UA 4EQBA 1NH8A 2XXTA 1NMUA 2UVIA 1UIUA 4MH5A 1SI1A 2A5TB 1FTKA 3TFLA 4H1XA 5KCJA 3PUWE 3TCFA 3OOAA 3OO7A 3VLVA 5J1DA 1LSTA 4LP2B 1LLSA 1QUIA 2ZYKA 1LAXA 1UIVA 3F11A 1I69A 4LVQA 3RUMA 3DP4A 4ONYA 4F1UA 3H06B 3OO8A 3RT6B 3TQLA 5CBRA 5L8DA 3MJNA 4F3PA 3MVYA 2Y7WA 2HAVA 3USDA 1WODA 3PPQA 3EF7A 1MPCA 3FV1A 3ILTB 4MF3A 1R6ZA 4X1BA 3G3HA 1NFTA 1B9JA 3FIRA 4FJPA 1IEJA 1BKAA 2F7BA 2UYEA 3FJMA 4YAHX 2HEUA 1URDA 4NF5B 5AA4A 2CZLA 2P1SA 3I3VA 4RPNA 1D9VA 3WAEA 4BDNA 5JK4A 3R7XA 1IIWA 1SW2A 2UVJA 3G7WA 1N0TA 2REGA 1MY3A 2ABHA 1NNKA 5L9MA 3PUVE 1O63A 3MZBA 3LUYA 4KQPA 1ZIUA 3PU5A 4G2ZA 2ALUA 2DVCA 1A99A 4OVJA 3T93B 3PPOA 3TELA 2F6GA 3QSLA 2QS3A 3R26A 1P1NA 2RC8A 3PMXA 1EZOA 3A3CA 4ESXA 3GBAA 2NOOA 1XC1A 1N04A 1ZJLA 4LQ2A 4WKMA 1D9YA 3TUSA 1I6BA 1BIYA 2QRYA 3MW0A 1B5JA 1B3LA 2DE4A 2OWSA 2KLFA 3KG2A 5HBCA 3IB1A 2I3WA 4RNSA 1UTHA 4I8CA 3N94A 1QKAA 3IB2A 3CFZA 4OFOA 4Z0IA 5DT6A 3G3FA 5KZTA 1RYXA 4F2OA 4GL0A 2DWIA 1M5EA 1FCKA 4N6PA 1S7YA 4UA8A 1FTMA 2F78A 1RYOA 4ELQA 2XXRA 2XXQA 4R2FA 4KPTA 2QPQA 4F19A 3VXBA 1A40A 4R75A 3MZ1A 2UYFA 4G77A 3SEWA 1VE4A 4YB7A 4ECFA 2V93A 3IK6B 1I6QA 1PB7A 3O6IA 1IQ7A 1SYHA 3FVGA 1Q1KA 1IXHA 1ZLQA 2FA7A 3CIJA 3C33A 3N6TA 1SDXA 2QS1A 2V3QA 4E0XA 2REJA 3SEVA 4RYAA 4GF8A 4BDRA 2VD2A 2H99A 3HV1A 2B3BA 3U93A 4HCYA 1US4A 4P0IA 3SERA
chains in the Genus database with same CATH superfamily
2FHYA 5AA2D 3IOVA 3W15C 2RF1A 4N4UA 4NAPA 4OVQA 4TLMB 3FZVA 1OMPA 1JW5A 4HXVA 4LN5A 4U23A 3L6HA 1MS7A 1S50A 3C9HA 4BDLA 1FTJA 2DWAA 4R9GA 2I4BA 3VVDA 2RINA 3IB0A 3THIA 3LR1A 4U2RA 3U72A 2FVZA 3TTNA 3IOWA 4PAIA 3EHUA 1NUXA 1OQHA 2FNCA 2R9JA 4MMPA 3GLBA 3TDJA 2H4IA 5JTYA 3O6HA 4LONB 1IXGA 1DTZA 2ZYOA 2XX9A 4G68C 1IMCA 1RKMA 2Y84A 4MNCA 4X9TA 4R74A 5DTBA 1EYKA 3H6VA 1IMAA 2QVVA 1B4HA 4ND9A 4HE1A 5AA3A 2F3DA 1L5TA 4TQUQ 1FTLA 1B0HA 3OMBA 4P9KA 3IR1A 4HE0A 3VE1B 4GX4A 4EQ9A 3LSXA 1IZ1A 3T96B 5B70A 4OYVA 5H8SA 1EZPA 5H8NA 2PFYA 1M5CA 1MY0A 5KCJB 4LZ8A 2OJTA 4ELPA 4Q8RA 5ITPA 4DCXA 1FTOA 4NE4A 4QSEA 1FPGA 2M8CA 1LBBA 1Y3PA 2Y7IA 4U4SA 1QW0A 3H3GA 4KCDA 3T22A 3KN7A 4N13A 4GVOA 5I2KB 3M8UA 1D4NA 5IKBA 1NH7A 3K6UA 1INPA 4G8HA 3B6TA 1LAFE 1PC3A 1A54A 2XXKA 4QRZA 4NF6A 2CZIA 3VLWA 1LBVA 4KYDA 1JVYA 2VT5A 3SEYA 5K2XA 3EN3A 3MSTA 2QL3A 1MRPA 3V8XB 1EZ9A 1H3DA 1XVYA 4H65A 5AA4B 4R6YA 4YICA 3RTFB 3ILUB 2H5YA 1KWHA 3C35A 2QS2A 4MX6A 1B58A 1OLAA 3TPAA 4ISUA 2PT1A 4F1VA 3QAXA 3H03A 4BLAA 4OMBA 4GOTA 1FPEA 4R6KA 3NOHA 1VFEA 4Q30B 2V84A 2AIXA 1N7WA 3FVOA 1TT1A 4F39A 1Y4TA 2ANJA 3K1PA 2FIXA 5H8QB 2CMOA 4PFUA 3JV9A 2PYYA 2O6AA 2CZHA 3ISPA 2Z8DA 2D3IA 4H45A 4OA4A 1NV0A 4PFWA 4F22A 2G93A 5L9SA 4N6DA 2XXHA 2THIA 1O64A 5I2NB 2X26A 3E13X 5FHMA 3OENA 4GLIA 4QSDA 3ECRA 1NI9A 1NV5A 3CFLA 3D4GA 1YYZA 3PMVA 2OCUA 3KBZA 3MP8A 2BJJX 4R9FA 2AL5A 3MVWA 3LSLA 1SQYA 4KCCA 4OENA 4PDDA 3OSQA 2RC7A 5I7IA 3UN6A 1D3KA 2R71A 2Y5LA 3IO6A 5IZ3B 3FJ7A 3O28A 2XX7A 3MUQA 3RPLA 3B50A 3OSRA 3HN0A 4NTLA 1QULA 5I56B 4PGNA 2ONSA 4BDMA 1B4ZA 2DVZA 3CFXA 2E1SA 4E0WA 1TFAA 4DI4B 4O8MA 3N26A 1Y1MA 5I3SA 4WXJA 3KSXA 1B1HA 1DOTA 1MG1A 5I59A 2Z8FA 4FEBA 2P0SA 3KSJA 1TXFA 4AB5A 2OWZA 2YLNA 4F31B 2XXWA 3ODBA 4YKKA 4OVRA 4EUOA 3OEMA 1R1NA 3T9UA 2AYSA 2DS9A 3MWBA 5I2KA 4GWWA 4R2BA 1PB9A 3K1MA 2GHAA 4NMYA 2XXXA 3E9XA 3K6VA 2DP8A 1DCUA 3BIGA 2ZZVA 4U22A 3UK4A 4LZ5A 3MYUA 1B3FA 4G4PA 3C34A 1Y3NA 1A7LA 2H25A 3IFAA 3KBRA 3OEKA 1FQEA 4U1OA 5CMKA 4GWYA 4DCYA 1NL5A 4O94A 4EXLA 3TCHA 4OVTA 1K9YA 4PBHA 1LB9A 4IB2A 1NNPA 1DSNA 1N7XA 1DPEA 4F29A 4Z7EA 1LFGA 1USYE 1JEVA 4MCOA 3T0JA 4NQ8A 4JWYA 3ROJA 1QUKA 4OHNA 4DXCA 2PT2A 5HPQA 5CMBA 3FD3A 2NVUB 4PFYA 1MXWA 2ZYMA 1Y1ZA 3SZPA 3AXFA 1SW4A 3ZKKA 3UORA 5JTYB 1UQWA 1QJMA 4F3GA 1MY4A 1IXIA 4M1VA 4XKPA 2FYIA 5H8QA 5ITOA 3Q28A 3KOSA 1XHYA 2AL4A 2HZKA 4MFIA 3A3UA 1YAEA 3A29A 4QBAA 4FAJA 2DWHA 4NEDA 5T3JA 3UP9A 1H44A 4ELOA 3EQ1A 4EQ7A 1FPDA 1FJ9A 1OIBA 5I2NA 1MXZA 2UXAA 4N15A 5DVJA 2RCAA 3DP6A 2V25A 1LBCA 2Q9TA 4AS5A 1LCTA 5B7DA 1PBQA 3D1RA 4ZZEA 2WEFA 2UVGA 2P2AA 4F3SA 4WEPA 4N17A 1QVSA 3BIHA 4PE3A 5H8NB 3FXBA 2F34A 1YZ0A 2O1MA 2Y5KA 3FATA 2CZKA 4YKIA 4IO6A 4BDQA 2Z23A 2XD3A 1SYIA 3BBRA 3UGWA 2G29A 4X8RA 3K0VA 4KI0E 2ZNTA 4PETA 3V5AA 3HO7A 4OTEA 4P8BA 1URGA 5I56A 5I57A 4I1DA 3IORA 1NV6A 4ZE8A 1B7ZA 2ONRA 3E4RA 1AOVA 3JYRA 2Z8EA 2IA4A 3HHGA 4NF6B 1BP5A 3KGCA 1MM6A 3FGSA 5KDTA 4H46A 2VPOA 5EYFA 3S4UA 4IO7A 1US5A 3H6WA 1FPLA 5H8HA 4OERA 2YJPA 3FASA 5ICQA 3GBBA 3U92A 4QF9A 4GWUA 1A8EA 2QVUA 4LATA 4ESWA 1NV7A 1FRPA 3T9VA 1GGGA 4IO4A 1DTGA 1LFIA 3KEIA 4X04A 3HCQA 2D5WA 3QYTA 2BJIA 5IZ1A 3TKDA 4N81A 4LQ5A 1Y3QA 3H7MA 4UACA 4PAKA 3IJOB 4NF8A 2CEYA 3MZ9A 1JW1A 3FXRA 3T66A 3RLFE 5ELVA 2OZZA 3CRBA 1FQBA 4YZZA 4WEDA 3EPEA 2IEEA 2O1LA 4Q5TA 3O2AA 5H8FA 5HM4B 4YB6A 1WVJA 1G0IA 3TTMA 1MQGA 1SW1A 4HS7A 1Y20A 2QMWA 1USYH 4GFRA 4LUBA 4N6KA 1B5HA 1LBZA 2Y7RA 1LBYA 4ZZAA 5FHOA 3EHSA 1POY1 1PDAA 3VLUA 3CG3A 1JW4A 1H45A 1J1NA 3ZSFA 5CBSA 4DLDA 1MQJA 4JWXA 3LC8A 5BWJA 1WDNA 2Z22A 1IITA 2I4CA 4QSCA 5I58A 3K2DA 3PUYE 4DE8A 5EHMA 1GTKA 3W9VA 3EHTA 1RDXA 3K6WA 1BTJA 3RPLB 1N3WA 4U21A 4DXUA 3VDFA 4X1DA 2B65A 1PB8A 3BFTA 2R8TA 4U4XA 1B3EA 4IY6A 1T0KA 3T1BA 4JVIA 3CR9A 1Q35A 3IO4A 2A5SA 4O3AA 1FQDA 3KJ7A 5I59B 1JVXA 3CI8A 2OK2A 3GXAA 2QVRA 3IX1A 5A5LA 4PCDA 1AIVA 1MM7A 2RKMA 2F8DA 3BFUA 3IJXB 5EQ8A 3G3IA 3FJGA 4N91A 2ZZXA 3Q27A 3E3KA 4G68A 3CG1A 2XXVA 2UVHA 4YB5A 4H6DA 3K02A 1MDQA 4JDFA 4PE5B 3U94A 4KYEA 4IY5A 1NUZA 2WYKA 2D21A 1B32A 3Q29A 2F3BA 3V83A 4PFRA 3RTWB 5TPAB 2QS4A 5CI5A 4YKPA 2O7IA 2XWKA 3E79A 2HXWA 4OWDA 2V4CA 4ZECA 3TTKA 1P99A 4GIZA 2F97A 2ZNUA 1Z7NE 2PFZA 1JP4A 4GWZA 2Y7KA 1Q9DA 4I3EA 2H98A 4MIJA 3M3LA 2Q88A 2V3TA 4OESA 3SESA 1EH3A 4NX1A 2XXIA 1B51A 1H76A 4NF4A 3MP1A 3O97A 2I6EA 3KOTA 4GL8A 2DE2A 3CSBA 1B1XA 3FXQA 2O68A 3UA8A 4I9DA 4POWA 3K1NA 1VDWA 4U1ZA 2GFEA 3Q26A 2PCRA 2F7CA 3S9MC 5A5XA 1POTA 1QKBA 3FBPA 3H4ZA 1MQHA 1FBPA 1B40A 3BKIB 4KR5A 3MAMA 5CMCA 3T9HB 2ZMBA 3UIFA 3IL1B 4NG7A 4QFKA 1ZMGA 1DPPA 1B3GA 4ZEIA 3C36A 4RK2A 2X7PA 1GR2A 3R6UA 4FIMA 2HQ0A 4FE8A 1LCFA 4F18A 3VFJA 1NV3A 4RA1A 1FBEA 1RDYA 3MBPA 1FBDA 4ZEFA 1QGXA 1FSAA 3O6GA 4IO5A 1OVTA 4EXKA 4XXUA 3V89B 4HTGA 4G8MA 5I57B 1Z7ME 2GHBA 3FVNA 3A09A 3P7IA 4ELRA 5ICTA 1II5A 3MVZA 3TZAA 3OO9A 4NHBA 3B8BA 4AB6A 3SDFA 2XWOA 5KDTB 1MPDA 1PEBA 2QMXA 2Q8JA 4EF2A 2GRVA 4QFLA 3U1OA 3RN8A 5H8HB 4RPOA 4LZ7A 4JXIA 3N6UA 4PGPA 3M3KA 4P11A 4QFOA 3KJTA 2XXUA 4GWOA 3SEXA 2HAUA 1VSOA 1YTVA 1Y9UA 1MQDA 4XKQA 4BDOA 5LTCA 4JVCA 2DSFA 4YMAA 3SEUA 1B46A 2I3VA 1ATGA 4OXVA 1FBFA 4GXAA 1MH3A 5IZZA 4R72A 4C0RA 4GRKA 2L5VA 3JZJA 4RK9A 1ZKBA 2ZZWA 5CM6A 3TYHA 4RJZA 3KN8A 3LUZA 4M4GA 4DI3D 5TPAA 3FUZA 1IMFA 1EYJA 4PDHA 4NF8B 3ZS6A 1OQGA 3D4CA 3PMWA 2YPNA 2F5XA 2XXPA 4GD5A 1BLFA 3KC0A 5H8FB 3KZGA 4NWCA 2JJKA 3OD7A 3DELB 3C31A 3GYYA 4K3FA 2NWJA 2OWTA 5F1QA 3RPWA 2I58A 4OFJA 3H6UA 4OEVA 3OXNA 3TAJA 1UTBA 4H67A 1ANFA 3RY3A 1HSLA 5TP9A 3TQWA 4MNPA 3QIMA 2R6GE 1N76A 4OQOA 1LB8A 2VOZA 2WX9A 3L6GA 4ZEKA 1DBZA 3FVKA 3S9NC 2MKZA 5I58B 2DQVA 1G0HA 1MDP1 4PP0A 2XXYA 1FPIA 4I40A 5ET7A 5FTHA 4FATA 1I6AA 2ONKE 2DE3A 1FPBA 2XHDA 3DM0A 3RYDA 5L9OA 1OVBA 4QXDA 3U65A 4KFQA 2F35A 4X48A 4GWXA 4PBQA 2X7QA 5DVIA 2RCBA 4P3LA 4ZEDA 4RY1A 2NUVA 1R9QA 1A55A 3DP8A 2HFBA 2Q2AA 4TLLB 5AA1A 3RNNA 1LBXA 2O84X 1FQAA 5DEXB 4ZE9A 4KD5A 1DMBA 1SI0A 3O66A 4F3BA 3RGYA 1MY2A 1ZBMA 4JSDA 2B3FA 3SETA 1P1OA 3QUJA 4G68B 4PC9A 5DYHA 2GH9A 1CNQA 5IGAA 2KR0A 3O9PA 4DZ1A 3U8QA 2PX1A 5AA2A 1URSA 4IGTA 2E0SA 4QFPA 3DLNA 2P3NA 4PFIA 5K2YA 4MLQA 1KA1A 1RDZA 2I0CA 4IR8A 1XS5A 3O29A 5LOMA 4JB7A 1GV8A 4O7MA 4FORA 1LAHE 4H8IA 3VXCA 4JSOA 4OFLA 3VVFA 4DIGA 1MH4A 1MXXA 3MVXA 1BK4A 4GXSB 4XKRA 4H8JA 4QFNA 2A5TA 4XTCQ 3MPLA 1NV1A 1LAGE 4OETA 4MNIA 5FBPA 1QUJA 4KYSA 2QJEA 2VHAA 2Q89A 3LSWA 5CRYA 3M3FA 4NF4B 5CC2A 1CE2A 1P1UA 2Q8MA 1EYIA 4QHQA 1XVXA 1M5DA 1IMDA 4GQOA 3PUZE 1FW0A 1JEUA 5ET8A 3K00A 4THIA 2DDKA 4MBPA 3B7DA 2VPNA 4YMBA 2Q74A 5EYGA 1EU8A 2P3VA 3HSTA 2H9BA 1IMEA 3ZKLA 5A5XB 4NF0A 4NWDA 3PPPA 4JBZA 3IOTA 1IMBA 3GZGA 1LEVA 2W7YA 1AMFA 3TEPA 3KN3A 3HHFA 4F2QA 4C1UA 1LFHA 4NF5A 5ISUA 1NV2A 1ELJA 2B4MA 1KZ8A 4F1YA 3W9WA 1H43A 4G8NA 3N5LA 3RQTA 4EDPA 3LSFB 1M5BA 4OANA 1B52A 4EF1A 3SKPA 4LA9A 4OEUA 3VV5A 4O3CA 5AE4A 4MLVA 2O51A 2WBBA 3MPKA 3VVEA 1AL3A 5BUUA 4ZEBA 2XA5A 1AH5A 3QMFA 1P1QA 4YKJA 1NNFA 1ZTYA 1MXUA 1M5FA 2HHMA 4KHZE 2OBGA 5DW8A 4HE2A 3C4MA 2F36A 3T9XB 4GBVA 1O7TA 3G3KA 4MEVA 3C32A 2O69A 3KFMA 5IAIA 3B6QA 3FV2A 2DXYA 5DVFA 1DK4A 1PBPA 1FQFA 3K01A 2I0BA 1SBPA 5TU0A 4H5FA 3S9LC 2GQ1A 3PV0E 5DEXA 2KQZA 3QUFA 4OVPA 1A8FA 2QSXA 1Y4CA 3I6VA 3S2VA 4Q0CA 2NXOA 3B6WA 1OLCA 3QK6A 4I62A 3MP6A 1XOCA 1MPBA 3OELA 1JETA 5FHNA 4IO3A 4C1TA 2PVUA 3IAZA 4OZ9A 1MY1A 4XFEA 1MXYA 5I5PA 4O7IA 2WBDA 2ZNSA 5M2VA 2DXRA 1XI6A 2VD3A 2V3UA 4DDDA 2Q2CA 4H5GA 2F6PA 4O3BA 1NV4A 1B5IA 4DXBA 4XIGQ 2XWIA 1YCJA 1F9BA 3PUXE 1B7UA 3PPRA 2B4LA 1B3HA 5I84A 4HCWA 5FTIA 1HSJA 1IXCA 2DYXA 2VGQA 3QXMA 2ZYNA 3FXUA 3H6TA 2XD2A 3TODA 1ZU0A 2HXRA 1NKXA 3TTLA 2ESNA 1UTBB 4NGUA 1B7HA 2HZLA 5ET5A 5TP9B 1B6HA 3G3JA 3CSGA 3PD8A 4FEDA 2WKYA 1SPIA 1VFDA 1B2HA 4P0GA 1XT8A 1NNTA 1YPNA 2F7AA 2WYPA 3K4UA 2I48A 2PBWA 4XF5A 1JNFA 4PAFA 4NN3A 4IO2A 3RT8A 3PPNA 2PMSA 1TFDA 4H0WA 4GBWA 3Q25A 1MXVA 4N07A 3G3GA 4PTKA 1VR5A 5CMMA 4HW8A 1TWYA 1B05A 2FIEA 4FECA 1SD3A 4R73A 4GX3A 1HSEA 2LAOA 3IOUA 4RXLA 3S9EA 5EQAA 5F7VA 1P1WA 3OO6A 1IUDA 3CHGA 2RC9A 4P47A 1R9LA 4JWOA 2VP1A 2XX8A 4ZDMA 2FBPA 1LGBC 3LBSA 3I5OA 2I49A 4R6HA 4IGRA 4AQ4A 4PFTA 2ZXTA 1NUYA 1FQCA 1UTHB 3HPIA 4XEQA 3CVGA 1N84A 5JEIA 3TTRA 1S9TA 3MC2A 3PGFA 2Y7PA 1GVCA 1SW5A 1N3XA 4L17A 5AA2B 3E78A 3ONMA 1MQIA 1CB6A 5EHSA 2HCAA 1SVXB 3K6XA 4GX6A 3MQ9A 2DOJA 5ET6A 1B0LA 4TOZA 3PD9A 4JVDA 3WAFA 4ZS9A 4POXA 4PQJA 1JQFA 3TMGA 4XKNA 1NUWA 2DWJA 3TCGA 2OLBA 4YU0A 2O7UA 4EQBA 1NH8A 2XXTA 1NMUA 3IFCA 2UVIA 1UIUA 4MAGA 4MH5A 1SI1A 4G61A 2A5TB 4KXPA 1FTKA 3TFLA 4H1XA 4PF6A 5KCJA 3PUWE 3TCFA 3OOAA 3OO7A 3VLVA 5J1DA 1LSTA 4LP2B 5LDZA 1LLSA 1QUIA 5F24A 2ZYKA 1LAXA 1UIVA 3F11A 1FBCA 1I69A 4LVQA 3RUMA 2OX3A 1FPFA 3DP4A 5EYHA 4ONYA 1FBHA 4F1UA 3H06B 3OO8A 3RT6B 3TQLA 5CBRA 5L8DA 4P1LA 3MJNA 4F3PA 3MVYA 2Y7WA 2HAVA 3USDA 1WODA 3HFUA 3LV0A 3PPQA 4OVSA 3EF7A 1MPCA 3FV1A 1FJ6A 3ILTB 4MF3A 1R6ZA 4X1BA 3G3HA 1NFTA 1B9JA 3FIRA 4FJPA 1IEJA 1BKAA 1K9ZA 2F7BA 2UYEA 3FJMA 4N8GA 4YAHX 2HEUA 1URDA 4NF5B 4P56A 5AA4A 2QFLA 2CZLA 1KA0A 2P1SA 3I3VA 5EQ7A 4RPNA 1D9VA 5EQ9A 3WAEA 4BDNA 2XWVA 5JK4A 3R7XA 1IIWA 1SW2A 2UVJA 3G7WA 4MHFA 1N0TA 2REGA 1MY3A 2ABHA 1NNKA 5L9MA 3PUVE 1O63A 3MZBA 3LUYA 4KQPA 5ESYA 1ZIUA 3PU5A 4UABA 4G2ZA 2ALUA 2DVCA 1A99A 4OVJA 3T93B 3PPOA 3TELA 2F6GA 3QSLA 2QS3A 3R26A 1P1NA 2RC8A 3PMXA 1EZOA 3A3CA 4ESXA 3GBAA 4MJOA 1FPKA 2NOOA 1XC1A 1N04A 1ZJLA 4N8YA 4PF8A 4LQ2A 1AWBA 3PTYA 4WKMA 1D9YA 3TUSA 1I6BA 1BIYA 2QRYA 3MW0A 1YXIA 1B5JA 4I3YA 1B3LA 4P1EA 2DE4A 2OWSA 2KLFA 3KG2A 5HBCA 1D9QA 3IB1A 2I3WA 4RNSA 1UTHA 1FBGA 4I8CA 3N94A 1QKAA 3IB2A 3CFZA 4OFOA 4Z0IA 5DT6A 3G3FA 5KZTA 1RYXA 4F2OA 4GWSA 4GL0A 2DWIA 5IZ3A 1M5EA 1FCKA 4N6PA 1S7YA 4UA8A 1FTMA 2F78A 1RYOA 4ELQA 2XXRA 2XXQA 4R2FA 4KPTA 2QPQA 4F19A 3VXBA 4PFBA 1A40A 2CEXA 4R75A 3MZ1A 2UYFA 4G77A 3SEWA 1VE4A 4YB7A 4ECFA 2V93A 3IK6B 1I6QA 1PB7A 2HPGA 3O6IA 1IQ7A 1SYHA 3FVGA 1FTAA 1Q1KA 1IXHA 1ZLQA 4AS4A 2FA7A 3CIJA 3C33A 3N6TA 1SDXA 2QS1A 2V3QA 4E0XA 2REJA 3SEVA 4RYAA 5IM2A 4GF8A 4BDRA 5J16A 3EKIA 2VD2A 2H99A 3HV1A 2B3BA 3U93A 4HCYA 1US4A 4P0IA 1LBWA 3SERA 3KC1A 1FPJA 4FBPA
chains in the Genus database with same CATH topology
5AA2D 3IOVA 3W15C 2RF1A 4TLMB 3FZVA 1OMPA 1JW5A 4U23A 3L6HA 1MS7A 1S50A 3C9HA 4BDLA 1FTJA 2DWAA 4R9GA 2I4BA 3VVDA 2RINA 3IB0A 3THIA 3LR1A 4U2RA 3U72A 3TTNA 3IOWA 3EHUA 1OQHA 2FNCA 2R9JA 3GLBA 3TDJA 2H4IA 5JTYA 3O6HA 4LONB 1IXGA 1DTZA 2ZYOA 2XX9A 4G68C 1RKMA 2Y84A 4X9TA 4R74A 5DTBA 3H6VA 1B4HA 4ND9A 5AA3A 1L5TA 4TQUQ 1FTLA 1B0HA 3OMBA 3IR1A 3VE1B 4EQ9A 3LSXA 1IZ1A 3T96B 5B70A 4OYVA 5H8SA 1EZPA 5H8NA 1M5CA 1MY0A 5KCJB 4LZ8A 2OJTA 4ELPA 4Q8RA 5ITPA 4DCXA 1FTOA 4NE4A 4QSEA 2M8CA 1LBBA 1Y3PA 2Y7IA 4U4SA 1QW0A 3H3GA 4KCDA 3T22A 3KN7A 4N13A 4GVOA 5I2KB 3M8UA 1D4NA 5IKBA 1NH7A 3K6UA 4G8HA 3B6TA 1LAFE 1PC3A 1A54A 4QRZA 4NF6A 3VLWA 4KYDA 1JVYA 3SEYA 5K2XA 3EN3A 2QL3A 1MRPA 3V8XB 1EZ9A 1H3DA 1XVYA 4H65A 5AA4B 4R6YA 4YICA 3RTFB 3ILUB 2H5YA 1KWHA 3C35A 2QS2A 1B58A 1OLAA 3TPAA 4ISUA 2PT1A 4F1VA 3QAXA 3H03A 4BLAA 4OMBA 4GOTA 4R6KA 1VFEA 4Q30B 2V84A 2AIXA 1N7WA 3FVOA 1TT1A 4F39A 1Y4TA 2ANJA 3K1PA 5H8QB 2CMOA 4PFUA 3JV9A 2PYYA 2O6AA 2Z8DA 2D3IA 4PFWA 4F22A 2G93A 5L9SA 2XXHA 2THIA 1O64A 5I2NB 2X26A 3E13X 5FHMA 3OENA 4GLIA 4QSDA 3ECRA 3CFLA 3D4GA 3PMVA 2OCUA 3MP8A 2BJJX 4R9FA 2AL5A 3MVWA 3LSLA 1SQYA 4KCCA 4OENA 3OSQA 2RC7A 3UN6A 1D3KA 2R71A 3IO6A 3FJ7A 3O28A 2XX7A 3MUQA 3OSRA 3HN0A 4NTLA 1QULA 5I56B 2ONSA 4BDMA 1B4ZA 2DVZA 3CFXA 2E1SA 4E0WA 1TFAA 3N26A 1Y1MA 4WXJA 3KSXA 1B1HA 1DOTA 1MG1A 5I59A 2Z8FA 4FEBA 2P0SA 3KSJA 1TXFA 4AB5A 2YLNA 4F31B 2XXWA 3ODBA 4YKKA 4EUOA 3OEMA 1R1NA 3T9UA 2AYSA 2DS9A 3MWBA 5I2KA 4R2BA 1PB9A 3K1MA 2GHAA 4NMYA 2XXXA 3E9XA 3K6VA 2DP8A 4U22A 3UK4A 4LZ5A 1B3FA 4G4PA 3C34A 1Y3NA 1A7LA 2H25A 3KBRA 3OEKA 1FQEA 4U1OA 5CMKA 4DCYA 1NL5A 4EXLA 3TCHA 1LB9A 4IB2A 1NNPA 1DSNA 1N7XA 1DPEA 4F29A 4Z7EA 1LFGA 1USYE 1JEVA 4JWYA 1QUKA 4OHNA 4DXCA 2PT2A 5HPQA 5CMBA 3FD3A 2NVUB 4PFYA 1MXWA 2ZYMA 1Y1ZA 3AXFA 1SW4A 3ZKKA 3UORA 5JTYB 1UQWA 1QJMA 4F3GA 1MY4A 1IXIA 4M1VA 4XKPA 2FYIA 5H8QA 5ITOA 3Q28A 3KOSA 1XHYA 2AL4A 2HZKA 4MFIA 3A3UA 1YAEA 4FAJA 2DWHA 4NEDA 3UP9A 1H44A 4ELOA 3EQ1A 4EQ7A 1OIBA 5I2NA 1MXZA 2UXAA 5DVJA 2RCAA 3DP6A 2V25A 1LBCA 2Q9TA 1LCTA 5B7DA 1PBQA 4ZZEA 2UVGA 2P2AA 4F3SA 4WEPA 1QVSA 5H8NB 2F34A 2O1MA 3FATA 4YKIA 4IO6A 4BDQA 2Z23A 2XD3A 1SYIA 3BBRA 3UGWA 2G29A 3K0VA 4KI0E 2ZNTA 4PETA 3V5AA 3HO7A 4OTEA 1URGA 5I56A 5I57A 4I1DA 3IORA 4ZE8A 1B7ZA 2ONRA 3E4RA 1AOVA 3JYRA 2Z8EA 2IA4A 3HHGA 4NF6B 1BP5A 3KGCA 1MM6A 3FGSA 5KDTA 5EYFA 3S4UA 4IO7A 1US5A 3H6WA 5H8HA 4OERA 2YJPA 3FASA 5ICQA 3GBBA 3U92A 4QF9A 1A8EA 4LATA 4ESWA 3T9VA 1GGGA 4IO4A 1DTGA 1LFIA 3KEIA 3HCQA 2D5WA 3QYTA 3TKDA 4LQ5A 1Y3QA 3H7MA 4UACA 3IJOB 4NF8A 3MZ9A 1JW1A 3FXRA 3T66A 3RLFE 5ELVA 2OZZA 3CRBA 1FQBA 4YZZA 4WEDA 3EPEA 2IEEA 2O1LA 4Q5TA 3O2AA 5H8FA 5HM4B 4YB6A 1WVJA 3TTMA 1MQGA 1SW1A 4HS7A 1Y20A 2QMWA 1USYH 4GFRA 4LUBA 1B5HA 2Y7RA 4ZZAA 5FHOA 3EHSA 1POY1 1PDAA 3VLUA 3CG3A 1JW4A 1H45A 1J1NA 3ZSFA 5CBSA 4DLDA 1MQJA 4JWXA 3LC8A 5BWJA 1WDNA 2Z22A 1IITA 2I4CA 4QSCA 5I58A 3K2DA 3PUYE 4DE8A 5EHMA 1GTKA 3W9VA 3EHTA 3K6WA 1BTJA 1N3WA 4U21A 4DXUA 3VDFA 4X1DA 2B65A 1PB8A 3BFTA 4U4XA 1B3EA 4IY6A 1T0KA 3CR9A 1Q35A 3IO4A 2A5SA 4O3AA 1FQDA 3KJ7A 5I59B 1JVXA 3CI8A 2OK2A 3GXAA 3IX1A 1AIVA 1MM7A 2RKMA 2F8DA 3BFUA 3IJXB 3G3IA 3FJGA 3Q27A 3E3KA 4G68A 3CG1A 2XXVA 2UVHA 4YB5A 4H6DA 3K02A 1MDQA 4JDFA 4PE5B 3U94A 4KYEA 4IY5A 2D21A 1B32A 3Q29A 3V83A 3RTWB 5TPAB 2QS4A 5CI5A 4YKPA 2O7IA 2HXWA 4OWDA 4ZECA 3TTKA 1P99A 4GIZA 2F97A 2ZNUA 1Z7NE 2Y7KA 2H98A 3M3LA 2Q88A 2V3TA 4OESA 3SESA 1EH3A 2XXIA 1B51A 1H76A 4NF4A 3MP1A 3O97A 2I6EA 3KOTA 4GL8A 2DE2A 3CSBA 1B1XA 3FXQA 2O68A 3UA8A 4I9DA 4POWA 3K1NA 4U1ZA 2GFEA 3Q26A 2F7CA 3S9MC 5A5XA 1POTA 1QKBA 3H4ZA 1MQHA 1B40A 3BKIB 4KR5A 3MAMA 5CMCA 3T9HB 2ZMBA 3UIFA 3IL1B 4QFKA 1ZMGA 1DPPA 1B3GA 4ZEIA 3C36A 4RK2A 2X7PA 1GR2A 3R6UA 4FIMA 2HQ0A 4FE8A 4F18A 1LCFA 3VFJA 4RA1A 3MBPA 4ZEFA 3O6GA 4IO5A 1OVTA 4EXKA 4XXUA 3V89B 4HTGA 4G8MA 5I57B 1Z7ME 2GHBA 3FVNA 3A09A 3P7IA 4ELRA 5ICTA 1II5A 3MVZA 3TZAA 3OO9A 4AB6A 3SDFA 5KDTB 1MPDA 1PEBA 2QMXA 2Q8JA 4EF2A 2GRVA 4QFLA 3U1OA 3RN8A 5H8HB 4RPOA 4LZ7A 4JXIA 3N6UA 3M3KA 4P11A 4QFOA 3KJTA 2XXUA 4GWOA 3SEXA 2HAUA 1VSOA 1YTVA 1Y9UA 1MQDA 4XKQA 4BDOA 2DSFA 4YMAA 3SEUA 1B46A 2I3VA 1ATGA 4OXVA 4GXAA 1MH3A 4R72A 4C0RA 4GRKA 3JZJA 4RK9A 1ZKBA 5CM6A 3TYHA 4RJZA 3KN8A 4M4GA 5TPAA 3FUZA 4NF8B 3ZS6A 1OQGA 3D4CA 3PMWA 2YPNA 2F5XA 2XXPA 4GD5A 1BLFA 5H8FB 3KZGA 4NWCA 3OD7A 3DELB 3C31A 4K3FA 2NWJA 2OWTA 5F1QA 3RPWA 2I58A 4OFJA 3H6UA 4OEVA 3OXNA 3TAJA 1UTBA 4H67A 1ANFA 3RY3A 1HSLA 5TP9A 3TQWA 3QIMA 2R6GE 1N76A 4OQOA 1LB8A 2VOZA 3L6GA 4ZEKA 3FVKA 3S9NC 5I58B 2DQVA 1MDP1 4PP0A 2XXYA 5FTHA 4FATA 1I6AA 2ONKE 2DE3A 2XHDA 3DM0A 5L9OA 1OVBA 4KFQA 2F35A 4X48A 2X7QA 5DVIA 2RCBA 4ZEDA 4RY1A 2NUVA 1R9QA 1A55A 3DP8A 2HFBA 2Q2AA 4TLLB 5AA1A 3RNNA 2O84X 1FQAA 5DEXB 4ZE9A 4KD5A 1DMBA 1SI0A 3O66A 4F3BA 3RGYA 1MY2A 1ZBMA 4JSDA 2B3FA 3SETA 1P1OA 3QUJA 4G68B 5DYHA 2GH9A 3O9PA 4DZ1A 3U8QA 2PX1A 5AA2A 1URSA 4IGTA 2E0SA 4QFPA 3DLNA 5K2YA 4MLQA 2I0CA 1XS5A 3O29A 5LOMA 4JB7A 1GV8A 4FORA 1LAHE 4H8IA 3VXCA 4JSOA 4OFLA 3VVFA 4DIGA 1MH4A 1MXXA 3MVXA 4GXSB 4XKRA 4H8JA 4QFNA 2A5TA 4XTCQ 3MPLA 1LAGE 4OETA 1QUJA 2QJEA 2VHAA 4KYSA 2Q89A 3LSWA 5CRYA 3M3FA 4NF4B 5CC2A 1CE2A 1P1UA 4QHQA 1XVXA 1M5DA 4GQOA 3PUZE 1FW0A 1JEUA 3K00A 4THIA 4MBPA 3B7DA 4YMBA 1EU8A 3HSTA 2H9BA 3ZKLA 5A5XB 4NWDA 3PPPA 4JBZA 3IOTA 3GZGA 2W7YA 1AMFA 3TEPA 3KN3A 3HHFA 4F2QA 4C1UA 1LFHA 4NF5A 5ISUA 1ELJA 4F1YA 3W9WA 1H43A 4G8NA 3N5LA 3RQTA 4EDPA 3LSFB 1M5BA 1B52A 4EF1A 3SKPA 4LA9A 4OEUA 3VV5A 4O3CA 5AE4A 4MLVA 2O51A 3MPKA 3VVEA 1AL3A 5BUUA 4ZEBA 1AH5A 1P1QA 4YKJA 1NNFA 1ZTYA 1MXUA 1M5FA 4KHZE 2OBGA 3C4MA 2F36A 3T9XB 1O7TA 3G3KA 3C32A 2O69A 3KFMA 5IAIA 3B6QA 3FV2A 2DXYA 5DVFA 1PBPA 1FQFA 3K01A 2I0BA 1SBPA 5TU0A 4H5FA 3S9LC 3PV0E 5DEXA 3QUFA 1A8FA 2QSXA 1Y4CA 3I6VA 3S2VA 4Q0CA 2NXOA 3B6WA 1OLCA 3QK6A 4I62A 3MP6A 1XOCA 1MPBA 3OELA 1JETA 5FHNA 4IO3A 4C1TA 2PVUA 3IAZA 4OZ9A 1MY1A 1MXYA 2ZNSA 5M2VA 2DXRA 2VD3A 2V3UA 4DDDA 2Q2CA 4H5GA 2F6PA 4O3BA 1B5IA 4DXBA 4XIGQ 1YCJA 1F9BA 3PUXE 1B7UA 3PPRA 1B3HA 5I84A 4HCWA 5FTIA 1HSJA 1IXCA 2DYXA 2VGQA 3QXMA 2ZYNA 3FXUA 3H6TA 2XD2A 3TODA 1ZU0A 1NKXA 3TTLA 2ESNA 1UTBB 1B7HA 2HZLA 5TP9B 1B6HA 3G3JA 3CSGA 3PD8A 4FEDA 2WKYA 1VFDA 1B2HA 4P0GA 1XT8A 1NNTA 1YPNA 2F7AA 3K4UA 2I48A 2PBWA 1JNFA 4IO2A 3RT8A 3PPNA 2PMSA 1TFDA 4H0WA 3Q25A 1MXVA 4N07A 3G3GA 1VR5A 5CMMA 4HW8A 1TWYA 1B05A 4FECA 1SD3A 4R73A 1HSEA 2LAOA 3IOUA 4RXLA 3S9EA 5F7VA 1P1WA 3OO6A 1IUDA 2RC9A 1R9LA 4JWOA 2VP1A 2XX8A 4ZDMA 1LGBC 3LBSA 3I5OA 2I49A 4R6HA 4IGRA 4AQ4A 4PFTA 2ZXTA 1FQCA 1UTHB 3HPIA 3CVGA 1N84A 5JEIA 3TTRA 1S9TA 3MC2A 3PGFA 2Y7PA 1GVCA 1SW5A 1N3XA 4L17A 5AA2B 3ONMA 1MQIA 1CB6A 5EHSA 2HCAA 1SVXB 3K6XA 3MQ9A 2DOJA 1B0LA 4TOZA 3PD9A 3WAFA 4ZS9A 4POXA 4PQJA 1JQFA 3TMGA 4XKNA 2DWJA 3TCGA 2OLBA 4YU0A 2O7UA 4EQBA 1NH8A 2XXTA 1NMUA 2UVIA 1UIUA 4MH5A 1SI1A 2A5TB 1FTKA 3TFLA 4H1XA 5KCJA 3PUWE 3TCFA 3OOAA 3OO7A 3VLVA 5J1DA 1LSTA 4LP2B 1LLSA 1QUIA 2ZYKA 1LAXA 1UIVA 3F11A 1I69A 4LVQA 3RUMA 3DP4A 4ONYA 4F1UA 3H06B 3OO8A 3RT6B 3TQLA 5CBRA 5L8DA 3MJNA 4F3PA 3MVYA 2Y7WA 2HAVA 3USDA 1WODA 3PPQA 3EF7A 1MPCA 3FV1A 3ILTB 4MF3A 1R6ZA 4X1BA 3G3HA 1NFTA 1B9JA 3FIRA 4FJPA 1IEJA 1BKAA 2F7BA 2UYEA 3FJMA 4YAHX 2HEUA 1URDA 4NF5B 5AA4A 2CZLA 2P1SA 3I3VA 4RPNA 1D9VA 3WAEA 4BDNA 5JK4A 3R7XA 1IIWA 1SW2A 2UVJA 3G7WA 1N0TA 2REGA 1MY3A 2ABHA 1NNKA 5L9MA 3PUVE 1O63A 3MZBA 3LUYA 4KQPA 1ZIUA 3PU5A 4G2ZA 2ALUA 2DVCA 1A99A 4OVJA 3T93B 3PPOA 3TELA 2F6GA 3QSLA 2QS3A 3R26A 1P1NA 2RC8A 3PMXA 1EZOA 3A3CA 4ESXA 3GBAA 2NOOA 1XC1A 1N04A 1ZJLA 4LQ2A 4WKMA 1D9YA 3TUSA 1I6BA 1BIYA 2QRYA 3MW0A 1B5JA 1B3LA 2DE4A 2OWSA 2KLFA 3KG2A 5HBCA 3IB1A 2I3WA 4RNSA 1UTHA 4I8CA 3N94A 1QKAA 3IB2A 3CFZA 4OFOA 4Z0IA 5DT6A 3G3FA 5KZTA 1RYXA 4F2OA 4GL0A 2DWIA 1M5EA 1FCKA 4N6PA 1S7YA 4UA8A 1FTMA 2F78A 1RYOA 4ELQA 2XXRA 2XXQA 4R2FA 4KPTA 2QPQA 4F19A 3VXBA 1A40A 4R75A 3MZ1A 2UYFA 4G77A 3SEWA 1VE4A 4YB7A 4ECFA 2V93A 3IK6B 1I6QA 1PB7A 3O6IA 1IQ7A 1SYHA 3FVGA 1Q1KA 1IXHA 1ZLQA 2FA7A 3CIJA 3C33A 3N6TA 1SDXA 2QS1A 2V3QA 4E0XA 2REJA 3SEVA 4RYAA 4GF8A 4BDRA 2VD2A 2H99A 3HV1A 2B3BA 3U93A 4HCYA 1US4A 4P0IA 3SERA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AA2 D;  3IOV A;  3W15 C;  2RF1 A;  4TLM B;  3FZV A;  1OMP A;  1JW5 A;  4U23 A;  3L6H A;  1MS7 A;  1S50 A;  3C9H A;  4BDL A;  1FTJ A;  2DWA A;  4R9G A;  2I4B A;  3VVD A;  2RIN A;  3IB0 A;  3THI A;  3LR1 A;  4U2R A;  3U72 A;  3TTN A;  3IOW A;  3EHU A;  1OQH A;  2FNC A;  2R9J A;  3GLB A;  3TDJ A;  2H4I A;  5JTY A;  3O6H A;  4LON B;  1IXG A;  1DTZ A;  2ZYO A;  2XX9 A;  4G68 C;  1RKM A;  2Y84 A;  4X9T A;  4R74 A;  5DTB A;  3H6V A;  1B4H A;  4ND9 A;  5AA3 A;  1L5T A;  4TQU Q;  1FTL A;  1B0H A;  3OMB A;  3IR1 A;  3VE1 B;  4EQ9 A;  3LSX A;  1IZ1 A;  3T96 B;  5B70 A;  4OYV A;  5H8S A;  1EZP A;  5H8N A;  1M5C A;  1MY0 A;  5KCJ B;  4LZ8 A;  2OJT A;  4ELP A;  4Q8R A;  5ITP A;  4DCX A;  1FTO A;  4NE4 A;  4QSE A;  2M8C A;  1LBB A;  1Y3P A;  2Y7I A;  4U4S A;  1QW0 A;  3H3G A;  4KCD A;  3T22 A;  3KN7 A;  4N13 A;  4GVO A;  5I2K B;  3M8U A;  1D4N A;  5IKB A;  1NH7 A;  3K6U A;  4G8H A;  3B6T A;  1LAF E;  1PC3 A;  1A54 A;  4QRZ A;  4NF6 A;  3VLW A;  4KYD A;  1JVY A;  3SEY A;  5K2X A;  3EN3 A;  2QL3 A;  1MRP A;  3V8X B;  1EZ9 A;  1H3D A;  1XVY A;  4H65 A;  5AA4 B;  4R6Y A;  4YIC A;  3RTF B;  3ILU B;  2H5Y A;  1KWH A;  3C35 A;  2QS2 A;  1B58 A;  1OLA A;  3TPA A;  4ISU A;  2PT1 A;  4F1V A;  3QAX A;  3H03 A;  4BLA A;  4OMB A;  4GOT A;  4R6K A;  1VFE A;  4Q30 B;  2V84 A;  2AIX A;  1N7W A;  3FVO A;  1TT1 A;  4F39 A;  1Y4T A;  2ANJ A;  3K1P A;  5H8Q B;  2CMO A;  4PFU A;  3JV9 A;  2PYY A;  2O6A A;  2Z8D A;  2D3I A;  4PFW A;  4F22 A;  2G93 A;  5L9S A;  2XXH A;  2THI A;  1O64 A;  5I2N B;  2X26 A;  3E13 X;  5FHM A;  3OEN A;  4GLI A;  4QSD A;  3ECR A;  3CFL A;  3D4G A;  3PMV A;  2OCU A;  3MP8 A;  2BJJ X;  4R9F A;  2AL5 A;  3MVW A;  3LSL A;  1SQY A;  4KCC A;  4OEN A;  3OSQ A;  2RC7 A;  3UN6 A;  1D3K A;  2R71 A;  3IO6 A;  3FJ7 A;  3O28 A;  2XX7 A;  3MUQ A;  3OSR A;  3HN0 A;  4NTL A;  1QUL A;  5I56 B;  2ONS A;  4BDM A;  1B4Z A;  2DVZ A;  3CFX A;  2E1S A;  4E0W A;  1TFA A;  3N26 A;  1Y1M A;  4WXJ A;  3KSX A;  1B1H A;  1DOT A;  1MG1 A;  5I59 A;  2Z8F A;  4FEB A;  2P0S A;  3KSJ A;  1TXF A;  4AB5 A;  2YLN A;  4F31 B;  2XXW A;  3ODB A;  4YKK A;  4EUO A;  3OEM A;  1R1N A;  3T9U A;  2AYS A;  2DS9 A;  3MWB A;  5I2K A;  4R2B A;  1PB9 A;  3K1M A;  2GHA A;  4NMY A;  2XXX A;  3E9X A;  3K6V A;  2DP8 A;  4U22 A;  3UK4 A;  4LZ5 A;  1B3F A;  4G4P A;  3C34 A;  1Y3N A;  1A7L A;  2H25 A;  3KBR A;  3OEK A;  1FQE A;  4U1O A;  5CMK A;  4DCY A;  1NL5 A;  4EXL A;  3TCH A;  1LB9 A;  4IB2 A;  1NNP A;  1DSN A;  1N7X A;  1DPE A;  4F29 A;  4Z7E A;  1LFG A;  1USY E;  1JEV A;  4JWY A;  1QUK A;  4OHN A;  4DXC A;  2PT2 A;  5HPQ A;  5CMB A;  3FD3 A;  2NVU B;  4PFY A;  1MXW A;  2ZYM A;  1Y1Z A;  3AXF A;  1SW4 A;  3ZKK A;  3UOR A;  5JTY B;  1UQW A;  1QJM A;  4F3G A;  1MY4 A;  1IXI A;  4M1V A;  4XKP A;  2FYI A;  5H8Q A;  5ITO A;  3Q28 A;  3KOS A;  1XHY A;  2AL4 A;  2HZK A;  4MFI A;  3A3U A;  1YAE A;  4FAJ A;  2DWH A;  4NED A;  3UP9 A;  1H44 A;  4ELO A;  3EQ1 A;  4EQ7 A;  1OIB A;  5I2N A;  1MXZ A;  2UXA A;  5DVJ A;  2RCA A;  3DP6 A;  2V25 A;  1LBC A;  2Q9T A;  1LCT A;  5B7D A;  1PBQ A;  4ZZE A;  2UVG A;  2P2A A;  4F3S A;  4WEP A;  1QVS A;  5H8N B;  2F34 A;  2O1M A;  3FAT A;  4YKI A;  4IO6 A;  4BDQ A;  2Z23 A;  2XD3 A;  1SYI A;  3BBR A;  3UGW A;  2G29 A;  3K0V A;  4KI0 E;  2ZNT A;  4PET A;  3V5A A;  3HO7 A;  4OTE A;  1URG A;  5I56 A;  5I57 A;  4I1D A;  3IOR A;  4ZE8 A;  1B7Z A;  2ONR A;  3E4R A;  1AOV A;  3JYR A;  2Z8E A;  2IA4 A;  3HHG A;  4NF6 B;  1BP5 A;  3KGC A;  1MM6 A;  3FGS A;  5KDT A;  5EYF A;  3S4U A;  4IO7 A;  1US5 A;  3H6W A;  5H8H A;  4OER A;  2YJP A;  3FAS A;  5ICQ A;  3GBB A;  3U92 A;  4QF9 A;  1A8E A;  4LAT A;  4ESW A;  3T9V A;  1GGG A;  4IO4 A;  1DTG A;  1LFI A;  3KEI A;  3HCQ A;  2D5W A;  3QYT A;  3TKD A;  4LQ5 A;  1Y3Q A;  3H7M A;  4UAC A;  3IJO B;  4NF8 A;  3MZ9 A;  1JW1 A;  3FXR A;  3T66 A;  3RLF E;  5ELV A;  2OZZ A;  3CRB A;  1FQB A;  4YZZ A;  4WED A;  3EPE A;  2IEE A;  2O1L A;  4Q5T A;  3O2A A;  5H8F A;  5HM4 B;  4YB6 A;  1WVJ A;  3TTM A;  1MQG A;  1SW1 A;  4HS7 A;  1Y20 A;  2QMW A;  1USY H;  4GFR A;  4LUB A;  1B5H A;  2Y7R A;  4ZZA A;  5FHO A;  3EHS A;  1POY 1;  1PDA A;  3VLU A;  3CG3 A;  1JW4 A;  1H45 A;  1J1N A;  3ZSF A;  5CBS A;  4DLD A;  1MQJ A;  4JWX A;  3LC8 A;  5BWJ A;  1WDN A;  2Z22 A;  1IIT A;  2I4C A;  4QSC A;  5I58 A;  3K2D A;  3PUY E;  4DE8 A;  5EHM A;  1GTK A;  3W9V A;  3EHT A;  3K6W A;  1BTJ A;  1N3W A;  4U21 A;  4DXU A;  3VDF A;  4X1D A;  2B65 A;  1PB8 A;  3BFT A;  4U4X A;  1B3E A;  4IY6 A;  1T0K A;  3CR9 A;  1Q35 A;  3IO4 A;  2A5S A;  4O3A A;  1FQD A;  3KJ7 A;  5I59 B;  1JVX A;  3CI8 A;  2OK2 A;  3GXA A;  3IX1 A;  1AIV A;  1MM7 A;  2RKM A;  2F8D A;  3BFU A;  3IJX B;  3G3I A;  3FJG A;  3Q27 A;  3E3K A;  4G68 A;  3CG1 A;  2XXV A;  2UVH A;  4YB5 A;  4H6D A;  3K02 A;  1MDQ A;  4JDF A;  4PE5 B;  3U94 A;  4KYE A;  4IY5 A;  2D21 A;  1B32 A;  3Q29 A;  3V83 A;  3RTW B;  5TPA B;  2QS4 A;  5CI5 A;  4YKP A;  2O7I A;  2HXW A;  4OWD A;  4ZEC A;  3TTK A;  1P99 A;  4GIZ A;  2F97 A;  2ZNU A;  1Z7N E;  2Y7K A;  2H98 A;  3M3L A;  2Q88 A;  2V3T A;  4OES A;  3SES A;  1EH3 A;  2XXI A;  1B51 A;  1H76 A;  4NF4 A;  3MP1 A;  3O97 A;  2I6E A;  3KOT A;  4GL8 A;  2DE2 A;  3CSB A;  1B1X A;  3FXQ A;  2O68 A;  3UA8 A;  4I9D A;  4POW A;  3K1N A;  4U1Z A;  2GFE A;  3Q26 A;  2F7C A;  3S9M C;  5A5X A;  1POT A;  1QKB A;  3H4Z A;  1MQH A;  1B40 A;  3BKI B;  4KR5 A;  3MAM A;  5CMC A;  3T9H B;  2ZMB A;  3UIF A;  3IL1 B;  4QFK A;  1ZMG A;  1DPP A;  1B3G A;  4ZEI A;  3C36 A;  4RK2 A;  2X7P A;  1GR2 A;  3R6U A;  4FIM A;  2HQ0 A;  4FE8 A;  4F18 A;  1LCF A;  3VFJ A;  4RA1 A;  3MBP A;  4ZEF A;  3O6G A;  4IO5 A;  1OVT A;  4EXK A;  4XXU A;  3V89 B;  4HTG A;  4G8M A;  5I57 B;  1Z7M E;  2GHB A;  3FVN A;  3A09 A;  3P7I A;  4ELR A;  5ICT A;  1II5 A;  3MVZ A;  3TZA A;  3OO9 A;  4AB6 A;  3SDF A;  5KDT B;  1MPD A;  1PEB A;  2QMX A;  2Q8J A;  4EF2 A;  2GRV A;  4QFL A;  3U1O A;  3RN8 A;  5H8H B;  4RPO A;  4LZ7 A;  4JXI A;  3N6U A;  3M3K A;  4P11 A;  4QFO A;  3KJT A;  2XXU A;  4GWO A;  3SEX A;  2HAU A;  1VSO A;  1YTV A;  1Y9U A;  1MQD A;  4XKQ A;  4BDO A;  2DSF A;  4YMA A;  3SEU A;  1B46 A;  2I3V A;  1ATG A;  4OXV A;  4GXA A;  1MH3 A;  4R72 A;  4C0R A;  4GRK A;  3JZJ A;  4RK9 A;  1ZKB A;  5CM6 A;  3TYH A;  4RJZ A;  3KN8 A;  4M4G A;  5TPA A;  3FUZ A;  4NF8 B;  3ZS6 A;  1OQG A;  3D4C A;  3PMW A;  2YPN A;  2F5X A;  2XXP A;  4GD5 A;  1BLF A;  5H8F B;  3KZG A;  4NWC A;  3OD7 A;  3DEL B;  3C31 A;  4K3F A;  2NWJ A;  2OWT A;  5F1Q A;  3RPW A;  2I58 A;  4OFJ A;  3H6U A;  4OEV A;  3OXN A;  3TAJ A;  1UTB A;  4H67 A;  1ANF A;  3RY3 A;  1HSL A;  5TP9 A;  3TQW A;  3QIM A;  2R6G E;  1N76 A;  4OQO A;  1LB8 A;  2VOZ A;  3L6G A;  4ZEK A;  3FVK A;  3S9N C;  5I58 B;  2DQV A;  1MDP 1;  4PP0 A;  2XXY A;  5FTH A;  4FAT A;  1I6A A;  2ONK E;  2DE3 A;  2XHD A;  3DM0 A;  5L9O A;  1OVB A;  4KFQ A;  2F35 A;  4X48 A;  2X7Q A;  5DVI A;  2RCB A;  4ZED A;  4RY1 A;  2NUV A;  1R9Q A;  1A55 A;  3DP8 A;  2HFB A;  2Q2A A;  4TLL B;  5AA1 A;  3RNN A;  2O84 X;  1FQA A;  5DEX B;  4ZE9 A;  4KD5 A;  1DMB A;  1SI0 A;  3O66 A;  4F3B A;  3RGY A;  1MY2 A;  1ZBM A;  4JSD A;  2B3F A;  3SET A;  1P1O A;  3QUJ A;  4G68 B;  5DYH A;  2GH9 A;  3O9P A;  4DZ1 A;  3U8Q A;  2PX1 A;  5AA2 A;  1URS A;  4IGT A;  2E0S A;  4QFP A;  3DLN A;  5K2Y A;  4MLQ A;  2I0C A;  1XS5 A;  3O29 A;  5LOM A;  4JB7 A;  1GV8 A;  4FOR A;  1LAH E;  4H8I A;  3VXC A;  4JSO A;  4OFL A;  3VVF A;  4DIG A;  1MH4 A;  1MXX A;  3MVX A;  4GXS B;  4XKR A;  4H8J A;  4QFN A;  2A5T A;  4XTC Q;  3MPL A;  1LAG E;  4OET A;  1QUJ A;  2QJE A;  2VHA A;  4KYS A;  2Q89 A;  3LSW A;  5CRY A;  3M3F A;  4NF4 B;  5CC2 A;  1CE2 A;  1P1U A;  4QHQ A;  1XVX A;  1M5D A;  4GQO A;  3PUZ E;  1FW0 A;  1JEU A;  3K00 A;  4THI A;  4MBP A;  3B7D A;  4YMB A;  1EU8 A;  3HST A;  2H9B A;  3ZKL A;  5A5X B;  4NWD A;  3PPP A;  4JBZ A;  3IOT A;  3GZG A;  2W7Y A;  1AMF A;  3TEP A;  3KN3 A;  3HHF A;  4F2Q A;  4C1U A;  1LFH A;  4NF5 A;  5ISU A;  1ELJ A;  4F1Y A;  3W9W A;  1H43 A;  4G8N A;  3N5L A;  3RQT A;  4EDP A;  3LSF B;  1M5B A;  1B52 A;  4EF1 A;  3SKP A;  4LA9 A;  4OEU A;  3VV5 A;  4O3C A;  5AE4 A;  4MLV A;  2O51 A;  3MPK A;  3VVE A;  1AL3 A;  5BUU A;  4ZEB A;  1AH5 A;  1P1Q A;  4YKJ A;  1NNF A;  1ZTY A;  1MXU A;  1M5F A;  4KHZ E;  2OBG A;  3C4M A;  2F36 A;  3T9X B;  1O7T A;  3G3K A;  3C32 A;  2O69 A;  3KFM A;  5IAI A;  3B6Q A;  3FV2 A;  2DXY A;  5DVF A;  1PBP A;  1FQF A;  3K01 A;  2I0B A;  1SBP A;  5TU0 A;  4H5F A;  3S9L C;  3PV0 E;  5DEX A;  3QUF A;  1A8F A;  2QSX A;  1Y4C A;  3I6V A;  3S2V A;  4Q0C A;  2NXO A;  3B6W A;  1OLC A;  3QK6 A;  4I62 A;  3MP6 A;  1XOC A;  1MPB A;  3OEL A;  1JET A;  5FHN A;  4IO3 A;  4C1T A;  2PVU A;  3IAZ A;  4OZ9 A;  1MY1 A;  1MXY A;  2ZNS A;  5M2V A;  2DXR A;  2VD3 A;  2V3U A;  4DDD A;  2Q2C A;  4H5G A;  2F6P A;  4O3B A;  1B5I A;  4DXB A;  4XIG Q;  1YCJ A;  1F9B A;  3PUX E;  1B7U A;  3PPR A;  1B3H A;  5I84 A;  4HCW A;  5FTI A;  1HSJ A;  1IXC A;  2DYX A;  2VGQ A;  3QXM A;  2ZYN A;  3FXU A;  3H6T A;  2XD2 A;  3TOD A;  1ZU0 A;  1NKX A;  3TTL A;  2ESN A;  1UTB B;  1B7H A;  2HZL A;  5TP9 B;  1B6H A;  3G3J A;  3CSG A;  3PD8 A;  4FED A;  2WKY A;  1VFD A;  1B2H A;  4P0G A;  1XT8 A;  1NNT A;  1YPN A;  2F7A A;  3K4U A;  2I48 A;  2PBW A;  1JNF A;  4IO2 A;  3RT8 A;  3PPN A;  2PMS A;  1TFD A;  4H0W A;  3Q25 A;  1MXV A;  4N07 A;  3G3G A;  1VR5 A;  5CMM A;  4HW8 A;  1TWY A;  1B05 A;  4FEC A;  1SD3 A;  4R73 A;  1HSE A;  2LAO A;  3IOU A;  4RXL A;  3S9E A;  5F7V A;  1P1W A;  3OO6 A;  1IUD A;  2RC9 A;  1R9L A;  4JWO A;  2VP1 A;  2XX8 A;  4ZDM A;  1LGB C;  3LBS A;  3I5O A;  2I49 A;  4R6H A;  4IGR A;  4AQ4 A;  4PFT A;  2ZXT A;  1FQC A;  1UTH B;  3HPI A;  3CVG A;  1N84 A;  5JEI A;  3TTR A;  1S9T A;  3MC2 A;  3PGF A;  2Y7P A;  1GVC A;  1SW5 A;  1N3X A;  4L17 A;  5AA2 B;  3ONM A;  1MQI A;  1CB6 A;  5EHS A;  2HCA A;  1SVX B;  3K6X A;  3MQ9 A;  2DOJ A;  1B0L A;  4TOZ A;  3PD9 A;  3WAF A;  4ZS9 A;  4POX A;  4PQJ A;  1JQF A;  3TMG A;  4XKN A;  2DWJ A;  3TCG A;  2OLB A;  4YU0 A;  2O7U A;  4EQB A;  1NH8 A;  2XXT A;  1NMU A;  2UVI A;  1UIU A;  4MH5 A;  1SI1 A;  2A5T B;  1FTK A;  3TFL A;  4H1X A;  5KCJ A;  3PUW E;  3TCF A;  3OOA A;  3OO7 A;  3VLV A;  5J1D A;  1LST A;  4LP2 B;  1LLS A;  1QUI A;  2ZYK A;  1LAX A;  1UIV A;  3F11 A;  1I69 A;  4LVQ A;  3RUM A;  3DP4 A;  4ONY A;  4F1U A;  3H06 B;  3OO8 A;  3RT6 B;  3TQL A;  5CBR A;  5L8D A;  3MJN A;  4F3P A;  3MVY A;  2Y7W A;  2HAV A;  3USD A;  1WOD A;  3PPQ A;  3EF7 A;  1MPC A;  3FV1 A;  3ILT B;  4MF3 A;  1R6Z A;  4X1B A;  3G3H A;  1NFT A;  1B9J A;  3FIR A;  4FJP A;  1IEJ A;  1BKA A;  2F7B A;  2UYE A;  3FJM A;  4YAH X;  2HEU A;  1URD A;  4NF5 B;  5AA4 A;  2CZL A;  2P1S A;  3I3V A;  4RPN A;  1D9V A;  3WAE A;  4BDN A;  5JK4 A;  3R7X A;  1IIW A;  1SW2 A;  2UVJ A;  3G7W A;  1N0T A;  2REG A;  1MY3 A;  2ABH A;  1NNK A;  5L9M A;  3PUV E;  1O63 A;  3MZB A;  3LUY A;  4KQP A;  1ZIU A;  3PU5 A;  4G2Z A;  2ALU A;  2DVC A;  1A99 A;  4OVJ A;  3T93 B;  3PPO A;  3TEL A;  2F6G A;  3QSL A;  2QS3 A;  3R26 A;  1P1N A;  2RC8 A;  3PMX A;  1EZO A;  3A3C A;  4ESX A;  3GBA A;  2NOO A;  1XC1 A;  1N04 A;  1ZJL A;  4LQ2 A;  4WKM A;  1D9Y A;  3TUS A;  1I6B A;  1BIY A;  2QRY A;  3MW0 A;  1B5J A;  1B3L A;  2DE4 A;  2OWS A;  2KLF A;  3KG2 A;  5HBC A;  3IB1 A;  2I3W A;  4RNS A;  1UTH A;  4I8C A;  3N94 A;  1QKA A;  3IB2 A;  3CFZ A;  4OFO A;  4Z0I A;  5DT6 A;  3G3F A;  5KZT A;  1RYX A;  4F2O A;  4GL0 A;  2DWI A;  1M5E A;  1FCK A;  4N6P A;  1S7Y A;  4UA8 A;  1FTM A;  2F78 A;  1RYO A;  4ELQ A;  2XXR A;  2XXQ A;  4R2F A;  4KPT A;  2QPQ A;  4F19 A;  3VXB A;  1A40 A;  4R75 A;  3MZ1 A;  2UYF A;  4G77 A;  3SEW A;  1VE4 A;  4YB7 A;  4ECF A;  2V93 A;  3IK6 B;  1I6Q A;  1PB7 A;  3O6I A;  1IQ7 A;  1SYH A;  3FVG A;  1Q1K A;  1IXH A;  1ZLQ A;  2FA7 A;  3CIJ A;  3C33 A;  3N6T A;  1SDX A;  2QS1 A;  2V3Q A;  4E0X A;  2REJ A;  3SEV A;  4RYA A;  4GF8 A;  4BDR A;  2VD2 A;  2H99 A;  3HV1 A;  2B3B A;  3U93 A;  4HCY A;  1US4 A;  4P0I A;  3SER A; 
#chains in the Genus database with same CATH topology
 2FHY A;  5AA2 D;  3IOV A;  3W15 C;  2RF1 A;  4N4U A;  4NAP A;  4OVQ A;  4TLM B;  3FZV A;  1OMP A;  1JW5 A;  4HXV A;  4LN5 A;  4U23 A;  3L6H A;  1MS7 A;  1S50 A;  3C9H A;  4BDL A;  1FTJ A;  2DWA A;  4R9G A;  2I4B A;  3VVD A;  2RIN A;  3IB0 A;  3THI A;  3LR1 A;  4U2R A;  3U72 A;  2FVZ A;  3TTN A;  3IOW A;  4PAI A;  3EHU A;  1NUX A;  1OQH A;  2FNC A;  2R9J A;  4MMP A;  3GLB A;  3TDJ A;  2H4I A;  5JTY A;  3O6H A;  4LON B;  1IXG A;  1DTZ A;  2ZYO A;  2XX9 A;  4G68 C;  1IMC A;  1RKM A;  2Y84 A;  4MNC A;  4X9T A;  4R74 A;  5DTB A;  1EYK A;  3H6V A;  1IMA A;  2QVV A;  1B4H A;  4ND9 A;  4HE1 A;  5AA3 A;  2F3D A;  1L5T A;  4TQU Q;  1FTL A;  1B0H A;  3OMB A;  4P9K A;  3IR1 A;  4HE0 A;  3VE1 B;  4GX4 A;  4EQ9 A;  3LSX A;  1IZ1 A;  3T96 B;  5B70 A;  4OYV A;  5H8S A;  1EZP A;  5H8N A;  2PFY A;  1M5C A;  1MY0 A;  5KCJ B;  4LZ8 A;  2OJT A;  4ELP A;  4Q8R A;  5ITP A;  4DCX A;  1FTO A;  4NE4 A;  4QSE A;  1FPG A;  2M8C A;  1LBB A;  1Y3P A;  2Y7I A;  4U4S A;  1QW0 A;  3H3G A;  4KCD A;  3T22 A;  3KN7 A;  4N13 A;  4GVO A;  5I2K B;  3M8U A;  1D4N A;  5IKB A;  1NH7 A;  3K6U A;  1INP A;  4G8H A;  3B6T A;  1LAF E;  1PC3 A;  1A54 A;  2XXK A;  4QRZ A;  4NF6 A;  2CZI A;  3VLW A;  1LBV A;  4KYD A;  1JVY A;  2VT5 A;  3SEY A;  5K2X A;  3EN3 A;  3MST A;  2QL3 A;  1MRP A;  3V8X B;  1EZ9 A;  1H3D A;  1XVY A;  4H65 A;  5AA4 B;  4R6Y A;  4YIC A;  3RTF B;  3ILU B;  2H5Y A;  1KWH A;  3C35 A;  2QS2 A;  4MX6 A;  1B58 A;  1OLA A;  3TPA A;  4ISU A;  2PT1 A;  4F1V A;  3QAX A;  3H03 A;  4BLA A;  4OMB A;  4GOT A;  1FPE A;  4R6K A;  3NOH A;  1VFE A;  4Q30 B;  2V84 A;  2AIX A;  1N7W A;  3FVO A;  1TT1 A;  4F39 A;  1Y4T A;  2ANJ A;  3K1P A;  2FIX A;  5H8Q B;  2CMO A;  4PFU A;  3JV9 A;  2PYY A;  2O6A A;  2CZH A;  3ISP A;  2Z8D A;  2D3I A;  4H45 A;  4OA4 A;  1NV0 A;  4PFW A;  4F22 A;  2G93 A;  5L9S A;  4N6D A;  2XXH A;  2THI A;  1O64 A;  5I2N B;  2X26 A;  3E13 X;  5FHM A;  3OEN A;  4GLI A;  4QSD A;  3ECR A;  1NI9 A;  1NV5 A;  3CFL A;  3D4G A;  1YYZ A;  3PMV A;  2OCU A;  3KBZ A;  3MP8 A;  2BJJ X;  4R9F A;  2AL5 A;  3MVW A;  3LSL A;  1SQY A;  4KCC A;  4OEN A;  4PDD A;  3OSQ A;  2RC7 A;  5I7I A;  3UN6 A;  1D3K A;  2R71 A;  2Y5L A;  3IO6 A;  5IZ3 B;  3FJ7 A;  3O28 A;  2XX7 A;  3MUQ A;  3RPL A;  3B50 A;  3OSR A;  3HN0 A;  4NTL A;  1QUL A;  5I56 B;  4PGN A;  2ONS A;  4BDM A;  1B4Z A;  2DVZ A;  3CFX A;  2E1S A;  4E0W A;  1TFA A;  4DI4 B;  4O8M A;  3N26 A;  1Y1M A;  5I3S A;  4WXJ A;  3KSX A;  1B1H A;  1DOT A;  1MG1 A;  5I59 A;  2Z8F A;  4FEB A;  2P0S A;  3KSJ A;  1TXF A;  4AB5 A;  2OWZ A;  2YLN A;  4F31 B;  2XXW A;  3ODB A;  4YKK A;  4OVR A;  4EUO A;  3OEM A;  1R1N A;  3T9U A;  2AYS A;  2DS9 A;  3MWB A;  5I2K A;  4GWW A;  4R2B A;  1PB9 A;  3K1M A;  2GHA A;  4NMY A;  2XXX A;  3E9X A;  3K6V A;  2DP8 A;  1DCU A;  3BIG A;  2ZZV A;  4U22 A;  3UK4 A;  4LZ5 A;  3MYU A;  1B3F A;  4G4P A;  3C34 A;  1Y3N A;  1A7L A;  2H25 A;  3IFA A;  3KBR A;  3OEK A;  1FQE A;  4U1O A;  5CMK A;  4GWY A;  4DCY A;  1NL5 A;  4O94 A;  4EXL A;  3TCH A;  4OVT A;  1K9Y A;  4PBH A;  1LB9 A;  4IB2 A;  1NNP A;  1DSN A;  1N7X A;  1DPE A;  4F29 A;  4Z7E A;  1LFG A;  1USY E;  1JEV A;  4MCO A;  3T0J A;  4NQ8 A;  4JWY A;  3ROJ A;  1QUK A;  4OHN A;  4DXC A;  2PT2 A;  5HPQ A;  5CMB A;  3FD3 A;  2NVU B;  4PFY A;  1MXW A;  2ZYM A;  1Y1Z A;  3SZP A;  3AXF A;  1SW4 A;  3ZKK A;  3UOR A;  5JTY B;  1UQW A;  1QJM A;  4F3G A;  1MY4 A;  1IXI A;  4M1V A;  4XKP A;  2FYI A;  5H8Q A;  5ITO A;  3Q28 A;  3KOS A;  1XHY A;  2AL4 A;  2HZK A;  4MFI A;  3A3U A;  1YAE A;  3A29 A;  4QBA A;  4FAJ A;  2DWH A;  4NED A;  5T3J A;  3UP9 A;  1H44 A;  4ELO A;  3EQ1 A;  4EQ7 A;  1FPD A;  1FJ9 A;  1OIB A;  5I2N A;  1MXZ A;  2UXA A;  4N15 A;  5DVJ A;  2RCA A;  3DP6 A;  2V25 A;  1LBC A;  2Q9T A;  4AS5 A;  1LCT A;  5B7D A;  1PBQ A;  3D1R A;  4ZZE A;  2WEF A;  2UVG A;  2P2A A;  4F3S A;  4WEP A;  4N17 A;  1QVS A;  3BIH A;  4PE3 A;  5H8N B;  3FXB A;  2F34 A;  1YZ0 A;  2O1M A;  2Y5K A;  3FAT A;  2CZK A;  4YKI A;  4IO6 A;  4BDQ A;  2Z23 A;  2XD3 A;  1SYI A;  3BBR A;  3UGW A;  2G29 A;  4X8R A;  3K0V A;  4KI0 E;  2ZNT A;  4PET A;  3V5A A;  3HO7 A;  4OTE A;  4P8B A;  1URG A;  5I56 A;  5I57 A;  4I1D A;  3IOR A;  1NV6 A;  4ZE8 A;  1B7Z A;  2ONR A;  3E4R A;  1AOV A;  3JYR A;  2Z8E A;  2IA4 A;  3HHG A;  4NF6 B;  1BP5 A;  3KGC A;  1MM6 A;  3FGS A;  5KDT A;  4H46 A;  2VPO A;  5EYF A;  3S4U A;  4IO7 A;  1US5 A;  3H6W A;  1FPL A;  5H8H A;  4OER A;  2YJP A;  3FAS A;  5ICQ A;  3GBB A;  3U92 A;  4QF9 A;  4GWU A;  1A8E A;  2QVU A;  4LAT A;  4ESW A;  1NV7 A;  1FRP A;  3T9V A;  1GGG A;  4IO4 A;  1DTG A;  1LFI A;  3KEI A;  4X04 A;  3HCQ A;  2D5W A;  3QYT A;  2BJI A;  5IZ1 A;  3TKD A;  4N81 A;  4LQ5 A;  1Y3Q A;  3H7M A;  4UAC A;  4PAK A;  3IJO B;  4NF8 A;  2CEY A;  3MZ9 A;  1JW1 A;  3FXR A;  3T66 A;  3RLF E;  5ELV A;  2OZZ A;  3CRB A;  1FQB A;  4YZZ A;  4WED A;  3EPE A;  2IEE A;  2O1L A;  4Q5T A;  3O2A A;  5H8F A;  5HM4 B;  4YB6 A;  1WVJ A;  1G0I A;  3TTM A;  1MQG A;  1SW1 A;  4HS7 A;  1Y20 A;  2QMW A;  1USY H;  4GFR A;  4LUB A;  4N6K A;  1B5H A;  1LBZ A;  2Y7R A;  1LBY A;  4ZZA A;  5FHO A;  3EHS A;  1POY 1;  1PDA A;  3VLU A;  3CG3 A;  1JW4 A;  1H45 A;  1J1N A;  3ZSF A;  5CBS A;  4DLD A;  1MQJ A;  4JWX A;  3LC8 A;  5BWJ A;  1WDN A;  2Z22 A;  1IIT A;  2I4C A;  4QSC A;  5I58 A;  3K2D A;  3PUY E;  4DE8 A;  5EHM A;  1GTK A;  3W9V A;  3EHT A;  1RDX A;  3K6W A;  1BTJ A;  3RPL B;  1N3W A;  4U21 A;  4DXU A;  3VDF A;  4X1D A;  2B65 A;  1PB8 A;  3BFT A;  2R8T A;  4U4X A;  1B3E A;  4IY6 A;  1T0K A;  3T1B A;  4JVI A;  3CR9 A;  1Q35 A;  3IO4 A;  2A5S A;  4O3A A;  1FQD A;  3KJ7 A;  5I59 B;  1JVX A;  3CI8 A;  2OK2 A;  3GXA A;  2QVR A;  3IX1 A;  5A5L A;  4PCD A;  1AIV A;  1MM7 A;  2RKM A;  2F8D A;  3BFU A;  3IJX B;  5EQ8 A;  3G3I A;  3FJG A;  4N91 A;  2ZZX A;  3Q27 A;  3E3K A;  4G68 A;  3CG1 A;  2XXV A;  2UVH A;  4YB5 A;  4H6D A;  3K02 A;  1MDQ A;  4JDF A;  4PE5 B;  3U94 A;  4KYE A;  4IY5 A;  1NUZ A;  2WYK A;  2D21 A;  1B32 A;  3Q29 A;  2F3B A;  3V83 A;  4PFR A;  3RTW B;  5TPA B;  2QS4 A;  5CI5 A;  4YKP A;  2O7I A;  2XWK A;  3E79 A;  2HXW A;  4OWD A;  2V4C A;  4ZEC A;  3TTK A;  1P99 A;  4GIZ A;  2F97 A;  2ZNU A;  1Z7N E;  2PFZ A;  1JP4 A;  4GWZ A;  2Y7K A;  1Q9D A;  4I3E A;  2H98 A;  4MIJ A;  3M3L A;  2Q88 A;  2V3T A;  4OES A;  3SES A;  1EH3 A;  4NX1 A;  2XXI A;  1B51 A;  1H76 A;  4NF4 A;  3MP1 A;  3O97 A;  2I6E A;  3KOT A;  4GL8 A;  2DE2 A;  3CSB A;  1B1X A;  3FXQ A;  2O68 A;  3UA8 A;  4I9D A;  4POW A;  3K1N A;  1VDW A;  4U1Z A;  2GFE A;  3Q26 A;  2PCR A;  2F7C A;  3S9M C;  5A5X A;  1POT A;  1QKB A;  3FBP A;  3H4Z A;  1MQH A;  1FBP A;  1B40 A;  3BKI B;  4KR5 A;  3MAM A;  5CMC A;  3T9H B;  2ZMB A;  3UIF A;  3IL1 B;  4NG7 A;  4QFK A;  1ZMG A;  1DPP A;  1B3G A;  4ZEI A;  3C36 A;  4RK2 A;  2X7P A;  1GR2 A;  3R6U A;  4FIM A;  2HQ0 A;  4FE8 A;  1LCF A;  4F18 A;  3VFJ A;  1NV3 A;  4RA1 A;  1FBE A;  1RDY A;  3MBP A;  1FBD A;  4ZEF A;  1QGX A;  1FSA A;  3O6G A;  4IO5 A;  1OVT A;  4EXK A;  4XXU A;  3V89 B;  4HTG A;  4G8M A;  5I57 B;  1Z7M E;  2GHB A;  3FVN A;  3A09 A;  3P7I A;  4ELR A;  5ICT A;  1II5 A;  3MVZ A;  3TZA A;  3OO9 A;  4NHB A;  3B8B A;  4AB6 A;  3SDF A;  2XWO A;  5KDT B;  1MPD A;  1PEB A;  2QMX A;  2Q8J A;  4EF2 A;  2GRV A;  4QFL A;  3U1O A;  3RN8 A;  5H8H B;  4RPO A;  4LZ7 A;  4JXI A;  3N6U A;  4PGP A;  3M3K A;  4P11 A;  4QFO A;  3KJT A;  2XXU A;  4GWO A;  3SEX A;  2HAU A;  1VSO A;  1YTV A;  1Y9U A;  1MQD A;  4XKQ A;  4BDO A;  5LTC A;  4JVC A;  2DSF A;  4YMA A;  3SEU A;  1B46 A;  2I3V A;  1ATG A;  4OXV A;  1FBF A;  4GXA A;  1MH3 A;  5IZZ A;  4R72 A;  4C0R A;  4GRK A;  2L5V A;  3JZJ A;  4RK9 A;  1ZKB A;  2ZZW A;  5CM6 A;  3TYH A;  4RJZ A;  3KN8 A;  3LUZ A;  4M4G A;  4DI3 D;  5TPA A;  3FUZ A;  1IMF A;  1EYJ A;  4PDH A;  4NF8 B;  3ZS6 A;  1OQG A;  3D4C A;  3PMW A;  2YPN A;  2F5X A;  2XXP A;  4GD5 A;  1BLF A;  3KC0 A;  5H8F B;  3KZG A;  4NWC A;  2JJK A;  3OD7 A;  3DEL B;  3C31 A;  3GYY A;  4K3F A;  2NWJ A;  2OWT A;  5F1Q A;  3RPW A;  2I58 A;  4OFJ A;  3H6U A;  4OEV A;  3OXN A;  3TAJ A;  1UTB A;  4H67 A;  1ANF A;  3RY3 A;  1HSL A;  5TP9 A;  3TQW A;  4MNP A;  3QIM A;  2R6G E;  1N76 A;  4OQO A;  1LB8 A;  2VOZ A;  2WX9 A;  3L6G A;  4ZEK A;  1DBZ A;  3FVK A;  3S9N C;  2MKZ A;  5I58 B;  2DQV A;  1G0H A;  1MDP 1;  4PP0 A;  2XXY A;  1FPI A;  4I40 A;  5ET7 A;  5FTH A;  4FAT A;  1I6A A;  2ONK E;  2DE3 A;  1FPB A;  2XHD A;  3DM0 A;  3RYD A;  5L9O A;  1OVB A;  4QXD A;  3U65 A;  4KFQ A;  2F35 A;  4X48 A;  4GWX A;  4PBQ A;  2X7Q A;  5DVI A;  2RCB A;  4P3L A;  4ZED A;  4RY1 A;  2NUV A;  1R9Q A;  1A55 A;  3DP8 A;  2HFB A;  2Q2A A;  4TLL B;  5AA1 A;  3RNN A;  1LBX A;  2O84 X;  1FQA A;  5DEX B;  4ZE9 A;  4KD5 A;  1DMB A;  1SI0 A;  3O66 A;  4F3B A;  3RGY A;  1MY2 A;  1ZBM A;  4JSD A;  2B3F A;  3SET A;  1P1O A;  3QUJ A;  4G68 B;  4PC9 A;  5DYH A;  2GH9 A;  1CNQ A;  5IGA A;  2KR0 A;  3O9P A;  4DZ1 A;  3U8Q A;  2PX1 A;  5AA2 A;  1URS A;  4IGT A;  2E0S A;  4QFP A;  3DLN A;  2P3N A;  4PFI A;  5K2Y A;  4MLQ A;  1KA1 A;  1RDZ A;  2I0C A;  4IR8 A;  1XS5 A;  3O29 A;  5LOM A;  4JB7 A;  1GV8 A;  4O7M A;  4FOR A;  1LAH E;  4H8I A;  3VXC A;  4JSO A;  4OFL A;  3VVF A;  4DIG A;  1MH4 A;  1MXX A;  3MVX A;  1BK4 A;  4GXS B;  4XKR A;  4H8J A;  4QFN A;  2A5T A;  4XTC Q;  3MPL A;  1NV1 A;  1LAG E;  4OET A;  4MNI A;  5FBP A;  1QUJ A;  4KYS A;  2QJE A;  2VHA A;  2Q89 A;  3LSW A;  5CRY A;  3M3F A;  4NF4 B;  5CC2 A;  1CE2 A;  1P1U A;  2Q8M A;  1EYI A;  4QHQ A;  1XVX A;  1M5D A;  1IMD A;  4GQO A;  3PUZ E;  1FW0 A;  1JEU A;  5ET8 A;  3K00 A;  4THI A;  2DDK A;  4MBP A;  3B7D A;  2VPN A;  4YMB A;  2Q74 A;  5EYG A;  1EU8 A;  2P3V A;  3HST A;  2H9B A;  1IME A;  3ZKL A;  5A5X B;  4NF0 A;  4NWD A;  3PPP A;  4JBZ A;  3IOT A;  1IMB A;  3GZG A;  1LEV A;  2W7Y A;  1AMF A;  3TEP A;  3KN3 A;  3HHF A;  4F2Q A;  4C1U A;  1LFH A;  4NF5 A;  5ISU A;  1NV2 A;  1ELJ A;  2B4M A;  1KZ8 A;  4F1Y A;  3W9W A;  1H43 A;  4G8N A;  3N5L A;  3RQT A;  4EDP A;  3LSF B;  1M5B A;  4OAN A;  1B52 A;  4EF1 A;  3SKP A;  4LA9 A;  4OEU A;  3VV5 A;  4O3C A;  5AE4 A;  4MLV A;  2O51 A;  2WBB A;  3MPK A;  3VVE A;  1AL3 A;  5BUU A;  4ZEB A;  2XA5 A;  1AH5 A;  3QMF A;  1P1Q A;  4YKJ A;  1NNF A;  1ZTY A;  1MXU A;  1M5F A;  2HHM A;  4KHZ E;  2OBG A;  5DW8 A;  4HE2 A;  3C4M A;  2F36 A;  3T9X B;  4GBV A;  1O7T A;  3G3K A;  4MEV A;  3C32 A;  2O69 A;  3KFM A;  5IAI A;  3B6Q A;  3FV2 A;  2DXY A;  5DVF A;  1DK4 A;  1PBP A;  1FQF A;  3K01 A;  2I0B A;  1SBP A;  5TU0 A;  4H5F A;  3S9L C;  2GQ1 A;  3PV0 E;  5DEX A;  2KQZ A;  3QUF A;  4OVP A;  1A8F A;  2QSX A;  1Y4C A;  3I6V A;  3S2V A;  4Q0C A;  2NXO A;  3B6W A;  1OLC A;  3QK6 A;  4I62 A;  3MP6 A;  1XOC A;  1MPB A;  3OEL A;  1JET A;  5FHN A;  4IO3 A;  4C1T A;  2PVU A;  3IAZ A;  4OZ9 A;  1MY1 A;  4XFE A;  1MXY A;  5I5P A;  4O7I A;  2WBD A;  2ZNS A;  5M2V A;  2DXR A;  1XI6 A;  2VD3 A;  2V3U A;  4DDD A;  2Q2C A;  4H5G A;  2F6P A;  4O3B A;  1NV4 A;  1B5I A;  4DXB A;  4XIG Q;  2XWI A;  1YCJ A;  1F9B A;  3PUX E;  1B7U A;  3PPR A;  2B4L A;  1B3H A;  5I84 A;  4HCW A;  5FTI A;  1HSJ A;  1IXC A;  2DYX A;  2VGQ A;  3QXM A;  2ZYN A;  3FXU A;  3H6T A;  2XD2 A;  3TOD A;  1ZU0 A;  2HXR A;  1NKX A;  3TTL A;  2ESN A;  1UTB B;  4NGU A;  1B7H A;  2HZL A;  5ET5 A;  5TP9 B;  1B6H A;  3G3J A;  3CSG A;  3PD8 A;  4FED A;  2WKY A;  1SPI A;  1VFD A;  1B2H A;  4P0G A;  1XT8 A;  1NNT A;  1YPN A;  2F7A A;  2WYP A;  3K4U A;  2I48 A;  2PBW A;  4XF5 A;  1JNF A;  4PAF A;  4NN3 A;  4IO2 A;  3RT8 A;  3PPN A;  2PMS A;  1TFD A;  4H0W A;  4GBW A;  3Q25 A;  1MXV A;  4N07 A;  3G3G A;  4PTK A;  1VR5 A;  5CMM A;  4HW8 A;  1TWY A;  1B05 A;  2FIE A;  4FEC A;  1SD3 A;  4R73 A;  4GX3 A;  1HSE A;  2LAO A;  3IOU A;  4RXL A;  3S9E A;  5EQA A;  5F7V A;  1P1W A;  3OO6 A;  1IUD A;  3CHG A;  2RC9 A;  4P47 A;  1R9L A;  4JWO A;  2VP1 A;  2XX8 A;  4ZDM A;  2FBP A;  1LGB C;  3LBS A;  3I5O A;  2I49 A;  4R6H A;  4IGR A;  4AQ4 A;  4PFT A;  2ZXT A;  1NUY A;  1FQC A;  1UTH B;  3HPI A;  4XEQ A;  3CVG A;  1N84 A;  5JEI A;  3TTR A;  1S9T A;  3MC2 A;  3PGF A;  2Y7P A;  1GVC A;  1SW5 A;  1N3X A;  4L17 A;  5AA2 B;  3E78 A;  3ONM A;  1MQI A;  1CB6 A;  5EHS A;  2HCA A;  1SVX B;  3K6X A;  4GX6 A;  3MQ9 A;  2DOJ A;  5ET6 A;  1B0L A;  4TOZ A;  3PD9 A;  4JVD A;  3WAF A;  4ZS9 A;  4POX A;  4PQJ A;  1JQF A;  3TMG A;  4XKN A;  1NUW A;  2DWJ A;  3TCG A;  2OLB A;  4YU0 A;  2O7U A;  4EQB A;  1NH8 A;  2XXT A;  1NMU A;  3IFC A;  2UVI A;  1UIU A;  4MAG A;  4MH5 A;  1SI1 A;  4G61 A;  2A5T B;  4KXP A;  1FTK A;  3TFL A;  4H1X A;  4PF6 A;  5KCJ A;  3PUW E;  3TCF A;  3OOA A;  3OO7 A;  3VLV A;  5J1D A;  1LST A;  4LP2 B;  5LDZ A;  1LLS A;  1QUI A;  5F24 A;  2ZYK A;  1LAX A;  1UIV A;  3F11 A;  1FBC A;  1I69 A;  4LVQ A;  3RUM A;  2OX3 A;  1FPF A;  3DP4 A;  5EYH A;  4ONY A;  1FBH A;  4F1U A;  3H06 B;  3OO8 A;  3RT6 B;  3TQL A;  5CBR A;  5L8D A;  4P1L A;  3MJN A;  4F3P A;  3MVY A;  2Y7W A;  2HAV A;  3USD A;  1WOD A;  3HFU A;  3LV0 A;  3PPQ A;  4OVS A;  3EF7 A;  1MPC A;  3FV1 A;  1FJ6 A;  3ILT B;  4MF3 A;  1R6Z A;  4X1B A;  3G3H A;  1NFT A;  1B9J A;  3FIR A;  4FJP A;  1IEJ A;  1BKA A;  1K9Z A;  2F7B A;  2UYE A;  3FJM A;  4N8G A;  4YAH X;  2HEU A;  1URD A;  4NF5 B;  4P56 A;  5AA4 A;  2QFL A;  2CZL A;  1KA0 A;  2P1S A;  3I3V A;  5EQ7 A;  4RPN A;  1D9V A;  5EQ9 A;  3WAE A;  4BDN A;  2XWV A;  5JK4 A;  3R7X A;  1IIW A;  1SW2 A;  2UVJ A;  3G7W A;  4MHF A;  1N0T A;  2REG A;  1MY3 A;  2ABH A;  1NNK A;  5L9M A;  3PUV E;  1O63 A;  3MZB A;  3LUY A;  4KQP A;  5ESY A;  1ZIU A;  3PU5 A;  4UAB A;  4G2Z A;  2ALU A;  2DVC A;  1A99 A;  4OVJ A;  3T93 B;  3PPO A;  3TEL A;  2F6G A;  3QSL A;  2QS3 A;  3R26 A;  1P1N A;  2RC8 A;  3PMX A;  1EZO A;  3A3C A;  4ESX A;  3GBA A;  4MJO A;  1FPK A;  2NOO A;  1XC1 A;  1N04 A;  1ZJL A;  4N8Y A;  4PF8 A;  4LQ2 A;  1AWB A;  3PTY A;  4WKM A;  1D9Y A;  3TUS A;  1I6B A;  1BIY A;  2QRY A;  3MW0 A;  1YXI A;  1B5J A;  4I3Y A;  1B3L A;  4P1E A;  2DE4 A;  2OWS A;  2KLF A;  3KG2 A;  5HBC A;  1D9Q A;  3IB1 A;  2I3W A;  4RNS A;  1UTH A;  1FBG A;  4I8C A;  3N94 A;  1QKA A;  3IB2 A;  3CFZ A;  4OFO A;  4Z0I A;  5DT6 A;  3G3F A;  5KZT A;  1RYX A;  4F2O A;  4GWS A;  4GL0 A;  2DWI A;  5IZ3 A;  1M5E A;  1FCK A;  4N6P A;  1S7Y A;  4UA8 A;  1FTM A;  2F78 A;  1RYO A;  4ELQ A;  2XXR A;  2XXQ A;  4R2F A;  4KPT A;  2QPQ A;  4F19 A;  3VXB A;  4PFB A;  1A40 A;  2CEX A;  4R75 A;  3MZ1 A;  2UYF A;  4G77 A;  3SEW A;  1VE4 A;  4YB7 A;  4ECF A;  2V93 A;  3IK6 B;  1I6Q A;  1PB7 A;  2HPG A;  3O6I A;  1IQ7 A;  1SYH A;  3FVG A;  1FTA A;  1Q1K A;  1IXH A;  1ZLQ A;  4AS4 A;  2FA7 A;  3CIJ A;  3C33 A;  3N6T A;  1SDX A;  2QS1 A;  2V3Q A;  4E0X A;  2REJ A;  3SEV A;  4RYA A;  5IM2 A;  4GF8 A;  4BDR A;  5J16 A;  3EKI A;  2VD2 A;  2H99 A;  3HV1 A;  2B3B A;  3U93 A;  4HCY A;  1US4 A;  4P0I A;  1LBW A;  3SER A;  3KC1 A;  1FPJ A;  4FBP A; 
#chains in the Genus database with same CATH homology
 5AA2 D;  3IOV A;  3W15 C;  2RF1 A;  4TLM B;  3FZV A;  1OMP A;  1JW5 A;  4U23 A;  3L6H A;  1MS7 A;  1S50 A;  3C9H A;  4BDL A;  1FTJ A;  2DWA A;  4R9G A;  2I4B A;  3VVD A;  2RIN A;  3IB0 A;  3THI A;  3LR1 A;  4U2R A;  3U72 A;  3TTN A;  3IOW A;  3EHU A;  1OQH A;  2FNC A;  2R9J A;  3GLB A;  3TDJ A;  2H4I A;  5JTY A;  3O6H A;  4LON B;  1IXG A;  1DTZ A;  2ZYO A;  2XX9 A;  4G68 C;  1RKM A;  2Y84 A;  4X9T A;  4R74 A;  5DTB A;  3H6V A;  1B4H A;  4ND9 A;  5AA3 A;  1L5T A;  4TQU Q;  1FTL A;  1B0H A;  3OMB A;  3IR1 A;  3VE1 B;  4EQ9 A;  3LSX A;  1IZ1 A;  3T96 B;  5B70 A;  4OYV A;  5H8S A;  1EZP A;  5H8N A;  1M5C A;  1MY0 A;  5KCJ B;  4LZ8 A;  2OJT A;  4ELP A;  4Q8R A;  5ITP A;  4DCX A;  1FTO A;  4NE4 A;  4QSE A;  2M8C A;  1LBB A;  1Y3P A;  2Y7I A;  4U4S A;  1QW0 A;  3H3G A;  4KCD A;  3T22 A;  3KN7 A;  4N13 A;  4GVO A;  5I2K B;  3M8U A;  1D4N A;  5IKB A;  1NH7 A;  3K6U A;  4G8H A;  3B6T A;  1LAF E;  1PC3 A;  1A54 A;  4QRZ A;  4NF6 A;  3VLW A;  4KYD A;  1JVY A;  3SEY A;  5K2X A;  3EN3 A;  2QL3 A;  1MRP A;  3V8X B;  1EZ9 A;  1H3D A;  1XVY A;  4H65 A;  5AA4 B;  4R6Y A;  4YIC A;  3RTF B;  3ILU B;  2H5Y A;  1KWH A;  3C35 A;  2QS2 A;  1B58 A;  1OLA A;  3TPA A;  4ISU A;  2PT1 A;  4F1V A;  3QAX A;  3H03 A;  4BLA A;  4OMB A;  4GOT A;  4R6K A;  1VFE A;  4Q30 B;  2V84 A;  2AIX A;  1N7W A;  3FVO A;  1TT1 A;  4F39 A;  1Y4T A;  2ANJ A;  3K1P A;  5H8Q B;  2CMO A;  4PFU A;  3JV9 A;  2PYY A;  2O6A A;  2Z8D A;  2D3I A;  4PFW A;  4F22 A;  2G93 A;  5L9S A;  2XXH A;  2THI A;  1O64 A;  5I2N B;  2X26 A;  3E13 X;  5FHM A;  3OEN A;  4GLI A;  4QSD A;  3ECR A;  3CFL A;  3D4G A;  3PMV A;  2OCU A;  3MP8 A;  2BJJ X;  4R9F A;  2AL5 A;  3MVW A;  3LSL A;  1SQY A;  4KCC A;  4OEN A;  3OSQ A;  2RC7 A;  3UN6 A;  1D3K A;  2R71 A;  3IO6 A;  3FJ7 A;  3O28 A;  2XX7 A;  3MUQ A;  3OSR A;  3HN0 A;  4NTL A;  1QUL A;  5I56 B;  2ONS A;  4BDM A;  1B4Z A;  2DVZ A;  3CFX A;  2E1S A;  4E0W A;  1TFA A;  3N26 A;  1Y1M A;  4WXJ A;  3KSX A;  1B1H A;  1DOT A;  1MG1 A;  5I59 A;  2Z8F A;  4FEB A;  2P0S A;  3KSJ A;  1TXF A;  4AB5 A;  2YLN A;  4F31 B;  2XXW A;  3ODB A;  4YKK A;  4EUO A;  3OEM A;  1R1N A;  3T9U A;  2AYS A;  2DS9 A;  3MWB A;  5I2K A;  4R2B A;  1PB9 A;  3K1M A;  2GHA A;  4NMY A;  2XXX A;  3E9X A;  3K6V A;  2DP8 A;  4U22 A;  3UK4 A;  4LZ5 A;  1B3F A;  4G4P A;  3C34 A;  1Y3N A;  1A7L A;  2H25 A;  3KBR A;  3OEK A;  1FQE A;  4U1O A;  5CMK A;  4DCY A;  1NL5 A;  4EXL A;  3TCH A;  1LB9 A;  4IB2 A;  1NNP A;  1DSN A;  1N7X A;  1DPE A;  4F29 A;  4Z7E A;  1LFG A;  1USY E;  1JEV A;  4JWY A;  1QUK A;  4OHN A;  4DXC A;  2PT2 A;  5HPQ A;  5CMB A;  3FD3 A;  2NVU B;  4PFY A;  1MXW A;  2ZYM A;  1Y1Z A;  3AXF A;  1SW4 A;  3ZKK A;  3UOR A;  5JTY B;  1UQW A;  1QJM A;  4F3G A;  1MY4 A;  1IXI A;  4M1V A;  4XKP A;  2FYI A;  5H8Q A;  5ITO A;  3Q28 A;  3KOS A;  1XHY A;  2AL4 A;  2HZK A;  4MFI A;  3A3U A;  1YAE A;  4FAJ A;  2DWH A;  4NED A;  3UP9 A;  1H44 A;  4ELO A;  3EQ1 A;  4EQ7 A;  1OIB A;  5I2N A;  1MXZ A;  2UXA A;  5DVJ A;  2RCA A;  3DP6 A;  2V25 A;  1LBC A;  2Q9T A;  1LCT A;  5B7D A;  1PBQ A;  4ZZE A;  2UVG A;  2P2A A;  4F3S A;  4WEP A;  1QVS A;  5H8N B;  2F34 A;  2O1M A;  3FAT A;  4YKI A;  4IO6 A;  4BDQ A;  2Z23 A;  2XD3 A;  1SYI A;  3BBR A;  3UGW A;  2G29 A;  3K0V A;  4KI0 E;  2ZNT A;  4PET A;  3V5A A;  3HO7 A;  4OTE A;  1URG A;  5I56 A;  5I57 A;  4I1D A;  3IOR A;  4ZE8 A;  1B7Z A;  2ONR A;  3E4R A;  1AOV A;  3JYR A;  2Z8E A;  2IA4 A;  3HHG A;  4NF6 B;  1BP5 A;  3KGC A;  1MM6 A;  3FGS A;  5KDT A;  5EYF A;  3S4U A;  4IO7 A;  1US5 A;  3H6W A;  5H8H A;  4OER A;  2YJP A;  3FAS A;  5ICQ A;  3GBB A;  3U92 A;  4QF9 A;  1A8E A;  4LAT A;  4ESW A;  3T9V A;  1GGG A;  4IO4 A;  1DTG A;  1LFI A;  3KEI A;  3HCQ A;  2D5W A;  3QYT A;  3TKD A;  4LQ5 A;  1Y3Q A;  3H7M A;  4UAC A;  3IJO B;  4NF8 A;  3MZ9 A;  1JW1 A;  3FXR A;  3T66 A;  3RLF E;  5ELV A;  2OZZ A;  3CRB A;  1FQB A;  4YZZ A;  4WED A;  3EPE A;  2IEE A;  2O1L A;  4Q5T A;  3O2A A;  5H8F A;  5HM4 B;  4YB6 A;  1WVJ A;  3TTM A;  1MQG A;  1SW1 A;  4HS7 A;  1Y20 A;  2QMW A;  1USY H;  4GFR A;  4LUB A;  1B5H A;  2Y7R A;  4ZZA A;  5FHO A;  3EHS A;  1POY 1;  1PDA A;  3VLU A;  3CG3 A;  1JW4 A;  1H45 A;  1J1N A;  3ZSF A;  5CBS A;  4DLD A;  1MQJ A;  4JWX A;  3LC8 A;  5BWJ A;  1WDN A;  2Z22 A;  1IIT A;  2I4C A;  4QSC A;  5I58 A;  3K2D A;  3PUY E;  4DE8 A;  5EHM A;  1GTK A;  3W9V A;  3EHT A;  3K6W A;  1BTJ A;  1N3W A;  4U21 A;  4DXU A;  3VDF A;  4X1D A;  2B65 A;  1PB8 A;  3BFT A;  4U4X A;  1B3E A;  4IY6 A;  1T0K A;  3CR9 A;  1Q35 A;  3IO4 A;  2A5S A;  4O3A A;  1FQD A;  3KJ7 A;  5I59 B;  1JVX A;  3CI8 A;  2OK2 A;  3GXA A;  3IX1 A;  1AIV A;  1MM7 A;  2RKM A;  2F8D A;  3BFU A;  3IJX B;  3G3I A;  3FJG A;  3Q27 A;  3E3K A;  4G68 A;  3CG1 A;  2XXV A;  2UVH A;  4YB5 A;  4H6D A;  3K02 A;  1MDQ A;  4JDF A;  4PE5 B;  3U94 A;  4KYE A;  4IY5 A;  2D21 A;  1B32 A;  3Q29 A;  3V83 A;  3RTW B;  5TPA B;  2QS4 A;  5CI5 A;  4YKP A;  2O7I A;  2HXW A;  4OWD A;  4ZEC A;  3TTK A;  1P99 A;  4GIZ A;  2F97 A;  2ZNU A;  1Z7N E;  2Y7K A;  2H98 A;  3M3L A;  2Q88 A;  2V3T A;  4OES A;  3SES A;  1EH3 A;  2XXI A;  1B51 A;  1H76 A;  4NF4 A;  3MP1 A;  3O97 A;  2I6E A;  3KOT A;  4GL8 A;  2DE2 A;  3CSB A;  1B1X A;  3FXQ A;  2O68 A;  3UA8 A;  4I9D A;  4POW A;  3K1N A;  4U1Z A;  2GFE A;  3Q26 A;  2F7C A;  3S9M C;  5A5X A;  1POT A;  1QKB A;  3H4Z A;  1MQH A;  1B40 A;  3BKI B;  4KR5 A;  3MAM A;  5CMC A;  3T9H B;  2ZMB A;  3UIF A;  3IL1 B;  4QFK A;  1ZMG A;  1DPP A;  1B3G A;  4ZEI A;  3C36 A;  4RK2 A;  2X7P A;  1GR2 A;  3R6U A;  4FIM A;  2HQ0 A;  4FE8 A;  4F18 A;  1LCF A;  3VFJ A;  4RA1 A;  3MBP A;  4ZEF A;  3O6G A;  4IO5 A;  1OVT A;  4EXK A;  4XXU A;  3V89 B;  4HTG A;  4G8M A;  5I57 B;  1Z7M E;  2GHB A;  3FVN A;  3A09 A;  3P7I A;  4ELR A;  5ICT A;  1II5 A;  3MVZ A;  3TZA A;  3OO9 A;  4AB6 A;  3SDF A;  5KDT B;  1MPD A;  1PEB A;  2QMX A;  2Q8J A;  4EF2 A;  2GRV A;  4QFL A;  3U1O A;  3RN8 A;  5H8H B;  4RPO A;  4LZ7 A;  4JXI A;  3N6U A;  3M3K A;  4P11 A;  4QFO A;  3KJT A;  2XXU A;  4GWO A;  3SEX A;  2HAU A;  1VSO A;  1YTV A;  1Y9U A;  1MQD A;  4XKQ A;  4BDO A;  2DSF A;  4YMA A;  3SEU A;  1B46 A;  2I3V A;  1ATG A;  4OXV A;  4GXA A;  1MH3 A;  4R72 A;  4C0R A;  4GRK A;  3JZJ A;  4RK9 A;  1ZKB A;  5CM6 A;  3TYH A;  4RJZ A;  3KN8 A;  4M4G A;  5TPA A;  3FUZ A;  4NF8 B;  3ZS6 A;  1OQG A;  3D4C A;  3PMW A;  2YPN A;  2F5X A;  2XXP A;  4GD5 A;  1BLF A;  5H8F B;  3KZG A;  4NWC A;  3OD7 A;  3DEL B;  3C31 A;  4K3F A;  2NWJ A;  2OWT A;  5F1Q A;  3RPW A;  2I58 A;  4OFJ A;  3H6U A;  4OEV A;  3OXN A;  3TAJ A;  1UTB A;  4H67 A;  1ANF A;  3RY3 A;  1HSL A;  5TP9 A;  3TQW A;  3QIM A;  2R6G E;  1N76 A;  4OQO A;  1LB8 A;  2VOZ A;  3L6G A;  4ZEK A;  3FVK A;  3S9N C;  5I58 B;  2DQV A;  1MDP 1;  4PP0 A;  2XXY A;  5FTH A;  4FAT A;  1I6A A;  2ONK E;  2DE3 A;  2XHD A;  3DM0 A;  5L9O A;  1OVB A;  4KFQ A;  2F35 A;  4X48 A;  2X7Q A;  5DVI A;  2RCB A;  4ZED A;  4RY1 A;  2NUV A;  1R9Q A;  1A55 A;  3DP8 A;  2HFB A;  2Q2A A;  4TLL B;  5AA1 A;  3RNN A;  2O84 X;  1FQA A;  5DEX B;  4ZE9 A;  4KD5 A;  1DMB A;  1SI0 A;  3O66 A;  4F3B A;  3RGY A;  1MY2 A;  1ZBM A;  4JSD A;  2B3F A;  3SET A;  1P1O A;  3QUJ A;  4G68 B;  5DYH A;  2GH9 A;  3O9P A;  4DZ1 A;  3U8Q A;  2PX1 A;  5AA2 A;  1URS A;  4IGT A;  2E0S A;  4QFP A;  3DLN A;  5K2Y A;  4MLQ A;  2I0C A;  1XS5 A;  3O29 A;  5LOM A;  4JB7 A;  1GV8 A;  4FOR A;  1LAH E;  4H8I A;  3VXC A;  4JSO A;  4OFL A;  3VVF A;  4DIG A;  1MH4 A;  1MXX A;  3MVX A;  4GXS B;  4XKR A;  4H8J A;  4QFN A;  2A5T A;  4XTC Q;  3MPL A;  1LAG E;  4OET A;  1QUJ A;  2QJE A;  2VHA A;  4KYS A;  2Q89 A;  3LSW A;  5CRY A;  3M3F A;  4NF4 B;  5CC2 A;  1CE2 A;  1P1U A;  4QHQ A;  1XVX A;  1M5D A;  4GQO A;  3PUZ E;  1FW0 A;  1JEU A;  3K00 A;  4THI A;  4MBP A;  3B7D A;  4YMB A;  1EU8 A;  3HST A;  2H9B A;  3ZKL A;  5A5X B;  4NWD A;  3PPP A;  4JBZ A;  3IOT A;  3GZG A;  2W7Y A;  1AMF A;  3TEP A;  3KN3 A;  3HHF A;  4F2Q A;  4C1U A;  1LFH A;  4NF5 A;  5ISU A;  1ELJ A;  4F1Y A;  3W9W A;  1H43 A;  4G8N A;  3N5L A;  3RQT A;  4EDP A;  3LSF B;  1M5B A;  1B52 A;  4EF1 A;  3SKP A;  4LA9 A;  4OEU A;  3VV5 A;  4O3C A;  5AE4 A;  4MLV A;  2O51 A;  3MPK A;  3VVE A;  1AL3 A;  5BUU A;  4ZEB A;  1AH5 A;  1P1Q A;  4YKJ A;  1NNF A;  1ZTY A;  1MXU A;  1M5F A;  4KHZ E;  2OBG A;  3C4M A;  2F36 A;  3T9X B;  1O7T A;  3G3K A;  3C32 A;  2O69 A;  3KFM A;  5IAI A;  3B6Q A;  3FV2 A;  2DXY A;  5DVF A;  1PBP A;  1FQF A;  3K01 A;  2I0B A;  1SBP A;  5TU0 A;  4H5F A;  3S9L C;  3PV0 E;  5DEX A;  3QUF A;  1A8F A;  2QSX A;  1Y4C A;  3I6V A;  3S2V A;  4Q0C A;  2NXO A;  3B6W A;  1OLC A;  3QK6 A;  4I62 A;  3MP6 A;  1XOC A;  1MPB A;  3OEL A;  1JET A;  5FHN A;  4IO3 A;  4C1T A;  2PVU A;  3IAZ A;  4OZ9 A;  1MY1 A;  1MXY A;  2ZNS A;  5M2V A;  2DXR A;  2VD3 A;  2V3U A;  4DDD A;  2Q2C A;  4H5G A;  2F6P A;  4O3B A;  1B5I A;  4DXB A;  4XIG Q;  1YCJ A;  1F9B A;  3PUX E;  1B7U A;  3PPR A;  1B3H A;  5I84 A;  4HCW A;  5FTI A;  1HSJ A;  1IXC A;  2DYX A;  2VGQ A;  3QXM A;  2ZYN A;  3FXU A;  3H6T A;  2XD2 A;  3TOD A;  1ZU0 A;  1NKX A;  3TTL A;  2ESN A;  1UTB B;  1B7H A;  2HZL A;  5TP9 B;  1B6H A;  3G3J A;  3CSG A;  3PD8 A;  4FED A;  2WKY A;  1VFD A;  1B2H A;  4P0G A;  1XT8 A;  1NNT A;  1YPN A;  2F7A A;  3K4U A;  2I48 A;  2PBW A;  1JNF A;  4IO2 A;  3RT8 A;  3PPN A;  2PMS A;  1TFD A;  4H0W A;  3Q25 A;  1MXV A;  4N07 A;  3G3G A;  1VR5 A;  5CMM A;  4HW8 A;  1TWY A;  1B05 A;  4FEC A;  1SD3 A;  4R73 A;  1HSE A;  2LAO A;  3IOU A;  4RXL A;  3S9E A;  5F7V A;  1P1W A;  3OO6 A;  1IUD A;  2RC9 A;  1R9L A;  4JWO A;  2VP1 A;  2XX8 A;  4ZDM A;  1LGB C;  3LBS A;  3I5O A;  2I49 A;  4R6H A;  4IGR A;  4AQ4 A;  4PFT A;  2ZXT A;  1FQC A;  1UTH B;  3HPI A;  3CVG A;  1N84 A;  5JEI A;  3TTR A;  1S9T A;  3MC2 A;  3PGF A;  2Y7P A;  1GVC A;  1SW5 A;  1N3X A;  4L17 A;  5AA2 B;  3ONM A;  1MQI A;  1CB6 A;  5EHS A;  2HCA A;  1SVX B;  3K6X A;  3MQ9 A;  2DOJ A;  1B0L A;  4TOZ A;  3PD9 A;  3WAF A;  4ZS9 A;  4POX A;  4PQJ A;  1JQF A;  3TMG A;  4XKN A;  2DWJ A;  3TCG A;  2OLB A;  4YU0 A;  2O7U A;  4EQB A;  1NH8 A;  2XXT A;  1NMU A;  2UVI A;  1UIU A;  4MH5 A;  1SI1 A;  2A5T B;  1FTK A;  3TFL A;  4H1X A;  5KCJ A;  3PUW E;  3TCF A;  3OOA A;  3OO7 A;  3VLV A;  5J1D A;  1LST A;  4LP2 B;  1LLS A;  1QUI A;  2ZYK A;  1LAX A;  1UIV A;  3F11 A;  1I69 A;  4LVQ A;  3RUM A;  3DP4 A;  4ONY A;  4F1U A;  3H06 B;  3OO8 A;  3RT6 B;  3TQL A;  5CBR A;  5L8D A;  3MJN A;  4F3P A;  3MVY A;  2Y7W A;  2HAV A;  3USD A;  1WOD A;  3PPQ A;  3EF7 A;  1MPC A;  3FV1 A;  3ILT B;  4MF3 A;  1R6Z A;  4X1B A;  3G3H A;  1NFT A;  1B9J A;  3FIR A;  4FJP A;  1IEJ A;  1BKA A;  2F7B A;  2UYE A;  3FJM A;  4YAH X;  2HEU A;  1URD A;  4NF5 B;  5AA4 A;  2CZL A;  2P1S A;  3I3V A;  4RPN A;  1D9V A;  3WAE A;  4BDN A;  5JK4 A;  3R7X A;  1IIW A;  1SW2 A;  2UVJ A;  3G7W A;  1N0T A;  2REG A;  1MY3 A;  2ABH A;  1NNK A;  5L9M A;  3PUV E;  1O63 A;  3MZB A;  3LUY A;  4KQP A;  1ZIU A;  3PU5 A;  4G2Z A;  2ALU A;  2DVC A;  1A99 A;  4OVJ A;  3T93 B;  3PPO A;  3TEL A;  2F6G A;  3QSL A;  2QS3 A;  3R26 A;  1P1N A;  2RC8 A;  3PMX A;  1EZO A;  3A3C A;  4ESX A;  3GBA A;  2NOO A;  1XC1 A;  1N04 A;  1ZJL A;  4LQ2 A;  4WKM A;  1D9Y A;  3TUS A;  1I6B A;  1BIY A;  2QRY A;  3MW0 A;  1B5J A;  1B3L A;  2DE4 A;  2OWS A;  2KLF A;  3KG2 A;  5HBC A;  3IB1 A;  2I3W A;  4RNS A;  1UTH A;  4I8C A;  3N94 A;  1QKA A;  3IB2 A;  3CFZ A;  4OFO A;  4Z0I A;  5DT6 A;  3G3F A;  5KZT A;  1RYX A;  4F2O A;  4GL0 A;  2DWI A;  1M5E A;  1FCK A;  4N6P A;  1S7Y A;  4UA8 A;  1FTM A;  2F78 A;  1RYO A;  4ELQ A;  2XXR A;  2XXQ A;  4R2F A;  4KPT A;  2QPQ A;  4F19 A;  3VXB A;  1A40 A;  4R75 A;  3MZ1 A;  2UYF A;  4G77 A;  3SEW A;  1VE4 A;  4YB7 A;  4ECF A;  2V93 A;  3IK6 B;  1I6Q A;  1PB7 A;  3O6I A;  1IQ7 A;  1SYH A;  3FVG A;  1Q1K A;  1IXH A;  1ZLQ A;  2FA7 A;  3CIJ A;  3C33 A;  3N6T A;  1SDX A;  2QS1 A;  2V3Q A;  4E0X A;  2REJ A;  3SEV A;  4RYA A;  4GF8 A;  4BDR A;  2VD2 A;  2H99 A;  3HV1 A;  2B3B A;  3U93 A;  4HCY A;  1US4 A;  4P0I A;  3SER A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...