2Z8WA

Structure of an ignar-ama1 complex
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
335
structure length
335
Chain Sequence
b'NYMGNPWTEYMAKYDIEEVHGSGIRVDLGEDAEVAGTQYRLPSGKCPVFGKGIIIENSNTTFLTPVATGNQYLKDGGFAFPPTEPLMSPMTLDEMRHFYKDNKYVKNLDELTLCSRHAGNMIPDNDKNSNYKYPAVYDDKDKKCHILYIAAQENNGPRYCNKDESKRNSMFCFRPAKDISFQNYTYLSKNVVDNWEKVCPRKNLQNAKFGLWVDGNCEDIPHVNEFPAIDLFECNKLVFELSASDQPKQYEQHLTDYEKIKEGFKNKNASMIKSAFLPTGAFKADRYKSHGKGYNWGNYNTETQKCEIFNVKPTCLINNSSYIATTALSHPIEVE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Apical membrane antigen 1
publication title Structure of an IgNAR-AMA1 Complex: Targeting a Conserved Hydrophobic Cleft Broadens Malarial Strain Recognition
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Immune system
total genus 84
structure length 335
sequence length 335
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-09-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.4.10 Alpha Beta 3-Layer(bba) Sandwich Hepatocyte Growth Factor Hepatocyte Growth Factor 2z8wA01
2LL3A 5I25A 1W81A 2Y8RA 3HN4A 3MKPA 5CT1A 4R19A 5CS9A 3HMTA 1NK1A 1GP9A 4IUAA 4Z09A 4APMA 2YIOA 2LL4M 2QJ2A 2Q8BA 4Z0FA 2YIPA 3ZWZA 2J8LA 2YILA 3HMRA 5CS3A 3SRJA 1HKYA 2J8JA 2Q8AA 4R1BA 5COEA 5CP9A 2Z8WA 5EODA 4Z0EA 5EOKA 1W8KA 4R1AA 5CS1A 2X2ZA 2QJ4A 5CT3A 4UAOA 1GMNA 4R1CA 4APLA 4Z0DA 2Z8VA 5CT2A 4UV6A 5CSQA 4DURA 1BHTA 2HGFA 3HMSA 3ZLEA 3SRIA 2K13X 1Z40A 2F83A 3SP8A 5CS5A 1I8NA 1YXEA 4A5TS 1GMOA
chains in the Genus database with same CATH superfamily
2LL3A 5I25A 1W81A 2Y8RA 3HN4A 3MKPA 5CT1A 4R19A 5CS9A 3HMTA 1NK1A 1GP9A 4IUAA 4YIVA 4Z09A 2YIOA 4APMA 2LL4M 2QJ2A 2Q8BA 4Z0FA 2YIPA 3ZWZA 2J8LA 2YILA 3HMRA 5CS3A 3SRJA 1HKYA 2J8JA 2Q8AA 4R1BA 5COEA 5CP9A 2Z8WA 5EODA 4YIZA 4Z0EA 5EOKA 2KL5A 1W8KA 4R1AA 5CS1A 2X2ZA 2QJ4A 5CT3A 4UAOA 1GMNA 4R1CA 4APLA 4Z0DA 2Z8VA 5CT2A 4UV6A 5CSQA 4DURA 1BHTA 2HGFA 3HMSA 3ZLEA 3SRIA 2K13X 1Z40A 2F83A 3SP8A 5CS5A 1I8NA 1YXEA 4A5TS 1GMOA
chains in the Genus database with same CATH topology
2LL3A 5I25A 1W81A 2Y8RA 3HN4A 3MKPA 5CT1A 4R19A 5CS9A 3HMTA 1NK1A 1GP9A 4IUAA 4YIVA 4Z09A 2YIOA 4APMA 2LL4M 2QJ2A 2Q8BA 4Z0FA 2YIPA 3ZWZA 2J8LA 2YILA 3HMRA 5CS3A 3SRJA 1HKYA 2J8JA 2Q8AA 4R1BA 5COEA 5CP9A 2Z8WA 5EODA 4YIZA 4Z0EA 5EOKA 2KL5A 1W8KA 4R1AA 5CS1A 2X2ZA 2QJ4A 5CT3A 4UAOA 1GMNA 4R1CA 4APLA 4Z0DA 2Z8VA 5CT2A 4UV6A 5CSQA 4DURA 1BHTA 2HGFA 3HMSA 3ZLEA 3SRIA 2K13X 1Z40A 2F83A 3SP8A 5CS5A 1I8NA 1YXEA 4A5TS 1GMOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LL3 A;  5I25 A;  1W81 A;  2Y8R A;  3HN4 A;  3MKP A;  5CT1 A;  4R19 A;  5CS9 A;  3HMT A;  1NK1 A;  1GP9 A;  4IUA A;  4Z09 A;  4APM A;  2YIO A;  2LL4 M;  2QJ2 A;  2Q8B A;  4Z0F A;  2YIP A;  3ZWZ A;  2J8L A;  2YIL A;  3HMR A;  5CS3 A;  3SRJ A;  1HKY A;  2J8J A;  2Q8A A;  4R1B A;  5COE A;  5CP9 A;  2Z8W A;  5EOD A;  4Z0E A;  5EOK A;  1W8K A;  4R1A A;  5CS1 A;  2X2Z A;  2QJ4 A;  5CT3 A;  4UAO A;  1GMN A;  4R1C A;  4APL A;  4Z0D A;  2Z8V A;  5CT2 A;  4UV6 A;  5CSQ A;  4DUR A;  1BHT A;  2HGF A;  3HMS A;  3ZLE A;  3SRI A;  2K13 X;  1Z40 A;  2F83 A;  3SP8 A;  5CS5 A;  1I8N A;  1YXE A;  4A5T S;  1GMO A; 
#chains in the Genus database with same CATH topology
 2LL3 A;  5I25 A;  1W81 A;  2Y8R A;  3HN4 A;  3MKP A;  5CT1 A;  4R19 A;  5CS9 A;  3HMT A;  1NK1 A;  1GP9 A;  4IUA A;  4YIV A;  4Z09 A;  2YIO A;  4APM A;  2LL4 M;  2QJ2 A;  2Q8B A;  4Z0F A;  2YIP A;  3ZWZ A;  2J8L A;  2YIL A;  3HMR A;  5CS3 A;  3SRJ A;  1HKY A;  2J8J A;  2Q8A A;  4R1B A;  5COE A;  5CP9 A;  2Z8W A;  5EOD A;  4YIZ A;  4Z0E A;  5EOK A;  2KL5 A;  1W8K A;  4R1A A;  5CS1 A;  2X2Z A;  2QJ4 A;  5CT3 A;  4UAO A;  1GMN A;  4R1C A;  4APL A;  4Z0D A;  2Z8V A;  5CT2 A;  4UV6 A;  5CSQ A;  4DUR A;  1BHT A;  2HGF A;  3HMS A;  3ZLE A;  3SRI A;  2K13 X;  1Z40 A;  2F83 A;  3SP8 A;  5CS5 A;  1I8N A;  1YXE A;  4A5T S;  1GMO A; 
#chains in the Genus database with same CATH homology
 2LL3 A;  5I25 A;  1W81 A;  2Y8R A;  3HN4 A;  3MKP A;  5CT1 A;  4R19 A;  5CS9 A;  3HMT A;  1NK1 A;  1GP9 A;  4IUA A;  4YIV A;  4Z09 A;  2YIO A;  4APM A;  2LL4 M;  2QJ2 A;  2Q8B A;  4Z0F A;  2YIP A;  3ZWZ A;  2J8L A;  2YIL A;  3HMR A;  5CS3 A;  3SRJ A;  1HKY A;  2J8J A;  2Q8A A;  4R1B A;  5COE A;  5CP9 A;  2Z8W A;  5EOD A;  4YIZ A;  4Z0E A;  5EOK A;  2KL5 A;  1W8K A;  4R1A A;  5CS1 A;  2X2Z A;  2QJ4 A;  5CT3 A;  4UAO A;  1GMN A;  4R1C A;  4APL A;  4Z0D A;  2Z8V A;  5CT2 A;  4UV6 A;  5CSQ A;  4DUR A;  1BHT A;  2HGF A;  3HMS A;  3ZLE A;  3SRI A;  2K13 X;  1Z40 A;  2F83 A;  3SP8 A;  5CS5 A;  1I8N A;  1YXE A;  4A5T S;  1GMO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...