2Z92B

Crystal structure of the fab fragment of anti-ciguatoxin antibody 10c9 in complex with ctx3c_abcde
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
210
structure length
210
Chain Sequence
b'ELVMTQTPAIMSASPGEKVTMTCSASSSVSSVHWYQQKSGTSPKRWIYDTSKLPSGVPGRFSGSGSGTSYSLTISSMEAEDAATYYCQQWSSNPPTFGAGTKLEVKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Anti-ciguatoxin antibody 10C9 Fab heavy chain
publication title How Protein Recognizes Ladder-like Polycyclic Ethers: INTERACTIONS BETWEEN CIGUATOXIN (CTX3C) FRAGMENTS AND ITS SPECIFIC ANTIBODY 10C9
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 53
structure length 210
sequence length 210
ec nomenclature
pdb deposition date 2007-09-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2z92B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2z92B01
4PBWD 3TT1H 1F6FB 1QG3A 3E6HB 2VZ1A 4PRBA 4C4KT 1YY8B 5FO8B 1MF2H 3U0WH 2BVOA 3IB4A 3CVHB 4TSCL 4Z7NE 4HKJB 1MI5B 2YPLD 3RL1A 2MHAB 1NMBH 1GH7A 1XCQB 2P8PA 1IGML 3CAFA 3VRIB 4JDTH 3D39E 5E8EA 1EFXA 3H3PH 4QRTA 1ODAA 5FA4B 2QHRL 3VRLF 1GIGH 1VKXB 4N0YH 1W0YT 1F8TL 4OUUB 2GTZA 4APQC 4QF1B 5DUPH 3T1FA 5DJAB 1VHPA 1KIPA 4NQDA 5ESVB 3MBXL 4MQXD 5D2NB 1BQLH 2E7BA 1BQHG 3OKOA 4LVEA 1WZ1L 3EOTL 3GMLA 2BNUA 1TZGL 3EO1A 4KQ3L 4HV8A 1NQBA 3C8KA 1FCCA 3QPQC 5T5FH 4GRLA 1UB6B 4U0RB 5MHSE 1ND0B 4RAVA 1J11A 1AGBB 2DI8A 3J8F7 3RWDB 4OZFA 1IQDA 4ZG1A 3CFJA 1SYSB 1CDJA 25C8H 1LD9B 2M2DA 4HUXA 3LOWA 4WV1C 2R56H 1WT5A 3TBYB 3F7RA 3ROOB 3TO2A 4GSDH 1KT2A 3DX7A 3HE6D 2CLZB 2ED8A 3T08A 5BVPH 1S7RB 3D18A 1I8LC 3SKJL 4G3YH 2YPLB 1B0RB 2NYYD 2Q3ZA 2XYCA 5FYJU 4QHNA 3WJLC 2UUDK 4RX4A 5FOJA 5DEFB 5IHZA 1C16A 4YFLF 4MA3A 5HVHB 5IESH 1HSBB 1CLOH 5F9DC 5FKAA 5ID1B 2FWOB 4FFYL 2DQJH 1H3GA 2XT1B 4DUVA 5ILTL 2DS4A 4PJIF 3RBGA 5C0EB 2AXFB 5IW6A 2ZUTA 5ABDE 4PRAA 3BGAA 5DUML 3OBAA 3QNYB 2YZ1A 1IKFL 1JFQH 1W0VB 3EYFA 3LQAH 4HQQL 5CS7A 3AC0A 5F1NB 5FKPA 2DOCA 1FNSL 1NGQL 2AJ3A 3B8SA 4FHBD 5C3LD 4GRWB 3SE3C 4AMKL 4RAHA 1IC4H 4LGPB 1G0DA 3L7FB 4R90L 1YEHL 5EA0H 4WFHD 5HGHA 4PJCF 4BJLA 1WWAX 4LF3A 2EDRA 1QBBA 4HS3B 1QLEL 4GRMB 3VFNA 3V5DA 4F7EA 5C9JB 1KPVA 5C0AD 4OCXH 3WFBL 1R3JB 1CT8A 3QFDA 4GXUM 3BDXA 5J9PB 4ZOEA 1IC5H 1ACYL 1VFUA 4WUUD 2Y7QB 3H42H 3C09B 4C54A 3HE6B 4FQ2H 5KTEL 2QJDA 2XWJB 3QNZB 4MLIA 2V5SA 4RDQG 5CJ8A 3AS0A 2VZUA 1HHGB 3WNPA 4DZBA 3R06A 3UC0L 1HILB 2AXGB 4GG8B 4PR5A 4OD3L 4WU7B 5CCKL 4MWFB 2GJ6B 1U8PB 1OAUL 3V52H 1TNMA 4PV8A 1IAIM 1NFDF 2RBLA 4RISL 4OFYD 1JUFA 1BREA 2BJMH 4UTBL 5I2IB 4YNYA 4RMWA 4ZSOB 5H94B 3OPZH 4K8RC 4YXKL 3MLVL 3ZKND 4XXDA 2IH1B 5B4MC 3VI3F 3AAZB 4JR9H 4OF8A 1JGLL 3BN9C 3P77B 3IU4L 3C6LB 4W6XB 4MXQC 5F3HB 1U6AL 3TJHD 2ATKB 2VUOA 3AM8A 4LLMB 5JZ7D 1NBQA 5EO1B 3HG1E 2FEEL 3TO4C 5C0AB 1TQCB 3T09A 2C1PA 2CRIA 3IFOA 5IVXB 4APQA 4PGCB 5L7XL 43C9A 4ZXBC 1WTGT 1HDMA 4WUUB 2XI9A 4HDIA 4XC3L 1UEYA 4QHLB 2ZPKH 4XX1E 4ZUTB 1SBSL 4N0CD 5I19L 1CD8A 3ESVF 2P5WD 4X9FA 4LRNH 3BI9X 3VRJA 3WKML 1EGJA 1H3VA 5C0RH 1N3NB 3GSQA 3DETC 3LMJL 4DN3H 2X1QA 4OI8A 1MAML 5HDOA 2C3WA 2FX8L 4HC1H 1A8JH 3O2DL 3LS5H 2FYYA 1JGUH 5BW7A 2X4UB 2YBRB 3O2VL 4BZ2H 4OCYL 4WV1A 5L0QB 5EO9A 3DVNB 5T1LD 4BQ9A 3O6FA 1R3IL 5EZLA 4IHOB 3BYTA 3NCMA 2VXVL 1JL8A 4QXWA 1NL0L 2EO9A 1LQSR 4Z78A 4JY6B 4P23D 2BMKA 4P4KC 4X6CB 4OFDA 2GQHA 4P46D 1L7IL 1WIPA 3DXAD 4WI6A 3TC9A 3R8QA 3IGAB 1V5JA 2OM5A 1KSRA 2FEDD 1BVKB 4L4VD 1CU4H 2P24A 3GK8H 3BQUB 5EG6C 5HSFA 1SMOA 5HYSA 1J5OL 1QVOA 3LY6A 2DTMH 4LSQH 4NQCD 3UEZA 2ESVE 3DV4A 4HH9B 4PJXA 5DWUH 1A6PA 1YC8A 4HIJB 2AVGA 1FV1A 4MAYB 3GM0A 1VESA 3SE3A 3OKKA 4POZD 3W11C 4H88L 2Q7NA 4XWOC 1I7ZB 4OD2B 5L8KB 2P5WB 3F6LA 1QBMH 4WENB 5KAQG 3ZKQD 4F7MA 3IXAB 5HDQH 5C6WH 1VGKB 4ZFZB 3VG9B 1LE5B 3AU1B 1F4XH 1KENL 3K8MA 5ISZE 1PEWA 1Q94A 3MNZB 3DBXB 1CTOA 1VEPA 3CCHB 3HPJB 1VFMA 1FFQA 5T1LB 5D7KE 4Z18A 5DJDB 1ZHBB 3MUJA 1RUKH 3G6AB 2OI9B 5INDA 1AGEA 1MFAH 2OTPA 3RWHB 3IJSB 1R5IA 2DQDH 3U7WL 2NLJA 4ZUVB 4P23B 4JQXC 1ZE3C 1CXFA 4G9DA 4Q9CA 5CBAB 4P46B 3DXAB 3GB7B 1PG7L 1WSST 4U4BA 5GHWH 2NY6D 5EBWA 4OFIA 3CFKB 5SX5K 2B1HH 5HI5C 2YMXH 3EJJX 4ODTH 4L4VB 5FHBL 2BVUA 3MBED 4FP8H 5HJ3B 4NQCB 5T3XL 4J3TA 4OV5A 1F4YH 4LHJB 4CJ1A 4FG6C 1RJLB 3FZUD 1U8KA 2APBA 3MLPA 1J0ZA 3L1OL 1LP9B 1F42A 1BF8A 4JG1H 2M1KA 1WITA 3L3DA 3O81A 3PHOA 3EBAA 3OKDA 5DSCA 2MPAH 3SGKC 5EU5A 4XP4L 2A38A 2NTFA 1T1YA 3T65B 3O9WC 4H0GA 5JW5B 3LCYA 1CFNA 2ICWJ 5KOMC 2FEEI 2X6MA 3VGFA 1RZJH 1UM6H 3TO4A 2B2XH 3QIUC 2FL5B 1FGVH 5IM7B 1D6EA 5B39A 4I1NB 1NBYB 4ZXBA 2AKRA 4DUXA 2PTTA 1AD9B 3O4OB 5SWZD 5DHYA 4JHWL 5ALCL 5EUOB 3VA6A 3O2WH 3MRRB 3NZ8B 4XZUA 1M71A 1AHWC 3WL9B 5HGAA 1GZPA 4I9WD 5E8OB 2EYRB 5IFHL 4K55A 2NY6B 1QSFE 1QYGL 3IDJB 3RVWC 5JOFB 2MJWA 4F9LA 2MCPL 1RZFH 2NY3C 5B8CB 2N7BA 1LO0L 3ARPA 1X44A 3BXNA 3MOBL 5T3ZD 3PF2A 3VXUE 1FORL 3MBEB 3X3FL 5GS0C 4BH8B 5HI3C 1V3JA 1INDH 1U91A 3HNVH 4YDKH 1R0AH 4YLQT 3LS4H 4HHAB 4RQQB 1XGYH 4KTEL 4NKIL 3VFMB 3DTXB 4XH2A 3MZTA 3DO7B 3GGWB 2CJUH 1SEQH 2VDOH 1BQUA 2FZ3A 1YECH 5JIKA 4Q9QH 2CDEB 2WM0A 1TJIL 4LEXH 3ILPB 4TRPL 4HJJH 1QPPA 1GOGA 1QKZL 2QQLH 5EC1B 4PB9H 4V1DD 4EI5C 5I30L 1FO0L 4UIMB 4KC3B 5J7CC 2VDNL 3KDMA 3D6GA 2QLVB 5T3ZH 4YFLI 3QO0B 4MDIB 5E4EC 4OF0A 4MLSA 3VFOB 4FQHB 3H9SB 3TEUA 3MRJB 4R96A 5ETUA 3PL6B 5SWZB 3NOIA 1Q0XH 1PYWA 3G5XA 3QJFB 4ENED 2BY3A 1C5CL 3BGFB 2A6IB 2BSSA 1N59A 2JB5H 5EBLA 3D2UA 5F7HA 2MTPA 4PTTB 3VXNB 1E4KC 3P73B 1QFUH 2VWEE 4OIAA 2D0HA 4MCYA 3L3JA 3U46A 3LRHA 4WW1A 3OR7B 3RVVD 3DGGA 2WBWB 1H5BB 1FLRL 4NQXB 2LVEA 4OJFH 1JYWA 4OAWB 2FJGA 2HG5B 4DJMA 4GT7A 3LZFH 3BP5B 5F96H 1U41A 4JFFE 4LSDA 3UTTA 4N8PA 5TJWK 2LAGB 5GS1A 5HPMB 1CTNA 4U2YA 1LO5A 2EYSA 4MB4A 1N26A 5TE6L 2FO4A 2H9GA 3QI9C 3QCVL 3VWJC 1Q9WB 3RJQB 2DQEH 3RY5A 3QDJE 2AJZB 3RWIB 3MSPA 4KVNH 4PTUA 5DJXB 3BFOA 2J6EL 1IEHA 2Z91A 1LO4H 2Q6WA 4HT1L 4PJCE 1KCRH 1J1XL 5CEZH 5L2KD 4TULH 4IMKC 4NQEB 1LO3L 5E6YA 3T0ED 2B7DT 3SGKA 1IARB 3AS1A 4YBLC 3OSKA 2CDGB 3L5WB 5IMMA 5IHUH 3L3GB 3NIDF 3TWCL 3O9WA 1DP0A 1BLNA 1EEQA 2HRLA 1XIWC 3CFCH 4GUPA 3WIHH 3D3VA 5E8NB 1FNEA 3WV0A 3GI8L 5D5MF 4L9LA 3B9EA 3WXWL 3SKNB 4Q9BA 1LE9A 4UQ3A 2XTLA 3JZ7A 5J1SC 1HHIA 2WBJB 3QQ3A 4X7TB 3HI1A 4OLYH 1O7VA 5EORH 1Z9LA 2SEBB 1P4BL 3STBA 3KS0H 1DEEA 5FA3B 1AHWA 2IFFH 5TE4H 4CU7A 2FLRT 1OGAE 5TDNB 4EI6A 5D71H 1OM3L 2GITB 5I0ZA 3PWVA 1ZTXL 1B3JA 2LU7A 4GMSL 1JNHB 3BPLB 2P46B 1F2XK 4RFOL 2G75B 4NQTA 4BKLA 3SE9H 4N0UB 3TBTA 3EOBA 3BH8A 3C08L 1ZGLM 5L2KB 2NCMA 5D1XD 2A9NH 4D3CL 2A6JA 2CO7B 4PRIE 3LQZB 3WUWG 2YC1B 5DJ0B 3RKPA 5DF0A 2VAAA 4OKVA 5C0BD 2ZNXA 2OZ4A 3CMOH 4D9QE 1D6VH 4NWUH 4FQIH 5DQ9A 4HJGB 1UJ3A 4EKXA 4UB0H 1MREH 1NAMH 4I48B 4J8RB 1JYVA 2NY5C 5D1QA 1U8NA 2B0SL 3A67L 2EYTB 3CC5B 4LSTH 4P9HH 3RIFK 1C5BH 4BFEA 1J8HE 5EOQL 4NP4L 4YX2H 3QEHB 1U95A 2Q8BH 4HJ0C 1MWAH 4PJAB 3HS0A 2Y5TB 3VMOA 2QTEA 4LQFH 3RDTD 2JKXA 5D93C 3WS3A 1B2WH 4JVUA 1YMMA 1E4KA 1PQZA 4YWGL 1DQLL 4Z6AT 4WNQA 5F72S 2PCPB 3X11A 1N0XL 3EDJA 5C08D 3MRNA 2P5ED 5AD0A 1JHTA 2DF3A 1XF1A 1S9XA 5DD1H 1GCFA 2VWEC 4EDWH 1ZV5A 2V17H 3PNWA 5D1XB 1G84A 1IRAY 2BSTB 3ZKSD 1X5YA 5ISZA 3BW9A 3FB7B 4AM0A 3TNMA 4XP5H 4RNRB 5C0BB 3SPVA 3TV3H 1LDPH 3CXDL 1QBLH 3WFCL 5M94B 2AK4E 2BNRD 1NKOA 3VWJA 3VXOB 1A0QL 4OBRA 3ZE0E 3TPUA 4LASH 4FZEL 1EEZB 1MNUH 3BZFB 1OCWH 5GRJL 5ESQB 2Q86B 4DUWA 5FDWA 3O0RL 3V4PL 3PWJA 5H35A 5EU6E 4G5ZH 4MD5B 3LQMA 4IMKA 4JRWA 1MFBH 2XWBB 3IDIA 1S5IL 1KCLA 4KJPD 1E28A 5KANG 3QQ4A 3G08B 3RDTB 4CL7A 5C71A 2Z9TA 1OF2A 3EOAA 1RPQA 1XCTA 1EO5A 1BQHA 2P7TA 4HUUA 1BD2D 4I3GA 1XIWA 4BQCA 4HIIA 2RCSH 1N2RA 4GXVL 5C08B 4JRYE 5J3HC 3LV3A 2P5EB 5F7MC 2ZOLA 3I50L 4X6BB 4HUVB 3EYVB 4AIZB 1MFDH 1RIVH 3VFSB 2H2SD 4Y4FC 4M43L 4N68A 2YUVA 2EDYA 3OAZH 3I6KB 4ORGB 5DRWA 3SY0B 5BS0E 1DANT 4MQ7B 4CVZA 3SDAB 1C08B 2QADD 3M8OL 4HK3J 1AC6A 4WWKC 1S9YB 2XQYK 2CD0A 4Z77A 1FZKB 2GSGB 3P0YH 5ICXB 2BNRB 3BP4A 1H8NA 3IJHB 4WFED 4IDJL 4Y1AD 4JQVC 1KTKE 5HHOA 4PGEA 4F37K 2GFBA 2R2HB 3MJ6A 5BV7C 5MP6L 3MROB 3LKNB 1YZZA 1EGJL 1NSNL 2Y23A 4XPAH 4G6JL 5IHLB 2E5EA 2VLJE 2A6KB 4JJHA 4XNZC 5J4MA 3RVXD 2GI7A 2FATH 4OGYH 5L8JB 4Y5XA 1YDPA 1I9IH 3VXUA 5EIQA 5T1DL 5JOEA 2W60B 3OB0K 1E6OH 1BD2B 2XQBH 1G9NH 1R6VA 3VG0H 4WTXA 4NNPL 4TN9A 2EDQA 3MTRA 4MB5A 1HOCA 5E00B 3UTZB 4EN3D 3HUJF 5DMGC 5HHNB 4PJDF 3FO9B 3SKMA 1T1WA 5GIRB 4DOHE 3IDMB 4J3SA 1ZGLB 4CN4A 2P4AB 4ONGH 4L8DA 2AV7A 2QADB 2X89A 1WCQA 3MUGA 1IVLA 1DQDH 1FVCA 3U0PA 4PFEA 4Y1AB 4XNUL 4Z0BL 1OY3B 3ARDD 4XCCL 4NO2B 5D7JA 5IMLA 1NGPL 3Q1SL 3C5SA 5ACLA 3K80A 2F53D 1X5FA 1WISA 3RZCD 4N5UA 2QEJA 4G6KH 2H32A 1GZQA 5DHXB 4PRHD 2EH7H 2E9BA 3NCYP 5DJZA 3JV4A 5A43C 3N1PC 3TCXA 3EGSB 3AY4C 3ESUF 5IMKB 3IKCB 2NY0C 1SYVB 4F7PB 3AROA 4HAFA 3IS0X 4KHTL 5GGSY 3MREA 1NUFA 3SDDD 4JFFA 3DIFA 4EN3B 4Z7VE 3M1BA 5CHNB 1FYTB 4LGSB 1HWHB 1LO2H 3AFLA 2YS4A 3TBWB 1K9TA 3RY6C 4Q74A 1I8MA 5C6TL 1YNTB 3ZDZF 1B4JL 4RZCA 3VXRD 4X7EC 4PJHE 1CF8H 3QDJA 1FFOB 3IDNA 4G8EB 3CZFB 5BVJB 1MHEB 1DBKH 4QRRB 4OM1L 2R2EA 2JIXD 4X7SL 3V0WL 1CYGA 3ZT5A 3RX7A 5DD6A 5DJ8A 4ELME 2XACC 4P5KB 2PXYD 4NO3B 5IW1A 1PAMA 1KCSH 4JM2D 3ARDB 5IOPA 1NCBH 4YZFE 3DGCR 1UT9A 4WDIA 2BXZA 4BK5A 1YJDH 3MCLL 1IGMH 3KHQA 4L8BB 2P1YA 4NPYB 3EO0A 4IRSD 3VU2A 2F53B 3UAJD 4HUNB 4NQVB 3GSRB 2OP4H 3GSWA 2DBLH 4NUGH 2VQ1A 3RZCB 3JWOL 1TVBB 1QO3A 4X6DB 5I66B 5FK9A 1ZS8B 4NUJA 1HHHB 4PRHB 2DMCA 1F8TH 4UOJA 5KVFL 1U8MB 4LCIH 3FAWA 4WTZG 1QA9B 4UV7H 3GMRB 4PJ5A 3QUZC 5TH2A 4OZGB 2OTWA 1EJOH 2X4TB 4PD4J 3SGEI 5KG9A 4I0KA 3EOTH 2D7MA 4MD0B 4JQVA 2B5IC 3SDDB 2RB8A 3GMQA 4KRPC 4EZMA 2ORBL 1ETZB 4HF5L 3P30L 1PW3A 3S35L 1OGAA 3FOLB 5A16B 5I1DB 4U1LA 1NBZA 1UZ8A 2EXYC 5EC2B 3VXRB 2YPKB 2ERJC 2VIRB 4K2UL 3OQ3B 4U6YA 3KLHC 2DN7A 4XCYB 5MEQB 4GAFB 1FAIH 4AEEA 3WLBB 3HE7C 2DL9A 2VL5B 1TCMA 1A9BB 2PXYB 2WINB 5KSBB 4AQOA 1A6TB 4YK4C 4JM2B 5MEND 3H7BA 3SKJH 4BSVA 1KLUB 4MX7A 1P1ZA 3T77A 3OKMB 1JF6A 1TQBC 1TVDA 4IRSB 4PJ7B 3BPOB 2WZPD 4HIXH 4ZO8A 3FJTA 2VLKD 3I2CH 4QYOA 4FFYH 5J11B 3VGBA 3VXMA 3N1GC 4XI5C 3S88L 5ILTH 3T4YA 2WV3A 4HKZA 3MACH 4WVRA 5DUMH 1PJ9A 4QTIL 2R0WL 3ULVF 2AGJL 1I1AD 1VACB 1EHLL 5DTFA 3QPXL 2VXQL 1T83C 3RUGB 1NGQH 1MJ8L 2OBGA 3MLUH 1H15A 1NCNA 1NJ9A 2A74B 3OV6A 4M6OL 4AMKH 3PG2A 4M4RA 4O58L 4LSRL 1AKJA 4R90H 5CD5D 4AT6A 1V3KA 3ARBC 3N50A 3QEUB 3T3MF 4M7JL 1WBXB 4M62L 4PGDB 3WFBH 1FL3B 2OJZL 1J86A 3EZ8A 5D6CB 4CU6A 1I3RA 1XT5A 3AY4A 3MJGX 2GJZA 3OJ2C 1ACYH 4GW1A 5T1MA 4H0HB 5DJ6B 3KPSD 1FL5A 3D0LB 4G9FA 5KTEH 4OFKA 4TOYL 3LPFA 1T66D 5MENB 1EZVY 1MCIA 4TSBL 1C12B 3MC0A 4YR6A 3BEVB 2H6PA 3UC0H 1WV7T 3U36B 3RY6A 2IALB 3ZKXB 1OAUH 2AK4A 5CINL 2KBGA 2AABL 4NN7C 3QXDA 1RULH 2VLKB 5ICYB 2ZJSL 3I02B 2WIIB 4GKSB 4OF7A 5MI0B 1BBDL 5LKNA 1JGEA 4R0LB 5LGJA 4PGBB 4S1RL 5A2LH 2P8MA 4KUZL 4QRQA 4JFQB 5JDJA 4X7CC 1MHHB 1I1AB 1L4IA 2F8OA 2VITA 2ZSVB 1OW0C 3WFHA 1KPUA 3RX5A 3JV6B 2HVKA 5EU6A 1JGLH 4BA8A 3IU4H 1ADQH 1NLBL 2IJ0C 4OB5L 3O4LB 5ALBH 5TQ2L 1U6AH 2CUIA 5ADOL 3UJTL 2P43B 2ITDB 4G42A 3ZE2F 2R23B 1KB5B 3BZEA 5J6GB 4AENA 4M6NL 4YGAB 5E5MB 5B39G 2PW2B 2HKHH 1ZA6B 3HZMB 5FGCB 4L8CB 3W81A 4K7FA 4P2QE 1FPTL 4PJGB 4WHTB 3QUZA 1A3RH 4NKOA 5M7QA 2YUXA 3P4NA 1NCWH 5A1AA 5BS0A 4POUB 4NFDA 4L8SB 2BK8A 2BSRB 4ZUSA 4NKDB 4ZUWA 4PD4K 3IKKA 3O3DA 5C07D 1MAMH 2FX8H 2LTQB 2WUBL 5HI4D 3CD4A 3O2DH 4HPOL 1YA5A 5F8RC 3H8NA 3K1KC 1MJUL 3OB8A 1PFCA 1YMHB 3HE7A 1HH6B 2VLJA 2VXVH 1QFWH 1UVQB 2IADA 4K3HA 5C0CE 3ULUL 4OF6A 4LBEB 1CE1H 5KSVA 3V8CA 1ZSDA 2X4OA 2OZ4L 5CLWA 3V6OE 4E42B 5JOPE 2D7PA 1ZHLB 3WFEL 1KCUH 3OR6A 1X6NA 4QRSB 3QYCA 2E6PA 4AH2B 4IRJA 5AWNL 4H1LH 1AR1D 3V7AG 3ISWA 1OAQL 4QO1A 4QWWD 4WY7H 2AEQL 1IGFL 4J6RL 2ID5A 2JCCF 1IAKB 4PG2A 1NANH 1WTLA 2R0ZL 2BXYA 3OAZK 5A3IC 3I6GB 2X1WL 5A40E 5J1TC 5E2VL 4TTDD 4H88H 2BY2A 3TM6A 1YC7A 4JFEE 4UINL 3KPLA 4M1CD 2W0FA 1M6OB 4O9HH 5JW4Q 3ARBA 3HAEG 4L5FL 1F6LL 2CLRA 2P48B 3RA7L 1GOFA 5C07B 3E6FA 4HLZH 4Z7WA 2NXYC 2GTWA 2GK0B 4WJ5A 4HK0B 5T3XD 4S0SD 1AD0A 2ZNWA 5TDPA 3NFNB 2CKBL 4M61A 3TA3A 5KJRL 3WMSA 4PJIB 2DIAA 1D9KA 1A1MB 4RCAA 4U1KA 1MCHA 4JFHD 1DLFH 3O6LL 4JPVH 4KRLB 3NFSH 4WI3A 3U7WH 5LCVL 4ONFL 5E9DE 2VUYA 5HHVL 4NN5B 3FB8A 3MLSL 4PLKC 4Y8AA 5E6ZA 5I0DA 5DD0H 3O11B 5FHBH 4W4OA 2C1OB 1AY1L 2XNAA 1RK0A 4Z7VA 5T3XH 2DQCH 3EHBD 3S5LA 3HRZA 1S7VB 2VB5A 4LCUA 5F71A 4YHPB 3TJEL 4FQQA 4LPUA 2FD6H 3L1OH 1EO7A 3RI5K 3EYOA 4YHNB 2W0PA 4FQCH 3WCYA 4JB9L 4PJHA 2LU4A 1J1PH 1DVFC 5I15L 3RGVD 4G6AD 1AGCA 5IB1A 1FC1A 3JTTA 2QR0B 5FO9A 5ID0B 4J3XA 4ZDHA 4QNPE 1G7JB 4ELMA 4LDOB 2I9TA 4D0DB 3BDYL 1A4KA 4YGVB 3QIWC 4JRXA 3U2SA 4TVPH 1NFDB 4TSAL 5EO0B 1GSMA 1MCWM 1PKQB 1FHGA 1D7FA 4R97B 2DQGH 3ECBB 3BKML 1UM5H 1U8HB 4KRMB 3R4DA 5ALCH 2VXUL 5IGXH 1EERB 2X5PA 2HYMA 3GSNB 4U1IB 5C0JB 4X9BA 4U3CA 1Y6MR 1VFAA 4DCQB 4AQ1B 1NGXB 2BNQE 1XZ0B 1FG2B 2WMPA 4K9EL 1NEZG 4DTGH 3MV9B 5E6ID 4FS0A 2EDBA 5GGTH 4ZQKB 1FORH 3X3FH 5DR5L 4U1SA 2LV4A 2WK2A 2DMKA 5D7LE 3WLWC 1ORQB 2FRGP 4KTEH 1RJYA 4NKIH 1JNJA 1CK0L 3ARFD 4R7DB 1G7MA 1YY9D 5I6XC 3RGVB 1DANU 4NZUH 1TJIH 5JUEL 1JRHH 2DI7A 3OZ9L 5CJBA 3U4EA 4CVXA 1QKZH 2W91A 1NGYA 4DKAA 5I30H 1FO0H 4M7KH 1ZLSH 4QOKE 2VDNH 2YEZB 3BD3A 2DI9A 5BZWA 4FTVE 2LE9A 1J05B 4ODXA 1P7QA 4K3GA 1JVKA 3U9UB 1UXWB 2X4PB 3B6SA 5ACZA 3V6OC 1M7DA 1WLHA 4OTXL 4JN2B 3B9KB 1XGRB 4ISVA 2EZ0D 3EJYC 3H0TA 3U1SH 3PGDB 4UOW1 1C5CH 5F1SA 3PIQA 3X3GL 4CMHB 2CQVA 1MJJA 2A77H 2FH8A 1FO0B 1JMXA 1E4XL 3OAYH 4D0CA 3D69A 3WD5L 5KBNC 4LCCB 5FYLE 2IF7A 2F8XC 4KMQA 3MR9A 4JZJC 2FSEA 3MLTA 4YHMH 4P4RA 3NN8B 4QHMA 1YYML 1OAXH 1IM3A 4HUMB 5DDHA 3L3OB 4JKWA 3ROLB 4UU9A 1DUYA 5CGMA 1U3ZA 1FJ1A 2OMNA 5IT2L 3NPZB 3ULVE 1KTRL 1MUJA 3DX8A 2VABB 5TE6H 3O3UN 4H8WH 2DQHH 3QCVH 2W38A 4XMLL 4GO6B 1SEBA 1MFEL 3HR5B 1UJTA 5I1IH 3HZYB 3QHTC 5E1AA 4R6UA 4PRNB 4B41A 5EBMB 1PGRB 1EFXD 1UENA 4BFIA 2KH2B 3SDCC 2PYFB 1S7WA 1XF4B 2IG2L 5HHPB 5GGSB 1IEAB 4YDVA 2P44B 3IDYC 1GXEA 4HD9A 4U31A 2PO6C 4LHUG 4NQDD 4FMFA 3TWCH 3NA9H 4MJIE 3T2QA 1TMCB 2HKFH 1QPXA 3ULSB 1FDLL 3KWWB 3KNBA 2DJUA 2DKSA 3QXAB 4KDVA 1G7QB 3QIWA 4L3CA 3GI8H 5K93A 4GRLD 2XTJE 5KN5B 1U8IA 2C3HA 3DNKA 4GJTB 3P9MA 4XBPB 3RAJL 4CADA 2F58H 4MNGE 1P4BH 1P84J 3OKNA 1HYRC 3I75A 3V5HB 4P2QA 1IAIH 1JWUA 2PYEA 3D5OF 5DXWA 3PHSA 4ZS7H 3VFPB 4PRBB 2R9HD 5HBBA 1C7SA 4OIBA 2VDML 1TIUA 3C2AH 3RL1B 3K8LA 4M48L 3V7AE 4HFUL 1K8IB 2P8PB 3TZVC 5F6IB 4RX4D 4KI5F 4RFOH 1MY7A 4OZFH 4WHCA 5FYJH 3C08H 2XA8L 2EXWC 5T1KD 1G6RL 2IQ9L 3CFBA 5KSUA 4D3CH 1Z2KA 2DYPA 32C2B 5GZNC 3T1FB 2NY4D 3FN0L 4NQDB 2DQTH 1CIDA 4ZPVA 1DBJH 3CXHJ 2Y25A 1KJ3H 2W0KA 3PWLA 1YYLL 2VLRA 1Q9KA 4K3EH 4JZNB 4LPTA 1CDCA 1G1CA 9CGTA 2CRMA 5C0CA 4PREA 4HV8B 3C8KB 1W72A 2B0SH 1KTDA 1DBBH 3ZTNL 4AZ8A 1XGQA 3B43A 4GRLB 4JDZB 4Z7OE 3QDMA 4RAVB 3V6OA 1T3FB 4KFZC 2O61B 4U1GC 4GW4A 4Z8FH 5EOQH 2J8UE 3VI4E 4LSVL 5CMAA 4ONHA 1FIEA 2DICA 4HUXB 4ACPA 3RKDD 4LHQB 5KVMC 4F58L 2HWZL 1TZIA 4Z5RB 4ZFFA 1YUHA 1X5ZA 1B90A 1E4XI 5AG9A 5E2UH 3TO2B 4ZPTB 3DX7B 5IBLD 1DQLH 3BKCL 2BHZA 1UCTA 1Y6NR 3D18B 4JANA 1N0XH 3GEWB 4JZJA 1RFDL 5D8JL 4G7VL 4PJBA 1IEBA 5DI8A 5KSAD 1IQWH 3W0WA 3TIDA 1BOYA 4BUGA 3CVIL 4JFEA 5IHZB 4MA3B 4Y5VB 3VD7A 1DBML 5FKAB 4U6HA 4U6XA 5T1KB 1P6FA 3MQIA 5IW6B 1LILA 1WZMA 3LEXA 1WCBB 1J9CT 3NIGF 2AJ3B 4R4FL 1HN1A 3SJVE 5L6YH 3MJ8B 3VXQA 1A0QH 1G7PA 3NZHL 5JQ6L 2NY2D 4X8XA 3T3PF 5D7IE 5GRJH 1AGDA 4IJ3B 2MFNA 3J7HA 5E9DA 1X4YA 4LF3B 4LVOC 2AJSL 5JO5B 3VFNB 1GGIL 1KPVB 2X44D 1G7IB 3O6ML 3OKLA 1CT8B 3QFDB 1I1FB 2JB6A 2PO6A 4FQJL 4APQD 1NPUA 4PYHA 1HEZB 1T03H 4WTZA 4JHAH 3U30C 4O02L 3LAFA 4JLRA 3F58H 3W5NA 2YUZA 5DVNA 4S10A 4HUWB 3IT8D 2D7NA 3QWQB 2BOCA 2FIRT 1S8DA 2DQUL 4GXVH 5SWSA 4H26B 4XWGL 4IRZH 5KSAB 3I50H 1WAAF 4G80B 3BAEH 1JZ8A 5CGTA 4PV8B 5E5UB 1HQ4A 4KK5C 3HC4L 4M43H 1FL6A 3BH9A 5F7DA 1BEYH 1A14L 2FR4A 2UYLA 2Z93A 4YNYB 3M8OH 5IVZB 2UWEA 4KMLB 2IPUK 4LLQA 2XTJC 3O6FD 1KJVA 2OTUA 3RNQB 5SX4I 3CK0L 4YHYB 4OSUH 3MPCA 4XXDB 5ERWA 2X4RB 3P4OA 3PDGA 4RGMB 5HYJE 4IDJH 5DMKB 3BZ4A 5DGQA 1J0KA 1P84K 2HTKD 2NY2B 4NZJA 3P0GB 2G5BA 2GT9A 1BQSA 4S1QH 3K2UH 4HC1A 1EGJH 3IDGA 2FJHA 2Z8RA 4R2GC 5TPWL 3WYRA 2HFEA 5D5MB 4DW2L 2YD7A 3AUVA 3IFOB 3IXTA 4JFXA 1MOEA 3EFDL 4APQB 4KWUA 5T1DH 43C9B 1OTSC 3NAAL 4M9OA 1G1YA 5I8EA 3NACL 2GCYA 5JA9A 1QSEE 2YA1A 1DL7L 2KDGA 3PQYE 1GL4B 4NNPH 4NYLA 2OMBA 1X5IA 1K4DA 1T80A 3LKRB 5D2LE 4HW6A 1SVCP 3LVEA 4PRPE 4NBXB 1UFUA 2R69L 1JJUA 2HJFA 3GSQB 5DQJA 3CXHK 1OWRM 1ZHNA 4KJYA 4QOKA 5I8OL 4JPWL 3VD4A 1JN6A 2K9UA 2FYYB 1P4IH 4FTVA 1ZVHA 4P5TC 5EO9B 4XBGA 4M5ZH 3O6FB 5LAXB 5DRZA 1Q72L 5EZLB 5HHQB 3CJJA 2D03L 5C0ND 4NDMA 4JZOB 2L7UA 2L7JA 4XCCH 3UBXG 4Z78B 4U6VH 8FABA 2BMKB 3DSNA 1NGPH 1T20A 4XCEB 4KROD 2CDFB 3NPSB 5IIEB 2AJXL 2C3VA 1RK1B 3O8XA 4PV9A 3EO9L 4P2RA 5EZIL 2P24B 1G9ML 5HYSB 3PWNA 3DWTA 3RY4A 3VFWA 1CIUA 4B7IA 4TTGA 3DV4B 4MXWL 4CW1A 4PJXB 4WGWB 4E41E 5IV2A 4KHTH 2QSTA 2ZKHH 5B4MD 5FM5O 4LARL 1CFTA 1M05B 1CFVH 3HTLX 3BGMA 2HLAB 5E99L 3OKKB 4U05A 3MCKB 3HZKB 2NX5D 2W9EL 4LLUA 7FABH 4Q9RL 1MRDH 2X7LA 4MXVF 1P4LA 5C6TH 2ITCB 4JPKL 1UEMA 3LN9A 2DIBA 3NGBB 1B4JH 1EMTH 4G8FB 4U2ZA 2H3NA 3KYKH 3I6LE 3BSZH 4JFPA 4G8IA 4PRDA 4X4XA 5HDBF 3TO4D 1DQTA 1T7VA 4LCWD 3TNNB 3MUHL 2VOTA 3B2VL 2AK1L 3DX9A 4JKMA 1OLZA 1W0WB 4Y16D 3V0WH 3QCTL 5ANME 4ZXBD 4YDJA 3X14A 4V2CB 1TZHB 3TN0A 4JGUA 2NXZD 2CLVA 1AGEB 2QQKH 4R26L 1R5IB 2NLJB 1JPFB 5BMFH 4G9DB 3MCLH 5TQ0L 4KROB 3FFDB 3EIFA 2NY1B 2GJJA 3KPRA 5EBWB 1MHPH 3DROA 1FZOB 4GAYA 2AP2A 1J7VR 4HZLB 5J13C 5JXAL 3W2DL 4KK9C 3AREC 1U8OA 2EKJA 2CK0L 5GQBA 1CGUA 4HK3N 15C8H 3RFZC 3E1F1 1YN6A 1S7XA 4JQIH 1CZ8L 5EU5B 2NX5B 1I4FA 2W65A 2NTFB 5J0BA 2ORBH 1ULVA 2GYSA 4ERSL 4HLJA 4KPHL 2R4RL 3S35H 5DVKA 4L3EA 3W9EA 1PX4A 4K2UH 3TO4B 5IB5A 4LCWB 1BOGA 2BOBA 5D9SA 4Y16B 1FE8L 2B1AL 4XVJL 2ZUXA 3DVGB 1HZHL 2NXZB 4P2OC 1I8KB 4YIQB 2ADIA 1KLFA 3QXUA 4LEOB 2H26A 4XZUB 5DEZA 3H7LA 4XWOD 1EZVX 5HGAB 4WEBL 1GZPB 4DAGL 4MNQE 3RNKB 1A6WL 3QP3A 1F45A 1KCVL 4MA7H 2HH0H 5CEYA 3RVTD 1FFRA 1EHNA 3S88H 2LQRA 2Y36L 2EEBA 4DEPB 4TUOB 4QTIH 2R0WH 1AXSB 2AEIT 3BPNB 3VFTA 1EHLH 3IFLL 4TNVF 1HH9A 2VXQH 1MJ8H 4KHXH 3UTTD 5H2BA 3HPLA 4LLWA 3ETBF 4O58H 3TT3L 5K9QG 1KTLB 1A7RL 1LK2B 4DN4H 2D9CA 5JW4N 3M17A 1DQJB 1CDGA 3VW3H 1CXKA 3KDMB 3RZWA 4JFDD 1EO8H 4PJDB 3UTPD 2X4NB 4CN1A 2UZIL 1EAPA 4M7LL 3QEGH 2OJZH 4JE4B 2E3VA 1T21A 3E8UH 4HBCL 5I9QB 1LMKA 3I3DA 5DJCA 5ETUB 1OAKL 1K2DB 2FIKB 5JPMA 2EH8L 1A7BA 4WO4A 1GRWA 1PYWB 1ZA3B 1KJMA 4GKOA 4TOYH 1JF5A 3HI6H 2UZYB 4RIRB 4TSBH 4K07A 3KXFE 1KNOA 2BSSB 4XMKL 3QG6A 1ZANL 3GJEA 5L2JB 3O9WD 4FNLL 3WIFB 1XF3A 5CINH 1K6QH 3D3VD 1MCPH 1KGCE 1C8PA 2XOTA 4MCYB 1T04A 3L3JB 3U46B 1NAKL 2R29L 4PUBL 5FXCH 4HPYL 4KUZH 4E5XA 3C5JB 5D7IA 1YPZF 1FZMA 2FH6A 3DURB 2I26N 3ILQC 4NRZA 1MCDA 3TT1L 1IL1A 3UTTB 5ITFA 2EDWA 5GS1B 3MGOB 1JZ6A 2PUQT 4QRPE 4U1JA 1MF2L 4Y0GA 5F93C 3U0WL 4M03A 2EDOA 2BZDA 2FO4B 2H8PA 3T0AA 1Q1JH 1Y6KR 4GAGL 5DZLA 1AO7E 5C0GB 3RIFF 1NEZA 2YKLL 4JDTL 4JFDB 3MRFA 4PTUB 5FM5M 2DKMA 2EKSA 3PP3K 3EZJB 4N0YL 2UWEF 3VMPA 4K94C 1CXLA 1P2CA 4W68A 3ULUD 1XEDA 2BC4A 2NR6D 5FEBA 1BQLL 1XMWA 4OZHF 1HI6A 5IMMB 4Y5YC 1IGYB 3UROR 3O9WB 3BYYA 1BLNB 1SVZA 3MFFA 4GUPB 3D3VB 5T5FL 5HYJA 2BY1A 2WUBH 5E4IA 4HS8H 5D1QD 3EDEA 1JYXA 5GS0H 4L9LB 1RJZA 4O2FA 3G04B 4NNYA 1JTTA 1LE9B 4LLDA 3QQ3B 3HI1B 4CDHA 5HD8C 4U7SA 4P2OA 1MJ7H 4N90D 3WDHA 2I27N 3ULUH 5I71B 4A6YA 3FTGA 1DEEB 4GSDL 4Y19D 4HULB 5BVPL 2ZG3A 1NAMA 1YMMD 1KC5L 1BBJB 2DWDA 3WFEH 3PWVB 4HAGA 2VNCA 1QSEA 3T1WA 3PQYA 2Z92A 1EA9C 4X9HA 3MLYH 1OAQH 1CLOL 1QLFB 2AEQH 3RIAK 1DLHA 1BGXL 1MWAA 2DQJL 2Y06L 4PJEA 4BKLB 3BH8B 4ETYA 1L9NA 2EDDA 5IKCB 2A6JB 2GK2A 3V0VA 1BM3H 5ISZD 1XH3B 1T7WA 3LQAL 3VFGH 2VC2L 3AVEA 2NW2A 4G6MH 1T1ZA 1DE4A 2VAAB 4OKVB 2OSLA 3KPOA 3ZDXE 5DQ9B 3RA7H 1UJ3B 4GMTL 3GMOA 4G6FD 5HXMA 1Z5LA 5D1QB 2FHBA 5IJVA 5F1KC 3ALXA 5KJRH 5CZXD 1Z6JT 3TFKC 4C56D 4GKNB 4OCXL 1Y0LA 3V4UL 2D7OA 3HMXA 4PJ8D 1IC5L 2JK5A 3AXLA 3SO5A 4RFNB 3S4SB 3SO3B 4OZIA 4Y19B 5F9OH 2C26A 4FQ2L 5LCVH 1JZ5A 4F37F 3WHXA 1A7NH 3WS3B 1YMMB 1PQZB 3ES6A 4PLJD 4WNQB 3B83A 3LHPL 2QHLA 1CLCA 1F3JA 4F15C 3MJ7A 3X11B 3WE6A 3V52L 1GJIA 2DTSA 4QKXB 1WJ3A 4UQ2A 4LL9A 4XAWH 5ECJE 4PY7A 2WP3T 2CKBB 4J12A 12E8L 3S35X 2BJML 3PNWB 5AAMA 4KK6C 3GMPA 5DK2A 3VGAB 2YN5A 2EIZB 4L29B 4JB9H 4HXAH 3OPZL 3V5KA 3S98A 1K4CA 1GGYA 5ESAA 4OFPA 3TNMB 1S7QB 3SPVB 3TBVA 3B5HA 1NC4D 4H25B 3FQUA 1F97A 2X40A 3BDYH 4QXGH 1MI5E 5HHOD 4XB7A 4JY4A 3TPUB 3MRCA 4J3UA 1L0QA 4AEHL 5FDWB 4TYUA 1HXYA 1SHMA 2BY0A 3PWJB 35C8H 4NRYB 5FYKU 4C56B 1CG9A 5DO2D 4PG9B 5I1KL 1S7UA 1T1XA 5E7FA 3BKMH 4P3CH 4PJ8B 4BH7A 2XPGB 3QEQA 2G2RA 1MQKH 5F9AC 3O3BA 3QQ4B 3C87A 2ZPKL 1LEIB 4TUKH 5D2NE 3V6ZA 4WI8A 5I16B 4HUUB 2X1PA 2XQYG 3JBG7 4HIIB 3S96B 5KVGL 4WFGE 4ODUB 3REVA 3G9VA 4LGRB 3BMWA 5C0RL 1O0VA 2BVQB 1EV2E 1NCAL 4UAOC 4HC1L 4F33B 3IAQA 3IVKA 1JGUL 2R4SH 3P4MB 3BT2H 4QXUL 1RZIA 5JPNB 4EEEA 5CZKA 4BZ2L 1IGTB 1S5HA 1WC7B 4M3JA 4W6WB 5DRWB 4AK1A 5DA0B 3FMGH 5FOBB 5DQDH 3G5YA 2X89D 4LOUC 5JUEH 1OWWA 3OZ9H 1NC4B 3MJ9A 3HI5L 4CAGA 3WNKA 3BP4B 4MHHI 1H3UA 3BIKA 4X4MA 4RGNC 2YPLE 5HHOB 2NY5H 4XT1C 4PGEB 1U93A 5D7JD 4MNQA 3GK8L 5KZCD 4LSQL 2DTML 1GAFH 3RPKA 5K59F 4Y5XB 3STZA 3MV11 3MO1A 5HYFA 1U8QB 5DWUL 3DMMC 5F3BB 3DJ9A 4OI9A 5C86A 3X3GH 5CJ5A 4LK4A 4Q2ZA 5F7EH 4IIQC 4MSWA 5C09A 1E4XH 1XR9A 3WD5H 2B4CC 1A1OA 1QBML 4GRWE 1YNKL 4LFHD 3C9NA 4JFFD 5HDQL 4X8JB 3SKMB 1T1WB 5B22A 2DQFA 1RZGA 3CX2A 3MLWL 4P3WA 1OPGH 3MYJA 2H32H 5FYLL 5IBUG 1KF9B 5IFJA 4L1HA 4RA0C 2JCCB 3FRPG 1RUKL 3VXTB 4L8DB 2AV7B 4ODBD 5CKGA 3QBTB 5A2IH 3PP4L 2Y07L 5JR1L 3U0PB 5K9KB 1OSPH 2Y5EA 3VXPB 1AC0A 1FN4A 1K8DA 5ITBH 2N1KA 2R1WA 3HHRB 1BFOA 4HH8A 4ZD3L 1YEEL 5D7JB 1Z9SA 4OZ4A 3KXFA 2B1HL 3C5SB 1NEUA 1TTFA 4ODTL 2GJ6E 3ZHDA 1PG7W 5F1IB 1D3CA 4NNXB 4EUPB 2DAVA 4O5LH 3G5VB 5I17A 4MZ3A 4QCIB 3QUKA 3QJHA 4LIQE 1F4YL 5DJZB 3JV4B 4ZSOE 1IJ9A 4PJ5D 1XGUA 4QHUA 4JG1L 4NJAH 3WN5C 1VFOA 2MPAL 1U2HA 3LKOB 1E27A 4OBSA 3MNWB 2MCG1 1FNGA 1RD6A 1HWGB 4P5MB 2VLLA 5CP7A 2AXJA 4WFHE 5F9WC 3FFCD 1I8MB 1UM6L 2B2XL 4OGXH 3BIBX 5EUKA 1KEGL 3DRQA 3UZEA 4RZCB 3MRHA 5C0AE 4Y8DC 1AR2A 5D7SH 3IDNB 5IVXE 4KU1A 2R2EB 3ZZ1A 2EE3A 3WKNA 2JJTC 4WUUE 5LJYH 4IS6A 5DJ8B 3O2WL 4FQPA 5IW1B 1TLKA 3IF1B 3BD4A 5IOPB 3C6SB 1T6VN 4M48H 1YEGH 4HFUH 5BV7H 1NGZB 3MGTA 4JAMB 4XPHH 2X1XR 3GSWB 4NSKA 2VQ1B 4IOIA 2XRAH 1INDL 2IQ9H 5FK9B 4YDKL 1R0AL 2ENYA 1JI1A 3VXMD 1XGYL 1INEL 5IEHB 2CJUL 4PJ5B 3X12A 1RSFA 2HFTA 2WNGA 1MIMH 1FNLA 3CH1A 1YYLH 4LEXL 4XCNA 3H9HB 4PP2B 3NCYS 4HJJL 2QQLL 2E27H 4PB9L 1GC1C 3K0WA 5DD5H 3JTSB 2IAND 3GMQB 5EOCJ 4X6CE 2ICEA 3HCVA 2ED9A 4KTYA 3FFCB 1MCQA 1AJ7H 1S7TA 3FT3B 1D5IH 4C83B 1G6RB 4PJEF 2Q7YB 1A6ZA 4U6YB 5FM4A 4EDXA 3DMMA 2V5TA 2VDLH 1UQSA 1CDHA 1Y18A 4MDJA 4OQ1A 4UZGA 5GJSL 5HVHC 4G9FD 4KK8D 3BKCH 3FRUA 2JB5L 2AV1A 3SGJC 4BSVB 2P5WE 4MX7B 1P1ZB 1QFUL 2DB8A 2PF6A 1RFDH 3FQTA 4G7VH 5JLZA 2NMSA 3L5XH 1F00I 3CVIH 1HSAA 4KAQL 1KJ2H 1X3DA 4WW2F 1OP3H 1ORSA 1PY4A 5F7NC 3VXMB 4P3DB 4OJFL 3T4YB 2HT3D 4HKZB 4O4YH 4GLRI 5KS9A 3LZFL 1WICA 1UXSB 4CUCA 4UUJA 1IT9H 4GG6F 4U1NA 5DTFB 4XNQA 4OZIF 4JVWA 2D7TH 3OHXB 4R4FH 1ZLWH 5EFIA 4JO1H 1AE6H 3TCLB 4O2CB 1H15B 4JFOA 2IANB 2HTLD 2VR5A 4CGTA 2DD8H 1DEDA 4KV5F 2DQEL 3VXSD 4B7LA 3DXAE 4OIIH 4KVNL 3C09C 4MA8H 1FNFA 3HE6C 1LO4L 4JKKA 2NTSP 2AJSH 3CFEA 1GGIH 4L4VE 3IFNL 1VSCA 1XGPA 4IBLT 2NYYC 4QY8A 3O6MH 4Z76B 4RRPA 4NQCE 5I76A 1MVFA 4FQJH 1U8LA 5CEZL 1NMCB 1EIBA 1KELL 2GJZB 4GW1B 4TULL 4O02H 1P9MC 3C60A 3QUZD 4AYFA 3TH2T 5F97E 1ADQA 1FL5B 3O41A 1LP9E 4G9FB 4YR6B 3TPKA 2DQUH 2N4IA 2BDNH 4YPJA 3VH8B 3CFCL 4KRPD 3WIHL 4I77H 4XWGH 4I2XB 1UWXK 1MFNA 1JK8B 1C1EH 1YY8A 3QXDB 3BUYB 3CVHA 3HC4H 3PDOA 3C6LC 3K4ZA 2MQ0A 1S78D 3JUYA 4KI5D 1A14H 4Z7UF 3MRLB 2EDXA 3L5HA 4D8PB 1XCQA 3BJLA 3VRIA 1ZT4B 4OLYL 2CGRL 2P8MB 4QRQB 3HLAA 2JJTA 5EORL 1MCWW 3RQ3A 1P7HL 2VITB 4C59B 3HE7D 3WFHB 1KPUB 1F2QA 4FABH 4PP1C 1TQCC 5EUOE 5TE4L 3BWAB 1NC2D 3LSOB 4DGYL 5D71L 3IETB 4QF1A 4U1HA 5E5RB 3VXSB 2AJVH 4OGZA 4G42B 3BZEB 4XNXL 5TPWH 4AENB 4CMMA 4IRJD 2R0LH 3VWKA 4DW2H 3LN4A 1KLGA 4DKDC 3EFDH 1UB6A 5C0FA 1H0DB 3OGCB 3ELAT 3QUZB 3TBSB 5LGKA 1DUZA 3BHBA 3NACH 2WP3O 5EBGA 4NWTH 3UTSD 3N1MC 1X5HA 2CXKA 2OR8A 3CMOL 3V9FA 1NUDA 3JVGC 4JO3H 4UDUA 1D6VL 2EECA 4NWUL 5L0QC 4FQIL 2IGFH 3OF6A 5JXED 4UB0L 1NAML 1BHGA 1JPGB 3TBYA 3ZKNC 4J2XA 1WEJH 2R69H 4ZUSB 4ZUWB 2CLZA 5I8OH 4JPWH 4LVNB 4NBYB 2FGZA 4P9HL 1C5BL 3RI5F 1FCGA 3H9SE 4YX2L 1CFBA 4M1GH 3RWJA 4BELD 5E24E 2BVTA 1RIUL 2CPCA 3TA3D 1FH5L 1MWAL 1Q72H 4ESKA 5DEFA 5SWZE 5LQBH 3P2TA 1D9KD 4UI2A 3P9WB 2IADB 5LG1A 4KXZH 5GJTH 3BVNB 4UNUA 3VMNA 1VDGA 3SGJA 3BQUC 1NC2B 1B2WL 1QRKA 2AXFA 3PGFL 1MCRA 2ILLA 4P48A 4I9WE 3QNYA 1BX2A 5B3JF 5JQHC 5DA4A 1W0VA 4NZTL 5F1NA 5D70H 3OR6B 4IRJB 4MAYC 2A0LC 1YEJH 4YPGB 1UM4H 1G9MH 5DD1L 2AQ2A 2QSCL 4EDWL 2X09A 2V17L 1CXHA 4MXWH 4KGLA 2Y72A 2V9RA 3DVIA 4M1DL 3HMXL 3UTSB 3DYOA 4LARH 4GRMA 4N8VA 4XP5L 5C9JA 3OX8A 3TV3L 1QBLL 1M4KA 3WSQH 4P59H 3GRWA 1EDQA 5J9PA 2W9EH 2Y7QA 2BRRL 1HQRA 2W0FB 5GS2H 4LASL 3HE6A 3QDHA 3E6FB 1MNUL 3BX7C 3KAAA 1OCWL 4WEUD 1BVZA 4NJ9H 3DV6A 4Z7WB 4P23C 2GTWB 4JRXD 5IF0A 4N0FA 2APTA 4WJ5B 3QUXA 1IE5A 4GG8A 2AXGA 5MEPA 1AD0B 4GQ9L 4P46C 4G5ZL 4WU7A 3TA3B 2GJ6A 4OZGF 1ZLUH 1P9MA 1MFBL 2J5LB 1D9KB 4ZO7A 3UYRL 4NQEE 2ICWA 1B4RA 5CZVH 5FYKL 2MQ3A 4QXTA 1DZBA 5IQ9B 5HHMD 4L4TB 5ACMA 3ZYIA 2RCSL 5CUSL 1LEKA 4XHQA 5FGRA 3AB0B 2G9HA 2IH1A 3FB8B 5LXGL 3EYUL 3AAZA 3MX0A 3NCEB 3ALPA 1A6UH 3C6LA 5KW9L 3PGCB 1F5WA 2ATKA 1QFHA 3W2DH 3S5LB 4WFFD 5I1EL 4LCUB 1QFPA 4NCDA 4FQQB 4LNVA 4ZNEE 4X99A 3EYOB 3DX6A 4LPCA 2XG4A 2Z35B 4JDVB 4XVUD 3FQRB 3LDBB 4OLVH 4HCRH 1CZ8H 3P0YL 2X41A 5IB1B 5IVXA 3JTTB 3Q6FA 5GSRB 3CSPA 1L7TL 2H2PD 4WUUA 3JV5A 1NDMB 5GGTA 5CIPB 1EEYB 3UMTA 3ZTJG 3LEYH 3MV01 4QHLA 4MQTB 4ZUTA 4MJ6A 1QRNB 1VGEH 4FQXB 4XPAL 3ARUA 4JRXB 1PVHA 1P7QD 2IAMD 2OK0L 5CD3A 3BRDA 5CSZB 1FE8H 2FATL 2B1AH 4OGYL 4NIKB 1RHHA 4TUJA 3QFJA 4N0UE 2GUOA 2NY6C 1HZHH 1I9IL 1YEDA 4X0KB 5L2KE 3VD5A 4XHJC 2YRZA 5B8CC 1RZJC 2LVCA 1TDQA 4OFYA 3MBEC 2X4UA 3UO1H 5I1CH 1E6OL 1DCLA 3VFUB 5TF1L 1WFUA 2E6JA 2XQBL 5HHMB 1BF2A 2PTUA 3FZUC 2YD1A 1F58H 4IHOA 1QTYT 1OT1A 5F44A 2FDBP 2DQIH 5E8PA 1RQ5A 2NXYD 1PZUB 3BD5A 3HNSH 2Y36H 2F74A 5FECB 5I75B 1FGNH 3IGAA 1MCLA 3V4VL 2VMFA 3QHZH 4PJAE 1BVKA 2YA0A 1NFIB 3UJJL 3BOVA 3LRSB 1G7MB 1DQDL 3BQUA 1NUNB 3RTQD 1BJ1J 5F6HI 3C8HA 1OGTA 3TT3H 3U4EB 4CVXB 4P49A 1HIMH 1NGYB 2VH5H 4HH9A 4ZAKA 3PL6C 3UP1A 3Q3GA 3MV7D 4PLKD 4MAYA 3CGTA 4OCSH 2J8OA 1T5XA 1I7ZA 1P7QB 2IAMB 2P5WA 3BGFC 3GIVA 3B6SB 4I5BB 5SV3A 4HBCH 1M7DB 3I3EA 1OAKH 4S0TD 2EH8H 5KS9F 2EH7L 3MUZ1 1OT2A 4Y2DA 1LE5A 4ZFZA 4X9IA 1TTGA 2MOVA 1HE7A 2JJSC 1A9EA 4Y4HD 1XAUA 1LNUA 4DWHA 3HPJA 1H5BC 5C0BE 4XMKH 1ZHBA 4YE4H 3FN9A 3D69B 3WO4C 2HT2C 5KVEL 1ZVYA 3IJSA 4Y4KD 2NZIA 3CDCA 2VO5A 3MR9B 4U3XA 2NXYB 4ZUVA 3F12B 2KZ1B 5JDSB 4PUBH 5CBAA 1WBZB 4NFCA 4P46A 2AJUH 4P4RB 2VN7A 3DXAA 3GB7A 2HA1A 3MUY1 3CFKA 5DDHB 1DBKL 3HRPA 2N56A 1A1NA 4WI7A 4L4VA 1CGSL 3BEWB 5D6DC 5D1ZD 4MB3A 3RTQB 4XP6H 1FJ1B 4P2QD 2PYED 1KCSL 3DYMA 1MUJB 1MCEA 1NCBL 1N5AA 3MV7B 4GAGH 1IGCH 5JHDA 1H9VA 1YJDL 1LP9A 2YKLH 3OKYA 2GAZB 4NHCH 5C08E 1GOHA 4ENEC 1JZ7A 1PY9A 2P5EE 2OP4L 1F11B 2DBLL 1I3UA 1PDKA 2AI0H 4KV5E 4NUGL 1MRFL 5JW4R 4BFIB 1GGCH 1IKNA 2X1OA 5JW5A 5H37G 3F62A 3FO2A 4LCIL 4NOBA 3KPTA 5C7XH 4UV7L 2DYPD 2FL5A 4Y4HB 3GMMB 4NM4L 3RVVC 5IM7A 1EJOL 1XGTB 3DO3A 4DKEH 1NBYA 2JE8A 5DD3H 1F3DH 5CJXC 2BNRE 1AD9A 5IB2B 2WBJC 1NCCL 1CGVA 1J0YA 2VLRD 3ZLQC 1JCKA 2ARJA 3S34H 5C0CD 3QWOA 4Y4KB 3KNBB 3SQOH 3MRRA 3NZ8A 1JIBA 3QDMD 5DGRA 1U8IB 2EYRA 3P9MB 4XPBL 5CAYB 4CADB 5AYUL 5B8CA 3EJYD 1FAIL 2IBBA 3OKNB 5D1ZB 3MBEA 1YQVL 4Y7MA 1H3PL 1Q0YH 3BPLC 4BH8A 2XN9A 4O51A 1JWUB 2PYEB 2E9JA 4RQQA 2C3XA 1KC5H 1BD2E 3VFMA 3LD8B 3DTXA 3DO7A 3CLEH 5INCB 4G43A 3TVMD 1N5YL 3TIEB 4OLWH 1W72H 2KPNA 2F54D 1QQDA 1UA6H 4HIXL 4LU5L 3ILPA 3W0WD 1AP2B 2IQAB 5L8LB 4JFED 3I2CL 4RAUA 5EC1A 1BGXH 3T4AB 2KQNA 2Y06H 4UIMA 2VISB 4TPRH 3MACL 3CFBB 5IFAL 2VDKL 4QHKI 2MKLC 4JCMA 2DYPB 5GGUB 3VGDA 3QO0A 4MDIA 2VC2H 4U3HA 3H9SA 4HG4J 3OGOE 1QZ1A 3MLUL 3MZGB 3PL6A 5E95B 3RL2B 4Y1AE 3IJYB 2VLRB 1Q9KB 3KYOA 5TDOA 4CU8A 4GMTH 5F9JB 3PABB 1ZLVH 4PREB 4MVBD 1E4JA 4YBHA 3IRPX 1DQMH 4S1DD 4F7CA 4F57H 3QDMB 4BSWB 4PTTA 3VXNA 3P73A 3THMH 1D5XA 4GW4B 5E2TH 3VJ6B 3V4UH 5F88A 2XFXB 4XAKE 3MRIB 4ONHB 3OR7A 2PO6D 5GRYA 5E08H 4ZFFB 1H5BA 1YEFL 3MRPA 3FOMA 4OAWA 1WBYB 5DK0A 1J0IA 1F90L 5D1XC 3TVMB 2MNUA 3LHPH 5F7LB 5T5NF 1U3HA 3KYNA 4M02A 3RWEB 1FYTE 2A73B 5SWSD 43CAA 2F54B 4PJBB 5DI8B 4XTRC 5B3JE 3W0WB 1RULL 3TIDB 3U82B 2UY7A 12E8H 4FFWD 3QAZB 4YHKL 4YXLH 5F7WC 3RWIA 4UDTB 1UZ6F 2FX9H 5D6DA 1EVUA 4QRRE 3L9RB 3CUPA 3LEXB 4ODVH 1TPXB 1ADQL 1Q9OA 3WDJA 5ALBL 4ODSH 3QULB 2IPKA 4HX1B 2AQ1A 4NQEA 3VXQB 4NKMB 2CDGA 4UNVA 1DR9A 3E2HC 4AEHH 1N6QH 1AGDB 2F53E 3L3GA 3Q5TA 2HKHL 3F7VB 5I1KH 1VADA 4X6DE 2JJVA 3CVHL 5E8NA 4PJFF 4CBPA 4PRHE 3AMKA 3G6JF 3OKLB 4FXKA 1M7XA 2JB6B 3VCLA 2PO6B 1A3RL 1YPZB 1MRCH 3SKNA 4M3KB 2IBZY 4OZGE 3FHAA 1CGTA 3G5ZA 1NCWL 2IPUG 2WBJA 4X7TA 2NNAB 2W9DH 5IVNA 5KVGH 2BOCB 3MLZH 3SDAC 4KGJA 3TGXA 5SWSB 1ZKAA 5FO7A 1NCAH 4URTB 3SDXA 1NLDH 5TDNA 1FLTX 4NC1E 2ZCLH 2GITA 3PWPA 3VXRE 4QXUH 3BRGC 1HQ4B 1CD0A 1FVDB 1FL6B 1WFNA 1KPRA 4RGOH 5F7DB 3F5WB 1TETL 5CEXA 2UWEB 1DQQA 2WWKO 4LLQB 1QFWL 1KJVB 1JBJA 1CE1L 3HI5H 1I8LA 5ERWB 3CFDA 5KSBE 5L2KA 5FGBC 4OZHB 3A6BL 1DDHB 3WJLA 3QA3A 1RZ8A 4RSVA 2RIKA 3LQZA 5FUZL 2YC1A 1U8JA 1KCUL 5DJ0A 3V6BR 4S2SB 4PJ7E 5IR1B 2OS7A 2FJHB 3O8XD 2HFEB 4P2RD 4WY7L 5E8DH 4I48A 1DN0B 5FYLD 1VPOL 2H41A 1U42A 1X5JA 3FKUS 1JYNA 2APXA 5I8EB 3RUGE 1SY6A 2C4XA 3JSSA 3QEHA 3NIFF 1BPVA 1QR4A 1YNKH 4X5WB 3GSOA 4PJAA 5E2JA 4O9HL 2QADC 3GBMH 4Z7QE 3MA9H 2HJFB 4NRXB 4HG4K 4E0RB 5DQJB 4U1GB 1G9NC 1ZHNB 4KJYB 3MLWH 1JN6B 1I1YB 5FYLH 2ZUYA 3RU8L 3KPQB 3GZKA 4XBGB 1DLFL 4GLRH 4JPVL 3PP4H 2Y07H 3NFSL 5JR1H 3TN0D 5IB3A 5C70A 4NDMB 3HNTH 3RVXC 5J56B 2FHCA 4PJ9D 4HFWB 5MENE 3C8DA 2BSTA 1OTUD 4ZD3H 3T8XB 1YEEH 2CIKA 3GRWL 1I8IA 2QQNL 1FFPA 4MCZB 1T20B 1BWWA 2XG5A 5C0BA 5DD0L 1HYSD 1MELA 3KPRD 4YDLB 3O8XB 4PV9B 1OARH 2VLKE 4KK5D 1IM9D 2DQCL 4P2RB 5F1OB 3VXOA 2X10A 4EN3C 4U33A 5M95B 3VFWB 2FD6L 1I9RL 3BZFA 3L5IA 2AJYL 4FQCL 2L4OA 2YD2A 1K85A 2R1YA 1J1PL 2XKSA 1CFTB 3BZDA 4MD5A 3BGMB 3O4LE 2XWBA 4EIZC 5FIEA 3CU1A 2NW3B 3K4AA 5K9JH 2XZCH 3G08A 2X7LB 3EJZD 1V3MA 1KEGH 3SKOA 2DM3A 2V2TB 4L3ED 5HY9A 4X4XB 2H3NB 3ARDC 2OJEA 3KG5A 4JFPB 1JTOA 4TVPL 5FGCE 4KKCD 3OXSB 3D39A 5C08A 4PJGE 3DX9B 4FFVD 4PYGA 2VSCA 3ZDYF 3ZHLA 2PW1B 2DQGL 3X14B 1UM5L 2JELL 4HUVA 5IGXL 3BPCA 3TN0B 4AIZA 3RZCC 2CLVB 4Q58C 2NZ9D 5A2JH 4PJ9B 3B5GA 3SY0A 5DUBB 4HIEB 3SDAA 4EOWH 4WI4A 5BJTA 2W07A 4XMPL 2LABA 1AIFB 1FRGH 3ZYZA 4DTGL 1RMFL 1S9YA 5CSBA 5HGBB 3KPRB 5GGTL 2C5DC 5IG7B 2BNRA 3IJHA 4RMRA 1TFHA 1IM9B 1KG0A 4HMCA 5ENWA 1L9MA 3SDDC 5MERA 4GAYB 5JW4M 4YHZH 1INEH 1QFWI 2YWYA 1U8OB 3VRLE 1CL7H 3LKNA 1LK3H 2WAHA 4JGMA 5EDXA 5F8QC 1HKLH 1Z0MA 4NC1C 3U0TB 2A6KA 1MIEH 4NZUL 5FGBA 1JRHL 4P4KA 3OJVC 1YN6B 3FO1A 4M7KL 1ZLSL 4H20H 1I4FB 2W65B 1WZKA 1L6ZA 5LGHL 2IH3A 3SBWC 3E0GA 2W60A 5IBUB 3SE8L 4RMSA 1BD2A 2PXYC 3MMEA 4L3EB 1NGWB 4JM2C 1NANI 4KVCL 5CWSA 4B0MM 6FABH 2YRLA 5D9SB 4HWEL 5E00A 3SN6N 5HHNA 3FO9A 1A21A 5GJSH 3BPOC 5GIRA 3VDCA 3IDMA 3U1SL 4WO4D 1RZKC 2D9QB 2K1MA 4ZOCA 3ZYOA 3VGEA 4CJ0A 4UT9H 1D5BA 1R3HB 1ZGLA 1X5GA 3A6OA 3ZSSA 2A77L 4NN6B 5IB4B 2UV3A 4R4NC 2J1KA 4QGTA 1KBGH 1KEMH 4BQ6A 4QT5B 4K3DH 4KAQH 5C07E 4L1DA 1AQDB 2QBWA 3UTQB 3V6FB 4YHML 4JEGB 1J0HA 1OAXL 1JHKH 5CEZD 4QEGA 5FM8A 1G7HB 3VFTB 2M26A 4PJIE 2BVYA 4F8QA 1HH9B 4JQXA 1JWMA 3EDFA 5IVOA 4EBQL 4V1DB 3HPLB 2ZOKA 3BE1L 3HN3A 4LLWB 3V0AC 2ARWA 4H8WL 2DQHL 5F70A 3SHSA 1T22A 3P11L 1SYVA 4F7PA 5I1IL 2VE6B 1A22B 4YH6A 4MNHA 4KI1A 5J1AB 3IFNH 5BRZD 5HHXH 2O5ZH 4GS7B 4EN3A 5CHNA 1FYTA 4KK9D 3TBWA 1KELH 3OXRA 3ZKXC 5JPMB 4WO4B 1A7QL 1OD7A 4KJWD 4JY5H 3GNML 1UYWH 2ICWI 1KIQA 1W2KT 1FFOA 4TNVK 5MI0C 4G8EA 5DZOA 4K23H 4M6MH 4R0LC 5BVJA 3NA9L 4QLRA 4QRRA 3QG6B 1MCCA 1ZHKB 2HKFL 1I1AC 1XF3B 4KRNA 3RIAF 3QIUA 1ZLVK 3SEPA 4NO3A 4XXCC 5HYJD 3ARDA 4ALAH 4X83A 1SM3H 3X13B 4YEEA 2DIJA 3S37L 5T3XE 1CDYA 1BZ7B 1NFDE 2F58L 5CD5C 2CGRH 4L8BA 3QR2A 2VRAA 2F53A 1PKQE 3HG1A 3KYAA 3RZCA 4W81A 1CFSA 2KZWA 4NRZB 4P2OD 1IAIL 5C0IB 1ZS8A 1HHHA 4ZS7L 1AXTH 4DGYH 3K81A 1EAJA 2JF1A 4U1JB 3VI3E 5DK3A 1U8MA 2H8PB 5KOVC 3C2AL 1BFTA 1TCRA 4MD4B 4XNXH 1QEWA 3P0VH 1JZ3A 3MV9E 1T66C 2EC8A 5IK3B 4M9PA 3UCRA 5BRZB 3PQYD 3U7AA 2YR3A 1FZJA 2OQJB 1WF5A 4L8SC 5FYJL 1TITA 1ETZA 1ZWIA 2ENSA 2EKSB 5I1DA 3T0EB 3D9AH 1JRHI 5EC2A 2OXGA 3QDAA 2HJLA 2LTQC 2YPKA 2VIRA 4A6YH 2DQTL 4EI5A 1DBJL 1E4WH 1KJ3L 5DC0A 4XCYA 2FJFA 3WIIL 3GUTB 1RUML 4K3EL 3HMWH 5IUSA 5FFLA 3VGHA 2VL5A 3KLAB 5DHVA 2Q8AL 3MFFB 1A9BA 2PXYA 2WINA 4H0IA 1DBBL 4UOW0 5KSBA 1R24A 4JM2A 3VE0A 4EVNB 1OAZL 1KLUA 1JNNH 4NO0A 1U58B 4Z8FL 1RJZB 4O2FB 4NNYB 3OKMA 4I8DA 4PJXF 1RIUH 5TE7H 1FH5H 3U48A 4YFEA 2WANA 5E2WH 2ESVA 5E2UL 2E7CA 3PGFH 5AUMB 1EFQA 1FG9C 3SE4C 1BZ9B 1NAMB 1KV3A 2B8OT 1VACA 3DI2B 4NZTH 2DWDB 2VKWA 2GEEA 3RUGA 1RV6X 4F3FB 2WIMA 2J7LA 1IQWL 2Z92B 2A74A 5CGYD 2UVEA 5F7FA 1I3GH 3QH3A 1Z9MA 2QSCH 1DLHB 2EE2A 1MWAB 4PJEB 5I73B 3QEUA 1VFBB 3FCTB 1CQYA 2YXFA 4M1DH 2XWTB 3HMXH 1WBXA 5GRZA 3ILQD 3V0VB 3I6LD 3REWA 4Q6IB 3GIZH 2J88H 3PV6A 3D48R 1FL3A 4I3SH 5FYKD 3MA7A 3QI9A 4HEME 1DE4B 5D6CA 5EN2A 3KLDA 5L6YL 2BRRH 2OSLB 3KPOB 4ZO9A 4YQXH 3QQ9D 5MENA 5DMJB 3GBLA 3MV8D 5IJVB 1JPST 4HWUA 2E9WA 4WW2B 4GQ9H 5AEAA 4J1UB 1WIOA 4NN5C 2IALA 3UJIH 5DEGA 1Y0LB 4JVPA 5JIIA 3LN5B 4LSSL 5C3TA 4YAQA 1T03L 3RWGA 5EU3B 4UBDD 3UYRH 1MEXL 2JK5B 3QEQD 4JHAL 1NKRA 4GG6B 2WIIA 5FYKH 5HYSG 1AR1C 3F58L 1FBIH 5IW3A 4OZIB 4R0LA 1Q9LB 4QWWC 3WHXB 1I1AA 1TJHL 4WGVB 5CUSH 1T6WA 1J0JA 2GY5A 3ES6B 3JV6A 5LXGH 3EYUH 1T2QL 4XXCA 4Z7NF 4IRZL 1F3JB 3KYMB 3QCUL 3MJ7B 4NGHH 1OVZA 3WE6B 4OQTA 4TTDC 3BAEL 3O4LA 4N9GA 5KW9H 1MVUA 5I1EH 4M1CC 2EDHA 5DRNB 1II4E 2ITDA 1BEYL 2R23A 1KB5A 5J6GA 1IAII 3QNXA 3GMPB 5DK2B 5DJYB 4K94H 4OCWH 5E5MA 2PW2A 4N1EA 1ZA6A 1FP5A 3HZMA 3W9DB 3WNLA 4LMQI 3UZQA 3V5KB 4OSUL 4L8CA 5ESAB 1J12A 1CD1B 1I3VA 2E7LC 1L7TH 4WHTA 1R3KB 1S7SA 1M7IB 3FQUB 1EEUA 4S1QL 3K2UL 3CSGA 4I3RH 3LKQB 4JY4B 3MV8B 1F4HA 4M93B 3OJDA 4XGZB 2OK0H 1OL0A 3Q5YA 4JO2H 3C5ZD 4L8SA 1QSFA 3IU3B 4JFYB 3FT4A 4J7RA 5FGSA 2FBJL 4NKDA 1CG9B 1T1XB 4Z7UB 2UUDH 4DGVH 3MYZA 3QQNA 3FT2B 4ZTOL 4BH7B 2Z4QA 1LDSA 3QEQB 1J10A 4GAJL 2G2RB 1VA9A 2Q20A 5TF1H 3EHBC 2H45A 4NQDE 5TGBA 2X4SB 3DUSA 3MJ9H 2DDQH 5C09D 1HH6A 3WHE0 3RWFB 3Q0HA 5GGRY 3B9AA 4LBEA 1Z3GL 2K7QA 3REVB 1NDGB 3RGVC 1SJXA 4G6AC 1QSZA 4PLOB 2APVA 3WFDH 3KS0J 4E42A 2CR6A 1ZHLA 3QZWB 3IVKB 1G6VK 1P4IL 3V4VH 4QRSA 4W6YB 1S5HB 2DLTA 3EKCA 4M5ZL 3UJJH 2W92A 4CVUA 4L4JA 1UCBL 2P45B 3G5YB 2E7HA 2Q76A 5GRXG 3SE4A 4X5XA 1RUPL 1SY6L 3B9KC 4U6VL 4ZYKB 3BIKB 3I6GA 2Y6SC 3CLFH 4I0PD 3PXHA 3RHWF 2I07A 1U93B 5FCUH 1L0XA 3C5ZB 2B20A 1ZEAL 4CMHC 2ADJB 1M6OA 4IMLA 4LCCC 3HB3D 6CGTA 5C07A 1T0NA 4KK6D 3MO1B 4NZRL 1X9QA 3S8WA 3RWCA 5EULV 2ZKHL 4GFTB 4GQPH 1CFVL 2VERN 3NFNA 4K7PL 4MSWB 1JWSB 5C09B 4PJIA 1A1OB 7FABL 4IDLA 3BWUC 5KVEH 3C9NB 1MRDL 2ZUUA 4ZO6A 1YY9C 1W8OA 4WI5A 4LDLB 1SBBA 5E56A 4LCYB 2XXMB 1EMTL 1HNFA 3KYKL 3BSZL 1PD6A 3WFZA 2WSKA 1OTTD 3ZT6A 1N4XH 3LKSB 1CGSH 2C1OA 3FHQA 5F6HJ 5BZDB 4K8RL 4PJCA 4UNTA 4OLUH 4U1MA 2BVPB 2YUWA 2QQKL 4YHPA 1BIIA 5BMFL 1NCDL 2EZ0C 1FN4B 3OG6B 4I0PB 1T0PB 2XZQH 1BFOB 4F15B 1MCOH 1JP5A 4RMTA 4Q0XH 4OZ4B 1MHPL 3BP6A 4N5ED 2QR0A 1MRFH 4Y4FA 3MLXL 5ID0A 2GSIA 5DLML 5LWYH 5I17B 1N0LA 5BO1H 3QUKB 3QJHB 5CJQL 4WWKA 2I5YL 1FFNB 4LVHB 4NM4H 15C8L 4KQ4H 4LOUD 5ADPL 2YSSB 4HXBL 1TVHA 4FZ8H 2E7LA 3UYPA 4DGIL 4JQIL 1NCCH 3ME0A 4HZAA 1E27B 3ZT7A 3MRMB 4NHUA 1FNGB 4RGND 3NIDE 1IAMA 2CH8A 3Q6GL 5CP7B 3GSNA 2IC2A 1CR9H 5EIIB 5C0JA 4H5SA 5EUKB 4XPBH 4XRCB 1NGXA 3DRQB 1XZ0A 1FG2A 5D5ME 5AYUH 1RURL 2JIXB 3MLRL 3MV9A 4X4YA 3ULUF 1ZT1B 2HJKA 3NCCB 4ZQKA 2APFA 1YQVH 1H3XA 2BCKB 1H3PH 3DMMD 5F6IC 3DI3B 1ORQA 3B2UD 4PRIA 1I9EA 3F6IA 4F9PC 4R7DA 2HT4D 1N5YH 4MMZC 5JNYB 3QUMA 4RWHA 3QB7C 4LLVB 4MA7L 5I74C 3RGVA 1NBVH 4PS4L 2HH0L 4LU5H 1UB5B 1FNAA 2BHYA 4NSKB 4IOIB 4KKLD 1ZMYA 4M6AA 5IFAH 2XY1A 2VDKH 4MJ5B 1J05A 4ETQA 5DURD 4GRLC 1OLLA 1UXWA 1J8HA 4BZ1H 3X12B 4KHXL 4JN2A 3B9KA 5CBEB 3CH1B 1XGRA 4XCNB 2B4CH 4BQBA 4RGNB 1A3LH 3GKWL 1C5DB 4DN4L 2ATPB 3T2NH 1P5UA 2ICEB 3VW3L 1KJ2A 1KFAL 2C7UB 4G8GD 1EO8L 1S7TB 3QEGL 1RUAH 1V3LA 4GKZB 2R9HC 3GHEH 4NT6A 1A4JA 2CIIA 4XX1G 1O7SA 5TFSL 3E8UL 5SX5H 5HYIA 2Z31D 4EDXB 1WWWX 2BX5A 1Q38A 4WRLA 4XPTH 1HHKB 4MDJB 2BP3A 4PJXE 3HI6L 3C60D 1YEFH 3NN8A 1U36A 4M5YH 1IBGH 4Y5VC 2IBZX 1F90H 3FRUB 3L3OA 2AV1B 4CNIA 2IMMA 5EU4B 2ICCA 1K6QL 2BFVH 2P8LA 1RY7B 1MCPL 3PUCA 4B5EA 5JLZB 3TESA 4Q6YA 4J3OC 5DRXB 1EPFA 3N9GL 4QHKJ 1ZK9A 4YHKH 4IOFD 2W9LA 5KS9B 5DURB 5HGGS 3HZYA 2YRPA 3GJFA 4OD1L 5F7YC 4IJ3C 4PRNA 1A2YB 4UUJB 5EBMA 4DVRH 3F7PC 1U3YA 4L9DA 2PYFA 1XF4A 5DT1H 2YD8A 5EFIB 4Q97A 2DWEB 3K74B 3RKDC 4JFOB 3S4SG 3ZKMC 1Q1JL 2JTDA 3AS3A 1IAOB 4G8GB 1HKFA 1KB9J 2CR3A 1CD9B 3CVHH 3O6KH 4JRYA 3VWKD 3ULSA 2ZUQB 3KWWA 2Z31B 3QXAA 2J6EA 1G7QA 4F7TB 5I76B 3KPSB 2EIEA 1U8LB 5KSAC 3SCMD 5KN5A 4R9HA 2DRUA 3C60B 3F7YA 4XBPA 4GBXD 3O41B 2F19L 4HKBA 4IEFB 2DL2A 5J8OA 4XNMB 4KY1H 2NX5E 3V5HA 1RUQL 1BAFH 4YC2C 3OF6D 5F9WB 4YHYC 4X5LA 5I1JL 3VFPA 2ZUSA 2I60H 4HS8L 4RGMC 5GS0L 2WWMC 3PDOB 4LCWE 1OD9A 2NY2C 2RFXA 4XPFL 1K8IA 1TETH 3AM8C 1UKQA 3HLAB 1MJ7L 3LRGA 4HIHA 4DVBA 4DK6A 2EC9T 2FX7H 1H3WM 4M7ZB 4F9PA 1CWVA 1UG9A 3A6BH 2VXTL 4DFIA 4ODHH 1GC1H 1EXUB 5FUZH 3WNMA 1JZ4A 32C2A 3U83A 4U1HB 2HMID 1MH5A 1ES0B 4OT1H 2XV6B 3GDBA 3L3HB 4Y2OA 4CMMB 3MLYL 3VWKB 4JZNA 4JHZA 3LN4B 4OM0H 1KLGB 1PLGH 2EDEA 1VPOH 3IDXL 4JDZA 1T83A 3SCMB 5C0FB 2QQQA 1BM3L 1T3FA 3TYFB 1DUZB 1EVTC 4GBXB 2O61A 1MAJA 1RZKL 3BHBB 3VFGL 4G6ML 4PLNC 4RDQF 4ELKA 1ZT7B 5BW7C 4UDUB 3BKYH 4WUKL 4Z5RA 3O6FC 3VA2C 5GZOD 4ZPTA 1CBVH 3LH2H 3HUJE 4H1LB 1FSKB 1T2JA 4PJDE 4NOFA 4GRWH 2R1XB 3W39A 4MA1B 2HTKC 4MS8C 3RU8H 1RJCA 3QUXD 1XF2B 3RWJB 3NPSC 3FQNA 2GJ6D 4P2CG 4Y5VA 1ZOXA 4B50A 5F9OL 1V7MH 5T1KA 1A7NL 3FB5B 2R2BB 4OCLC 4X6EA 3K46A 4HSQA 3GRWH 1A3QA 4BM7A 5D96B 3SGDI 2QQNH 4EXKA 4K7PY 3QIBD 1BX2B 1WCBA 3BKJH 4FXLA 1SJVA 3LB6C 5EB9A 5I18L 1QR1A 4I18B 2N7AA 4XAWL 4TVPD 3C6LD 3IRZA 3MJ8A 2F9BT 1FVEB 1DN2A 1I9RH 1OW0A 2AJYH 1HHJA 4HXAL 4LDEB 5A2FA 3NGBC 5DYOA 3GHBH 1BJMA 3O3EB 4N8VB 4PP1D 5JO5A 3B3IA 3OX8B 4YBQD 1YEIL 3UTTE 3GFUA 2HAZA 4LIQH 1G7IA 2VDQH 3ET9F 1I1FA 1HEZA 4FFZH 4QXGL 1HQRB 1CFQB 4KKBD 5C0NC 2DLHA 1XF5A 4JFDE 4OCNC 4HUWA 3UTPE 3DV6B 4HKXA 4OQTL 4JCLA 35C8L 3ARGD 1BFVH 3GSXA 5IF0B 4N0FB 3ZDZE 3QUXB 4ZFOA 4H26A 1NFKA 5EZJB 5MEPB 1BJ8A 2ADFH 5J12B 5KSAA 4KROC 2X4QA 4K71B 4P3CL 4YHLL 3EYSL 3QFJD 2NY1C 2JELH 4G80A 1KB5L 4EUPG 1KB9K 3WUWA 1MQKL 4HCRA 3MRGA 5J6HA 3UPRA 2HRPL 1X5AA 2DM2A 4K3JH 2ICWB 4TUKL 5B38B 2EE9A 1RU9H 4QXTB 5IVZA 1AGFB 4XMPH 3QIBB 1JI2A 1RMFH 4JM4H 3RNQA 5DMIL 1LEKB 3MXWL 2G9HB 3D3VE 2X4RA 1I7RA 3MRKB 4Z0XB 4LKCB 5DMKA 3GSVB 4LFHG 2R4SL 3BT2L 2IFGA 2IPTH 5DFTA 4MGXA 1A7OH 4OF3A 4PJFB 5JHLL 1S9VB 3G6JB 3FMGL 4X99B 3JWOC 5HYQB 5DQDL 3DYPA 5D5MA 1GPOL 4DZ8A 3DX6B 1RAMA 1OOAA 3BQUD 5K9OB 1FIGL 4Y16C 5LGHH 3Q6FB 5GS3A 1EUTA 2O5YH 5JW3L 5KAQF 4ZAKD 2NY5L 3SE8H 4NM8H 4RMUA 1P7KA 2NXZC 1MQ8A 4MJ6B 4MAYD 2A0LD 2D31A 5EZOH 3SOBL 4KVCH 3ARGB 5DS8A 3LKRA 4HEPG 4HWEH 5CD3B 1GAFL 3N1QC 4TUJB 1NMAL 1RHHB 4X4ZA 3QFJB 1B6DA 2GUOB 2HVJB 1IGJA 2YD9A 1YEDB 4F9LC 3QO1A 4RMQA 4Y2DD 3PWUA 4ZFGH 4P99A 5C0DB 3S36L 3ULUE 3Q48A 4M8QA 5C2UB 1TXKA 5F7EL 5GGRB 2Z0BA 3F8UB 2P47B 3RVUD 4DEPC 3RGHA 5I1HH 5LAXA 1BFSA 3BPNC 5E6IB 1ZVSA 5HHQA 1T89C 1IFHL 4HMEA 4XP9L 4JZOA 1MCNA 3QDGD 5EPMA 4WU5A 2F8VA 5E8PB 2DM4A 2CMRL 3V7MA 4XB8A 3WNNA 3ARFB 2F74B 4XCEA 1OPGL 3V8OA 2CDFA 5IIEA 3CDFA 1RK1A 1UH2A 4N90E 1SJEB 4EBQH 1OSPL 2W59A 3BE1H 4Y19E 4JPIA 1OGTB 1R5VA 5I9QC 3P11H 1YMME 4ZAKB 5ITBL 3U6RB 3Q3GB 5GSVB 1CQKA 5JHDD 1M05A 4JREB 4FA8A 3EYQD 2HLAA 5FB8A 1T5XB 5IMOB 4X7FC 3ZE0F 3MCKA 3GIVB 3HZKA 4O5LL 3OKEB 3T3ME 4LAQL 4YHOL 4DKFH 2VZTA 3ZSTA 3WXVL 4AL8H 2R2CA 1JPTL 1A7QH 2ITCA 3RVTC 4Y2DB 1DVFA 3GNMH 4G8FA 1FNHA 3L7EB 1A9EB 4NJAL 1ED3B 3TNNA 1LNUB 3PHQA 1W0WA 5BQ7B 4HMDA 5CP3A 3L6FB 1TZHA 1BVLA 3QDGB 3UZVB 1HXMA 1I9JH 1JPFA 5GS1C 4OGXL 1OAYH 2V7NA 1AFVH 3S37H 5C92A 5FYJD 4FXGB 1X4ZA 3FFDA 1JF1A 3L3KB 4C56E 5D7SL 3UX9B 5I8KL 1QBAA 5GGQL 4XHJD 1A1NB 5FCSH 1FZOA 1RZ7H 4LLYA 2VDPL 4HZLA 2XN9D 5I1GH 2R0KL 1DFBL 1CDUA 2BVOB 5AYQA 5DFVD 1N5AB 1YEGL 5JHDB 5BV7L 3OB0H 2QKIA 2WUCH 4YDIH 4GW5A 4XPHL 4QRUA 5E8EB 1EFXB 1H8OA 3ZE2E 1MSPA 2NX5A 4QRTB 3GSNL 1JV5A 4TVSa 3VH8G 2XRAL 3RRQA 2YWZA 2VAJA 3FO2B 2RQ8A 5GISL 2GTZB 1KIPB 1MPAH 2OX5A 4LCWA 4L9LC 1MIML 4Y16A 3OKOB 3H9SD 4OUOA 5IBTL 3WIIH 1RUMH 2MKWA 2C9AA 2BNUB 3GMLB 3EO1B 1A6AA 2E27L 3DVGA 3PL6D 5DD5L 2Q8AH 3FQXA 1I8KA 4YIQA 2ARJB 3A6CH 5HHOE 5I71C 3QUML 3QWOB 4LEOA 1OAZH 1QHOA 3GO1L 1AJ7L 3NBNA 1D5IL 4OZFB 1IQDB 1CLYH 3RNKA 3CFJB 3EDDA 1DBAH 1G9EA 1MLCA 1KULA 4O2EA 5HVWA 2Y1VA 5CILH 1UADC 3ZL4L 2NPLX 2VDLL 1A02N 5T33L 5DJ2A 5IWLC 1KT2B 2XN9B 4O51B 4OLXH 4TUOA 1AXSA 4KUCF 4HWBA 4FQLL 4QHNB 1T89A 1EJ6A 2HT2D 4G43B 3ULUC 1MLBA 3L5XL 4Z7WF 1KIUA 2NR6C 1U3HD 1C16B 1QQDB 1KJ2L 3TH3T 3OG4B 1ONQA 1KTLA