2Z8JA

Crystal structure of escherichia coli gamma-glutamyltranspeptidase in complex with azaserine prepared in the dark
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
350
structure length
350
Chain Sequence
EDVFHPVRAKQGMVASVDATATQVGVDILKEGGNAVDAAVAVGYALAVTHPQAGNLGGGGFMLIRSKNGNTTAIDFREMAPAKATRDMFLDDQGNPDSKKSLTSHLASGTPGTVAGFSLALDKYGTMPLNKVVQPAFKLARDGFIVNDALADDLKTYGSEVLPNHENSKAIFWKEGEPLKKGDTLVQANLAKSLEMIAENGPDEFYKGTIAEQIAQEMQKNGGLITKEDLAAYKAVERTPISGDYRGYQVYSMPPPSSGGIHIVQILNILENFDMKKYGFGSADAMQIMAEAEKYAYADRSEYLGDPDFVKVPWQALTNKAYAKSIADQIDINKAKPSSEIRPGKLAPYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gamma-glutamyltranspeptidase
publication title Crystal structures of Escherichia coli gamma-glutamyltranspeptidase in complex with azaserine and acivicin: novel mechanistic implication for inhibition by glutamine antagonists
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 99
structure length 350
sequence length 350
chains with identical sequence C
ec nomenclature ec 2.3.2.2: Gamma-glutamyltransferase.
pdb deposition date 2007-09-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.246.130 Mainly Alpha Orthogonal Bundle Serum Albumin; Chain A, Domain 1 Serum Albumin; Chain A, Domain 1 2z8jA02
3WHRA 4ZCGA 2QM6A 2DBUA 2E0XA 5BPKA 4OTUA 2V36A 3FNMA 4OTTA 4ZBKA 3WHSA 2E0YA 4ZC6A 4GDXA 5B5TA 2Z8JA 2Z8IA 2QMCA 2Z8KA 2DG5A 2DBWA 2NQOA 2DBXA 4Z9OA 4GG2A 3WHQA 3A75A
chains in the Genus database with same CATH superfamily
1BKEA 1E7BA 4F5UA 1HK5A 5IJEA 1E7GA 2BXDA 4HGKA 1VFIA 4GDLB 4NAWB 4F5TA 2DBUA 3SIUB 1SB0A 2BX8A 3SQJA 4F5SA 1MUSA 1E7IA 4GDKB 4OR0A 2BXCA 5GINA 2I2ZA 1TF0A 5FUOA 3WHSA 2E0YA 4LUFA 2VUFA 4L9KA 5DBYA 5B5TA 2YDFA 2QMCA 2Z8KA 1N5UA 3NVIA 3H37A 4LB2A 1GNIA 5IIXA 2NNWA 1JNBA 2DBXA 4Z9OA 3JQZA 2BXIA 4M70B 3A75A 1O9XA 4ZBRA 3NMUA 1LOTA 5IIHA 3MHSB 2GUTA 4HGMB 1GNJA 3VQIA 1AO6A 2XVVA 4DHXB 2EFDA 1H5WA 2AGHB 4N3ZA 2DYMA 4WA6B 2AJEA 2VUEA 1HK1A 1IJGA 4S1YA 3GA9L 2V36A 1NT2B 3CX9A 3ECPA 3B9MA 1BJ5A 2BXEA 3V09A 2KWFA 4ZC6A 1HK2A 2CKXA 2I30A 5IJ5A 2EFHA 4F5VA 4IW2A 2BXQA 2DG5A 3B9LA 4Z69A 2BXMA 5GIOA 2XW0A 1LNSA 2LQHA 2BXBA 4EMXA 3NVMA 4BKEA 5ID7A 4GG2A 4J2VA 4OT2A 4K2CA 1H9ZA 3NVKA 4FJCB 3GQUA 1HA2A 1KW2A 2BXLA 2XVQA 4PO0A 2ROHA 4DM0A 4E99A 1E7EA 4L9QA 3UIVA 2XVUA 2XVWA 2LOQA 2XMOA 2QM6A 2BXOA 2LXTA 2JUHA 2BXKA 1E78A 1J78A 1MIWA 2KBZA 2BXGA 4N0UD 3V03A 5BPKA 3M99C 1TXUA 4ZUXV 2QHBA 4I9OA 2BXNA 3GQXA 4ZBKA 1KDXA 2XW1A 4GDXA 4N0FD 4C31B 2LXSA 3FWCC 4D7XA 5IJFA 4BY9C 5ID9A 1E7FA 1MA9A 3JRYA 3LU8A 4FK5B 4LA0A 3H3AA 3LU7A 1E7AA 4K71A 4LB9A 5HOZA 3PLAA 3WHQA 1FOUA 4ZBQA 1UORA 1MM8A 1MIYA 1MUHA 5IFOA 3V08A 3WHRA 3KIKA 5GIPA 1MIVA 3G9KD 4G04A 2XSIA 1HK3A 4ZCGA 5IIUA 1KXPD 3KJLA 5GHKA 3LU6A 4MBEC 4G03A 2E0XA 4LUHA 4OTUA 4G01A 3FNMA 1E7HA 4L8UA 4OTTA 3BPJA 3A73A 1BM0A 3ICXA 2BXFA 5D7GA 2BXPA 1J7EA 4W4UB 2Z8JA 4JK4A 3FWBC 5DQFA 2Z8IA 2OZBB 2BXAA 2EFEA 2DBWA 2OT3A 1E7CA 2NQOA 3MHHB 2K0NA 4TQ1A 3TDLA 3W1SA 1VZSA 2VDBA 2DYOA 2EFCA 3SIVB 4TQ0A 4FIPB 4IW1A 1HK4A 2BXHA 2LQIA
chains in the Genus database with same CATH topology
1BKEA 1E7BA 4F5UA 1HK5A 5IJEA 1E7GA 2BXDA 4HGKA 1VFIA 4GDLB 4NAWB 4F5TA 2DBUA 3SIUB 2BX8A 3SQJA 4F5SA 1E7IA 4GDKB 4OR0A 2BXCA 5GINA 2I2ZA 1TF0A 5FUOA 3WHSA 2E0YA 4LUFA 2VUFA 4L9KA 5DBYA 5B5TA 2YDFA 2QMCA 2Z8KA 1N5UA 3NVIA 3H37A 4LB2A 1GNIA 5IIXA 2NNWA 1JNBA 2DBXA 4Z9OA 3JQZA 2BXIA 4M70B 3A75A 1O9XA 4ZBRA 3NMUA 1LOTA 5IIHA 3MHSB 4HGMB 1GNJA 3VQIA 1AO6A 2XVVA 4DHXB 1H5WA 2EFDA 4N3ZA 2DYMA 4WA6B 2AJEA 2VUEA 1HK1A 1IJGA 4S1YA 3GA9L 2V36A 1NT2B 3CX9A 3B9MA 1BJ5A 2BXEA 3V09A 4ZC6A 5IJ5A 1HK2A 2CKXA 2I30A 4F5VA 2EFHA 4IW2A 2BXQA 2DG5A 3B9LA 4Z69A 2BXMA 5GIOA 2XW0A 1LNSA 2BXBA 4EMXA 3NVMA 4BKEA 5ID7A 4GG2A 4J2VA 4OT2A 4K2CA 1H9ZA 3NVKA 4FJCB 1HA2A 1KW2A 2BXLA 2XVQA 4PO0A 2ROHA 4E99A 1E7EA 4L9QA 3UIVA 2XVUA 2XVWA 2LOQA 2XMOA 2QM6A 2BXOA 2JUHA 2BXKA 1E78A 1J78A 1MIWA 2KBZA 2BXGA 4N0UD 3V03A 5BPKA 3M99C 1TXUA 4ZUXV 2QHBA 2BXNA 3GQXA 4ZBKA 2XW1A 4GDXA 4N0FD 4C31B 3FWCC 5IJFA 4BY9C 5ID9A 1E7FA 1MA9A 3JRYA 3LU8A 4FK5B 4LA0A 3H3AA 3LU7A 1E7AA 4K71A 4LB9A 5HOZA 3PLAA 3WHQA 1FOUA 4ZBQA 1UORA 1MIYA 5IFOA 3V08A 3WHRA 3KIKA 5GIPA 1MIVA 3G9KD 4G04A 2XSIA 1HK3A 4ZCGA 5IIUA 1KXPD 3KJLA 5GHKA 3LU6A 4MBEC 4G03A 2E0XA 4LUHA 4OTUA 4G01A 3FNMA 1E7HA 4L8UA 4OTTA 3A73A 1BM0A 3ICXA 2BXFA 5D7GA 2BXPA 1J7EA 4W4UB 2Z8JA 4JK4A 3FWBC 5DQFA 2Z8IA 2OZBB 2BXAA 2EFEA 2DBWA 2OT3A 1E7CA 2NQOA 3MHHB 3TDLA 4TQ1A 3W1SA 1VZSA 2VDBA 2DYOA 2EFCA 3SIVB 4TQ0A 4FIPB 4IW1A 1HK4A 2BXHA 3GQUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WHR A;  4ZCG A;  2QM6 A;  2DBU A;  2E0X A;  5BPK A;  4OTU A;  2V36 A;  3FNM A;  4OTT A;  4ZBK A;  3WHS A;  2E0Y A;  4ZC6 A;  4GDX A;  5B5T A;  2Z8J A;  2Z8I A;  2QMC A;  2Z8K A;  2DG5 A;  2DBW A;  2NQO A;  2DBX A;  4Z9O A;  4GG2 A;  3WHQ A;  3A75 A; 
#chains in the Genus database with same CATH topology
 1BKE A;  1E7B A;  4F5U A;  1HK5 A;  5IJE A;  1E7G A;  2BXD A;  4HGK A;  1VFI A;  4GDL B;  4NAW B;  4F5T A;  2DBU A;  3SIU B;  1SB0 A;  2BX8 A;  3SQJ A;  4F5S A;  1MUS A;  1E7I A;  4GDK B;  4OR0 A;  2BXC A;  5GIN A;  2I2Z A;  1TF0 A;  5FUO A;  3WHS A;  2E0Y A;  4LUF A;  2VUF A;  4L9K A;  5DBY A;  5B5T A;  2YDF A;  2QMC A;  2Z8K A;  1N5U A;  3NVI A;  3H37 A;  4LB2 A;  1GNI A;  5IIX A;  2NNW A;  1JNB A;  2DBX A;  4Z9O A;  3JQZ A;  2BXI A;  4M70 B;  3A75 A;  1O9X A;  4ZBR A;  3NMU A;  1LOT A;  5IIH A;  3MHS B;  2GUT A;  4HGM B;  1GNJ A;  3VQI A;  1AO6 A;  2XVV A;  4DHX B;  2EFD A;  1H5W A;  2AGH B;  4N3Z A;  2DYM A;  4WA6 B;  2AJE A;  2VUE A;  1HK1 A;  1IJG A;  4S1Y A;  3GA9 L;  2V36 A;  1NT2 B;  3CX9 A;  3ECP A;  3B9M A;  1BJ5 A;  2BXE A;  3V09 A;  2KWF A;  4ZC6 A;  1HK2 A;  2CKX A;  2I30 A;  5IJ5 A;  2EFH A;  4F5V A;  4IW2 A;  2BXQ A;  2DG5 A;  3B9L A;  4Z69 A;  2BXM A;  5GIO A;  2XW0 A;  1LNS A;  2LQH A;  2BXB A;  4EMX A;  3NVM A;  4BKE A;  5ID7 A;  4GG2 A;  4J2V A;  4OT2 A;  4K2C A;  1H9Z A;  3NVK A;  4FJC B;  3GQU A;  1HA2 A;  1KW2 A;  2BXL A;  2XVQ A;  4PO0 A;  2ROH A;  4DM0 A;  4E99 A;  1E7E A;  4L9Q A;  3UIV A;  2XVU A;  2XVW A;  2LOQ A;  2XMO A;  2QM6 A;  2BXO A;  2LXT A;  2JUH A;  2BXK A;  1E78 A;  1J78 A;  1MIW A;  2KBZ A;  2BXG A;  4N0U D;  3V03 A;  5BPK A;  3M99 C;  1TXU A;  4ZUX V;  2QHB A;  4I9O A;  2BXN A;  3GQX A;  4ZBK A;  1KDX A;  2XW1 A;  4GDX A;  4N0F D;  4C31 B;  2LXS A;  3FWC C;  4D7X A;  5IJF A;  4BY9 C;  5ID9 A;  1E7F A;  1MA9 A;  3JRY A;  3LU8 A;  4FK5 B;  4LA0 A;  3H3A A;  3LU7 A;  1E7A A;  4K71 A;  4LB9 A;  5HOZ A;  3PLA A;  3WHQ A;  1FOU A;  4ZBQ A;  1UOR A;  1MM8 A;  1MIY A;  1MUH A;  5IFO A;  3V08 A;  3WHR A;  3KIK A;  5GIP A;  1MIV A;  3G9K D;  4G04 A;  2XSI A;  1HK3 A;  4ZCG A;  5IIU A;  1KXP D;  3KJL A;  5GHK A;  3LU6 A;  4MBE C;  4G03 A;  2E0X A;  4LUH A;  4OTU A;  4G01 A;  3FNM A;  1E7H A;  4L8U A;  4OTT A;  3BPJ A;  3A73 A;  1BM0 A;  3ICX A;  2BXF A;  5D7G A;  2BXP A;  1J7E A;  4W4U B;  2Z8J A;  4JK4 A;  3FWB C;  5DQF A;  2Z8I A;  2OZB B;  2BXA A;  2EFE A;  2DBW A;  2OT3 A;  1E7C A;  2NQO A;  3MHH B;  2K0N A;  4TQ1 A;  3TDL A;  3W1S A;  1VZS A;  2VDB A;  2DYO A;  2EFC A;  3SIV B;  4TQ0 A;  4FIP B;  4IW1 A;  1HK4 A;  2BXH A;  2LQI A; 
#chains in the Genus database with same CATH homology
 1BKE A;  1E7B A;  4F5U A;  1HK5 A;  5IJE A;  1E7G A;  2BXD A;  4HGK A;  1VFI A;  4GDL B;  4NAW B;  4F5T A;  2DBU A;  3SIU B;  2BX8 A;  3SQJ A;  4F5S A;  1E7I A;  4GDK B;  4OR0 A;  2BXC A;  5GIN A;  2I2Z A;  1TF0 A;  5FUO A;  3WHS A;  2E0Y A;  4LUF A;  2VUF A;  4L9K A;  5DBY A;  5B5T A;  2YDF A;  2QMC A;  2Z8K A;  1N5U A;  3NVI A;  3H37 A;  4LB2 A;  1GNI A;  5IIX A;  2NNW A;  1JNB A;  2DBX A;  4Z9O A;  3JQZ A;  2BXI A;  4M70 B;  3A75 A;  1O9X A;  4ZBR A;  3NMU A;  1LOT A;  5IIH A;  3MHS B;  4HGM B;  1GNJ A;  3VQI A;  1AO6 A;  2XVV A;  4DHX B;  1H5W A;  2EFD A;  4N3Z A;  2DYM A;  4WA6 B;  2AJE A;  2VUE A;  1HK1 A;  1IJG A;  4S1Y A;  3GA9 L;  2V36 A;  1NT2 B;  3CX9 A;  3B9M A;  1BJ5 A;  2BXE A;  3V09 A;  4ZC6 A;  5IJ5 A;  1HK2 A;  2CKX A;  2I30 A;  4F5V A;  2EFH A;  4IW2 A;  2BXQ A;  2DG5 A;  3B9L A;  4Z69 A;  2BXM A;  5GIO A;  2XW0 A;  1LNS A;  2BXB A;  4EMX A;  3NVM A;  4BKE A;  5ID7 A;  4GG2 A;  4J2V A;  4OT2 A;  4K2C A;  1H9Z A;  3NVK A;  4FJC B;  1HA2 A;  1KW2 A;  2BXL A;  2XVQ A;  4PO0 A;  2ROH A;  4E99 A;  1E7E A;  4L9Q A;  3UIV A;  2XVU A;  2XVW A;  2LOQ A;  2XMO A;  2QM6 A;  2BXO A;  2JUH A;  2BXK A;  1E78 A;  1J78 A;  1MIW A;  2KBZ A;  2BXG A;  4N0U D;  3V03 A;  5BPK A;  3M99 C;  1TXU A;  4ZUX V;  2QHB A;  2BXN A;  3GQX A;  4ZBK A;  2XW1 A;  4GDX A;  4N0F D;  4C31 B;  3FWC C;  5IJF A;  4BY9 C;  5ID9 A;  1E7F A;  1MA9 A;  3JRY A;  3LU8 A;  4FK5 B;  4LA0 A;  3H3A A;  3LU7 A;  1E7A A;  4K71 A;  4LB9 A;  5HOZ A;  3PLA A;  3WHQ A;  1FOU A;  4ZBQ A;  1UOR A;  1MIY A;  5IFO A;  3V08 A;  3WHR A;  3KIK A;  5GIP A;  1MIV A;  3G9K D;  4G04 A;  2XSI A;  1HK3 A;  4ZCG A;  5IIU A;  1KXP D;  3KJL A;  5GHK A;  3LU6 A;  4MBE C;  4G03 A;  2E0X A;  4LUH A;  4OTU A;  4G01 A;  3FNM A;  1E7H A;  4L8U A;  4OTT A;  3A73 A;  1BM0 A;  3ICX A;  2BXF A;  5D7G A;  2BXP A;  1J7E A;  4W4U B;  2Z8J A;  4JK4 A;  3FWB C;  5DQF A;  2Z8I A;  2OZB B;  2BXA A;  2EFE A;  2DBW A;  2OT3 A;  1E7C A;  2NQO A;  3MHH B;  3TDL A;  4TQ1 A;  3W1S A;  1VZS A;  2VDB A;  2DYO A;  2EFC A;  3SIV B;  4TQ0 A;  4FIP B;  4IW1 A;  1HK4 A;  2BXH A;  3GQU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...