2Z92B

Crystal structure of the fab fragment of anti-ciguatoxin antibody 10c9 in complex with ctx3c_abcde
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
210
structure length
210
Chain Sequence
ELVMTQTPAIMSASPGEKVTMTCSASSSVSSVHWYQQKSGTSPKRWIYDTSKLPSGVPGRFSGSGSGTSYSLTISSMEAEDAATYYCQQWSSNPPTFGAGTKLEVKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Anti-ciguatoxin antibody 10C9 Fab heavy chain
publication title How Protein Recognizes Ladder-like Polycyclic Ethers: INTERACTIONS BETWEEN CIGUATOXIN (CTX3C) FRAGMENTS AND ITS SPECIFIC ANTIBODY 10C9
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 53
structure length 210
sequence length 210
ec nomenclature
pdb deposition date 2007-09-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2z92B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2z92B01
1NMAL 4Y4HC 3KYMB 1UA6L 2F54B 5GGQL 3U7YL 4LSQL 1E4KA 4L8BA 35C8H 5H8DA 3RJDA 3ZT5A 2DQTL 2F53E 1IM3A 3U2SA 1NSNH 4GXUM 3ARBA 2OSLA 2A77L 4Y19A 1ZA3A 4APQA 3L5XH 4G6KH 4CN1A 5FM5M 3V0WL 3LOWA 4NWTH 4Z7OF 5DEFA 4HJ0C 4HZLA 3NZ8B 1J1XH 5MENE 4M1DL 2HTKC 1KC5L 5KAQG 3MNZB 3HI5H 4KRNA 1NC4B 4OF6A 4PTTB 4X83A 2FH8A 5DJXB 5J0BA 2F9BT 4LU5L 2WV3A 5TPWL 3IU4H 4DKEL 4U6VH 5HVGB 4Q0XH 1GYAA 2PYEB 4P3CH 1NJ9B 1JN6B 5DJYA 2QSVA 2CRIA 3K80A 4HIXL 3U0PA 1AGFB 2C1PA 2AJSL 5ISZA 1Q1JL 2H2PC 4R0LA 3NIFF 3A6CH 2ADJB 2NY7H 1VSCA 4OGAD 1R3JB 4D9QD 4RGNB 4Y1AD 1YJDC 4LHJB 3I50H 4P4KD 2EE9A 4MS8D 1C5BL 4Q9RH 3KPMB 1DBBH 1KN2H 5JW4M 4WO4C 2FECI 4PRIE 4A2MA 3CVHH 2IFFL 5E08L 3S88L 2K1MA 5D5MB 4MNQD 4P59L 4U6XB 2QQLH 3TBYA 15C8L 3FN3A 4MA1B 2FATL 4NGHL 5I1CL 2A0LD 3V5KB 1NC4A 5DMJB 5EC2B 2YD7A 3WXWL 1IAOA 1FGVL 2ITDB 1A2YB 3P4NA 3KLAB 2CPCA 4NKIL 3I02A 1X5JA 1UJ3B 1IM9B 4JKKA 5E9DE 3CUPB 3S34L 3DUSB 3KPPB 3D9AH 3IRPX 5EC1B 2IMNA 3RDTC 5F7KC 4P23B 3GMNB 1W0WA 3E2HC 5ITFB 1MWAB 5B38B 2H26B 1DLFL 3TT1L 1NUFA 1BFVL 5HYQA 1A6VH 1QR1B 1BAFL 1RZGB 3QDAA 5MERA 1N7ML 1WWAX 4GKNA 1NAMH 5CINL 4JZNB 1XGYL 2B5IB 2VZVA 2B39A 2NYYC 3B8YA 1PQZB 2BVQB 2QLVB 4OD1H 3M8OL 3ZKSD 3O4OC 3GDBA 5HYFA 3SGKC 5IFAH 3V5KA 2HFEB 1Q72L 4HV8B 1FHGA 4XBGA 1N0XH 4U6HB 4EUPG 2BNUA 1MFEH 4L1DA 5D5MF 3FONA 5J12B 3GSQA 1D5XB 2VLKD 1UJ3A 2D31A 4UQ2B 1URLA 1IM9A 2NX5B 4ODTL 1I1FB 4CMMB 4YX2H 1XF3B 4PJ9D 3Q1SH 1C5DB 4QT5B 4PJXB 4R97C 2AV1B 5FUOL 4TUOB 3GMNA 3Q6FB 3V5HB 3GBNH 5KSAB 2VZ1A 2ZWLT 4OKVA 4HC1A 1MWAA 3MXWH 5B38A 1IFHL 4QF1B 3P4OA 2BHUA 5D7KE 1RZGA 2A2QT 4UIKL 3L9RA 1A4KA 4DFHA 1U8KA 3EFFA 2R0WH 5BZDB 1JNLL 4G5ZH 2CIKA 1PQZA 2BVQA 1E4WL 2KZ1B 1TQBC 1LK3H 4KROB 5I1HH 3WLWC 4KJWC 1JK8B 4DGIL 4WCYH 4Y5YC 4HV8A 5F7LB 1CWVA 3BZDA 4KKLC 1G7QB 3SDAA 4HGWB 4WEBH 2OX5A 1EEZB 4JE4B 5T1MA 4UQ2A 1CI5A 4P46D 1K4CB 4NBYB 1I1FA 2W9DL 2DQCL 1KF9B 1KIRB 3DXAE 1JMXA 4MLSA 1BQLH 4TTDD 2XZAH 4L4VD 4TUOA 5IJKA 4OIIH 5CJOL 3V5HA 1WITA 5KSAA 1CGSL 2VSDA 5A2KH 1TJIH 1QPXA 3FFCE 4CDHA 4XP1H 4NQEA 4XNZB 4QF1A 5EBWB 3KPNA 4NQCD 4L3CB 2YSSB 2BNRB 4JHZA 2R69H 3O9WA 4PJXF 1GZPA 4HCRL 1PZ5B 3GHEL 4PFEA 1FYTE 3VWJA 1IC4L 1I3GH 1NGPH 4WFFD 4OKDA 1Z9MA 4YBLB 1JHLL 3KPRB 7FABL 2H6PA 1ZT4B 4K2UH 3LV3B 1FV1A 4LSPH 1G7QA 3FN0L 4IOFC 3QQ3A 3ZTJH 3TYGH 2FX9H 2JELL 1AC6A 1DVFB 4YGAB 1K4CA 2JTDA 4LEXH 1ZANL 3BDBA 4G7VL 4PBVC 2HKHL 3OG6B 1QFOA 1KIRA 4Y4FC 1QOKA 2BRRH 3ZYJA 5DYOA 1A7RL 2LTQC 2DQDL 3W5NA 1HHHB 2ZUYA 1KCVH 2LVEA 2VZOA 4TYUA 2I60L 3WE6B 3PABA 4XVTH 4AEFA 5EBWA 3RAJL 2BXYA 5A2FA 2F15A 4AEHH 5CEYA 4FZ8L 4W81A 3MLRH 4G6JH 4HIEA 4M1GH 5C0BE 1F90L 2AK1H 2V9QA 3MJ9L 3RVVD 5E2VL 3IDGA 1RMFH 4R7DA 3SQBA 1ZT4A 4MNHA 4F7CB 5TGBA 3JWOC 4NRXB 1UM5L 1HEZB 3ABZA 3CDCA 4CVXB 4LVHB 5EOTB 2YZ8A 4MHHG 1INDH 3EDFA 4HFWB 4LAJH 5D1ZC 4W68A 3ULVE 1DVFA 2PTTA 1NLDH 2IG2H 3RPIA 1MJUL 2A6KB 3OV6A 4YXHH 2NY5C 5I1AB 5L2KE 1YUHA 2XPGB 2C9AA 3PWPD 1S9XA 4PREB 5TFSH 1ACYL 5ETUB 3WDIA 1YEGL 4M1CD 1NFIB 2W9EL 3UTZB 3L1OH 3D85D 3IS1X 1SYVB 32C2B 3PGFL 2J6EA 3DGGA 4UINH 3BZ4A 3MODL 2JB5H 4PJFE 4YLQT 4RZCA 1ZWIA 1FSKB 4KZEH 3SOBL 5F1NB 3GIVB 1RUPL 2XY2A 3WSQL 1S7XB 2DMBA 3D25B 5IKCA 4D8PA 3P77A 1NGXA 1OQOA 4KAQH 4MAUH 1KT2A 4HKXA 1AH1A 3CDFA 1KOAA 3VXTB 2DB8A 2IAMC 5EU6B 2BJML 2A6KA 4PJ8D 1WAAE 5I1AA 4RX4D 1AGBA 1BP3B 5ILTH 1XGUB 1NCCL 1EIBA 3QISA 1YPZE 1KB5B 1YEEL 3OZ9H 1J7VR 2IFGA 5C70A 5ETUA 4Y2DA 2AJVH 4D3CL 3R0MA 3IDIB 4UT9H 4Q58C 1FIGL 1I7UB 4ODXB 3OKNB 3DJ9A 5DVOA 4MNGA 3S5LA 5A2LH 3UTZA 4CGTA 3EIFA 3U82B 4PR5B 2CDFB 4LAQH 1UFUA 3TN0B 3GMQB 4FG6D 2OK0H 3RZWA 4MAYC 2F54D 4NN6C 2GJ6A 1A6TB 4H20L 2ARWA 2D4DA 1B88A 1I3RA 3WL9B 1E4XH 4JVPA 2EICA 2X9WA 5C7XH 1BIHA 4MQ7A 1NL0L 1FH5H 4DN3L 2HAZA 2ZCKH 3C5JB 4LVEA 2ITCA 3JZ7A 4OI7A 5C9JA 4HEPG 1RHHA 5DGRA 1G6RL 1I8LA 5C3LD 1KB5A 1HHJA 3VFSB 1ZHKB 3OKOB 3VFWB 5JNYA 5K59E 3LRSB 4Z77B 3T0BA 2XWTA 3IDIA 4OFDA 1I7UA 1T0PB 2MQ0A 4ODXA 3QG7H 3REWB 1TZHA 1EERB 1MH5B 4OFVA 1MHEA 2DAVA 3M17B 4PR5A 2PNDA 4LKCB 5IG7A 1PG7H 1IAIM 5A16B 2J4WL 3TN0A 2PYED 2YKLH 4XPHL 3VGBA 5CSZB 1FN4A 1KB9J 2VB5A 1OP5K 3ROOA 3WS6A 3UTSA 5CCKL 5FKAB 5AZEL 2VC2L 3QUXC 1A6TA 4OCWH 4R4FH 4JZJC 4RGND 4P2QA 3WL9A 1G7MA 2DRUA 3E1F1 12E8L 4J4PC 1S7RA 3B9KC 4PJAA 3AB0C 1MRFL 1IAII 5J4MA 3KXFB 1WWCA 1UCTA 4KPHH 3W9EB 4GMTH 4QHKJ 1RU9H 4HW6A 3N1PC 2A9MH 5DEZA 2F19L 4FFYH 3EAKA 5FIEA 2VKWA 1T7XA 2Y23A 3VFSA 1BQHB 4BQ9A 2JJWA 4G3YH 2FYYA 3RGVD 1QEWA 4PRDB 4PJAF 4IIQA 4MJIE 1TPXC 4PRPA 3KYOB 4LF3A 1F4YL 1BVZA 3NZHH 5HYJB 3M17A 4X98B 1WBYB 3HLAB 4QXWA 4O9HH 2YK1H 5CSZA 3EHBC 2C3VA 3WKML 2YPKB 4LCWA 2BVYA 4OCXL 4KH2A 3MLUL 3V4VL 2E7LA 4ZXBC 3P40A 3U7WH 3O2DH 3NCBB 5JHDB 4TOYL 3EOAA 2FRGP 1JV5B 5C3TA 2CR6A 4P23D 2FB4H 1DZBA 4JHAH 4A6YH 3D0VB 3EO1A 1JZ5A 5B4MC 2VR5A 3W9EA 4PJCE 3MROB 1AR1D 4JO4L 2J2ZA 2X4SB 4XCFL 2CLZB 3FQTB 1JPFA 1JWUB 5E5RB 1H8NA 1OLLA 3WD5H 3Q6GH 3OR7B 1MEXH 3PWJA 5F89A 2HJLA 1WBYA 5ESVB 5EIVA 4HK3J 3I9GL 1U8IB 5SX5K 5HVHB 2CRMA 3D3VE 3ES6B 4EI5B 1FL3A 4JKPH 3TZVB 3GNMH 5DJ8A 3WJJC 3TP4A 4JFFB 3ARGD 3VWKB 4Y16B 3QIBA 3PWLA 5DR5H 4KJPC 4OLVH 2BNQE 1ZGLP 5E4IA 1G0DA 4OZHB 3MLSH 1Q94A 5EDXA 3MBEB 2VLJB 4J3WA 2LQRA 4LCCB 3MROA 2X4SA 2FJHB 5K9OB 4HKBA 3UJJH 2R2HB 5E6IC 5FKPB 3UTQB 4G7YL 5CZXC 1CF8L 2O26U 4JRWA 2P5EE 1OAXL 5J8OA 3H9YA 4R96B 5T5FH 4EUPA 4KJYB 3BKML 2NW3B 1EEQA 1U8IA 4MDIB 4ZD3L 1P4IH 4NKOA 4B7LA 1NAKH 3BHBB 1DBAH 2BERA 4ZFFB 4UDUA 4YDVB 3TZVA 1PY9A 5BRZE 4Q6YA 4EDWH 4JFFA 5IVOA 2AXJA 5DD0L 4LLUA 1TLKA 1DBJL 1LE5A 5K9KB 3GJFK 3CU1A 4N8VG 1FZOA 3TNMB 4YK4B 5HJ3B 1KXQE 3MBEA 3SHSA 4QRRB 3LKPB 4ONHB 4JFQB 2BNRD 4LCIL 4G42B 5HD8D 3VXRE 5C0AB 2FR4B 4KKAC 4LVOC 5ELIA 1NEZG 1NGQL 2WWKO 2NXZD 2AXFA 3MRMB 2EDJA 1HOCA 1YNKL 4WTZG 1OAZH 2BCKB 4OZHF 5FKPA 3QRFM 4ETQB 5HGAB 3KPRD 1I7TA 4RMTA 2CMRH 4G6FB 4Y4KC 3TJHD 2J8UA 2UYLB 4Y7MA 4JN1L 4KJYA 2FLBT 4X7SL 3VU2A 1NFKA 4NN7C 1CS6A 1UJTA 2P24B 3IFOB 4MDIA 1CLZL 4ODSH 3VD3A 3NPZB 5IWLC 2FLRT 1J8KA 1RUML 5HHOE 1IC7L 3TM6A 3S3JA 1ZVSB 4X6DB 4N0YH 3N85L 3TO4D 1L7TL 3WLBB 4XI5D 5IROA 3UPCA 3C60A 4XXDB 4PRBB 3INUL 4QRRA 4PP1D 3RY6C 2HJFB 3PHOB 4OQTL 5D7LB 3DOSA 4H25B 3TPUA 1RSFA 5IFHH 4O02H 4GRLB 2W91A 3MRMA 4YE4L 6CGTA 1L7IL 2XTJC 2BCKA 4MQTB 1IQWL 3GO1L 3WFEH 1AY1L 4XBPB 5FV2A 3FOLB 1FLRH 1KACB 4HMDA 1S5IH 2WANA 2Q8AL 3QDGD 1KCUH 3KPLB 3VRJA 3L3JA 1IC5L 5I66A 5F7DA 5L2JB 4JJ5B 4WWKC 2MJWA 3BZEA 1I9RL 2R9HD 4ZYKA 4RFNC 4BA8A 3FQXB 3GI9H 1B9ZA 3GRWH 4X6DA 4Z7NE 4FFVC 5ENWB 3JV4A 2H32A 3BPNC 4LGSB 4ZO9A 4IRZL 2FX8H 2VL5B 2PO6A 1YNLH 1YNTA 3RNKB 4ZSOA 1B2WL 2BC4B 1QFUH 1OAUH 4P9HH 4X6DF 4BH7B 4LVNB 2VQ1A 3RTQA 2HWZH 2ZUUA 1PGRB 4X6FB 2A9NL 4O4YH 1FFNB 3IXTA 3STBA 3LVEA 2XOTA 4XRCA 3HAEG 5DHVH 5EUKA 1NGWA 1KEMH 4XB7A 1DTUA 2Z31D 4MJ6B 5TE4H 2Z9TA 1MPAL 4TVPD 4X5XB 2I9TB 2OR7A 4YFEA 5L2JA 4JJ5A 5EU6D 1BBJB 4PP2B 4M62L 1BJ1J 1HYRC 3FQXA 3WXVL 5FECA 4YXLH 5DJ6B 5ENWA 3QFDA 1BWMA 4ZAKA 2VR4A 5D93C 5DUPH 2QBWA 5FYKH 4Y89A 4POZD 3LSOB 5L0QC 2VLRD 3RNKA 3EYSH 1EBPA 4F57H 2FEEL 3V79C 5I73C 5GZOC 1RFDH 1D6EB 4I77H 5BV7B 4BH8A 4NP4L 2X44D 3KJ6L 1MJ7L 2QQKH 4KV5F 1VFMA 4DK6A 4LLDB 5AD0A 2EH8L 4KVNH 5C0RL 3K8KA 4NRZA 4LHUD 4TQEL 4N1CA 3GMPB 2VQUA 2PCPB 4ESKA 5EBMA 3LPWA 4XVJL 3WIHL 1TETL 3T65A 3VI3F 3O4LB 2I9TA 3V0VB 1CU4H 1QFWI 1XGQA 2BHYA 4WFED 4HAGA 1BBJA 5F96H 4WUUA 1A64A 4QTHA 4ZUTB 5F9OL 5I1EL 5EH1A 4WUKH 4AQOA 3BZFA 1YEKL 2HLFC 3MXVH 4YHLH 1LO5A 2AJZB 1GL4B 4UNTA 4DKAA 4E41E 4XNQB 3KR3L 4IRSC 1SJXA 3QDJA 1E0OB 3VI4E 1D6EA 4P5TB 1CFVL 4PGDA 5DSCA 5H37H 4BQ8A 5E8EB 3UTTE 3DTXB 3N1MC 1PZUB 2EDWA 4N5ED 1NUDA 3ARVA 2VQTA 3FO0L 3S37H 1J18A 5C71A 4TUKH 3GMPA 5E5UB 4FQLH 3NIDE 4PB9L 1IGJB 2A6IA 5FCUH 4BK5A 3IFLL 2AJYH 5GGVH 5LCVH 2EDOA 4FQPA 4OZIA 4LBEA 4KK9D 2E8ZA 4RDQG 3ARFC 4U0RB 3O4LA 1AO7B 1MCLA 3RWGA 2GFBB 3QHTC 3OX8B 4OCNC 1P1ZB 2XNAA 5EFIB 4D0CB 3G9VA 4ZUTA 5DUMH 1QVOB 3QCUH 1AGCA 4X99A 3A6OA 3HC3H 2XYCA 4XAWH 5I8EB 4NM8H 4Y5VA 1U8NA 3GMRB 4JFZL 2DF3A 5KOMC 3UMTA 1KG0A 3G5ZB 3D39E 3O6FC 4NM4H 1DBMH 5HYJD 3T2NL 4P5TA 5C0FA 3C8KA 1YEFL 4JPVL 1IKFH 2OBGA 3DTXA 4RGOL 2FEDC 4FQHA 2VITA 2DMCA 3RVXC 4XMKL 2B7DT 1JVKA 3BP5A 4NO0B 5JHDD 1HQ4A 4NZJA 4OBSA 5EO0A 1P6FA 3D6GA 1AJ7L 1VGKA 2EC8A 2HFGH 4XNYL 1ED3B 2P5WA 3OX8A 4XPGH 1ADQL 1EGJH 5IIEB 3MJ7B 3QFJD 4XHJD 1C1EL 3MSPA 1I9JL 3LS4H 3DUUB 5SWZB 5MEPB 3GMRA 1BVKA 4U1NB 4ELKA 1U3JA 5EG6C 3G5ZA 5I1DB 3QH3B 4JFPB 3CMOL 5KTEL 1CFQA 4EOWH 5EO1B 5GRZA 2F53B 3TBVA 2VZ3A 3K4DA 4EI5D 5FYLD 2XI9A 3ET9F 1P7QB 1Z0NA 2VDPH 3QJFB 3VWKD 4Y16D 5FM5O 5HI3C 5CJQH 5J9PA 2V5SA 5FHBH 1OB1A 2OYPA 1OM3H 3UJIH 1UKSA 5EOCJ 4NKDB 2V2TA 4GRMB 2VLJD 2V7HA 3MLYH 5MENB 3F8UB 2CJUL 3P30L 1QSZA 5IIEA 4X6BB 3KLSA 3H9SA 3MJ7A 5JXED 1DL7H 4PJHA 5HGHB 4U3XA 3DUUA 5AG8A 1BD2E 3RHWF 4I48A 5MEPA 2PXYA 2I25N 3QH3A 1R3IL 2YMXL 1MWAH 1KXTB 4JFPA 2P8LA 1YY8B 3EW3B 3EZJB 1YMME 2JE8A 1UQSA 1MNUL 3MLWH 4PJHF 1OGTB 2AW2A 2F53A 2IWGA 3HZYB 5I8CB 2R1XB 5F9WB 2KQNA 4HK0A 4P2RE 5KN5B 2Q76B 5GISH 2W60B 5I6XB 3PWUB 4MD5A 1M7IB 1C7TA 3JUZA 3FCTA 4GRMA 3SGJC 5I8OH 4K8RD 1ZOXA 4OD3H 5C0AD 2YEZA 3DMMB 1B0RB 1OGAA 1WCQA 4LSSL 3CSYB 3LB6D 4F9LC 2BK8A 3ZO0A 1HIMH 3SKJL 1FE8H 2NZ9C 3WFDH 4G6FD 4FP8L 5E9DB 5HI5D 4HDIB 1G9EA 2EIEA 1J5OL 2YUXA 1TIUA 4S1QL 4XNUH 4EBQL 4LLAA 1R5IB 3HI6L 4U1SB 5C2BH 1OGTA 4XVSL 1I1AC 1ZLVH 5DQ9B 5JIKA 2NLJB 5I8CA 4QEGA 4QRUB 1OF2B 2ZCHH 3S36L 3UXFA 4Q9QL 3T77B 3ZKXB 4GQ9H 3PL6C 4RWYL 2OJEB 3P73A 3FB7B 3LZFH 3G9AB 4N8VA 3L3OA 4JRXE 5E0QA 5ACZA 4J3SA 4J6RH 3BUYB 3KVQA 3MJ9A 3PHSA 3T4YA 1T4KB 4TSCH 5D7LD 2R23B 3K3QA 1CE1H 2EDEA 2HKFL 4GRLD 1F58H 4QHKI 3CSYA 4B50A 3UZQA 4NDMA 3C6LC 3DBXB 1LP9E 2YRPA 1N2RB 3NFSH 4WTZA 3UPAA 3GJFB 1MFDH 4JG0H 3EOBB 3UAJD 2IPUG 5CFHA 2GSIB 4UV7L 2OP4H 1KFAL 1RUAH 3PQYB 3L6FB 1YQVL 5DVNA 5JW4Q 3VJ6A 3G6DH 4GKSB 4HDIA 1A6AB 4S1SH 3H42H 4KI5E 2Z35B 1D5IH 1LO2L 4OCYH 1G7HB 1AE6L 1R5IA 4U1SA 5I1IL 1HXYB 3HNTH 2P1YA 4M4PA 3VG0L 1JF5A 5DQ9A 3B9AA 4QRUA 1WIPA 1RZKH 3F7YA 3OL2A 1F8TL 4NHUA 5HYIA 3OGOE 1QYGH 5CD3A 1MCDA 3HFMH 5FYJL 3T77A 2WMPA 1JPTH 4I0PC 5D8JL 3FB8B 3VMNA 3JV5A 1MVUB 2UWEE 1X6LA 1T1XB 2FO4A 3MRDA 4LP4A 3I6GA 4R4BB 4OGYL 2R2EB 4LFHG 3S36X 3SKOB 5I30H 3MGOA 2BY1A 3LY6A 2R23A 3ZDXE 4LGRB 1RVFH 3FKUS 4XPTH 5ITBH 4DN4H 1N2RA 3GJFA 3EOBA 2GSIA 2AVGA 1IQDB 3PQYA 3X11A 3MRCA 2AV7A 4I3GA 1CIUA 4ODUB 2WINB 5SV3A 4XMPL 5IM7B 2VXVH 3T0ED 2ZZUT 2Z35A 3DXAB 3CFDA 2VDMH 5D7JC 3P4MA 1YN6A 1LE9A 1G7HA 2J6EH 4P9HC 5ECJE 1GH7A 4YJZL 4JHWL 2ZP0T 4XPFH 3FFCB 3IAQA 5T3XD 4Z9KB 3ULSB 3U48A 5CEZL 5H94A 2JIXB 8FABA 4FXGB 2VLLA 3FB8A 1SBSH 3L5JA 5JR1L 4Z7WA 1BZ7B 1JHTB 4KKCD 3OAUL 1FYTB 3QEQE 2P7TB 1T1XA 3VXSE 4R4BA 3SKOA 1R3HB 3G5VA 1DUYA 4RFOH 1UWXK 2GTZB 3CDGB 1F45A 3DX7B 3VFMB 3C08L 1D7FA 3BMVA 3O0RH 1HCFX 1M7XA 3QPQD 4HPOL 3HAEA 5F8QC 5I2IA 2E7MA 4ODUA 3DROA 2ZJSL 1X5GA 5L7XH 5C0EB 4F8QA 1V5JA 4KGJA 3RKPA 1AR2A 4X7FC 3B5TA 4YFLI 1FP5A 2M1KA 3VXUE 4C55A 5FOJA 5EBGA 4GFTB 1BGXL 5HI4D 4HQQH 3RA7L 5FUZH 1T7VA 3ZMRA 1D5MB 1P7KA 3DX6B 4FXGA 5F6IC 5C0BB 4OCRL 5DUBA 4M1CC 4FTVA 1BEYL 4X4XA 4PGBA 4NIKB 1I85A 1R3HA 5DVKA 1A6ZB 2GTZA 4NBXB 3VXNA 3UC0H 5DFVD 3DX7A 2ADFH 5KSVA 1ITCA 3ARDC 2MFNA 1JZ7A 4JFEA 1KB5H 1M4KA 1E4KC 3MRHB 4QHNB 4NUGH 5FOBB 35C8L 1RI8A 3G5XB 4IM8A 1FNGB 4ERSH 2X4OA 3ARBC 4KMTH 1N6QH 1AO7D 4N0CC 1TMCB 1NSNL 1J1OH 3VFPB 1DN0B 4M8QB 2EYSB 1ZA6A 3L5XL 1U8PA 5B3NA 2QKIA 3MRKA 4G6KL 5I76A 4XVUC 3B2VL 4YAQB 4H1LG 4NWTL 2A38A 3HR5A 2E6JA 3OB0H 1Q8MA 2QV2A 5IQ9A 1AGEA 5C0BA 4PJFB 3KJ4B 4PJ7E 4AYFA 5I75B 5CILL 3NFNB 1M71B 4PGCA 3HI5L 3HTLX 3TVMB 5LG1A 3BQUB 2ARJB 5DJCB 3U6RB 3IU4L 4GBXA 4U6VL 1A1NA 3QG6B 4Q0XL 3QB7C 4P3CL 1UENA 3WS3A 1U42A 4ONOA 2M26A 4NO0D 3MOBH 4BUHA 1I7ZB 1MHPH 4QHNA 2FO1A 4UUJB 2Q3ZA 3IDJA 3NAAH 1YPZB 2LVCA 3LKNA 4JFHD 5JZ7D 5E56A 4RAUB 1FNGA 1QSFE 5CHNA 5FM4A 2DBLH 3STZB 4K07A 1DBBL 1KN2L 3ULVF 5C08E 1DN0A 3RWIB 2EYSA 3CVHL 3X17A 2NY2B 4C56D 4XC1H 3BIBX 3VW3H 3TCLA 5KG9B 5SWSB 5HHME 1GOGA 3LN4A 5HDQH 3TIEB 1HYSD 3FJTA 4UT7H 1QSEB 4WFHD 3BKJH 2XXMB 1LEGA 4DTGL 2VH5H 3K4AA 1VB9A 3MBXL 3TVMA 1CFBA 2UZYB 5DJCA 2MKWA 1S7VB 2Q6WB 5HHXL 3QG6A 4X9HA 3MV9A 3PP4H 4PJFF 3L3DB 4MXWL 4JFYA 1P7QD 3VGDA 2C5DC 2Y9RT 3D9AL 2KUTA 3E6HA 3G6AB 5TDPB 1BBDH 3FB6B 3VDBA 3MPCA 1I7ZA 1WISA 3L3KA 5I18L 4F37K 4UUJA 5EN2A 2OMNA 1QSVA 4XNXH 4RAUA 5EUOA 1GSMA 5HDOA 3STZA 4GS7B 4HWBA 5MEND 1HH6A 2VZTA 3RWIA 1A6VL 5CIPA 4BFIB 1NAML 4EVNB 5T1LA 1T2JA 1T5WB 5DVLA 2BSTA 3VE0A 4MA1C 3I6KA 1YPZF 5SWSA 3F7VB 4OGZA 3GSOA 5J57B 4OD1L 5EUOF 4ETYA 5DQDH 1C5CH 3V6FB 1QSEA 5HGBA 5IFAL 1SMOA 3T3ME 1MFBH 3ZHDA 2JF1A 1FZMB 4EQ3A 3H7BB 1MFEL 3TFKC 2XG4A 4FQ2H 4K9EL 1UJ3C 3O6MH 1LO3L 4YDLB 2DWEA 3G6AA 4PRID 2CUMA 2VDQH 1JL8A 1T2QH 3FQWA 3H3KA 3PE9A 3HC0B 3W2DH 3VA6A 3LKOA 4JAMB 4PLNC 3V6OC 3ZKQD 3HNSH 3GIZH 3MNWA 2GQHA 1HHGA 3GBNL 1CK0L 3QIWA 5F71A 4IJ3B 3BAEH 1I4FB 3X3GH 1F3DH 3MXWL 4HEME 4KXZI 4MJIB 1Q0XH 2JJTA 3DMMD 4FQIH 1AR1C 1NLBH 3P0VH 4X8XA 4K7FA 1T5WA 5IBTH 4XP9H 3GGWA 2ZPKH 3F7VA 4G5ZL 4X4MA 4OGXH 3MO1B 4PJIE 5E9DD 1K8DA 2BMKB 5K59F 3V6FA 3HC4H 3B5GA 5I1HL 4NQUA 2A6DB 4KGLA 4WCYL 4CRPA 3SDAC 1HSAB 1QUNA 1FZMA 4NOFA 3H7BA 5I71C 4WEBL 1VFBB 4PV8B 3DHMA 1U0QA 1QLRB 4KK6D 1EJOL 3ZT7A 5GJTL 1BQLL 4JAMA 4OTXH 5DZOA 1MIEH 2XZAL 5EIIB 5E94A 5IJKC 1EZVY 5C0GA 5KSAC 4OIIL 3IB4A 3MRQB 1TJIL 3IJYA 4FQJH 4JY6B 1I4FA 1Z3GH 3RWHA 4XP1L 1RK1B 4KC3B 1F97A 5D1QB 3EOTH 4X4YB 4LGPB 1F13A 1OW0A 3C5SB 3FO1B 2BDNH 5KVGH 3ARUA 3OXRB 4ZTOH 3D3VB 4KROC 3MO1A 1I3GL 1NGPL 1JWMB 2A6DA 4K2UL 1WFUA 4E0RB 4LSPL 3TBWB 2RCSH 3TYGL 2FX9L 1AIFB 2BNQB 1HE7A 3AREB 1RZJH 1FFPB 1QLRA 4QXTB 3GSRA 4TVSa 1BF8A 2GT9A 4PJDA 5D7KD 4HIJA 1T0NB 2XFXA 3PGCB 2BRRL 1INQB 2YUWA 1HWGB 1AFVL 1JPGB 4R8WH 2VNCA 1S9YA 2DMKA 2ED8A 5DRNA 3VXOB 25C8H 4BQCA 4XNZC 4JANB 3NIGF 3QZWG 5HD8C 3O8XD 1FNSH 4XVTL 2HVKB 5D1QA 1A1MB 2W65A 1T22A 3OMZA 3TBTB 4AEHL 3MLRL 3VMPA 1Z5LB 4P5MB 2AQ1A 4M1GL 2ADGA 2AK1L 3F62A 1RZKC 5F7WC 2IEPA 5D1XB 3OXRA 2XKNB 3G6JA 3FQNA 4PG2C 1G7JA 1FO0B 1RMFL 1SEBA 3MJGX 2G60H 3U4AA 3DXAD 3STLB 3W39B 1TITA 5D70L 3IJSB 1DVFC 2GKIA 3I85A 1WJ3A 2KKQA 4NJAL 3OSKA 3QO1B 1NLDL 1MELA 2IG2L 3FFCD 4X6EB 4QXTA 4YIQB 2DLHA 3VXRB 4QGYA 2OL3B 2JIXD 5CBEA 5F8RC 2P8PB 1RZFH 1FYTD 1KLFA 3VXOA 4DCQB 4Y1AE 4PP1C 4F9PA 3IKCB 1FRGH 3L1OL 3WYRA 3BKCH 4AIOA 1A1MA 4HJJH 4M6OH 3TBTA 1Z5LA 4P5MA 1CXEA 4WRLA 2JB5L 2PW2A 1KSRA 1J8HA 2XKNA 4R2GB 4MJ2A 1FO0A 2VIRA 4YPJA 5HHOB 2FWOB 4YQXL 3STLA 3M45A 3FAXA 3SDCA 3IJSA 1ZHLB 2EXWD 1AXSB 3LQZA 2DI7A 1AKJA 2YBRB 5DK0B 3QO1A 3RJQB 4X6EA 5DO2C 1QRKA 2W1NA 2FJFB 1CFNA 2VMFA 4J8RB 3AY4A 5ILTL 1BQUA 4UV4L 3OZ9L 3QIUD 1XGTB 2AJVL 3WHE0 1OP3K 4DCQA 2RFXA 3QUYB 5JORA 4HWEL 2D0HA 1HHKA 1MRDH 2GHWB 5LXGH 3BFOA 3RWCA 4LAQL 1KB9K 3K74B 3BP7A 3MRIB 1BFOB 4CW1B 4HUUA 2OK0L 3MRJB 1GAFL 1FSKC 5INDA 5CGYD 3ARSA 1OTSC 5AUMB 4MB5A 2X4NA 2K7PA 5L2KD 2DJ4A 5D71H 3LEVL 5IMKA 5K9QI 5GGSY 1AD9A 1E4XL 4JQVA 4BSWA 2R1YB 5AG9A 1AXSA 5IOPB 5BV7H 3MCG1 3VXQB 1XF4B 2OTWB 1R24B 4Q2ZB 3BXNB 2ZUWA 2ZCKL 1HI6A 3CFJB 4AMKH 4YGVB 4U1JA 4J8RA 4U1KB 5E2WH 1U9KA 1UXWB 4JJHA 4WO4A 3R1GL 2KQMA 4H5SB 4UIMA 3PXHA 2K3TA 4XP5H 1R3KA 1L0YA 1EZVX 2IANA 2Z8SA 4AEIL 3WFHA 1RJZB 3TN0C 1TZIB 3FHQA 1PG7L 1UYWH 1T89A 3BOVA 3MLVH 1I3VA 3H3PH 2HA1A 2YKLL 1BFOA 4NQED 2NTSP 4CW1A 3MRJA 4K3JH 1Q0YH 1UH3A 1VGEL 4XCNB 5DFWH 3F58H 4NO5B 5CJXC 5HHPB 1CFSB 3L5WA 1RQ5A 4OCWL 1ADQA 4RSVA 3HE7D 4WU7B 3QI9D 4UOW1 3PDOA 2PYFB 2ZKHH 3LDBB 2FZ3B 2EIDA 1KCKA 5IOPA 3QQ4B 2CDGB 4Q2ZA 4GMTL 3ROLA 5SX4H 2NY2D 3LMJH 1RU9L 4ZPVB 4Z7QE 4FFYL 4U1KA 1U36A 2DQEH 3RPKA 4IIQC 3BIAX 3W11D 1JZ4A 1P5UA 4JPWL 3U4BL 4L4VE 3NZHL 4O2EB 1MLCA 1M6OB 2UUDK 4KDWA 1GIGH 4ZOAA 3WCYA 5DD1H 1RJZA 3NACL 1TZIA 2N7BA 4QXGL 2MNUA 1WWBX 4AIXA 4O9HL 2YK1L 1S7TB 2WWMD 3AXLA 1MIMH 2ADIA 4N5EC 3TESA 5C09B 5T1DH 2E7LC 2R4RH 3SE9H 3U7WL 5HHPA 3O2DL 2ICEB 5IBLD 3KLHC 2ZCLH 1JI2A 4BQBA 2FB4L 4JM4L 4XWGH 4MDJA 2GTWA 1WWWX 4JHAL 5DF0A 5CD5C 3RP1A 3VH8G 1UWEL 3GSXA 3QAZB 4E41B 2CDGA 4FQQB 1HILA 3WN5B 1ZLWH 5C0IB 1KENH 4ZPVA 2GUOB 3MUJA 3ZE2E 3UTTB 2RQ8A 5B8CB 1MCOH 3Q6GL 4G8FA 1WC7A 1KYOJ 2ZSWA 1OTTD 1GC1L 5JXAL 4J3XA 2Z4QB 4LLVB 4O2EA 1M6OA 4EZMA 1K3ZA 4PUBH 4JPIA 1T7WA 1S9VB 1IT9H 2ATKB 4KI1A 1S7TA 2VXSH 5KS9E 43CAA 5L8LB 4Y5YA 2V5RA 4JKPL 3GNML 5C09A 3ILPA 2G5BA 2YRLA 5IB5B 2ICEA 3GM8A 4NO2B 5DR5L 3GBMH 4K3GA 1QNZH 3OKLB 4OLZL 2QEJA 3FO2B 2CLRB 1CCZA 3MLSL 4U1IA 1U3YA 4MJID 4JG1H 1HXMB 3WN5A 5C8JB 5IB4A 2D7TL 1SMAA 4BYHA 2R1WA 1WFNA 2O5ZL 2BRQA 2P8MB 4CN4A 4XHJC 4J3UA 1UEMA 2I07A 3IF1B 3UJJL 2GUOA 1ORSA 3ZTJG 2FH6A 4ZUVA 5B8CA 3PWPE 2BY0A 1PKOA 5HYEA 2Z4QA 4EEEA 2BOBA 1U6AH 3C6SA 5HGDA 4S11A 4BFGA 1NH6A 2WLYA 3H0TB 3VI4F 1S9VA 3KAAA 5KOVC 2DICA 1P4IL 1QRNB 1MFCH 3OAZK 1NAKL 3TZVC 1DBAL 3TV3L 1FDLH 1XCTB 3BGFB 4BQ6A 5DD5H 3ARXA 3IFPA 3MYJB 3E6FA 3VWKC 4MMXC 2R4SH 4Y16C 4JGMA 4EDWL 5BW7A 1DP0A 1D9KB 4PTUA 3A0OA 5IB5A 4UTAL 4NO2A 4DKFL 2DM2A 3RNQB 3NIDF 2Y7QB 5D9SB 5IB2A 2CLRA 3MBEC 1RY7B 1DQLH 4ZFZB 4Y4FA 1A6WL 4HD9A 4S1DD 1GGIL 4IHOB 2LAGB 3K8LA 2V7NB 3U0WH 3CK0H 2W92A 3ZE0F 2XN9B 4NC0B 5HY9B 3D3VD 1LEKB 1OAZL 4I2XA 2CMRL 1CG9B 5CZKA 1EEYB 2XQBH 1PKQE 4K23L 1N64H 3LPFA 2BNQD 4F37F 5C0DA 2X4RA 3ARED 1QRNA 4JO3H 4NWUH 5I1GH 5DMGD 1XCTA 1IGIL 4GG8B 1VKXB 4XT1C 3N1GC 3MYJA 2WW8A 4DAGH 3EZ8A 1T21B 5D1ZA 3SCMD 5IROC 3C60C 1XH3B 3GZKA 4ALAL 1FZJB 2P48B 1ZLUK 4YK4C 3FN9A 4I18B 3QQNA 1BD2B 3V7AG 4CUCA 3T2PA 3EO9L 5DJAB 4HH8A 3GSWB 2P5ED 2WP3O 4IHOA 1QKZH 1UXSA 2PW1A 2GAZA 2VXQH 1RZJC 3LB6C 4O02L 4UBDC 2V7NA 2XN9A 4PB0H 1YMMB 3SDXE 5HY9A 3QEHB 5D1XD 1UZ8B 4RNRB 1LEKA 3W5MA 2N4IA 5T33H 3LH2H 3WFEL 5HI5C 5BRZD 5T1KD 5TJWK 1CG9A 3AROA 4PV9A 1FLRL 1EEYA 4P2RB 1KCUL 4XC3H 2HTLC 4KHTL 1KTDB 4L8SA 4PRPD 5HHQA 1G1CA 4G43A 2AJ3A 4HX1B 1BFTA 5DI8A 4EN3D 3BGMB 4GG8A 4MD0B 1VKXA 5ABDE 3GJFH 5CBAA 3VXRD 5FYKU 1A8JH 1P4LA 5I9QC 5LGHH 2J12B 4RCAA 2R56H 3EKCA 2VXUH 1XH3A 4QRPD 1BD2A 2FX8L 5IK3A 3S7GA 2ZOLB 1YEHL 3QZWA 4LSUL 3GSWA 3O2VH 1QFUL 1L6XA 4GRLC 4IRJA 5F7EH 3RUGE 3EGSA 3RTQC 3PWVB 3QEHA 1W0YT 2HWZL 4EXKA 4PD4J 4JFDE 4R2GD 1D6VH 3BEWB 4O4YL 4G8GA 3OHXB 2NY4D 4KK8C 2VL4A 5HHOD 3H8NA 4NCC1 2D2OA 1KEML 3RKDD 1F5WA 3GK8H 5TE4L 4MAYA 5DC4B 3T4AA 4J1UB 3BN9D 1AP2B 2OM5A 4XZUA 4UT6H 4JVWA 3WHXB 4JRXB 3NVQA 3UBXB 4MD0A 2NXYD 2OR8A 2DQUL 3D48R 1FFQA 2ZUXA 2G2RA 5EU3B 4AJ0A 3MV8A 4G9FA 4YXLL 5DQJB 5IW6A 1H15A 5JA9A 1N3NB 4YR6A 4LSVH 4QOKE 5FF6B 5FGSA 3S9DB 3ZYZA 1K5NA 1LP9B 5DUPL 5FYKL 3MYZA 3QUYD 3HE6B 3EYSL 4F57L 3ARYA 3LKRA 4YDIL 3AAZB 4LIQL 4K3DH 4LVNC 2B2XL 4I77L 2BY3A 5KVEH 5E8DH 3QDHA 5DC9B 1U58B 1CXFA 3MV7E 1DQMH 5D72H 2YA2A 2LV4A 4LLQB 4B5EA 3OHXA 1X6NA 4OZFB 4P49A 4ZUSA 4AT6A 2FD6H 4WJ5A 2VYRE 3WIFA 4DZ8A 3H9HB 1FVDB 5I1JL 3IGAB 1AP2A 1H3UA 3RVUC 1CVSC 1CU4L 1OT1A 3ULUF 3QUXA 4JRXA 1S7SB 5IEHA 1V7NH 4JZJA 3SEPA 5F96L 1TNMA 5DMKB 4YHKH 1IGCH 5EU3A 1FG2B 3IDYB 1GHFH 3RFZC 3HMXH 3B9KA 5DQJA 3MXVL 4YUEH 5FF6A 3I3BA 4PRHD 5ICXA 3KDMB 2AGJH 5CJBA 3THML 1LD9A 3BO8A 5JOPE 4DUXA 5CEZE 1ZKAA 3MZTA 5BV7C 3MLTB 5EIQA 3QNYB 2OZ4H 3DETC 5D6CA 2WBJB 1J1PH 1LP9F 5DDHB 4HUMB 1JGVH 1FCCA 5B39B 4N1EA 5CAYB 4JY4B 3S37L 1KEGH 4NQTA 2Y4SA 3QUMB 4IOIA 2A1WH 4I3SL 4FQLL 1OCWH 4L8DB 4NJ9H 3GUTB 4I9WD 1YEJH 1W2KT 2CQVA 2AJYL 5CS7A 2MTPA 2X40A 5GGVL 5LCVL 3MRRA 4UQ3A 1FVDA 4NPYA 3BVNB 4TNVF 4HIIB 5E5MB 1EO5A 3KYNA 5DMKA 3VXSB 5CMAB 5DUML 3ULVH 1PW3A 3QCUL 3HC3L 2Q1EA 1DE4B 3JSSA 4NNXB 4PGEB 2F8OA 4NM8L 3RVWD 1ZT7B 2H2SD 5CP3A 1OSPH 4KY1H 1DBML 4MX7A 4NM4L 4RAVB 1NCWH 5F7FA 4P5TC 3VD5A 2HLAA 1OAQH 4U4BA 1IKFL 5DFVC 3MMEB 2WAHA 2WBJA 4GAJH 1T1YA 2NPLX 5B39A 4I8DA 1A3RL 3VXUB 4JY4A 1GRWA 2E27H 3QUMA 4P4RA 1NAMA 3IDMB 4U0RC 4A2LA 1CDCA 2HFGL 2L7JA 2AK4E 4L4TE 5GHWH 3VH8B 3WFBH 4DWHA 4E41D 4DVRL 5C0JA 1MQKH 1YQ2A 4TPRH 3VXMB 4WENB 2HH0H 1BIIB 5E5MA 4XPGL 5IW3A 2Z8WC 4LASH 4X80L 1A22B 2EDXA 2P43B 4NNXA 3UTTD 4PJ5E 1BOGA 1ZT7A 1T1ZA 4YHYB 5CEXB 3L3IA 5TF1H 5JPNB 5TF0A 4RAVA 2GK0A 1TZGH 5I16A 2XZCH 5E6IA 2VE6A 2YC1B 5IUSA 4EOWL 4LRNL 3N0PB 2AI0H 4KQ3H 2VDPL 4HMCA 4BSVA 4XMLH 3VXUA 3MRLB 5CJQL 2HYMA 2YWZA 3MUY1 5E2UH 5FHBL 3D2UA 4DZBA 1OM3L 4PJBE 4P57B 3IDMA 3QDGE 4H26B 5FM8A 3VH8A 1CQKA 2UY6A 3MLYL 4MA7L 4PJ7B 4BZ1H 5FB8B 4OI8A 2D3VA 3D39D 2H9GB 2HT2D 4JDZA 3VXMA 1FJ1A 1K4DB 4M7LH 5I0ZA 3TCXA 5IVXE 1WIOA 1HYSC 5FHAH 1IBGH 1A9EA 2PXYC 4Z7VA 5IR1B 4HC1L 1B6UA 1MWAL 1YN7B 3MOAH 1FAKT 5ALCH 1ZAGA 4KQ4H 4XCCH 4ACPA 3SQOH 3AS3A 3V52L 1C8PA 3MLWL 3HI1B 4HWZA 2D9CA 4LHQB 1R5VB 1QSFB 5I1KH 3NCJH 3PGDB 2Y6SC 1T5XB 1JMZA 1MSPA 2MKLC 5C08B 4K94H 5DGQA 3QJHB 4H8WH 4PRAA 5GISL 3MRLA 1HKLH 3HUJE 5CWSA 4JM2D 3NCCB 3I6LD 5BZWA 4HKZB 5I8OL 3UTPE 4OD3L 2DQGH 4PJ7A 1LEIB 1BX2B 3OG4B 2FJGB 4P48A 1G6RB 1G7IA 5IBUB 4F7PB 4PGJA 3QUKA 2JLLA 4WUUD 4OF7A 4M7ZB 3WFDL 1HNGA 3LKSB 5FCSH 2XWJB 4PJ7F 5IR1A 2CRYA 2AKRB 2YPLE 1YN7A 3MCKA 4LLYB 1JRHI 2GIYA 4XNUL 4MJ4A 1VFAB 2VLRE 3WFCH 4OLYL 2NY3B 1G9NH 3HI1A 5C2BL 1R5VA 3CU7A 5F9WC 1TTUA 2ZCHL 1U95A 5I6XC 3VFUB 3QHFH 1NFDE 2AJUH 5JTWA 2P44B 1E6JL 4GQ9L 5KSBA 1H5BA 5KVDH 3DWTA 3LZFL 3T1FA 2JJSA 1T03H 4JFOB 4QRTB 4KZDH 4J6RL 1X7QA 4OFPA 4XBEH 4CL7A 3DMMC 4U1LA 5ANMA 3NCYP 1SVCP 5EO9A 4Q6IB 4WTWA 3V6ZA 2G9HB 4YFLF 5DRWB 5IP4A 1YMMD 3HKFA 3QA3A 4YHNB 2LU7A 4FZEH 3NFSL 1MFDL 4JG0L 2NY6B 3RWJA 1INEH 1DQDL 3WIIL 1RUAL 2R0ZH 5JOFA 1K6QL 3K4ZA 4P2RD 4JDTH 1WBXB 4S1SL 3H42L 1C16B 1D5IL 2SEBB 4LLYA 5F3BA 1IEBA 5F9JB 3DV6A 4NNYB 1OWWA 3GI8H 5KSUB 2YOCA 4M3JA 5GGRB 1NBYB 3HNTL 3MX0A 4X6CA 5JIHA 1SEQH 1N59A 1T6WA 2Z93B 1ZT1B 3R06B 1OAKH 1RZKL 2DWDA 3OKKA 1QYGL 4W70A 5C0CA 3ZKXC 3HFML 3V6BR 1X5FA 4PG9B 3IETA 1JPTL 1MCQA 2PKDA 2WQRA 3FQRB 3C5ZD 4XB8A 1IARB 3MCLH 4KKBD 1JNNH 5DZLA 2BZDA 2DKUA 2FBJL 3PHQB 3AFLA 3P0YH 1U8LA 2EE3A 4KHXH 1BECA 5DD3H 2P5WD 2Y5EA 1IAIH 1EHLL 1OOAA 1FNLA 3S96B 3VMOA 2QSCH 3QNZA 1D5BB 1JGLH 2DJSA 3T3MF 3WKNA 1WBXA 2H1PL 2VXVL 3BDYH 4OM1H 4CMHB 2VDML 5DTFA 3LRHA 4DK3A 1IAKB 1I1YB 4WW1A 2J6EL 4NC1E 2OXGA 4PY8J 5CP7A 1GXEA 3L7EA 2V2XB 1NDMB 1OPGH 4XPFL 2Z93A 2X5PA 3QEGL 1B6DA 1CICB 5ACLA 2QR0A 4V1DA 2WK2A 5CKAA 4O2FB 1FO0H 5J3HC 4ZNEE 1KPUB 5H37G 3SPVB 1SBSL 1ZGLM 2DI8A 4K7PH 4NFCA 1CE6A 3W0WB 3HE6D 1ZMYA 3V8CA 3L3HA 5ESQB 4KI5D 4RFOL 3DNKA 5JW5A 4TSBH 4HBCL 4HS3A 3TLRA 4HT1H 4IRSA 3S96A 1XGPA 2OL3H 2DLFH 3O0RL 1XCQB 1D5BA 4DQOL 3H9SD 3O11B 1M05B 3HCVB 4OD2B 5L7XL 4OZGE 1LMKA 1WUNT 2CKBB 1IAKA 1KIPB 3I2CL 4LOUD 3QWRD 5GRUH 1FFRA 4F7EB 5GGTA 3ECBB 3ORJA 1YA5A 1YYML 2CLVA 1CL7I 4L29A 3O3DB 1CICA 4MXVE 1HQRB 5FYLE 1Z9SA 4HQQL 4POUB 4LQFH 2QJDA 3ARFA 2W0LA 4HXAH 2EZ0D 4HH9B 4HUVA 1JYVA 2XWBB 2X1PA 3U9PH 3W0WA 1I85C 3B9DA 4XWOC 4M93B 5IESH 4Z5RA 4P2OD 3UC0L 1EDQA 3VCLA 2ADFL 4N0FB 3O6FA 5GJSH 2MPAH 3RZCB 1KB5L 1XCQA 5IMOB 3VFOB 1M05A 1MHCB 2X4PA 5DK2B 4NUGL 1EAPB 2ESVE 4ELMB 3HCVA 1EAJA 2MQ3A 2EH7H 5CLTA 2CKBA 4ERSL 3X14B 4KMTL 2YN3A 2GCYA 5SWQB 3MC0A 3IYLW 1J1OL 3ECBA 2R15A 1JGEA 3QEQD 4HF5H 4L3EA 4Y1AB 3VXSD 3O3DA 4P4KB 1M7DB 1UEYA 4HH9A 3C9NA 3O41A 5E95B 4G9DA 4X9BA 1S8DB 1I7RB 2OTUB 1TVBB 4GBXC 1CGWA 3O2DA 2IQAB 5F7HA 1QBML 5A1AA 2NW2B 5FGCE 2MHAB 3KPSE 3HPJA 2PTUA 4HUXA 3EYOB 3ULVC 4N0FA 3ALWA 3KPQA 4GAFB 4MCZB 3SJVA 4A6YA 1B90A 4NQVB 4F7TB 2O93L 4C57C 2RJMA 4Q74A 1MHCA 4XP4H 1MHPL 1EAPA 2VTFA 1F4AA 2HT3C 1ZTXH 4ELMA 4MA3B 2M2DA 5TH2B 2DBLL 3CAFA 5C6TH 1HDMA 1A9BB 5I74B 3A67H 4P4KA 1IGYB 1HWHB 3CC5B 4ELMF 5B38G 3VW3L 1EMTH 5CGTA 3KJ4C 5EZLB 5HDQL 5I75C 4C54A 4X7EC 4NZRH 2R29H 5D2LA 3TVMC 4MNQA 3BQUC 1S8DA 2VH5L 1I7RA 1TVBA 3BPCB 2I9LB 1JUFA 2IH1A 4R26H 2NW2A 4KJQD 3PP4L 1S7QB 3G04B 4MCZA 5E00B 1TJGH 1T04B 4NQVA 1BBDL 1S5HB 4JRYE 5FGRA 1U2CA 2VLKB 4YHIA 1MCNA 2ICCA 2IGFH 4JQIH 5DEGA 5AAWA 4MA3A 3VDAA 4XNXL 4I3RL 5JDSB 4NUJB 5JO5B 5IT2H 2J7LA 4MQXD 1QA9B 1IGYA 1WT5A 3MFGB 2E9JA 3SGJA 5GZNC 1CD1B 3W11C 2BVPB 1LILA 1C5CL 1LK2A 1L0QA 4F9LA 4QCIB 4L8CB 4KUCF 2GJZA 1SHMA 4RQQA 2I9LA 5EOQH 3MJ6A 4JR9H 1KJ2B 4ZOEA 4X7TA 4AH2A 4FABL 2GITB 1EO8H 2G75A 1QSFD 4UI2A 2XA8H 1S7QA 5E99H 1XMWA 1S7WB 3FRPG 3G04A 1T04A 4FFZH 4UAOB 4TSAL 3SDDD 1YEDB 5D2NB 5IBLC 3W2DL 2VLKA 1XZ0A 4P46B 1JBJA 4UOJA 3NA9H 1I1AA 3HNSL 2IPTH 1T3FB 1U8HA 5HHMD 3T0EE 3BAEL 2JJTC 4PJ9A 3X3GL 4RBPH 5JO5A 1Q0XL 2KDGA 4CDGC 4FQIL 4OT1H 4L4VB 3P0VL 1XGRB 4KK5C 2N1KA 5FK9A 2WIIB 3NCYS 5IBTL 4FNLH 1LGVA 4Y4HB 3PIQB 4K94C 5IFJB 4H8WC 4NO3A 4NQCB 4OGXL 4QWWD 3HC4L 4ORGB 1P4BL 3BDXA 4JLRA 1WTLA 4CU8A 5IJVB 4XAKE 1BVLB 1DBKL 1KJ2A 2NY3D 4XHQA 4WIQA 2GITA 3IU3A 3W82A 1OWRM 3MQIA 4D2NA 2H3NB 3QUZB 5GXBB 4LNRB 5ADPH 4LCUA 2E7HA 5AAMA 4JB9H 1FL5B 1WZ1H 1YEDA 5D2NA 4QHUB 3AUVA 4OTXL 1F6FB 4P46A 1MIEL 2C1OA 1T3FA 4IJ3C 4KTYA 4JZOB 3FFDB 3QWOA 4MZ2A 1RULH 1W8NA 3KHOA 4FQJL 4HG4J 1Z3GL 5L88L 2KL6A 5H2BA 1G9NC 3RX8A 4L4VA 1XGRA 3U79A 2A73A 2WIIA 5GGQH 3U7YH 2BDNL 4LSQH 4D0DB 3DUHA 5KVGL 4UTBL 5IFJA 1QFWH 4ZTOL 1P2CA 2NY6D 4NQCA 3NGBB 5F21B 1CZ8H 1N5YH 2DM4A 5KS9B 1RZ8B 5FO7A 3IAPA 4ZFGH 2ILLA 2CIIA 1U8JA 4ODVL 2A77H 1T7YA 3L3GB 4WI2A 3MUGA 3PWNA 1BREA 3GRWA 5TDNB 3IDNB 3D1MC 2RCSL 4G6AD 3V0WH 4GXVL 1FVCA 3O45B 3CXHJ 2H3NA 1RZJL 2VDOH 3QSKB 4LNRA 5B21A 4U2YA 5LGJA 1EK3A 1JYWA 1FL5A 1KC5H 5EWIL 2CD0A 4LU5H 4QHMB 1LNUB 4HS8H 2O61A 3QULB 3OJMB 1V3KA 3Q5TA 3MRPB 25C8L 2PN5A 1RV6X 1XIWB 5D1QC 3PWPB 5I1LB 1XF2B 4ODWA 4E5XB 4D9RE 3F65A 1BFSA 4MVBC 4OB5H 5BJTB 1Q1JH 3BW9B 4F33A 3RDTB 3JUYA 5J1TC 3OB0K 1FZKA 5DJZB 3UPRB 3D85B 4FXKB 4GG6E 4NQSB 1G7LA 2G60L 2Y5TB 5FFLA 3BP4B 4OV5B 4R90H 2J1KA 1MCCA 2IFFH 5E08H 5TDNA 3IDNA 2NMSA 4MMZC 4HUWB 4LCYB 5KS9F 2FATH 3HG1E 4KVCH 4RMVA 3PV6B 2E9WA 4NGHH 1FFOB 4B7IA 1CTOA 5ADOL 3WXWH 2ZSVA 1LDPL 3P9WB 2ZOKB 1GCFA 4PJ8B 1RZFL 4O2CA 2QADC 4PIRF 3EJYC 3PWPA 3N9GH 3CFCH 4J12A 1XF2A 4JQXC 4HJJL 2EO9A 3OXSA 1PKQB 1UACL 4R7NB 3CX5J 3VGAB 5IVZB 3CFEA 4F58L 3BW9A 4XCEA 2HG5B 2FDBP 1ETZB 4DUVA 3GEWB 3GBLA 3D85A 4LLMA 1A02N 4FXKA 1KLGB 1DUZA 1PYWA 1DLFH 3TT1H 1BF2A 5BXFB 1BFVH 3SDCC 2N7AA 4KTDH 1BAFH 3NH7L 1N7MH 5BOZG 3ARTA 1XGYH 5GRWA 2F58L 1QLFA 1P5VA 1KNOA 4HUWA 5H35A 2FBOJ 2WM0A 3AY4C 4Y8AA 3PV6A 3ULUH 1TQBB 1CFTB 1A14L 1UB5B 3RQ3A 4Z8FH 1FAIH 3SDXB 1EV2E 3KHQA 4PJ8A 1ZHNB 4PS4H 3DLQR 4RX4A 2X7LB 1MHHB 3V4PH 4EI6A 2H41A 1IGMH 4W4NA 1MRDL 3PXJA 4LKXA 5J6HB 5LXGL 2ZUVA 3QIWD 4W4OC 5IVZA 2R0LL 3QDMD 4R2GC 3RZCD 1F3RB 5FUOH 1I9IH 2D0GA 3JTSA 4WHTA 3S35X 5C07E 3DVGA 4DVBB 2K7QA 4UILH 1SJEA 5D71L 1TCRA 3SY0B 4JQVC 4MWFA 4HJGA 4UIKH 1WEJL 3MJ8B 3KYMA 2F54A 5BV7L 2IF7A 1X4XA 5EB9A 5LGKA 4GQPH 2NTFB 2Z0BA 1MFAH 4MD4B 3QPXH 4DGIH 1UH2A 5HDBE 2PUQT 4OZFH 2APBA 3RUGB 5E2WL 2P49B 1UB5A 5IHZB 5JDJA 1OVZA 3SDXA 3F7QA 4JFDB 1ZHNA 1MHHA 1SJHB 1GVIA 1BQHG 3NZ8A 4M03A 1T89C 3QO0B 5J6HA 2EDRA 3RGVB 2W9DH 5JLZB 2X9XA 3MLVL 3H3PL 3MNZA 4EDXB 4AEEA 4PTTA 5DJXA 5FYKE 2CK0H 4G8EB 3SDXF 4K3JL 4U1HB 4H88L 5D7SH 3F58L 1CGSH 4LIQE 4PLKC 4DVBA 2PYEA 1NJ9A 1JN6A 5CP3H 4U1MB 1EGJA 3SN6N 1KN4H 3KWWB 1AGFA 5IB3B 3BSZL 4XNMB 4M61B 1KELH 2ADJA 1R3JA 4KUCD 1UZ6E 4XPAL 4DGVL 3LMJL 3S6CA 5A43C 1UM4L 1QLEH 3KPMA 1OP3H 2DQEL 1KYOK 5IHZA 3QUMH 1WGOA 4LPVA 2CDEB 3OGCB 3TH2T 2BOCB 3MV7B 5D5MA 4U6XA 4OZ4B 2AJXH 1CT8B 1R5WB 3FZUD 2LU4A 4FQXD 5GRVK 5DD1L 4G7VH 3QO0A 1BZQK 4ENED 3RGVA 2Q8BH 5JLZA 3RUGF 1DSFH 2CXKA 1MUJB 3LQMA 3R0NA 5EC2A 4G8EA 4EQ2A 4KU1A 2ITDA 1A2YA 3QXTA 3KLAA 2DLTA 3MRBB 1CGYA 2ZCLL 3HZMB 5GSRB 3CUPA 4U1MA 4I0CC 3RAJH 2FHFA 3DUSA 3DX8B 1Q38A 3KPPA 4XWGL 4CJ1A 3LDBC 4ONGH 5EC1A 2X1QA 5DK3A 4WY7H 5BVJB 4F80A 2Z8VC 3ARGB 5I15L 4TTGA 4XNMA 4MB3A 2F8VA 3FAWA 3V6OA 4P23A 4PY8I 4ZS7L 2VR9A 3NIFE 5ITFA 2H26A 4HWUA 1MCEA 1Y6KR 5C1MB 3FB5B 1QR1A 3QXDB 2CDEA 4JZNA 2D03L 2R2BB 3TWCL 5FO8B 2EXYC 4OZ4A 3RX5A 3V5DB 4W6YB 5ISZE 4EKXA 3C8DA 4PUBL 2PF6A 2GI7A 4Q7DA 1IT9L 2X2YA 3U1SL 4JVUA 2HFEA 1A5FH 5GGUB 1PG7W 2VXSL 4U6HA 2D7OA 4M43H 1W72B 3BN3B 1CLCA 1VERA 4G8IB 4RA0C 1D5XA 2NX5A 2VABB 3QRGH 5GSRA 1QNZL 3DIFB 3PGFH 3DX8A 4CMMA 2BVEA 1NANI 5DWUL 1XF3A 3QAZC 5BVJA 3ARGA 1KCRH 1C5DA 2DQIL 2Y06H 3WN5C 5BMFH 4QT5A 4PJXA 4RISH 2AV1A 4JY5H 3TT3H 3Q6FA 1X5AA 3LRGA 4Y4HD 1RUPH 3TH3T 1EFXB 3WSQH 5DT1L 2UUDH 5B8CC 4LPUA 3FB5A 3N06B 5TE7H 4G80B 4GSDL 3RL2B 1D5ZB 2NXZB 3UO1L 3RRQA 1U6AL 5L8KB 5BZDA 4EJ1C 3SO5A 1NGYB 3E3QE 3EDJA 5J06A 4N68A 1JK8A 5T5NF 1IEAB 1A7PL 1MFCL 1NCCH 3QUZD 4PBXA 3IDXH 3WUZA 1FDLL 1B0GB 1YEEH 2AK4B 3BRGC 2C7UB 3FRPA 4HJ0D 4HGWA 5BW7C 1W72A 3TA3B 4XX1G 2HT4D 2R4SL 4D3CH 4LPWA 2GY7B 1EEZA 5B3JE 1U41A 1RUQL 1FIGH 2HTKD 2VABA 2WUBL 2YXMA 1PFCA 2YZ1A 4PJ5B 3SKMB 1DQLL 3Q3GB 3TO4B 1ORQB 1DLHB 3LQAH 1OTUD 3MLXL 2ENSA 5J1AB 3FOMB 3GB7B 3U0WL 2H2PD 2ERJB 4M5ZH 3D69B 4L3CA 2YSSA 2BNRA 4GO6B 5JW3H 4K3EL 4L5FL 1LVEA 2ORBH 1PZ5A 2YD3A 4DN3H 1CD0A 3AB0B 1N8ZB 1PEZA 4X8JB 1MJJB 1NGYA 3BMWA 1FNAA 4PG2A 1KCLA 2OJZL 3KPRA 3RL1B 5F7UA 4PJBB 3LV3A 4JO3L 3BGFC 1G6RH 3QDGB 3BRFA 2L4OA 1D9KC 2X4UB 3EO0B 4DKDC 4UNUA 3EDEA 4OLWL 3O3AB 5CSBA 3AS0A 1FORH 4JFXB 1Z0MA 3M1BB 5IVXB 4ZMAT 3GSNB 5EA0H 1XIWD 3FT3B 4WW2B 4JN2B 5KZCD 3CVHB 4GKZB 3TO4A 1IEHA 4X7DC 1OQXA 4FQCL 1QKZL 4KMLB 1I8IB 2VXQL 4B41A 3FOMA 1HHHA 4PD4K 4Z7UE 3RDTD 3WE6A 2VC2H 1I8KB 3CPLB 3LCYA 4F3FB 3TYFB 2VSCA 4LSRH 2R0KH 3LH2L 4KTEH 1TNNA 1Z6JT 2Q86B 3OAZH 4L8SC 4PLJD 4XC3L 1EJ6A 3HUJB 5AWNL 5GS0L 3OR6B 5GGRY 2VKXA 2F19H 4F7CA 4PLOB 4NRXA 1HEZA 4CVXA 5EOTA 1CTNA 2Z31B 5E70A 1X5LA 4NQEE 4HFWA 1RK0B 4YXKH 4H0IA 2D9QB 5LGHL 1HCVA 1VEPA 2DS4A 2R56L 3M1BA 2VXUL 4I18C 4OLUH 5F1OB 1UT9A 2XPGA 3V8OA 3SBWC 3FT3A 4GKZA 4GW4B 4IRJC 4PREA 3WKMH 4FRWA 1VADB 3V4VH 1NFIA 1TXKA 3T0AA 2VLRB 5GQBA 4MB4A 5IVXF 4TOYH 1D6VL 1SYVA 3TYFA 32C2A 2FECL 3OBAA 4WW2F 5F1IB 3DSFH 2MSPA 2Q86A 43C9B 4YFDB 3GK8L 5BVPL 1NFDB 1JJUA 4R9HA 4XCFH 5F1NA 3GIVA 4O58H 5IB1B 1CLYH 2ZNWA 3KS0H 1S7XA 4LHUB 3D25A 3I75B 2Z31A 2ID5A 3DVNB 4OIBA 1ZLUH 4LPYA 1SM3L 1JNHB 3WO4B 3WLWD 3WEXB 3C09B 3VXTA 3HUJF 4NC2B 4LSVL 5EU6A 4KKLD 4OFIA 2L0DA 3L7FB 3C87A 3I9GH 4YBQC 1XGUA 4CADB 4JO1H 1ZLWK 5GGTH 3LIZH 4IDJH 3H6JA 3HRZB 2D7PA 3OKNA 5DHYB 5E8DL 5B22A 1J11A 1AC0A 2VLRA 3ULUC 3BYTA 3K46A 2CXGA 2CDFA 5TQ2L 3GMQA 3DVIA 1U3ZA 3RHWK 4HMEA 1U92B 5F1IA 4P99A 1BJ1H 43C9A 5FDYA 1F3JB 2X6MA 4WEMB 1QBBA 1AI1H 2V5TA 5CJXA 1VFUA 5KVMC 4UB0L 2HRPL 4LHUA 2OR9L 2XKUA 2A6JB 3WJLC 3DVNA 2P46B 4G7YH 1I8MB 1W8OA 1GHFL 1CF8H 3HMXL 1MI5D 5FGBA 4N5UA 1CXLA 1OAXH 1NFDF 2BSRB 4YUEL 5F9DC 3MGAA 3C5JA 3H3BC 4PGZA 1OARL 4JFDD 4IOFD 2BY2A 4OFYD 1J0YA 2CKBH 1N5AB 1ZHKA 3OKOA 3VFWA 3LRSA 5DD6B 4Z77A 3MFFB 5TQ0H 1ZVYA 2A83B 5ICYB 3REWA 5DHYA 1MH5A 5DD0H 4KXZH 1J1PL 1H3GA 1Y6NR 4LKCA 2OS7A 5A16A 1JGVL 2XY1A 4N9GB 4TRPH 4NJ9L 1OCWL 5MEQB 1F3JA 3KNBB 5FKAA 4QOKD 4ZUUB 1ONQB 3SE4C 2CGRL 2IADB 3DV4B 3IDYC 1K8IB 1I8MA 4MNGE 5C9KA 3ULVL 2IJ0C 3KPOB 4M00A 3KXFA 4WTXA 5EZJB 2A74B 2EZ0C 4LLWB 3R4DA 3MV7D 4YHMH 5KANI 3DO3A 3QFJB 5D1ZD 4KY1L 5DVMA 1NCWL 1BQHA 1N5AA 4BZYA 4PRDA 2GJ6E 1IC7H 5DD6A 3KYOA 2D7NA 4GW1B 4OZGB 2A83A 2WBJC 5ICYA 1L7TH 5HYJA 1E28B 4X98A 3HLAA 4GAJL 1U8OB 1H0DB 5L9DL 2E27L 3DYOA 2YPKA 1DEDA 5MEQA 1CXHA 1FVEB 4S0TD 3KNBA 2JJUA 1MCRA 1CGVA 5GHWL 1IE5A 4YE4H 5JHDA 1JV5A 1QO3B 4TPRL 2LAAA 1A7QL 2IADA 3DRTB 1UVQB 2IBBA 1BHGA 4X9FA 1K8IA 5JOPD 5CEZD 1AY1H 2CSPA 3D0VA 3B4NA 5KJRH 4WV1B 3KPOA 4ZTPH 2VISB 2F5AH 4LLWA 1NUNB 2CLZA 2DTML 1MY7A 3FQTA 3P11H 5J1SC 1CDIA 3QFJA 3UYRH 1JWUA 4S2SB 3UTSE 4NQDD 4HWBL 4F7MB 1TZGL 2IAMD 3OR7A 4LRIC 4P2QE 4NCC2 3QQ9D 2AI0L 4KQ3L 4MQSB 4PJAE 5ESVA 5D93B 1H0DA 4XMLL 2WP3T 3ES6A 4EI5A 2H45A 5ACMA 4OZGF 4G6MH 4GRWE 3L5HA 3VWKA 4Y16A 4FMKA 4BZ1L 4UZGA 3HRPA 3WUWB 4EIGB 4PRPE 4M7LL 4UDTB 1UVQA 4OZHA 4MXVF 1EFXD 2EE6A 2F5BH 2VLJA 3G08B 3SKNB 5IMMB 1XF5B 2X1XR 4LCCA 2W0FB 1IBGL 4YHYC 3TH4T 2FJHA 1TENA 4LCWE 4CVZB 5K9OA 5JXEA 4HWNA 4QRPE 1DN2A 1WZMA 2R2HA 3MOAL 1OHQA 5ALCL 1G1YA 1OAYL 3UTQA 1WFTA 4BFBD 4KQ4L 4XCCL 7CGTA 2FL5B 3SQOL 3WXVH 1ZGLB 1E6OL 4LARH 5EOCH 4L4TD 2AK4D 5HHNB 3NCJL 1U3HB 5I1KL 4R96A 3TA3D 3B83A 2NW3A 4K94L 1UKTA 1CLOH 3PUCA 4H8WL 4LSTH 1HKLL 3BHBA 1K2DB 4ZFFA 1VESA 4YDVA 4FQ1H 3MOQA 4PJ5D 4WI8A 3OF6D 1EHAA 1KJ2H 5HPOA 5F88B 4UU9B 2DQGL 3WUWA 1MJ7H 4UDTA 1QTYT 4MQXC 5K9KA 3TNMA 5HJ3A 1NBZB 1E4JA 2EH8H 5C0RH 5JHLH 3G08A 3LKPA 5IMMA 4ONHA 4TQEH 1ZSDB 4NHCL 4JFQA 2W0FA 3OPZH 4G42A 4J7RA 5C0AA 2FR4A 4N1HB 2DN7A 4J4PD 4XVJH 4ZFOB 3WIHH 2X4TB 2B1HH 4HGMA 4JRYB 2JB6B 1KULA 3R8QA 4ETQA 5HGAA 3B2UC 5F9OH 3LQAC 1G9NL 2E7CA 3VFTB 2UYLA 1PBYA 2WNGA 3BH8B 2I27N 3PV7A 2EYRB 2P24A 3IFOA 3QHFL 3KR3H 1VEMA 2AJUL 1H5BC 3PF2A 1G9MH 1JZ3A 2JJSC 4PJEB 3OKEB 1CFVH 1T03L 4KZDL 1ZVSA 5F88A 4XBEL 3WLBA 3EHBD 2HFTA 3KS0J 1Y0LB 3ARPA 2O5YL 5EZOL 4XXDA 4U3CA 3FO0H 5LQBH 4PRBA 2EKJA 2FCBA 4ZXBD 5GRXG 4FZEL 4M6ML 4M7ZC 1A21A 2HJFA 3PHOA 5D7LA 4H25A 3IFLH 4P9MH 1EH9A 4I0KA 1INEL 4GRLA 4TULH 3UZVB 4ZFOA 3BPOB 2X4TA 1G84A 4JFFE 4WI5A 4PRHE 2JK5B 3FT2B 2JB6A 3GI8L 4OJFL 4XBPA 4OAWB 3FOLA 3ZDZE 3T0EB 3Q2CA 5I8KH 3UTPD 3KPLA 4HIHB 1OAKL 4ZOCA 3IFNH 5DA0B 4NYLB 2E7BA 1YY9C 3HR6A 2B8OT 3GSUB 4PJEA 3OKEA 1OSZB 3MCLL 4NT6B 5DZNA 4I9WE 4Q6IC 2HP4A 2DL2A 1CDBA 3OKDB 2BVUA 2YPLD 4CU7A 5C86A 4XMKH 1YECH 3HB3C 2J8UE 2DIAA 4O00A 2VL5A 3P0YL 4KHXL 4OM0H 5DD3L 1IAIL 3VFRB 4PJEF 2NY6C 2BC4A 1QZ1A 2X42A 3BGAA 2YD2A 2KPNA 5TDOB 4BH7A 1LO4H 1AJ7H 3FQUB 1JGLL 1TTGA 4M5YH 2HJKB 3BDYL 4OM1L 1A3LL 2BFVL 4X6FA 1FFNA 1DFBH 1NDGB 1YYLL 3U83A 2UVFA 1EA9C 1HSBB 1L0XA 1C1EH 1I9JH 1OPGL 4NBZB 4N8CH 4MJ6A 5GGSB 1DQJB 1NMCC 5ID0B 4QRRE 4X5XA 4YDKH 1FO0L 4F2MB 1N6UA 3WDHA 4QHLB 4YO0B 1JI1A 4PP2A 3CMOH 4M4RA 4DFIA 4K7PL 1AXTH 5DJ6A 3RWDB 2E6PA 5IEKB 3EYVB 3TF7C 3LSOA 4TSBL 2EDQA 1HZHL 1SYSB 4MJ5B 4HT1L 4TNWK 1Q9WB 2DLFL 4U6TA 4X7CC 3X3FL 5CSGA 3MRNB 1Q9KB 2IALB 3ISWA 5FUCC 1MY5A 4CMHC 2FNBA 1RURH 2HJKA 4X6DE 2R8SH 4NZUH 4KKAD 4LLDA 5GRUL 1S9WB 5E7FA 4AL8H 4LQ1A 1NQBA 1CICC 5GGSA 2PCPA 4E9LA 5ID0A 1X5ZA 4ZSOE 3ZDYE 3TBSB 2VDRH 1J0IA 4HAFA 3V0VA 4LQFL 4Y4KD 4XP6H 3O2WH 1AGDB 1KPVB 2AABL 1MNUH 3U9PL 5ID1B 3BISA 4GG6B 4S1RL 1I1RA 1MREL 2AJZA 3QEUB 4YHOL 2MWCA 4XNQA 1VENA 4HS6B 3VGGA 1YJDL 2VOTA 4OSUH 1SYSA 5GJSL 3TIDB 2V9TA 1Q9WA 3C2AL 4JREC 4D9LH 1JZ6A 3PL6B 4Z18A 2BVOB 4QRQB 1DQQB 2CO6B 3HG1B 5E8EA 1NEUA 1SBBA 2DYPB 5BS0D 4L3AA 2DOCA 1EXUB 2EH7L 3RWFB 5HPMB 1RUKH 3BD4A 1RD6A 1HNFA 1IGJA 1ZHBB 3SKJH 4HF5L 2XTJD 3DRQB 3WNKA 1NC2B 1AO7A 3IS0X 2GFBA 4X0KB 1P1ZA 4H0HB 5EFIA 4D0CA 5FDWB 1QVOA 4C56B 1UCBH 4XVSH 3I6LE 4WWKD 2YS4A 5I8EA 4W6WB 4M93C 2V2WB 4MSWB 1TJHL 3ARZA 1AD0B 1P84J 1QACA 1KLUB 3S36H 2I26N 4OUUB 3K7UA 4HS6A 2I24N 3L95B 4FFVD 4YNYB 2IQ9H 1JFQH 4LPXA 2BVOA 1NGZB 1DQQA 2X4QB 1IZKA 4XP4L 1ZS8B 4WUUE 1MAMH 1ZTXL 4KUZL 1IJ9A 1Q9LB 3MRFB 3KYKL 4M7KH 3MLZH 4NO0A 4OGAC 3UJTH 1ZEAL 1FQ9C 4JKLA 1WBZB 3OQ3B 3UBXI 4IMKC 4P4KC 4MS8C 3A67L 2Z91B 3QDJE 1KFAH 3DRQA 1ED3A 1YQVH 1EMTL 4X0KA 1GGUA 4O51B 3B3IB 3K2MC 2EO1A 3RGHA 5D7JB 4C56A 1AE6H 1T0MB 3BD3A 4HHAB 5DLML 5C07B 1A6UH 3UROR 5SWZA 2ESVD 4R26L 4MSWA 1QBLH 1AD0A 3HZVB 4ZQKB 1KLUA 2A0LC 3AU1B 4U1NA 4OUUA 1ZE3C 1RZIB 2Y1VA 5I1DA 1CR9H 1WZKA 5HHVH 4OZIE 2XIDA 2FIRT 1VACB 1TJGL 3O4LE 2GYSA 3GSVB 5EO1A 4R4ND 1ZS8A 4JQIL 3FL7A 4GXUN 1P7QA 1A7BA 3MRFA 1NCBH 3QJFA 4HKJB 4PRIB 4P3DB 2BSED 4M7LT 2EDKA 5I74C 4RIRB 5IT2L 4NKDA 1WT5C 3QHZL 2Z91A 3CMGA 1A0QH 2WQ8A 5MENA 5E03A 2NCMA 3KPSD 4J3VA 4M6AA 3B3IA 3U36B 4V1DD 3N50A 4X6BA 1J10A 3OJDB 5HGHA 1EFQA 4GLRH 2AAVA 5EOQL 4JR9L 3GMLB 1RZIA 3HNVL 4IS6B 2PTVA 4LDEB 5CEZH 1U3HD 2XA8L 5E99L 1YY8A 3QXAB 5JR1H 4FFZL 5K9JL 2P5WE 3OAUH 2IPKB 1JYXA 5FYJU 3P9LB 1AQKH 4NN5C 4BZ2H 2BXZA 3NA9L 3HZYA 4HG4K 2RIKA 2R1XA 5JW4N 5M7QA 1H3TA 1MCKA 4PJ9C 4PRIA 1N26A 5KN5A 2Q76A 1IGFL 5MI0C 2W60A 4P0DA 3PWUA 4OT1L 1M7IA 4NRYB 1IRAY 4GH7B 4RIRA 4OFKA 2VAJA 1T80A 1W72H 2YUZA 2NY1B 4L8BB 2ZJSH 5F7NC 5LWYH 3DMMA 1B0RA 1AXIB 1IM3B 3U30C 3U2SB 2OSLB 4JRYD 3AGVA 4APQB 2IH3B 2W0PA 3CXHK 5E9DA 6FABL 1BGXH 3GHBL 1MOEA 3RA7H 5DEFB 1PLGL 2YHGA 5JQ6L 4UAOC 5D2NC 2MOVA 1WZ1L 4P46C 1BEYH 3U0TB 3ARQA 3QR2A 3EUUA 3P9LA 3EBAA 2NLJA 1GGBH 3H9SE 2PR4L 1OF2A 3LN5B 1NBQA 1RULL 4PJHE 1RJYB 5CZVL 1LO0H 4TTDC 1T66D 2FEDD 5DJYB 4U3HA 2OJEA 4QXUH 3FB7A 1MCWM 2N56A 1UZ6F 3JWOL 3O6KL 3U0PB 2C1PB 1SY6A 5ISZB 3BUYA 4MCYB 4R0LB 1T4KA 1EUUA 2DQJH 3O8XB 1QFWL 2R2CA 4L3ED 3O6LL 5DHXB 1CZ8L 1N5YL 1G9MC 2APTA 5GRJH 4ZFGL 1GGTA 3K1DA 3F5WB 4U31A 3DBXA 3RI5K 4BFEA 2NY5L 3QYCA 4ZDHB 2IH3A 2XZQH 1OT2A 3B2VH 3L6FA 1FG9C 3QUZC 2QL1A 4GKSA 2VDOL 1A6AA 3TBYB 4HLJA 2HT4C 2X41A 1LQSR 5CILH 1HXYA 3SO3B 1JTTA 3U0TA 1QHOA 1OGAE 1IAOB 4HS8L 3SJVD 2AERT 3P4NB 3LN5A 1RJYA 3I02B 4HFUH 4HZAA 1VFOA 4NZDA 1OTUC 3CX5K 4XAKD 5KANG 1MVUA 4OB5L 3VGEA 4MCYA 5HI3D 5T3ZL 1MCSA 3NGBC 2R2EA 4DW2H 3O8XA 1E27B 1W0WB 4KRMB 3F5WA 3GSNH 3RVVC 5HYQB 4R90L 2DBJA 4ZDHA 5CUSH 5MERB 1N4XL 1NMBL 4GKNB 2VN7A 1IQDA 1T7ZA 3HPLB 2WINA 5IM7A 1VPOH 3DXAA 2UY7A 4KVCL 4M7JL 3T08A 1EHXA 1JIBA 5EU7E 1LHZA 4DTGH 3NFPB 4XBGB 5DFTA 3MBXH 3FFCA 2BNUB 3FONB 5HHXH 1XIWC 3ULSA 3GSQB 2D31B 3N9GL 2JIXA 3CFCL 4MXWH 3QIUB 3V9FA 1BZ7A 1B4JL 1JHTA 1IAMA 3HA0A 1FYTA 4TVPH 3BJ91 2P7TA 3S4SB 5I18H 4JDVB 1E27A 3LEYH 3UP1A 5GIRB 3CDGA 5JUEL 4OKVB 4QKXB 5F6HI 4PLJC 3P4OB 3VFMA 3CSBA 4KTDL 3HMXA 1T6VN 4WHCA 3L9RB 1A4KB 2XICA 3HPLA 4L9LB 4TUJB 1U8KB 3EFFB 5L2KB 5C0EA 2CIKB 1YC7A 3ULUL 2NZ9D 3TPKA 3WHE1 4D9RD 5B3JF 2APFA 3NFPA 5IVNA 4Z6AT 4Z7UB 4PJ8C 3SDAB 4Z8FL 1FAIL 1S3KH 1KTKE 4K9EH 5T1MB 2K9UA 5I71B 4PS4L 4PRNB 2OZ4A 3V4PL 1IGML 1II4E 1I1AD 3QIUA 3PQYE 1D5MA 3DX6A 1LO3H 3O81A 3VGAC 1J1XL 1BMGA 4LMQI 2YA0A 4ODBD 3S4SA 3Q5YA 4JDVA 1I9IL 3ZKMD 3PL6D 4FG6C 3HG1D 1A6ZA 1CK0H 5GIRA 3JTTB 2DYPD 5IGXH 4NQEB 4UILL 3V4UH 3KPNB 3O9WB 3LHPH 1GZPB 4OLXH 2X1WL 3A6CL 3MRHA 2NY7L 4L9LA 4TUJA 3GMMB 5FOBA 3C6LD 1OLZA 4Z7WE 5L2KA 3B6SB 2AXHA 3G5XA 3HE7B 3VWJB 3QI9B 1MFAL 3I50L 3ZSTA 1F00I 4Q9RL 3CCHB 1NC2D 2H6PB 3QPXL 3SGEI 1FV1B 1J0HA 3VFPA 4M8QA 2B4CH 4Z7UA 3GKWH 3QQ3B 1MRCH 2P47B 4M9OA 4NCDA 4YEEA 4YAQA 4PRNA 2QQLL 4MLIA 4RBPK 1EX0A 1EJOH 5GJTH 4PJFA 1F4HA 4ORZC 3NFNA 1M71A 2ENYA 3EOYG 5DMIH 4Z7UF 2YD4A 2CK0L 5LBSH 2VXTH 3BQUA 2ARJA 5DYOB 4I0PD 3U6RA 1H3XA 5D7SL 3VXPB 3CVIH 1RZ7H 3JTTA 1EHNA 2AQ2A 1O7VA 3EJZD 3PABB 5HYSB 2GJJA 1MCPH 1KN4L 1Z9OA 3WNMA 2RBLA 1TTFA 1ZLSH 3DPBA 5CEYB 4HIEB 4FMFA 1KELL 1WAAA 4RGNC 2C3XA 3GMMA 3B6SA 3HE7A 4FTVE 1YPZA 3QI9A 1JRHH 3IDGB 3KPTA 4CAGA 1QLEL 3CCHA 4R7DB 4MNHB 5TGBB 3QUML 5EZIH 3HZKB 1BWWA 5D7JD 1WAAF 4KRPB 4TNWF 2GSGB 5C07D 2AJXL 2PTTB 2VO5A 4JFEE 4XXCA 3U46B 2EIZB 5KG9A 3RGVC 3RPIB 3TIEA 2Q8BL 4MZ3A 1YUHB 1DSFL 1N0XL 1S9XB 2MQCA 1AFVH 2DQHH 4LMQE 1S7VA 2Q6WA 3VXPA 3S3SA 1A3QA 3RBGA 1NPUA 3BKYH 3BT2H 3L3DA 3GKZA 5HYSA 5HDLA 4O5LH 4YX2L 4ONGL 5TDPA 3FB6A 4WY7L 3DGGB 3NTCH 1PD6A 3Q1SL 3BZ4B 2ATPB 4P23C 1QP1A 4RZCB 1ZWIB 2HFFB 1N6VA 5FYKD 2APWA 3HZKA 3T1WA 5IKCB 2B5IC 4D8PB 5FYLH 3P77B 5D70H 4BFIA 1NGXB 1CDHA 4R6UA 4EVNA 1KT2B 2GSGA 4HKXB 2DDQH 2FX7H 4NJAH 3U46A 2EIZA 2R0WL 3SDYH 2ZG1A 5I0DA 1LK3L 4ODHH 2FGWH 4N0UE 1AGBB 1A5FL 5JMRA 4OCSH 2IMMA 4M43L 4WWID 5J12C 4I4WB 3SE8H 4Y2DB 5E1HB 1F6AB 4MNGB 3QRGL 3S5LB 2ZG3A 1HKFA 1GZQB 3ARGC 4PJCB 1YMHB 1KCRL 3HC0A 2Y06L 1TVDA 2ATPA 5E6YA 5BMFL 4RISL 3DARA 4JY5L 2Y72A 3TT3L 3ARDD 2HFFA 1MQ8A 1BZ9B 2NY1D 2GJ6B 2C3HA 4MJIA 3I3EA 4YQXH 3NBNA 1I3RB 5IW1B 5TE7L 3MV9E 2R69L 2UZIH 3ARBD 4MQ7B 4N0CD 4Y19D 4APQD 4M6NH 2YPVH 1WF5A 2BMKA 2ITCB 4XVUD 5C9JB 3QQ9C 1RHHB 4UV4H 1HSAA 5DRXB 3IDXL 1HHJB 4K8RH 5EUOE 5JNYB 2XQYK 5D6DC 4OF8A 4I4WA 1VFBA 3MZGB 4PV8A 2XWTB 1F6AA 1TZHB 3HN3A 4IMLB 4HWEH 1MHEB 4LEXL 5IG7B 1JZ2A 1GZQA 4PJCA 2D0FA 1RIUH 5SWSE 1YMHA 4Y8DC 1GAFH 1FN4B 3SCMB 5EIIA 1SQ2N 1QSEE 4I1NB 4QTIH 3LQAL 3ROOB 3UTSB 5ISZD 3TNNB 1KCVL 3MRQA 4JY6A 1BZ9A 1RK1A 4M5ZL 1JGUH 3LEVH 4P2QB 4PJCF 2P5EB 4X4YA 1G7MB 5IW1A 3D5OF 2NXZC 4KKNA 5JW3L 3IVKB 1S7RB 4G6JL 1CL7H 4BM7A 4PJAB 3C5SA 3FO1A 2Q87A 2ORBL 3DHJA 1R3LB 1V7MH 2QQNH 1ZK9A 3D3VA 4YBLC 1JWMA 3E8UH 5JOEA 3TJHC 5BRZB 2YRZA 1FL6B 5T1KB 2VN4A 4GRWB 5DRXA 4E0RA 3TBWA 3TA3C 4AG4H 4U1GB 2FYYB 1QEWB 3R1GH 4KDTC 5DJ2B 1INDL 3QDME 4IIQB 4PRPB 1AIFA 2BNQA 4LF3B 1NC4D 4C4KO 3AREA 2WBKA 2NZIA 3EYUH 4IMLA 1FFPA 1BJMA 1FORL 2EDDA 4EN3B 4AEIH 2KBGA 1UG9A 2FHBA 4YXHL 3VG9B 2C3WA 5E2JA 1T0NA 5EA0L 3TO4C 3PGCA 4X4ME 4XI5C 1INQA 2C3VB 1NCNA 1WCBB 3SCMA 3VFGH 4LEOB 5MHSE 1JPGA 2XQYG 3AS2A 4LCWB 1S78D 4HLZH 5AEAA 5TFSL 1VGEH 4QRPB 4TNVK 3DECA 1KIUA 3MACH 3TNNA 2ERJC 1KJ3H 1X4YA 4JANA 3EOAB 2HVKA 3MUHL 2P5EA 4LSRL 1TDQA 2R0KL 4JQXA 3TEUA 3IVKA 4KTEL 4UINL 4DOHE 3EO1B 2Q7YB