2Z8WA

Structure of an ignar-ama1 complex
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
335
structure length
335
Chain Sequence
NYMGNPWTEYMAKYDIEEVHGSGIRVDLGEDAEVAGTQYRLPSGKCPVFGKGIIIENSNTTFLTPVATGNQYLKDGGFAFPPTEPLMSPMTLDEMRHFYKDNKYVKNLDELTLCSRHAGNMIPDNDKNSNYKYPAVYDDKDKKCHILYIAAQENNGPRYCNKDESKRNSMFCFRPAKDISFQNYTYLSKNVVDNWEKVCPRKNLQNAKFGLWVDGNCEDIPHVNEFPAIDLFECNKLVFELSASDQPKQYEQHLTDYEKIKEGFKNKNASMIKSAFLPTGAFKADRYKSHGKGYNWGNYNTETQKCEIFNVKPTCLINNSSYIATTALSHPIEVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Apical membrane antigen 1
publication title Structure of an IgNAR-AMA1 Complex: Targeting a Conserved Hydrophobic Cleft Broadens Malarial Strain Recognition
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Immune system
total genus 84
structure length 335
sequence length 335
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-09-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.4.10 Alpha Beta 3-Layer(bba) Sandwich Hepatocyte Growth Factor Hepatocyte Growth Factor 2z8wA01
5CS5A 5CT3A 4A5TS 2K13X 3HN4A 5CT1A 2Y8RA 4IUAA 5CS1A 2Q8AA 3SP8A 5EODA 1GMNA 2YIPA 1HKYA 2LL4M 2Z8WA 4R1AA 2LL3A 2J8JA 4R1BA 5I25A 5COEA 3HMRA 2J8LA 2QJ4A 4Z09A 1BHTA 1GP9A 3SRJA 5CT2A 4APLA 2YIOA 5CP9A 4R19A 4Z0DA 2HGFA 2F83A 3SRIA 2Z8VA 3HMSA 2Q8BA 3MKPA 1W81A 3HMTA 5CS3A 4DURA 1I8NA 1NK1A 5EOKA 1W8KA 1Z40A 4UV6A 2X2ZA 3ZLEA 5CS9A 3ZWZA 4APMA 2YILA 4Z0FA 1GMOA 5CSQA 4UAOA 2QJ2A 4R1CA 1YXEA 4Z0EA
chains in the Genus database with same CATH superfamily
5CS5A 5CT3A 4YIZA 4A5TS 2K13X 3HN4A 4YIVA 5CT1A 2Y8RA 4IUAA 5CS1A 2Q8AA 3SP8A 5EODA 1GMNA 2YIPA 1HKYA 2LL4M 2Z8WA 4R1AA 2LL3A 2J8JA 4R1BA 5I25A 5COEA 3HMRA 2J8LA 2QJ4A 4Z09A 1BHTA 1GP9A 3SRJA 5CT2A 4APLA 2YIOA 5CP9A 4R19A 4Z0DA 2HGFA 2F83A 3SRIA 2Z8VA 3HMSA 2Q8BA 3MKPA 1W81A 3HMTA 5CS3A 4DURA 1I8NA 1NK1A 5EOKA 1W8KA 2KL5A 1Z40A 4UV6A 2X2ZA 3ZLEA 5CS9A 3ZWZA 4APMA 2YILA 4Z0FA 1GMOA 5CSQA 4UAOA 2QJ2A 4R1CA 1YXEA 4Z0EA
chains in the Genus database with same CATH topology
5CS5A 5CT3A 4YIZA 4A5TS 2K13X 3HN4A 4YIVA 5CT1A 2Y8RA 4IUAA 5CS1A 2Q8AA 3SP8A 5EODA 1GMNA 2YIPA 1HKYA 2LL4M 2Z8WA 4R1AA 2LL3A 2J8JA 4R1BA 5I25A 5COEA 3HMRA 2J8LA 2QJ4A 4Z09A 1BHTA 1GP9A 3SRJA 5CT2A 4APLA 2YIOA 5CP9A 4R19A 4Z0DA 2HGFA 2F83A 3SRIA 2Z8VA 3HMSA 2Q8BA 3MKPA 1W81A 3HMTA 5CS3A 4DURA 1I8NA 1NK1A 5EOKA 1W8KA 2KL5A 1Z40A 4UV6A 2X2ZA 3ZLEA 5CS9A 3ZWZA 4APMA 2YILA 4Z0FA 1GMOA 5CSQA 4UAOA 2QJ2A 4R1CA 1YXEA 4Z0EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CS5 A;  5CT3 A;  4A5T S;  2K13 X;  3HN4 A;  5CT1 A;  2Y8R A;  4IUA A;  5CS1 A;  2Q8A A;  3SP8 A;  5EOD A;  1GMN A;  2YIP A;  1HKY A;  2LL4 M;  2Z8W A;  4R1A A;  2LL3 A;  2J8J A;  4R1B A;  5I25 A;  5COE A;  3HMR A;  2J8L A;  2QJ4 A;  4Z09 A;  1BHT A;  1GP9 A;  3SRJ A;  5CT2 A;  4APL A;  2YIO A;  5CP9 A;  4R19 A;  4Z0D A;  2HGF A;  2F83 A;  3SRI A;  2Z8V A;  3HMS A;  2Q8B A;  3MKP A;  1W81 A;  3HMT A;  5CS3 A;  4DUR A;  1I8N A;  1NK1 A;  5EOK A;  1W8K A;  1Z40 A;  4UV6 A;  2X2Z A;  3ZLE A;  5CS9 A;  3ZWZ A;  4APM A;  2YIL A;  4Z0F A;  1GMO A;  5CSQ A;  4UAO A;  2QJ2 A;  4R1C A;  1YXE A;  4Z0E A; 
#chains in the Genus database with same CATH topology
 5CS5 A;  5CT3 A;  4YIZ A;  4A5T S;  2K13 X;  3HN4 A;  4YIV A;  5CT1 A;  2Y8R A;  4IUA A;  5CS1 A;  2Q8A A;  3SP8 A;  5EOD A;  1GMN A;  2YIP A;  1HKY A;  2LL4 M;  2Z8W A;  4R1A A;  2LL3 A;  2J8J A;  4R1B A;  5I25 A;  5COE A;  3HMR A;  2J8L A;  2QJ4 A;  4Z09 A;  1BHT A;  1GP9 A;  3SRJ A;  5CT2 A;  4APL A;  2YIO A;  5CP9 A;  4R19 A;  4Z0D A;  2HGF A;  2F83 A;  3SRI A;  2Z8V A;  3HMS A;  2Q8B A;  3MKP A;  1W81 A;  3HMT A;  5CS3 A;  4DUR A;  1I8N A;  1NK1 A;  5EOK A;  1W8K A;  2KL5 A;  1Z40 A;  4UV6 A;  2X2Z A;  3ZLE A;  5CS9 A;  3ZWZ A;  4APM A;  2YIL A;  4Z0F A;  1GMO A;  5CSQ A;  4UAO A;  2QJ2 A;  4R1C A;  1YXE A;  4Z0E A; 
#chains in the Genus database with same CATH homology
 5CS5 A;  5CT3 A;  4YIZ A;  4A5T S;  2K13 X;  3HN4 A;  4YIV A;  5CT1 A;  2Y8R A;  4IUA A;  5CS1 A;  2Q8A A;  3SP8 A;  5EOD A;  1GMN A;  2YIP A;  1HKY A;  2LL4 M;  2Z8W A;  4R1A A;  2LL3 A;  2J8J A;  4R1B A;  5I25 A;  5COE A;  3HMR A;  2J8L A;  2QJ4 A;  4Z09 A;  1BHT A;  1GP9 A;  3SRJ A;  5CT2 A;  4APL A;  2YIO A;  5CP9 A;  4R19 A;  4Z0D A;  2HGF A;  2F83 A;  3SRI A;  2Z8V A;  3HMS A;  2Q8B A;  3MKP A;  1W81 A;  3HMT A;  5CS3 A;  4DUR A;  1I8N A;  1NK1 A;  5EOK A;  1W8K A;  2KL5 A;  1Z40 A;  4UV6 A;  2X2Z A;  3ZLE A;  5CS9 A;  3ZWZ A;  4APM A;  2YIL A;  4Z0F A;  1GMO A;  5CSQ A;  4UAO A;  2QJ2 A;  4R1C A;  1YXE A;  4Z0E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...