2Z9KA

Complex structure of sars-cov 3c-like protease with jmf1600
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
305
structure length
305
Chain Sequence
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSGVTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3C-like proteinase
publication title Structural basis of mercury- and zinc-conjugated complexes as SARS-CoV 3C-like protease inhibitors.
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Hydrolase
total genus 86
structure length 305
sequence length 305
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2007-09-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 2z9kA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2z9kA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2z9kA02
1F7ZA 1OXGA 3C1KA 1ZSJA 5GDSH 1KTTB 1C1UH 1XXFA 2A2XH 1YPGH 2ZU2A 1ELVA 5F8TA 1T8NA 4GLYA 1GBMA 3SV6A 2GT7A 1L0ZA 1Y5BT 4VGCB 2BDYA 2FDAA 3LJOA 2Z9LA 2G51A 2DE8A 4X6PA 2RA3A 1OP0A 1YPHC 1DE7H 2XBVA 2W3KA 3JZ1B 3B23B 4A6LA 2UUKB 3BIUH 4ABAA 3E1XB 1RD3B 3T27A 1EKBB 2VJ1A 5DP7A 1GMDG 4TPYA 1TOMH 1W8BH 3MNXA 2QXGA 2FOHA 3A83A 1GI4A 3LT3A 3MH4A 1CSOE 8KME2 1Q2WA 1G3CA 1MH0A 4WXVA 4B74A 3F6UH 3M7UA 1ZPBA 3RXGA 1P03A 2V3OH 1LTOA 2ANWA 3TK9A 2R0LA 1UTLM 1TPAE 1KLJH 3UR9A 3M7QA 1ESAA 2A5AA 2O8UA 1BMMH 5TJXA 3OY5U 1A5IA 3RXQA 2Z94A 2PUXB 4FUCA 4AGKA 1DWEH 4GSOA 5JBAS 1O33A 1DY8A 1ZJDA 3MHWU 2GV7A 3KNXA 1IQHA 1AGJA 5EQQA 4ABBA 1XUKA 4NZQA 2J95A 4Y8YA 1BJVA 4O3UA 4D9QA 2VINA 3RXLA 4ZROA 4JZDH 2HALA 1ELDE 2Y7XA 3E0NB 1MQ6A 5A8YA 1JOUB 1TX8A 1W13U 8ESTE 1OYQA 4Y10E 5FPTA 1YC0A 1O3KA 3SUDA 1E38B 1NFUA 1Y3YA 2FZZA 4FVDA 3E0PB 1E34B 3A87A 2Z9KA 1FNIA 1XMNB 1ZPZA 3RXSA 1ZGIA 3LPRA 4OS6A 1T8MA 1LQEA 2FTLE 3VEQB 4DIIH 3ZVCA 2FOMB 1WAYB 1MD7A 1C5MD 1SHYA 1NZQH 2FM2A 1C5RA 1DSUA 3CS0A 1HLTH 2OC1A 4SGBE 3TJNA 1DWCH 1O3AA 2TGPZ 5ETXA 1UHBB 3GY6A 2VVVA 2PGQB 2J92A 1DITH 1TBQH 4TYDA 3GDUA 3S69A 4DY7B 4TY6A 3BTFE 1NRQH 3GY5A 4A1TA 4BAMB 2P59A 1FN6A 2GMTC 1LDTT 4I8LA 3ELAH 3H7OA 2WPJS 4X1QU 4SGAE 3W94A 2GX4A 2QV1A 3RXHA 1LKBA 2Q1JA 1SPJA 1GBTA 3A81A 4K2YA 3AAUA 4JZIA 3SU0A 2HGTH 4ZHAA 1IQIA 3C27B 1A0JA 3PMHB 4NA7A 2C4FH 2VB0A 4OS2A 4WMFA 4H6TA 1MBMA 1HAVA 1O5DH 1XM1A 2XW9A 5EQRA 2AS9A 2B8OH 2Q6GA 1GI7B 2QF3A 3L6PA 1O2JA 1NN6A 1AZ8A 1F0TA 1EJNA 1BRCE 1GL0E 2G81E 4J1YA 1EB1H 3BEFB 3MO9A 3V3MA 2FESH 3NUMA 1FZZA 5DP9A 1UTPA 3UWJH 2ZECA 3A7XA 1FUJA 3VB7A 1QJ6B 3SGQE 2G4UA 1GJDB 2R2MB 3D49H 4BAOB 2CJIA 2NU2E 1ZRKA 7KMEH 1EOLA 1TA6A 3T5FH 2ALPA 1BMNH 1YPJH 3LONA 4HGCA 5ESBA 3BTEE 2QYIA 3U9AH 1O0DH 1LVYA 1O32A 1ABIH 1TX6A 1K2I1 1BTZA 2BB4A 3SO3A 1G36A 4MPWA 2FTMA 4JYTA 5B6OA 3O8DA 3TJOA 1P0SH 1TNJA 1C2DA 2OD3B 5CMXH 1BHXB 1S82A 1W0YH 3PLBA 3ZZCA 5JBCS 5LPFA 2FOEA 3SV7A 1C1PA 2H2ZA 2GMTB 1C9TA 1DDJA 2ZGHA 3EBNA 1AZZA 4FUDA 1UMAH 1SSXA 1ELTA 4ISHH 1DUEA 4FUGA 1FLEE 5DPAA 1LHGH 1HAIH 3E8LA 2F91A 1W10U 1KLIH 1NESE 5IYTA 4BNRA 1GI2A 1B5GH 4E06H 4AYVB 3GCNA 2B0FA 4MPUA 1O5EH 1RRKA 2C93B 4GUXA 2PSYA 1LMWB 9LPRA 3MTYA 3N7OA 1BTYA 1BIOA 1O3NA 5L2ZH 1O2MA 1E37B 7GCHG 3U8OH 4Q2KA 1D3PB 4YT6H 1N8OC 3GCTG 2J94A 1TNIA 3RXEA 1G2MA 1J15A 5DG6A 3LIWA 3Q77A 1GBFA 3ZYDA 2XBWA 4UE7H 4ABGA 2A4OA 1Q31A 1O3PB 3VB5A 3TK5A 3MNCA 1PQ7A 3LH1A 3P92A 1P9UA 1AE5A 2VGCC 1QJ7B 3M3VA 1TGSZ 2P8OC 3GDSA 4DG4A 1RJXB 3B8JA 3Q3XA 4H4FA 4CREA 1QFKH 1VJ9U 2ZFPH 3W95A 2ODQA 1TX7A 1KDQB 3BTQE 4WJG2 1ZTKA 5C67A 3PM3A 1UTMA 1C5VA 1F2SE 1YPKH 1V2OT 1O3LA 1OWEA 1QR3E 3P8GA 2CXVA 1V2VT 1SGQE 1GHAG 2ZQ1A 3P70B 4MQAA 3T62A 1A5GH 2Y7ZA 2EEKA 4CRAA 3SUFA 1A61H 3QK1A 2XXLA 4B73A 3ATMA 1XKAC 4THNH 4Z0KA 4ZKSU 3GYLB 4DIHH 1C1TA 3VB3A 1KXDA 2FI4E 2D26C 5A8ZA 4UDWH 1C5NH 2W7SA 1HJ9A 2ZU3A 1H8IH 4XFQA 1O2TA 2V0BA 2C90B 1TA2A 1OKXA 1GI9B 2ZU4A 2BVRH 1C9PA 1BQYA 5EPNA 4RSPA 2JKHA 2FS9A 1LHCH 1FY3A 1AKSA 1O3MA 3ATLA 4NIYA 3ZZ9A 1OP2A 2AGGX 3BTTE 4K8YA 2YNBA 3QZQA 1N8OB 4X8SH 1ETTH 1U6QA 1S6FA 3LDXH 5EQSA 4CBOA 5JBTA 4DW2U 3E3TA 2VVUA 4YOGA 2PUQH 4R0IA 1AUTC 4YLUA 2B7DH 3UQOA 4AFZA 2G52A 1IQEA 2VIDA 1M9UA 1SQAA 2ZDNA 1HCGA 4QT8C 2XTTB 2C8ZB 2VGCB 4J2YB 1BCUH 2P8OB 1XUJA 3S7HB 1AVGH 1O2RA 1GCDA 1P2QA 3URCA 1GMCF 4FU8A 1WUNH 1LO6A 2VIVA 5HM2A 5FX6A 1HV7A 2ZG0H 1CQQA 2P3UB 3RM0H 1TFXA 4K8BA 1V6DA 1P3EA 1HGTH 3A89A 2A32A 4NIXA 4NSYA 2ZIQH 2GKVE 2ZHQH 1H9HE 3SNCA 3T2NA 1TRMA 2TIOA 3RDZA 2FYQA 3NKKA 3PWBA 1DT2A 1Z8GA 1YPHE 5FCRA 1EZUC 3RXMA 3KQCA 3SHAH 4ZKOU 1D9IA 1S83A 2G00A 2FI5E 3OYPA 2ANKH 1FY5A 1W12U 2O8WA 4WMDA 1H8DH 5LH8A 2BLWA 1K22H 3UREA 2XC0A 1MKXH 3E90B 1NU7B 1QNJA 2GDEH 4I32A 3PMBB 2SGEE 4BTIB 1HNEE 1TGBA 2ZGBH 2F3CE 2UWLA 2PLXA 3UNSA 8GCHG 2Z7FE 5DP4A 4ESTE 1LQDB 4K1EA 2HOBA 1FXYA 3DFLA 2R3YA 2XRCA 3MNSA 3K65B 1THRH 1TOCB 5A09A 5JPMH 4AN7A 2C3SA 3SJ8A 3RMOH 1AHTH 2H9EH 2BY9X 2A4QA 3AAVA 1QBNA 1IQFA 2VWOA 4TY7A 3KGPA 5T6FA 1AN1E 2QC2A 5E0JA 1C2LA 1RTFB 1RFNA 3F9EA 2M5TA 3TNTA 2FI3E 1O3IA 1TQ0B 1P2MA 1C2FA 2SFAA 2BDIA 3BTME 4BTUB 3QN7A 2TGDA 4B2BA 2HWLB 1N1LA 1DPOA 3UNQA 2P94A 3SORA 3M5NA 2GGVB 4WH8A 1ORFA 2GCHF 3TIUA 1ARCA 1TNKA 1ESTA 2ZP0H 4BAKB 4AB9A 5AFYH 1VR1H 4Q7ZA 3HGPA 1K1IA 1ELCA 3KN2A 3LGWA 4ZHLU 9ESTA 4ABEA 1DVAH 4B75A 3RLWH 2AMDA 3SV9A 1DXPA 1QL9A 3PWCA 4UFFH 4FUIA 3PMJA 4GPGA 1OOKB 7ESTE 3ZYEA 2WPHS 4IGDA 3HATH 3A8CA 1TE0A 4HFPB 4ABHA 1XXDA 3HKJB 1XUGA 4IC5A 3M7TA 4CH2B 4YO9A 1TALA 3SQEE 1O5BB 1ANDA 1NU9A 4CRFA 1QBVH 1WSSH 1HAYB 3A7ZA 5E8EH 1ZSKA 3SU5A 1A3EH 2PKAB 5LGOA 2OBOA 2UWOA 1PYTD 4X2YA 2DUCA 1TPPA 1OX1A 4GHQA 1WU1A 2CGAA 1D4PB 2ZKSA 1FN8A 1V2MT 4X8TH 3SU1A 2Z9IA 2B5TB 2BD7A 1MU6B 2XCFA 2BY8X 5C20A 4IN1A 1FI8A 1D6WA 1THSH 2BDCA 1G9IE 1UVSH 4FUHA 5C1YA 2RDLA 6LPRA 3MO6A 2AYWA 2BDBA 1YCPH 1PPEE 4GCHG 4IN2A 3DUXH 2IJOB 4I8HA 1GHVH 1T8OA 4NIWA 2K7XA 1DOJA 1SGEE 2VU8E 1L1NA 1G37A 2C8YB 1GDNA 4UFEH 1GHBG 8LPRA 4NA9H 3HK6B 1NS3A 1VCWA 1GMDF 4CBNA 3FVFB 2FODA 4BAQB 3ZZBA 2GZ8A 3UTUH 3MWIU 1DWDH 2XWBI 5T6DA 3P6ZB 2A4GA 1ELBA 1P3CA 1ZHPA 1MTVA 3UPEA 4NWKA 1AMHA 2LPRA 2OQ5A 1GBCA 4DVAU 1SLXB 2TPIZ 4B71A 1CBWC 1YLCA 3UFAA 2F9OA 2FOBA 1TRYA 2WUCA 3F9HA 1LHFH 1P10A 1TABE 1QL8A 4A5TS 1KDQA 5DGJA 1S0QA 1W7GH 2GD4B 2BZAA 1OWDA 4ZH8A 4XSKU 3MMGA 1TWXB 5K0HA 4X1PU 3TPIZ 2QXJA 4OS1A 4X6MA 1J16A 5FPYA 1Z1IA 2QXHA 3RUOA 5EG4A 3PROA 1MKXK 4MDSA 3P8OA 1C1SA 3UOPA 2GVFA 3ZZAA 1GJ5H 2ZGJA 3A7VA 3F68H 4FU9A 3UQVA 3AVZA 1Z8RA 1O3CA 3QZRA 1IQGA 5JDUB 1Z6EA 1HRTH 3VB6A 5C5NA 1TNLA 2ZC9H 1SFIA 5GJ4B 1JRSA 1CO7E 1JBUH 5TCCA 3BN9A 5L6NH 1F5LA 3BV9B 3OSYA 2ZHFH 1S85A 1GHXH 2ZO3H 5EXMA 3L3TA 1DLKB 2ZQ2A 2AIPA 4AZ2B 1PFXC 1YKTA 3BEIB 1A46H 2Y5GA 3P95A 3ZVFA 2PSXA 3NWUA 1EUFA 1AU8A 1QHRB 2CMYA 3ODDA 2BX4A 3MFJA 1P9SA 1FQ3A 2TGAA 1GG6C 3Q3YA 5DP3A 3LU9B 1CBWB 1SGNE 2GV6A 3PO1C 4O3TA 1PYTC 3QLPH 4LK4A 1UK2A 1HAGE 4D9RA 2VWNA 1C2JA 1SGFA 3STJA 1SGIB 2WPKS 2BY7X 3PTNA 1ZTJA 1QTFA 3GY7A 4JYVH 1MCTA 2HNTC 3M37A 4XOJA 1MUEB 1KYNA 2WV5A 2OBQA 4O97A 2J38A 1BHXF 1TONA 3AW1A 1C2HA 1WQVH 3RC6A 1SQTA 3FZDA 1DXWA 1CGIE 1Z6JH 2JETC 4E05H 1DFPA 4DJZB 5FX5A 1NTPA 4ABJA 4KTSA 3SJIA 4AX9H 1GWAA 1O3JA 1CGHA 3LGTA 3ZVGA 1KXEA 5E2PA 1UVPA 3CENA 4X6NA 1O38A 3F9FA 1GVZA 2BDHA 4JK6A 4X2VA 4UD9H 2XC5A 3RXJA 3V0XA 1LVBA 5A0BA 1PPCE 1GJ6A 1X7AC 3DA9B 3FAOA 2GCTC 3MI4A 3V13A 2A0QB 1TLDA 4KTCA 1TAWA 3KHVA 3O8BA 1EASA 1WYKA 1OWIA 3RXOA 1OSSA 1SGTA 1C2GA 1EZSC 2KAIA 3MU4A 3O8RA 1W11U 2QIQA 3GCOA 1AI8H 3FZZA 3LJJA 1C2MA 1GG6B 1AY6H 1ID5H 1O5GH 1EAXA 1BRAA 3S0NA 3UY9A 3IWMA 5T6GA 1Z8IB 3PO1B 1J9CH 1H1BA 1UTKA 2QXIA 1YCPK 1IOEA 3SOSA 2BYAX 3M5LA 3ZVBA 2FLRH 1H9IE 1LVMA 1GBJA 1C4Y2 1ZHMA 1HDTH 1O2XA 1P02A 4Y0YE 3TK6A 4BAHB 1HAPH 4I8GA 2SNWA 1N6YA 4BXSA 3PV4A 3SGBE 2PFEA 3BTKE 4TPIZ 2Y5HA 1BBRH 2JETB 1V2WT 4MNVA 1ANBA 4NSVA 2ASUB 1TNHA 2ZHWH 5TCAA 3T28A 1WTHD 4WXIA 2THFB 1GJ4H 2Z9GA 1O3EA 5HMAA 1BJUA 1YPLH 1BMLA 1MKWH 1HFDA 1ELAA 7GCHF 1FIWA 3M5MA 3MU5A 3UR6A 5ABWA 1O2LA 1BZXE 1BT7A 3GY8A 1ETSH 3M35A 1BUIA 3T26A 1BA8B 2GCTB 1GI8B 5DP8A 2ZPQA 2BD5A 1GI3A 1Z71A 5A0CA 2FS8A 4K1TA 3P8FA 4JZEH 2A7CA 4IW4E 2P93A 4X0WU 3RXTA 1GBIA 3RU4T 4U30A 3EYDA 4Y0ZE 2ZZUH 2PKAA 1GJAB 1V2QT 2FMJA 5A8XA 2F9PA 3G01A 2ODPA 1PPGE 1MTNC 3ESTA 6CHAC 5I25A 2SNVA 1A0LA 1GHAF 3ATKA 1B7XB 4UFGH 3RXKA 1QL7A 1HIAB 1D3TB 1WOFA 2EC9H 2RA0A 3SGAE 3T29A 3CP7A 1FDPA 1K1JA 4NGAH 4YT7H 1FY4A 3RXCA 2PKSC 4D76A 2ILNA 3O8CA 2FXRA 1IQJA 3KEEA 2FP7B 1C5YB 1DLEA 1HJAC 4CRCA 4X2XA 4CR9A 1GBHA 1MZDA 2BVSH 1SG8B 3MU8A 1BDAA 3A7TA 4JYUH 1UO6A 1QQ4A 2W5EA 1MQ5A 1EPTA 3BTHE 3U1IB 3DT0H 1G3EA 1RIWC 1GJBB 5C3NA 2PR3A 1UVOA 4Z6AH 1THPB 4X8VH 1FAKH 1Z8JB 4ZHMU 3RMMH 1C5PA 2OLGA 3DFJA 1GMHG 2OTVA 1SQOA 5EW1H 1JIMA 1V2KT 1RTKA 2BOHB 3QTVH 1SGDE 3SV8A 2F9UA 1Y3XA 1C5SA 1HYLA 4A92A 4AG1A 1IHSH 1O37A 1LCYA 3ITIA 1GHYH 5FXLA 3BG8A 1JRTA 3IG6B 1P05A 1SBWA 2WPLS 2BXTH 3ATIA 3L33A 2H1UA 2FYRA 1RGQA 1BBRE 1MTNB 1GDUA 6CHAB 1O39A 1ZOMA 1C1MA 3ZVEA 2GT8A 4INLA 3HKIB 3SNDA 5IDKA 1C2IA 4ZUHA 1E35B 4K60A 1BMAA 2PKSB 2SGQE 3LKWA 1O3BA 2VIWA 2R0KA 5K7RA 1MZAA 2BD4A 1MAYA 2IPHA 1HJAB 1ZR0A 1S5SA 2YOLA 1YCPM 4ABDA 3TH4H 4RKJB 3V7TA 1A0HB 3PMAB 2RG3A 2H6MA 2Z6BD 2ZHEH 3UUZA 3RXDA 1TPSA 4K69A 4IMZA 2PW8H 1LHDH 3GISB 1RIWB 3EAJA 4NZLA 4I7YH 8GCHF 2ZHDA 4YZUA 3SNEA 5AHGH 2QN5T 4YOIA 3SV2H 2BTCE 1WQSA 2ODYB 2H5DA 2BQ7B 3SJ9A 5GCHG 4MPVA 1C5OH 1NFXA 1O2PA 3F1SB 2QAAA 4AFSA 1O3DA 3UWIA 5AVDA 2C8WB 4R8TB 2VH6A 5FBIA 1BBRK 2H9TH 1O2ZA 1TMBH 3SI4H 2UWPA 4OGXA 1QRXA 1GDQA 2XBXA 5LPRA 3F9GA 1P11E 2AGIX 1CHGA 4O03A 1CVWH 2ZDMA 2BD9A 4MNYA 7LPRA 1MKWK 1TYNA 1YLDA 1GJ9B 1C1WH 1MAXA 2ZNKH 4FVBA 1GCTC 3JZ2B 1SB1H 1NFYA 1XVOA 5DP5A 5JBBS 1ZMLA 5L30H 1V2LT 4NFFA 2ZTYA 4YTAA 1TRNA 4U2WA 2BLQA 2ZCLP 1O30A 2A1DB 1EZXC 1S84A 2J34A 2WYGA 1ZLRA 1UHBA 1VJAU 1FONA 2OCVB 4UEHH 2FOGA 1GBLA 1FV9A 1YM0A 3MYWA 2G4TA 5FHTA 3ZZ4A 2LIZA 1KIGH 1Y8TA 1VITG 2Y82A 2J4IA 3EDXB 1PJPA 3R0FA 4Q7XA 1Y5AT 4IBLH 3RU4E 2A2QH 2AERH 4WY3A 1O2SA 2YNAA 4BTTB 4B2CA 1QURH 3WY8A 1KY9A 1IQMA 1Y3UA 1EB2A 3U98H 2LNCA 1HAVB 1TGCA 1O5CB 2JH0D 1S6HA 2PHBA 4D7GA 6GCHG 5FCKA 4GHTA 4HTCH 1RTLA 1WV7H 3K6ZA 1O2NA 3STIA 5EODA 1S81A 4Y8ZA 4TWWA 1AWHB 3ZZ6A 1GHWH 2HNTE 1CU1A 3SJKA 3GY4A 1ZJKA 3KQDA 1C5LH 2WYJA 3UOUA 4CRDA 1ZTLA 1P09A 1LPZB 2BD8A 1GCTB 2OQUA 2Y81A 2HVXA 3VFEA 1G2LA 1ZMJA 2HPPH 3MNBA 1UJ1A 2Q6FA 1P57B 4GCHF 4X1RU 1OYTH 2O9QA 5F8ZA 3RLYH 3QGJA 4K5ZA 1FY1A 3A80A 1LPGB 1NPMA 1GHBF 4NFEA 1QA7A 3A8DA 1QQUA 3M36A 1UVUH 4FXGH 3D62A 3IITA 4Y6DA 5JB8S 3TH3H 1SLVB 1DS2E 3FP8E 3D23A 2ZU1A 2TBSA 4IC6A 4JZFH 1V2RT 4GVUA 1LHEH 1O31A 1O2VA 4YM9A 1H4WA 5FBEA 4B76A 3MO3A 1L1JA 1F0RA 1O35A 3I29A 1XKBC 1C5QA 2TGTA 1SGCA 3SQHE 1GI0A 2SGFE 3S9CA 1ZGVA 2Z3DA 2QA9E 2ZFSA 3SHCH 2OC8A 1MTSA 1L4DA 3KIDU 1PQAA 3P17H 4X2WA 2ZDAH 1BTXA 4I31A 1O2WA 2ZI2H 5C1UA 2Q6DA 5L2YH 3HK3B 1JXPA 1SC8U 3A7YA 1RXPA 2BX3A 1OWKA 3GDVA 4RN6A 3MH7A 4I8JA 3EQ0H 4DCDA 3U69H 1QRWA 3OY6U 4UONA 1V2JT 2BMGB 2FX6A 3Q3KA 2AMPA 3QTOH 1KLTA 2XNIA 2ZWLH 1CHOG 1O5AB 5A2MH 1SMFE 1JIRA 2AEIH 3I78A 1O2GH 1W14U 2VWMA 3SU3A 1F92A 5F6MA 2ZF0H 1HAOH 4JCNA 5CHAC 4ISIH 2ZPSA 1V2TT 3LH3A 1O2IA 3HGNA 2VNTA 1WCZA 1TNGA 3SU2A 1YYY1 3LGUA 1BTHH 2VIQA 4BOHA 1LVOA 1IQKA 2C8XB 1MCVA 3NCLA 1UTOA 4Y79A 5DK1A 5H4IB 5A0AE 1TQ7B 3E6PH 1GJ8B 1GI5A 1A7SA 3BIVH 2GZ7A 1V2PT 3RC4A 1QCPA 3ATWA 1HAXB 3Q76A 2ZGCA 1A5HA 1TB6H 1ABJH 3DHKH 5EU8A 1KXFA 4YOJA 1V2NT 1Z7KA 1T32A 1EJAA 4CH8B 2OC0A 1AKSB 5GWZA 3MOCA 5E2OA 3EA8A 3A7WA 1UTQA 2D8WA 4NG9H 3A84A 3QO6A 2UUYA 2AFQB 1YP9A 3SI3H 5JYIA 3Q00A 3VXFH 1EAUA 5J4QA 2BHGA 1G3DA 2QF0A 1D3QB 4YLQH 3FANA 3RXVA 1SLWB 4NA8A 1GJ7B 2HNTF 3AASA 3SUGA 2BD2A 1OS8A 1VITH 1ZZZA 3SZNA 1NRNH 3EA9A 1EP5A 4WVPE 1EJMA 1J8AA 5CHAB 1FY8E 1ZPCA 3A82A 1VGCC 1HBTH 1CE5A 1NC6A 4ZAEA 2O8TA 2WUBA 3KQEA 1DICA 3ZZ7A 5AF9H 1XX9A 1ANEA 1J17T 1PQ5A 1W0ZU 4XBBA 5DP6A 5HXFA 1F0UA 3NXPA 4U32A 5DKMA 2DE9A 5BPEA 3ENSB 4RKOB 1XUIA 2K1QA 2A31A 1GI6A 1L2EA 3ZVAA 1HXFH 1JMOH 1O2QA 1B0EA 2EA3A 1ZSLA 2CV3A 3LC5A 1P01A 4MNXA 5DJ7A 1O2KA 2FEQH 4K3JA 1ZRBA 1W2KH 4JK5A 1OPHB 3RC5A 2TRMA 2P3TB 1EXFA 2XYAA 1QJ1B 1VCPA 2AH4X 1SHHB 5E0GA 5C2ZA 2VH0A 1EATA 4FUEA 4H42U 4INHA 2Y5FA 1V3XA 3NZIA 2I6QA 4TWYA 1T8LA 1TBRH 3TH2H 1ANCA 3LGIA 1UCYH 4E7NA 3FFGA 1AQ7A 1INCA 2FOCA 2NU4E 1O3OA 2BOKA 2Y80A 3GY2A 2OINA 4DOQA 1PPBH 1BTUA 3TGKE 1TGNA 2A7HA 1G30B 2PGBB 3A8AA 3ZZ5A 1QRZA 1BTWA 1ELEE 3RXBA 4MNWA 4CR5A 3SBKA 2D1JA 1CT0E 1ETRH 4WMEA 3H5CB 1AD8H 2OC7A 4LZ1H 5GPIB 4DT7B 2BZ6H 1IQLA 2ALVA 4I8KA 1FAXA 2BQ6B 1CT2E 1AVXA 1P2OA 3RXAA 1K1OA 1T4VH 5HGGA 4CRGA 1MTUA 1BTPA 2ZPRA 1A4WH 1ACBE 1A3BH 1VGCB 2A5IA 1O5FH 4AORA 2CN0H 2R2WU 1AFEH 1Q3XA 4ZKRU 2A5KA 1K9OE 2O8MA 3ZZ8A 4DURA 1BITA 1Y3VA 3LOXA 5E0HA 4Y7BA 4Q80A 1BOQA 1XVMA 1NT1A 1EQ9A 1NROH 1O2OA 3KL6A 1RS0A 3SUEA 3UIRA 3MU0A 2IN2A 3TU7H 1F5KU 3PTBA 1CGJE 5HM9A 2WPMS 1AIXH 4M7GA 1DSTA 1HAZB 1HXEH 3NK8A 1C5XB 2P95A 2V6NA 3VB4A 1DANH 2ANYA 2ZGXH 3BF6H 3GCTF 3K2UA 4WH6A 3TITA 4E7RG 4JMYA 2ZDLA 2XC4A 5LPEA 3UNRA 3EE0B 4NCYA 2A7JA 1QBOA 1P2IA 2J2UA 3OX7U 2AIQA 3TJVA 2W3IA 1C1RA 4A7IB 3RMNH 5GXPA 1GBEA 2HRVA 3E16B 4OGYA 4XDEA 1A2CH 2SGDE 1KXBA 2ULLA 2BY6X 4ZXXH 4PROA 3MH6A 1C5UA 3M61U 1HB0B 1O2UA 2A4RA 4NIVA 2O8LA 5PTPA 1HJ8A 3ZZ3A 4ZMAH 1QY6A 1XUFA 1NFWA 3FP6E 1K21H 1GMHF 2GZ9A 1AE8H 2I6SA 3T25A 1O2HA 3BTWE 1T4UH 1L4ZA 4HI3A 1V2UT 3BG4C 1O34A 1MD8A 1NRRH 2G55A 4XE4A 5EXNA 1P04A 1SL3A 2HLCA 1V2ST 2V3HH 2R3UA 1K1MA 3E91A 1C5WB 1PPFE 1QB9A 1AUJA 1UCYE 2A45B 1XUHA 2BLVA 2BM2A 4KKDA 4X1NU 2NU0E 1GGDC 2UUJB 1QA0A 1S0RA 4MTBA 2ZFRH 4CHAC 1NRPH 1P2JA 4FUBA 2WPIS 4F4OC 4AOQA 4O9VA 1C1NA 3EGKH 4AG2A 4IS5A 2AGEX 2NU3E 1QIXB 2QGRA 3OTJE 5F03A 2WV4A 1P2KA 4LZ4B 1TGTA 4JZ1A 3V12A 1A1RA 2J9NA 1K1LA 3K9XB 4MPXA 1O2YA 4OS7A 1TPOA 4NWLA 2EI7A 3EA7A 2GDDA 2ZCKP 1L1GA 2W7UA 3LC3A 2OXSA 1GI1A 1Y5UT 3KQBA 3MU1A 4D7FA 5FAHA 1C5ZB 2F83A 4XBDA 1ELFA 5T3HA 4ABIA 1E0FD 2XBYA 3VGCC 1EAIA 1SOZA 1NO9H 1EP6A 1CA8B 2JH6D 3RXRA 2XCNA 3D65E 2G8TA 2UUFB 5HYOA 3GCHC 1DY9A 3ZV8A 1OWJA 2V35A 2STBE 4FUFA 1QB1A 4AGJA 2ZCHP 2NWNA 1CA0C 1K1NA 4Y7AA 2SGAA 3LGVA 1MMJN 3PLPA 1AFQC 1W3CA 4X6OA 4Y71A 5CE1A 1C1OA 1UCYK 5GCHF 1SOTA 1ARBA 3TGJE 1HAHH 3BG4B 4KELA 2W26A 3AW0A 1SGFG 5JB9S 4OS5A 1DM4B 4KGAA 1GJCB 4K1SA 4WF8A 4X1SU 2SGPE 1OWHA 2ZFFH 5EPYA 1T31A 1GPZA 3SJOA 4KP0A 1TBZH 2VIOA 3H7TA 1C1VH 1O3GA 1YBWA 1GGDB 3DD2H 1MTWA 2GP9B 5EOKA 4CHAB 2IOTA 1YPMH 2BDGA 1E36B 3GYMA 4CRBA 4A1XA 1O36A 1DX5M 4Y76A 3TJUA 1G3BA 3TGIE 2PWXA 1BRBE 2Z3CA 2WINI 1FMGA 3CS7A 4LOYH 1SR5C 3QGNB 4MVNA 3S9AA 1EOJA 4ISOA 3VPKA 3A88A 1TMUH 4ISLA 2VIPA 3S7KB 1GVLA 4ZKNU 2F9NA 3P8NA 2G5NA 1ESBA 4WWYA 3BTGE 2P3FH 2JH5D 4UFDH 5EGMA 1QGFA 3M3SA 1AWFH 1Y59T 2ZFTA 1W7XH 1VITF 3RXIA 3RXPA 3SU6A 3VGCB 2AMQA 1F5RA 1AO5A 3ZVDA 2ZA5A 1FIZA 1PQ8A 4D8NA 3GCHB 3SNAA 2BXUH 2CF9H 1NRSH 5GIBA 1CA0B 1K1PA 4FUJA 2OP9A 3U8TH 1JWTA 2BDAA 1AFQB 4BANB 1DUAA 1OP8A 1SLUB 2BY5X 1IQNA 2B9LA 1GBKA 6GCHF 4DGJA 1T7CA 1TIOA 3QWCH 1NY22 1YPEH 3GY3A 4AB8A 5SGAE 5AFZH 1PPZA 1LPKB 1FJSA 2ZU5A 3RM2H 2D2DA 3M3TA 2PTCE 3MH5A 2VVCA 2PTNA 1AVWA 1WTGH 3K6YA 2FO9A 1UTJA 5ESTE 2ANMH 1AB9C 1GMCG 4KTUA 1BB0B 4ABFA 1Y3WA 3FP7E 2STAE 1P06A 1ZHRA 3U1JB 1QB6A 1C4U2 1EAWA 2CHAC 2KAIB 1J14A 2Y6TA 3BEUA 3R3GB 2PV9B 2HPQH 3A86A 1KXAA 1TMTH 1B0FA 4ASHA 4MLFB 3SNBA 4BXWA 1HPGA 4H6SB 3RXFA 5C5OA 1SGYE 1D6RA 1D3DB 1YF4A 1VCQA 2FWWA 5BRRE 5EW2H 2R9PA 3TLOA 1KTSB 2BD3A 1P2NA 1UK4A 3U8RH 2ESTE 3HPTB 1F0SA 2BQWB 1C1QA 2H9HA 3SW2B 1NM6A 1Z1JA 1UVTH 1FPCH 1C2EA 2Z3EA 2ZFQH 3SN8A 1DWBH 4ZXYH 2VWLA 1KSNA 1MU8B 3GOVB 3ZV9A 3I77A 3BSQA 3NPSA 2QCYA 1SFQB 2OUAA 4IMQA 3URDA 1SI5H 4AYYB 3RU4D 1IHTH 4X8UH 1G32B 2ZEBA 1HUTH 1ZYOA 3RMLH 1EPTC 3PYHA 4HZHA 6ESTA 3SU4A 2G5VA 2FX4A 4ISNA 3B9FH 1GBBA 3S9BA 4INKA 4FU7A 4Y11E 5DO4H 1AB9B 3M5OA 1LKAA 1EX3A 4Q7YA 2FOAA 2RCEA 3A85A 1CHOF 1GHZA 3TNSA 2ZDKA 1P8VC 3RXUA 3BTDE 4LXBH 1VZQH 2CHAB 3LGYA 2ZDVH 4VGCC 5C1XA 5I46H 1FPHH 4I33A 2ZTZA 1GBDA 2GCHG 3RP2A 1O3FA 3PLKA 1K28D 5FPSA 4A1VA 3OU0A 1GVKB 4XBCA 1C2KA 3TVJB 1KXCA 1P12E 2QY0B 2P16A 4B2AA 2F9BH 2FIRH 1YGCH 2Z9JA 1MBQA 1HIAA 3A8BA 3PB1E 1IAUA 3KF2A 1N6XA 3QDZB 4F49A 3ODFA 5G4BA 2GTBA 4B1TA 4GAWA 4AFUA 2FLBH 1GBAA 2XWAA 3KCGH 1BRUP 4Y8XA 3ZZDA 1ELGA 2EI6A 2FPZA 4U01A 2CF8H 1H9LB 3VXEH 5F8XA 1GL1A 2H5CA 1UTNA 2F9VA 5EXLA 3GICB 1ZMNA 2FOFA 1SGPE 3QUMP 1C5TA 3QX5H 4MG3A 1EPTB 1SGRE 1UK3A 4AFQA 1C4V2 1CT4E 5J4SA 4YESB 1O3HA 1SVPA 4OS4A 1EZQA 2BLOA 2BVXH 1WBGB 1PPHE 2NU1E 2ZTXA 2EI8A
chains in the Genus database with same CATH superfamily
1F7ZA 1OXGA 3C1KA 1ZSJA 5GDSH 1KTTB 1C1UH 1XXFA 2A2XH 1YPGH 2ZU2A 1ELVA 5F8TA 1WXRA 1T8NA 4GLYA 1GBMA 3SV6A 2GT7A 1L0ZA 1Y5BT 4VGCB 2BDYA 2FDAA 3LJOA 2Z9LA 2G51A 2DE8A 4X6PA 2RA3A 1OP0A 1YPHC 1DE7H 2XBVA 2KCYA 2W3KA 3JZ1B 3B23B 4A6LA 2UUKB 3BIUH 4ABAA 3E1XB 1RD3B 3T27A 1EKBB 3CNRA 2WPDD 2VJ1A 5DP7A 1GMDG 4TPYA 1TOMH 1W8BH 3MNXA 2QXGA 2FOHA 3A83A 5HKKD 1GI4A 1SKYE 3LT3A 1CSOE 3MH4A 3WW7A 3SYJA 8KME2 1Q2WA 1G3CA 1MH0A 4WXVA 4B74A 3F6UH 3M7UA 1ZPBA 3RXGA 1P03A 2V3OH 1LTOA 2ANWA 3TK9A 2R0LA 1UTLM 1FX0B 1KLJH 1TPAE 3UR9A 3M7QA 1ESAA 2W6JD 2A5AA 2O8UA 1BMMH 5TJXA 3OY5U 1A5IA 4RI0A 3RXQA 2Z94A 2PUXB 4FUCA 4AGKA 1DWEH 3KYFA 5C94A 4GSOA 5JBAS 1O33A 1DY8A 1ZJDA 3MHWU 2GV7A 3KNXA 1IQHA 1AGJA 5EQQA 4ABBA 1XUKA 4NZQA 2J95A 4Y8YA 1BJVA 4O3UA 4D9QA 2VINA 3RXLA 4ZROA 4JZDH 2HALA 1ELDE 2Y7XA 3E0NB 1MQ6A 5A8YA 1JOUB 1TX8A 1W13U 3N99A 8ESTE 1OYQA 4Y10E 5FPTA 2JDID 1YC0A 1O3KA 3SUDA 1E38B 1NFUA 1Y3YA 2FZZA 2QF5A 4FVDA 3E0PB 1E34B 3A87A 2Z9KA 1FNIA 1XMNB 1ZPZA 3RXSA 1ZGIA 3LPRA 4OS6A 1T8MA 1LQEA 2FTLE 3VEQB 4DIIH 3ZVCA 2FOMB 1WAYB 1MD7A 1C5MD 1SHYA 1NZQH 2FM2A 1C5RA 1DSUA 3CS0A 1HLTH 2OC1A 4SGBE 3TJNA 1DWCH 1O3AA 2TGPZ 5ETXA 1UHBB 3GY6A 2VVVA 3UB0A 4Z1MD 2PGQB 2J92A 1DITH 1TBQH 4TYDA 3GDUA 3S69A 4DY7B 4TY6A 3BTFE 1NRQH 3GY5A 2KM0A 4A1TA 4BAMB 2P59A 1FN6A 2GMTC 1LDTT 4I8LA 3ELAH 3H7OA 2KR7A 2WPJS 4X1QU 4SGAE 3W94A 2GX4A 2QV1A 3RXHA 1LKBA 2Q1JA 1SPJA 1GBTA 3A81A 4K2YA 3F2HA 3AAUA 4JZIA 3SU0A 2HGTH 4ZHAA 1IQIA 3C27B 1A0JA 3PMHB 4NA7A 2C4FH 2VB0A 4OS2A 4WMFA 4H6TA 1MBMA 1HAVA 1O5DH 2L74A 1XM1A 2XW9A 5EQRA 2AS9A 2B8OH 2Q6GA 1GI7B 2QF3A 3L6PA 1O2JA 1NN6A 1AZ8A 1F0TA 1EJNA 1E1QD 1BRCE 1GL0E 2G81E 4J1YA 1EB1H 3BEFB 3MO9A 3V3MA 2FESH 3NUMA 1FZZA 5DP9A 1UTPA 3UWJH 2ZECA 3A7XA 1FUJA 3VB7A 1QJ6B 3SGQE 2G4UA 1GJDB 2R2MB 3D49H 4BAOB 2CJIA 2NU2E 1ZRKA 7KMEH 1EOLA 1TA6A 3T5FH 2ALPA 1BMNH 1YPJH 3LONA 4HGCA 5ESBA 3BTEE 2QYIA 3U9AH 1O0DH 1LVYA 1O32A 1ABIH 1TX6A 1K2I1 1BTZA 2BB4A 3SO3A 1G36A 4MPWA 2FTMA 4JYTA 5B6OA 3O8DA 3TJOA 1P0SH 1TNJA 3WWFA 1C2DA 2OD3B 5CMXH 1BHXB 1S82A 1W0YH 3PLBA 3ZZCA 5JBCS 5LPFA 2FOEA 3SV7A 1C1PA 2H2ZA 2GMTB 1C9TA 1DDJA 2ZGHA 3EBNA 1AZZA 4FUDA 1UMAH 1SSXA 1ELTA 4ISHH 1DUEA 2KCAA 4FUGA 1FLEE 5DPAA 1LHGH 1HAIH 3E8LA 2F91A 1W10U 1KLIH 1NESE 5IYTA 4BNRA 1GI2A 1B5GH 4E06H 4AYVB 3GCNA 2B0FA 4MPUA 1O5EH 1RRKA 1WDIA 2C93B 4GUXA 1NBMD 2PSYA 1LMWB 9LPRA 3MTYA 3N7OA 4RT0A 1BTYA 1BIOA 1O3NA 5L2ZH 1O2MA 1E37B 7GCHG 3U8OH 4Q2KA 1D3PB 4YT6H 1N8OC 3GCTG 2J94A 1TNIA 1W0JD 3RXEA 1G2MA 1J15A 5DG6A 3LIWA 3Q77A 1GBFA 3ZYDA 2XBWA 4UE7H 4ABGA 2A4OA 1Q31A 1O3PB 3VB5A 3TK5A 3MNCA 1PQ7A 3LH1A 3P92A 1P9UA 1AE5A 2VGCC 1QJ7B 3M3VA 1TGSZ 3OFND 2P8OC 3GDSA 4DG4A 1RJXB 3B8JA 3Q3XA 4H4FA 4CREA 2J98B 1QFKH 1VJ9U 2ZFPH 3W95A 2ODQA 1TX7A 1KDQB 3BTQE 4WJG2 1ZTKA 5C67A 3PM3A 1UTMA 1C5VA 1F2SE 1YPKH 1V2OT 1O3LA 1OWEA 1QR3E 3P8GA 2CXVA 1V2VT 1SGQE 1GHAG 2ZQ1A 3P70B 4MQAA 3T62A 1A5GH 2Y7ZA 2EEKA 4CRAA 5EJZA 3SUFA 1A61H 3QK1A 2XXLA 4B73A 3ATMA 1XKAC 4THNH 4Z0KA 3PV5A 4ZKSU 3GYLB 4DIHH 1C1TA 3VB3A 1KXDA 2FI4E 2D26C 5A8ZA 4UDWH 1C5NH 3MQKC 4I86A 2W7SA 1HJ9A 2ZU3A 1H8IH 4XFQA 1O2TA 2V0BA 2C90B 1TA2A 2BVRH 1OKXA 2ZU4A 1GI9B 1C9PA 1YWUA 1BQYA 5EPNA 4RSPA 2JKHA 2FS9A 1LHCH 1FY3A 1AKSA 1O3MA 3ATLA 4NIYA 3ZZ9A 1OP2A 2AGGX 3BTTE 4K8YA 2YNBA 3QZQA 1N8OB 4X8SH 1ETTH 1U6QA 1S6FA 3LDXH 5EQSA 4CBOA 5JBTA 4DW2U 3E3TA 2VVUA 4YOGA 2PUQH 4R0IA 4P00A 1AUTC 4YLUA 2B7DH 3UQOA 4AFZA 2G52A 1IQEA 2VIDA 1M9UA 1SQAA 2ZDNA 3PV2A 1HCGA 4QT8C 2XTTB 2C8ZB 2VGCB 4J2YB 1BCUH 2P8OB 1XUJA 3S7HB 1AVGH 1O2RA 1GCDA 1P2QA 3URCA 1GMCF 4FU8A 1WUNH 1LO6A 2VIVA 5HM2A 5FX6A 1HV7A 2ZG0H 1CQQA 2P3UB 3RM0H 1TFXA 4K8BA 1V6DA 1P3EA 1SQRA 1HGTH 3A89A 2A32A 4NIXA 4NSYA 2ZIQH 2GKVE 2ZHQH 4DT4A 1H9HE 3SNCA 3T2NA 1TRMA 2TIOA 3RDZA 2FYQA 3NKKA 3W1EA 3PWBA 1DT2A 1Z8GA 1YPHE 5FCRA 1EZUC 3RXMA 3KQCA 3SHAH 4ZKOU 1D9IA 1S83A 2G00A 2FI5E 3OYPA 1VKYA 2ANKH 1FY5A 1W12U 2O8WA 4WMDA 1H8DH 5LH8A 3OTPA 2BLWA 1K22H 3UREA 2XC0A 1MKXH 3E90B 1NU7B 1QNJA 2GDEH 4I32A 3PMBB 2SGEE 4BTIB 1HNEE 1TGBA 2ZGBH 2F3CE 2UWLA 2PLXA 3UNSA 8GCHG 2Z7FE 5DP4A 4ESTE 1LQDB 4K1EA 2HOBA 5B6LA 1FXYA 3DFLA 2R3YA 2XRCA 3MNSA 3K65B 1THRH 1TOCB 5A09A 5JPMH 4AN7A 2C3SA 3SJ8A 3RMOH 1AHTH 2H9EH 2BY9X 2A4QA 3AAVA 1QBNA 1IQFA 2VWOA 4TY7A 3KGPA 5T6FA 1AN1E 2QC2A 5E0JA 1C2LA 1RTFB 1RFNA 3F9EA 2M5TA 3TNTA 2FI3E 1O3IA 1TQ0B 1P2MA 1C2FA 2SFAA 2BDIA 3BTME 4BTUB 3QN7A 2TGDA 4B2BA 2HWLB 1N1LA 1DPOA 3UNQA 2P94A 3SORA 3M5NA 2GGVB 4WH8A 1ORFA 2GCHF 3TIUA 1ARCA 1TNKA 1ESTA 2ZP0H 5C17A 4BAKB 4AB9A 5AFYH 1VR1H 4Q7ZA 3HGPA 1K1IA 1ELCA 3KN2A 3LGWA 5F53A 4ZHLU 9ESTA 4ABEA 1DVAH 4B75A 3RLWH 2AMDA 3SV9A 1DXPA 1QL9A 3PWCA 4UFFH 4FUIA 3PMJA 4GPGA 1OOKB 7ESTE 3ZYEA 2WPHS 4IGDA 3HATH 3A8CA 1TE0A 4HFPB 4ABHA 1XXDA 3HKJB 1XUGA 4IC5A 3M7TA 4CH2B 4YO9A 1TALA 1S6LA 5C0UA 3SQEE 1O5BB 1ANDA 1NU9A 4CRFA 1QBVH 1WSSH 1HAYB 3A7ZA 5E8EH 1ZSKA 3SU5A 1A3EH 2PKAB 5LGOA 5DSFA 2OBOA 2UWOA 1PYTD 4X2YA 5CDFE 2DUCA 1TPPA 1KMHB 1OX1A 4GHQA 1WU1A 2CGAA 1D4PB 2ZKSA 1FN8A 1V2MT 4X8TH 3SU1A 2Z9IA 2B5TB 2BD7A 1MU6B 2XCFA 2BY8X 5C20A 4IN1A 1FI8A 1D6WA 1THSH 2BDCA 1G9IE 1UVSH 4FUHA 5C1YA 2RDLA 6LPRA 3MO6A 2AYWA 2BDBA 1YCPH 1PPEE 1MABB 3OAAD 4GCHG 4IN2A 3DUXH 2IJOB 4I8HA 1GHVH 1T8OA 4NIWA 2K7XA 1DOJA 1SGEE 2VU8E 1L1NA 1G37A 2C8YB 1GDNA 4UFEH 1GHBG 8LPRA 4NA9H 3HK6B 1NS3A 1VCWA 1GMDF 3UAIC 4CBNA 3FVFB 2FODA 4BAQB 3ZZBA 2GZ8A 3UTUH 3MWIU 1DWDH 2XWBI 5T6DA 3P6ZB 2A4GA 1ELBA 1P3CA 1ZHPA 1MTVA 3UPEA 4NWKA 1AMHA 2LPRA 2OQ5A 1GBCA 4DVAU 1SLXB 2TPIZ 4B71A 1CBWC 2IJD1 1YLCA 3UFAA 2F9OA 2FOBA 1TRYA 2WUCA 3F9HA 1LHFH 1P10A 1TABE 1QL8A 4A5TS 4P02A 1KDQA 5DGJA 1S0QA 1W7GH 2GD4B 2BZAA 1OWDA 4ZH8A 4XSKU 3MMGA 1TWXB 5K0HA 4X1PU 3TPIZ 2QXJA 4OS1A 4X6MA 1J16A 5FPYA 1Z1IA 2QXHA 3RUOA 5EG4A 3PROA 1MKXK 4MDSA 3P8OA 1C1SA 3UOPA 2GVFA 3ZZAA 1GJ5H 2ZGJA 3A7VA 3F68H 4FU9A 3UQVA 3AVZA 1Z8RA 1O3CA 3QZRA 1IQGA 4RT1A 5JDUB 1Z6EA 1HRTH 3VB6A 5C5NA 1TNLA 2ZC9H 1SFIA 1QZ8A 5GJ4B 1JRSA 1CO7E 1JBUH 5TCCA 3BN9A 5L6NH 1F5LA 3BV9B 3OSYA 2ZHFH 1S85A 1GHXH 2XOKD 2ZO3H 5EXMA 3L3TA 4Q4LA 1DLKB 2ZQ2A 2AIPA 4AZ2B 4M9FA 1PFXC 1YKTA 3BEIB 1A46H 2Y5GA 3P95A 3ZVFA 2PSXA 3NWUA 1EUFA 1AU8A 1QHRB 2CMYA 3DSGA 3ODDA 2BX4A 2RDEA 3MFJA 5GNDA 1P9SA 1FQ3A 2TGAA 1GG6C 3Q3YA 5DP3A 3LU9B 1CBWB 1SGNE 2GV6A 3PO1C 4O3TA 1PYTC 3QLPH 4LK4A 1UK2A 1HAGE 4D9RA 2VWNA 1C2JA 5EJ1A 1SGFA 3STJA 1SGIB 2WPKS 2BY7X 3PTNA 1ZTJA 1QTFA 2HLDD 3GY7A 4JYVH 1MCTA 2HNTC 3F2GA 3M37A 4XOJA 1MUEB 1KYNA 2WV5A 2OBQA 4O97A 5KEDA 2J38A 1BHXF 1TONA 3AW1A 1C2HA 1WQVH 3RC6A 1SQTA 3FZDA 1DXWA 1CGIE 1Z6JH 2JETC 4E05H 1DFPA 4DJZB 5FX5A 1NTPA 4ABJA 4KTSA 3SJIA 4AX9H 1GWAA 1O3JA 1CGHA 3LGTA 3ZVGA 1KXEA 5E2PA 1UVPA 3CENA 4X6NA 1O38A 3F9FA 1GVZA 2BDHA 4JK6A 5HIZA 4X2VA 4UD9H 2XC5A 3RXJA 3V0XA 1LVBA 5A0BA 1PPCE 1GJ6A 1X7AC 3DA9B 3FAOA 2GCTC 3MI4A 3V13A 2A0QB 2XNDD 1TLDA 4KTCA 1TAWA 3KHVA 3O8BA 1EASA 1WYKA 1OWIA 3RXOA 1OSSA 1SGTA 1C2GA 1EZSC 2KAIA 3MU4A 3O8RA 1W11U 2QIQA 3GCOA 3EE7A 1AI8H 3FZZA 3LJJA 4YXWD 3PRDA 1C2MA 1GG6B 1AY6H 1ID5H 1O5GH 1EAXA 1BRAA 2QE7D 3S0NA 3UY9A 3IWMA 5T6GA 1Z8IB 3PO1B 1J9CH 1H1BA 1UTKA 2QXIA 1YCPK 1IOEA 3SOSA 2BYAX 3M5LA 3ZVBA 2FLRH 1H9IE 1LVMA 1GBJA 1C4Y2 1ZHMA 1HDTH 1O2XA 1P02A 4Y0YE 3TK6A 4BAHB 1HAPH 4I8GA 2SNWA 1N6YA 4BXSA 3PV4A 3SGBE 2PFEA 3BTKE 4TPIZ 2Y5HA 1BBRH 2JETB 2JJ2D 3F0OA 2JJ1D 1V2WT 4MNVA 1ANBA 4NSVA 2ASUB 1TNHA 2ZHWH 5TCAA 3T28A 1WTHD 4WXIA 2THFB 1GJ4H 2Z9GA 1O3EA 5HMAA 1BJUA 1YPLH 1BMLA 1MKWH 1HFDA 1ELAA 7GCHF 1FIWA 3M5MA 3MU5A 3UR6A 5ABWA 1O2LA 1BZXE 1BT7A 3GY8A 1ETSH 3M35A 1BUIA 3T26A 1BA8B 2GCTB 1GI8B 5DP8A 2ZPQA 2BD5A 1GI3A 1Z71A 5A0CA 2FS8A 4K1TA 3P8FA 4JZEH 2A7CA 4IW4E 2P93A 4X0WU 3RXTA 1GBIA 3RU4T 4U30A 3EYDA 4Y0ZE 2ZZUH 2PKAA 1K0HA 5IK2D 1GJAB 1V2QT 2FMJA 5A8XA 2F9PA 3G01A 2ODPA 1PPGE 1MTNC 3ESTA 6CHAC 5I25A 2SNVA 1A0LA 1GHAF 3ATKA 1B7XB 4UFGH 3RXKA 1QL7A 1HIAB 1D3TB 1WOFA 2EC9H 2RA0A 3SGAE 3T29A 3CP7A 1FDPA 1K1JA 4NGAH 4YT7H 1FY4A 3RXCA 2PKSC 4D76A 2ILNA 3O8CA 2FXRA 1IQJA 3KEEA 2FP7B 1C5YB 1DLEA 1HJAC 4CRCA 4X2XA 4CR9A 1GBHA 1MZDA 2BVSH 1SG8B 2WV9A 1UW7A 4AC9A 3MU8A 1BDAA 3A7TA 4JYUH 1UO6A 1QQ4A 2W5EA 1MQ5A 1EPTA 3BTHE 3U1IB 3DT0H 1G3EA 1RIWC 1GJBB 5C3NA 2PR3A 1UVOA 4Z6AH 1THPB 4X8VH 1FAKH 1Z8JB 4ZHMU 3RMMH 1C5PA 2OLGA 3DFJA 1GMHG 2OTVA 3F3BA 1SQOA 5EW1H 1JIMA 1V2KT 2J97A 3WWBA 1RTKA 2BOHB 3QTVH 1SGDE 3SV8A 2F9UA 1Y3XA 1C5SA 4B6FA 1HYLA 4A92A 4AG1A 1IHSH 4ZCNA 1O37A 1LCYA 3ITIA 1GHYH 5FXLA 3BG8A 1JRTA 3IG6B 1P05A 1SBWA 2WPLS 2BXTH 3ATIA 3L33A 2H1UA 2FYRA 1RGQA 4B6EA 1BBRE 3F2FA 1MTNB 1GDUA 6CHAB 1O39A 1ZOMA 1C1MA 3PRBA 3ZVEA 2GT8A 4INLA 2K0QA 2EQNA 3HKIB 3SNDA 5IDKA 1C2IA 4ZUHA 1E35B 4K60A 1BMAA 2PKSB 2SGQE 3LKWA 1O3BA 2VIWA 2R0KA 5K7RA 1MZAA 2BD4A 1MAYA 2IPHA 1HJAB 1ZR0A 1S5SA 2YOLA 1YCPM 4ABDA 3TH4H 4RKJB 3V7TA 1A0HB 3PMAB 2RG3A 2H6MA 2Z6BD 1OHHD 2ZHEH 3UUZA 3RXDA 1TPSA 4K69A 4IMZA 2PW8H 1LHDH 3GISB 1RIWB 3EAJA 5EJLA 4NZLA 4I7YH 2WHXA 8GCHF 2ZHDA 4YZUA 3SNEA 5AHGH 2QN5T 4YOIA 3SZEA 5HIYA 3SV2H 2BTCE 1WQSA 2ODYB 2H5DA 2BQ7B 3SJ9A 5GCHG 4MPVA 1C5OH 1NFXA 1O2PA 3F1SB 2QAAA 4AFSA 1O3DA 3UWIA 5AVDA 2C8WB 4R8TB 2VH6A 5FBIA 1BBRK 2H9TH 1O2ZA 1TMBH 3SI4H 2UWPA 4OGXA 1QRXA 1GDQA 2XBXA 5LPRA 3F9GA 1P11E 2VBCA 2AGIX 1CHGA 4O03A 1CVWH 2ZDMA 2BD9A 4MNYA 7LPRA 1MKWK 1TYNA 1YLDA 1GJ9B 1C1WH 1MAXA 2ZNKH 4FVBA 1GCTC 3JZ2B 1SB1H 1NFYA 5EIYA 1XVOA 5DP5A 5JBBS 1ZMLA 5L30H 1V2LT 4NFFA 2ZTYA 4YTAA 5KECA 1TRNA 4U2WA 2BLQA 2ZCLP 1O30A 1W0KD 2A1DB 1EZXC 3GS9A 1S84A 2J34A 2WYGA 1ZLRA 1UHBA 1VJAU 1FONA 2OCVB 4UEHH 2FOGA 1COWD 1GBLA 1FV9A 1YM0A 3MYWA 2G4TA 5FHTA 3ZZ4A 2LIZA 1KIGH 1Y8TA 1VITG 2Y82A 2J4IA 3EDXB 1PJPA 3R0FA 4OM9A 4Q7XA 1Y5AT 4IBLH 3RU4E 2A2QH 2AERH 4WY3A 1O2SA 2YNAA 4BTTB 4B2CA 1BMFD 1QURH 3WY8A 1KY9A 1IQMA 1Y3UA 1EB2A 3U98H 2LNCA 1HAVB 1TGCA 1O5CB 2JH0D 1S6HA 2PHBA 4D7GA 6GCHG 5FCKA 4GHTA 4HTCH 1RTLA 1WV7H 3K6ZA 1O2NA 3STIA 5EODA 1S81A 4Y8ZA 4TWWA 1AWHB 3ZZ6A 1GHWH 2HNTE 1CU1A 3SJKA 3KQ5A 3GY4A 1ZJKA 2LELA 3KQDA 1C5LH 2WYJA 3UOUA 4CRDA 1ZTLA 1P09A 1LPZB 2BD8A 1GCTB 2OQUA 2J5UA 2Y81A 2HVXA 3VFEA 1G2LA 3DCLA 1ZMJA 2HPPH 3MNBA 1UJ1A 2Q6FA 1P57B 4GCHF 4X1RU 1OYTH 2KCPA 2O9QA 5F8ZA 4ASUD 3RLYH 3QGJA 2AHME 4K5ZA 1FY1A 3A80A 1LPGB 1NPMA 1GHBF 4NFEA 1QA7A 3A8DA 1QQUA 3M36A 1UVUH 4FXGH 3D62A 3IITA 4Y6DA 5JB8S 3TH3H 1SLVB 1DS2E 3FP8E 3D23A 2ZU1A 2TBSA 4IC6A 4JZFH 1V2RT 4GVUA 1LHEH 2LP6A 1O31A 1O2VA 4TSFD 1H4WA 5FBEA 3FN8A 4YM9A 4B76A 4FETA 4ACBA 3MO3A 1L1JA 1F0RA 1O35A 3I29A 3H09A 1XKBC 1C5QA 2TGTA 1SGCA 3SQHE 1GI0A 2SGFE 3S9CA 1ZGVA 2Z3DA 2QA9E 2ZFSA 3SHCH 2OC8A 1MTSA 1L4DA 3KIDU 1PQAA 3P17H 4X2WA 2ZDAH 1BTXA 4I31A 1O2WA 2ZI2H 5C1UA 2Q6DA 5L2YH 3HK3B 1JXPA 1SC8U 3A7YA 1RXPA 3DSPA 2BX3A 1OWKA 3GDVA 4RN6A 3MH7A 4I8JA 3EQ0H 4DCDA 3U69H 1QRWA 3OY6U 4UONA 1V2JT 2BMGB 2FX6A 3Q3KA 2M2AA 2AMPA 3QTOH 1KLTA 2XNIA 2ZWLH 1CHOG 1O5AB 5A2MH 1SMFE 1JIRA 2AEIH 3I78A 1O2GH 1W14U 2VWMA 3SU3A 1F92A 1YLNA 5F6MA 2ZF0H 1HAOH 4JCNA 5CHAC 4ISIH 2ZPSA 1V2TT 3LH3A 1O2IA 3HGNA 2J98A 1WCZA 1TNGA 2VNTA 3NRLA 3SU2A 1YYY1 3LGUA 1BTHH 2VIQA 2EY4C 4BOHA 1LVOA 1IQKA 2C8XB 4XD7D 1MCVA 3NCLA 1UTOA 4Y79A 3FO8D 2KCOA 5DK1A 5H4IB 5A0AE 1TQ7B 3E6PH 1GJ8B 1GI5A 1A7SA 3BIVH 2GZ7A 3U28C 1V2PT 3RC4A 1QCPA 3ATWA 1HAXB 3Q76A 2ZGCA 1A5HA 3FKSD 5KGOA 1TB6H 1ABJH 3DHKH 5EU8A 1KXFA 4YOJA 1V2NT 4ACAA 1Z7KA 1T32A 1EJAA 4CH8B 2OC0A 1AKSB 5GWZA 3MOCA 5E2OA 3EA8A 2YMSD 3A7WA 1UTQA 2D8WA 4NG9H 3A84A 3QO6A 2UUYA 2AFQB 1YP9A 3SI3H 5JYIA 3Q00A 3VXFH 1EAUA 5J4QA 2BHGA 1G3DA 2QF0A 1D3QB 4YLQH 2F4LA 3FANA 3RXVA 1SLWB 4NA8A 1GJ7B 2HNTF 3AASA 3N7EA 3SUGA 2BD2A 1OS8A 1VITH 1ZZZA 3VG8A 3SZNA 1NRNH 3EA9A 1EP5A 4WVPE 1EJMA 1J8AA 5CHAB 1FY8E 1ZPCA 3A82A 1VGCC 1HBTH 1CE5A 1NC6A 4ZAEA 2O8TA 2WUBA 3KQEA 1DICA 3ZZ7A 5AF9H 1XX9A 3N7DA 1ANEA 1J17T 1PQ5A 1W0ZU 4XBBA 5DP6A 5HXFA 1F0UA 3NXPA 4U32A 5DKMA 2DE9A 5BPEA 3ENSB 4RKOB 1XUIA 2K1QA 2A31A 1GI6A 1L2EA 3ZVAA 1HXFH 1JMOH 1O2QA 1B0EA 2EA3A 1ZSLA 2CV3A 3FOAA 1P01A 3LC5A 4MNXA 5DJ7A 1O2KA 2FEQH 4K3JA 1ZRBA 1W2KH 4JK5A 1OPHB 3RC5A 2OK5A 2TRMA 2P3TB 2WSSD 1EXFA 2XYAA 1QJ1B 1VCPA 2AH4X 1SHHB 5E0GA 5C2ZA 2VH0A 1EATA 4FUEA 4H42U 4INHA 2Y5FA 1V3XA 3NZIA 2I6QA 4TWYA 1T8LA 1TBRH 3TH2H 1ANCA 3LGIA 1UCYH 4E7NA 3FFGA 1AQ7A 1INCA 2FOCA 2NU4E 1O3OA 2BOKA 2Y80A 3GY2A 2OINA 4DOQA 1PPBH 1BTUA 3TGKE 1TGNA 2A7HA 1G30B 2PGBB 3A8AA 3OEHD 3ZZ5A 1QRZA 3AK5A 1BTWA 1ELEE 3RXBA 4MNWA 4CR5A 3SBKA 2D1JA 1CT0E 1ETRH 4WMEA 3H5CB 1AD8H 2OC7A 4LZ1H 5GPIB 4DT7B 2BZ6H 1IQLA 2ALVA 4I8KA 1FAXA 2BQ6B 1CT2E 1AVXA 1P2OA 3RXAA 1K1OA 1T4VH 5HGGA 4CRGA 1MTUA 1BTPA 2ZPRA 1A4WH 1ACBE 1A3BH 1VGCB 2A5IA 1O5FH 4AORA 2CN0H 2R2WU 1AFEH 1Q3XA 4ZKRU 2A5KA 1K9OE 2O8MA 3ZZ8A 4DURA 1BITA 1Y3VA 3LOXA 5E0HA 4Y7BA 4Q80A 2RFKC 1BOQA 1XVMA 2V7QD 1NT1A 1EQ9A 1NROH 1O2OA 3KL6A 1RS0A 3SUEA 3UIRA 3MU0A 2IN2A 3TU7H 1F5KU 3PTBA 1CGJE 5HM9A 2WPMS 1AIXH 4M7GA 1DSTA 1HAZB 1HXEH 3NK8A 5C0TA 1C5XB 2P95A 2YMSC 2V6NA 3VB4A 1DANH 2ANYA 2ZGXH 3BF6H 3GCTF 3K2UA 4WH6A 3TITA 4E7RG 4JMYA 2ZDLA 2XC4A 5LPEA 1NBME 3UNRA 3EE0B 4NCYA 2A7JA 1QBOA 1P2IA 2J2UA 3OX7U 2AIQA 3TJVA 2W3IA 1C1RA 4A7IB 3RMNH 5GXPA 1GBEA 2HRVA 3E16B 4OGYA 4XDEA 1A2CH 2SGDE 1KXBA 2ULLA 2BY6X 2V3MA 4ZXXH 4PROA 3MH6A 1C5UA 3M61U 1HB0B 1O2UA 2A4RA 4NIVA 2O8LA 5PTPA 1HJ8A 3ZZ3A 4ZMAH 4FOUC 1QY6A 1XUFA 1NFWA 3FP6E 1K21H 1GMHF 2GZ9A 1AE8H 2I6SA 3T25A 1O2HA 3BTWE 1T4UH 1L4ZA 4HI3A 1V2UT 3BG4C 1O34A 5T1VA 4HG6A 1MD8A 1NRRH 2G55A 4XE4A 5EXNA 1P04A 1SL3A 2HLCA 1V2ST 2V3HH 2R3UA 1K1MA 3E91A 1C5WB 1PPFE 1QB9A 1AUJA 1UCYE 2A45B 1XUHA 2BLVA 2BM2A 4KKDA 4X1NU 2NU0E 1GGDC 2UUJB 1QA0A 1S0RA 4MTBA 2ZFRH 2PP6A 4CHAC 1NRPH 1P2JA 4FUBA 2WPIS 4F4OC 4AOQA 1YY3A 4O9VA 1C1NA 3EGKH 4AG2A 4IS5A 2AGEX 2YMSB 2NU3E 1QIXB 2QGRA 3OTJE 5F03A 2WV4A 1P2KA 4LZ4B 1TGTA 4JZ1A 3V12A 1A1RA 2J9NA 1K1LA 3K9XB 4MPXA 1O2YA 4OS7A 1TPOA 4NWLA 2EI7A 3EA7A 2GDDA 2ZCKP 1L1GA 2W7UA 3LC3A 2OXSA 4XRNA 1GI1A 1Y5UT 3KQBA 3MU1A 4D7FA 5FAHA 1C5ZB 2F83A 4XBDA 1ELFA 5T3HA 4ABIA 1E0FD 2XBYA 3VGCC 1EAIA 1SOZA 1NO9H 1EP6A 1CA8B 2JH6D 3RXRA 2XCNA 3D65E 2G8TA 2UUFB 5HYOA 3GCHC 1DY9A 3ZV8A 1OWJA 2V35A 2QF4A 2STBE 4FUFA 1QB1A 3F0PA 4AGJA 2ZCHP 2NWNA 1CA0C 1K1NA 2K8IA 4Y7AA 2SGAA 3LGVA 1MMJN 3PLPA 1AFQC 1W3CA 4X6OA 4Y71A 5CE1A 1C1OA 5CHBA 1UCYK 5GCHF 1SOTA 5DN6D 1ARBA 3TGJE 1HAHH 3BG4B 4KELA 2W26A 3AW0A 1SGFG 5JB9S 4OS5A 1DM4B 4KGAA 1GJCB 4K1SA 4WF8A 4X1SU 2SGPE 1OWHA 2ZFFH 5EPYA 1T31A 1GPZA 2JIZD 3SJOA 4KP0A 1TBZH 2VIOA 3H7TA 1C1VH 1O3GA 1YBWA 1GGDB 3DD2H 1MTWA 2GP9B 5EOKA 4CHAB 2IOTA 1YPMH 2BDGA 1E36B 3GYMA 1E1RD 4CRBA 4A1XA 1O36A 1DX5M 4Y76A 3TJUA 1G3BA 3TGIE 2PWXA 1BRBE 2Z3CA 2WINI 1FMGA 3CS7A 2F43B 4LOYH 1SR5C 3QGNB 4MVNA 3S9AA 1EOJA 4ISOA 3VPKA 3A88A 1TMUH 4ISLA 2VIPA 3S7KB 1GVLA 4ZKNU 2F9NA 3P8NA 2G5NA 1ESBA 4WWYA 3BTGE 2P3FH 2JH5D 4UFDH 5EGMA 1QGFA 3M3SA 1AWFH 1Y59T 2ZFTA 1W7XH 1VITF 3RXIA 3RXPA 3SU6A 3VGCB 2AMQA 1F5RA 1AO5A 3ZVDA 4F55A 2ZA5A 1FIZA 1PQ8A 4D8NA 3GCHB 3SNAA 2BXUH 2CF9H 1NRSH 5GIBA 1CA0B 1K1PA 4FUJA 2OP9A 3U8TH 1JWTA 2BDAA 1AFQB 1EFRD 4BANB 1DUAA 2HVYB 1OP8A 1SLUB 2BY5X 1IQNA 2B9LA 1GBKA 6GCHF 4DGJA 1T7CA 1TIOA 3QWCH 1NY22 1YPEH 1H8ED 3GY3A 4AB8A 5SGAE 5AFZH 3DSOA 1PPZA 1LPKB 1FJSA 2W6ID 2ZU5A 3RM2H 2D2DA 3M3TA 2PTCE 3MH5A 2VVCA 2PTNA 1AVWA 1WTGH 3OEED 3K6YA 2FO9A 1UTJA 5ESTE 2ANMH 1AB9C 1GMCG 4KTUA 1BB0B 4ABFA 1Y3WA 4Q63A 4F48B 3FP7E 2STAE 1P06A 1ZHRA 2KFWA 3U1JB 1QB6A 1C4U2 1EAWA 2CHAC 2KAIB 1J14A 2Y6TA 4TT3D 3BEUA 3R3GB 2PV9B 2HPQH 2GJGA 3A86A 1KXAA 1TMTH 3OE7D 1B0FA 4ASHA 4MLFB 3SNBA 4BXWA 1HPGA 4H6SB 3RXFA 5C5OA 1SGYE 1D6RA 1D3DB 2KZ4A 1YF4A 1VCQA 2FWWA 5BRRE 5EW2H 2R9PA 3TLOA 1KTSB 2BD3A 1P2NA 1UK4A 3U8RH 2ESTE 3HPTB 1F0SA 2BQWB 1C1QA 2H9HA 3SW2B 1H8HD 1Z1JA 1NM6A 1UVTH 1FPCH 1C2EA 2Z3EA 2ZFQH 3SN8A 1DWBH 4ZXYH 2VWLA 1KSNA 1MU8B 3GOVB 3ZV9A 3I77A 3BSQA 3NPSA 2QCYA 1SFQB 2OUAA 4IMQA 3URDA 1SI5H 4AYYB 3RU4D 1IHTH 4X8UH 1G32B 2ZEBA 3KYGA 1HUTH 1ZYOA 2CK3D 3RMLH 1EPTC 3PYHA 4HZHA 6ESTA 3SU4A 2G5VA 2FX4A 4ISNA 3B9FH 1GBBA 3S9BA 4INKA 4FU7A 4Y11E 5DO4H 1AB9B 3ZIAD 3M5OA 1LKAA 1EX3A 4Q7YA 2FOAA 2RCEA 3A85A 1CHOF 1GHZA 3TNSA 2ZDKA 1P8VC 3RXUA 3BTDE 4LXBH 1E79D 1VZQH 2CHAB 3LGYA 2ZDVH 4VGCC 5C1XA 5I46H 1FPHH 4I33A 2IPQX 2ZTZA 1GBDA 2GCHG 3RP2A 1O3FA 3PLKA 1K28D 5FPSA 4A1VA 3OU0A 1GVKB 4XBCA 1C2KA 2L6OA 3TVJB 1KXCA 1P12E 2QY0B 2P16A 4B2AA 2F9BH 2FIRH 1YGCH 2Z9JA 1MBQA 1HIAA 3A8BA 3PB1E 1IAUA 3KF2A 1N6XA 3QDZB 4F49A 3ODFA 5FL7D 5G4BA 2GTBA 4B1TA 4GAWA 4AFUA 2FLBH 1GBAA 2WZQA 2XWAA 3KCGH 1BRUP 4Y8XA 3ZZDA 1ELGA 2EI6A 2FPZA 4U01A 2CF8H 1H9LB 3VXEH 2KX4A 5F8XA 1GL1A 2H5CA 1UTNA 2F9VA 5EXLA 3GICB 1ZMNA 2FOFA 1SGPE 3QUMP 1C5TA 3QX5H 4MG3A 1EPTB 1SGRE 1UK3A 4AFQA 1C4V2 1CT4E 5J4SA 4YESB 1O3HA 1SVPA 4OS4A 1EZQA 2BLOA 2BVXH 1WBGB 1PPHE 2NU1E 2ZTXA 2EI8A
chains in the Genus database with same CATH topology
1F7ZA 1OXGA 3C1KA 1ZSJA 5GDSH 1KTTB 1C1UH 1XXFA 2A2XH 1YPGH 2ZU2A 1ELVA 5F8TA 1T8NA 4GLYA 1GBMA 3SV6A 2GT7A 1L0ZA 1Y5BT 4VGCB 2BDYA 2FDAA 3LJOA 2Z9LA 2G51A 2DE8A 4X6PA 2RA3A 1OP0A 1YPHC 1DE7H 2XBVA 2W3KA 3JZ1B 3B23B 4A6LA 2UUKB 3BIUH 4ABAA 3E1XB 1RD3B 3T27A 1EKBB 2VJ1A 5DP7A 1GMDG 4TPYA 1TOMH 1W8BH 3MNXA 2QXGA 2FOHA 3A83A 1GI4A 3LT3A 3MH4A 1CSOE 8KME2 1Q2WA 1G3CA 1MH0A 4WXVA 4B74A 3F6UH 3M7UA 1ZPBA 3RXGA 1P03A 2V3OH 1LTOA 2ANWA 3TK9A 2R0LA 1UTLM 1TPAE 1KLJH 3UR9A 3M7QA 1ESAA 2A5AA 2O8UA 1BMMH 5TJXA 3OY5U 1A5IA 3RXQA 2Z94A 2PUXB 4FUCA 4AGKA 1DWEH 4GSOA 5JBAS 1O33A 1DY8A 1ZJDA 3MHWU 2GV7A 3KNXA 1IQHA 1AGJA 5EQQA 4ABBA 1XUKA 4NZQA 2J95A 4Y8YA 1BJVA 4O3UA 4D9QA 2VINA 3RXLA 4ZROA 4JZDH 2HALA 1ELDE 2Y7XA 3E0NB 1MQ6A 5A8YA 1JOUB 1TX8A 1W13U 8ESTE 1OYQA 4Y10E 5FPTA 1YC0A 1O3KA 3SUDA 1E38B 1NFUA 1Y3YA 2FZZA 4FVDA 3E0PB 1E34B 3A87A 2Z9KA 1FNIA 1XMNB 1ZPZA 3RXSA 1ZGIA 3LPRA 4OS6A 1T8MA 1LQEA 2FTLE 3VEQB 4DIIH 3ZVCA 2FOMB 1WAYB 1MD7A 1C5MD 1SHYA 1NZQH 2FM2A 1C5RA 1DSUA 3CS0A 1HLTH 2OC1A 4SGBE 3TJNA 1DWCH 1O3AA 2TGPZ 5ETXA 1UHBB 3GY6A 2VVVA 2PGQB 2J92A 1DITH 1TBQH 4TYDA 3GDUA 3S69A 4DY7B 4TY6A 3BTFE 1NRQH 3GY5A 4A1TA 4BAMB 2P59A 1FN6A 2GMTC 1LDTT 4I8LA 3ELAH 3H7OA 2WPJS 4X1QU 4SGAE 3W94A 2GX4A 2QV1A 3RXHA 1LKBA 2Q1JA 1SPJA 1GBTA 3A81A 4K2YA 3AAUA 4JZIA 3SU0A 2HGTH 4ZHAA 1IQIA 3C27B 1A0JA 3PMHB 4NA7A 2C4FH 2VB0A 4OS2A 4WMFA 4H6TA 1MBMA 1HAVA 1O5DH 1XM1A 2XW9A 5EQRA 2AS9A 2B8OH 2Q6GA 1GI7B 2QF3A 3L6PA 1O2JA 1NN6A 1AZ8A 1F0TA 1EJNA 1BRCE 1GL0E 2G81E 4J1YA 1EB1H 3BEFB 3MO9A 3V3MA 2FESH 3NUMA 1FZZA 5DP9A 1UTPA 3UWJH 2ZECA 3A7XA 1FUJA 3VB7A 1QJ6B 3SGQE 2G4UA 1GJDB 2R2MB 3D49H 4BAOB 2CJIA 2NU2E 1ZRKA 7KMEH 1EOLA 1TA6A 3T5FH 2ALPA 1BMNH 1YPJH 3LONA 4HGCA 5ESBA 3BTEE 2QYIA 3U9AH 1O0DH 1LVYA 1O32A 1ABIH 1TX6A 1K2I1 1BTZA 2BB4A 3SO3A 1G36A 4MPWA 2FTMA 4JYTA 5B6OA 3O8DA 3TJOA 1P0SH 1TNJA 1C2DA 2OD3B 5CMXH 1BHXB 1S82A 1W0YH 3PLBA 3ZZCA 5JBCS 5LPFA 2FOEA 3SV7A 1C1PA 2H2ZA 2GMTB 1C9TA 1DDJA 2ZGHA 3EBNA 1AZZA 4FUDA 1UMAH 1SSXA 1ELTA 4ISHH 1DUEA 4FUGA 1FLEE 5DPAA 1LHGH 1HAIH 3E8LA 2F91A 1W10U 1KLIH 1NESE 5IYTA 4BNRA 1GI2A 1B5GH 4E06H 4AYVB 3GCNA 2B0FA 4MPUA 1O5EH 1RRKA 2C93B 4GUXA 2PSYA 1LMWB 9LPRA 3MTYA 3N7OA 1BTYA 1BIOA 1O3NA 5L2ZH 1O2MA 1E37B 7GCHG 3U8OH 4Q2KA 1D3PB 4YT6H 1N8OC 3GCTG 2J94A 1TNIA 3RXEA 1G2MA 1J15A 5DG6A 3LIWA 3Q77A 1GBFA 3ZYDA 2XBWA 4UE7H 4ABGA 2A4OA 1Q31A 1O3PB 3VB5A 3TK5A 3MNCA 1PQ7A 3LH1A 3P92A 1P9UA 1AE5A 2VGCC 1QJ7B 3M3VA 1TGSZ 2P8OC 3GDSA 4DG4A 1RJXB 3B8JA 3Q3XA 4H4FA 4CREA 1QFKH 1VJ9U 2ZFPH 3W95A 2ODQA 1TX7A 1KDQB 3BTQE 4WJG2 1ZTKA 5C67A 3PM3A 1UTMA 1C5VA 1F2SE 1YPKH 1V2OT 1O3LA 1OWEA 1QR3E 3P8GA 2CXVA 1V2VT 1SGQE 1GHAG 2ZQ1A 3P70B 4MQAA 3T62A 1A5GH 2Y7ZA 2EEKA 4CRAA 3SUFA 1A61H 3QK1A 2XXLA 4B73A 3ATMA 1XKAC 4THNH 4Z0KA 4ZKSU 3GYLB 4DIHH 1C1TA 3VB3A 1KXDA 2FI4E 2D26C 5A8ZA 4UDWH 1C5NH 2W7SA 1HJ9A 2ZU3A 1H8IH 4XFQA 1O2TA 2V0BA 2C90B 1TA2A 1OKXA 1GI9B 2ZU4A 2BVRH 1C9PA 1BQYA 5EPNA 4RSPA 2JKHA 2FS9A 1LHCH 1FY3A 1AKSA 1O3MA 3ATLA 4NIYA 3ZZ9A 1OP2A 2AGGX 3BTTE 4K8YA 2YNBA 3QZQA 1N8OB 4X8SH 1ETTH 1U6QA 1S6FA 3LDXH 5EQSA 4CBOA 5JBTA 4DW2U 3E3TA 2VVUA 4YOGA 2PUQH 4R0IA 1AUTC 4YLUA 2B7DH 3UQOA 4AFZA 2G52A 1IQEA 2VIDA 1M9UA 1SQAA 2ZDNA 1HCGA 4QT8C 2XTTB 2C8ZB 2VGCB 4J2YB 1BCUH 2P8OB 1XUJA 3S7HB 1AVGH 1O2RA 1GCDA 1P2QA 3URCA 1GMCF 4FU8A 1WUNH 1LO6A 2VIVA 5HM2A 5FX6A 1HV7A 2ZG0H 1CQQA 2P3UB 3RM0H 1TFXA 4K8BA 1V6DA 1P3EA 1HGTH 3A89A 2A32A 4NIXA 4NSYA 2ZIQH 2GKVE 2ZHQH 1H9HE 3SNCA 3T2NA 1TRMA 2TIOA 3RDZA 2FYQA 3NKKA 3PWBA 1DT2A 1Z8GA 1YPHE 5FCRA 1EZUC 3RXMA 3KQCA 3SHAH 4ZKOU 1D9IA 1S83A 2G00A 2FI5E 3OYPA 2ANKH 1FY5A 1W12U 2O8WA 4WMDA 1H8DH 5LH8A 2BLWA 1K22H 3UREA 2XC0A 1MKXH 3E90B 1NU7B 1QNJA 2GDEH 4I32A 3PMBB 2SGEE 4BTIB 1HNEE 1TGBA 2ZGBH 2F3CE 2UWLA 2PLXA 3UNSA 8GCHG 2Z7FE 5DP4A 4ESTE 1LQDB 4K1EA 2HOBA 1FXYA 3DFLA 2R3YA 2XRCA 3MNSA 3K65B 1THRH 1TOCB 5A09A 5JPMH 4AN7A 2C3SA 3SJ8A 3RMOH 1AHTH 2H9EH 2BY9X 2A4QA 3AAVA 1QBNA 1IQFA 2VWOA 4TY7A 3KGPA 5T6FA 1AN1E 2QC2A 5E0JA 1C2LA 1RTFB 1RFNA 3F9EA 2M5TA 3TNTA 2FI3E 1O3IA 1TQ0B 1P2MA 1C2FA 2SFAA 2BDIA 3BTME 4BTUB 3QN7A 2TGDA 4B2BA 2HWLB 1N1LA 1DPOA 3UNQA 2P94A 3SORA 3M5NA 2GGVB 4WH8A 1ORFA 2GCHF 3TIUA 1ARCA 1TNKA 1ESTA 2ZP0H 4BAKB 4AB9A 5AFYH 1VR1H 4Q7ZA 3HGPA 1K1IA 1ELCA 3KN2A 3LGWA 4ZHLU 9ESTA 4ABEA 1DVAH 4B75A 3RLWH 2AMDA 3SV9A 1DXPA 1QL9A 3PWCA 4UFFH 4FUIA 3PMJA 4GPGA 1OOKB 7ESTE 3ZYEA 2WPHS 4IGDA 3HATH 3A8CA 1TE0A 4HFPB 4ABHA 1XXDA 3HKJB 1XUGA 4IC5A 3M7TA 4CH2B 4YO9A 1TALA 3SQEE 1O5BB 1ANDA 1NU9A 4CRFA 1QBVH 1WSSH 1HAYB 3A7ZA 5E8EH 1ZSKA 3SU5A 1A3EH 2PKAB 5LGOA 2OBOA 2UWOA 1PYTD 4X2YA 2DUCA 1TPPA 1OX1A 4GHQA 1WU1A 2CGAA 1D4PB 2ZKSA 1FN8A 1V2MT 4X8TH 3SU1A 2Z9IA 2B5TB 2BD7A 1MU6B 2XCFA 2BY8X 5C20A 4IN1A 1FI8A 1D6WA 1THSH 2BDCA 1G9IE 1UVSH 4FUHA 5C1YA 2RDLA 6LPRA 3MO6A 2AYWA 2BDBA 1YCPH 1PPEE 4GCHG 4IN2A 3DUXH 2IJOB 4I8HA 1GHVH 1T8OA 4NIWA 2K7XA 1DOJA 1SGEE 2VU8E 1L1NA 1G37A 2C8YB 1GDNA 4UFEH 1GHBG 8LPRA 4NA9H 3HK6B 1NS3A 1VCWA 1GMDF 4CBNA 3FVFB 2FODA 4BAQB 3ZZBA 2GZ8A 3UTUH 3MWIU 1DWDH 2XWBI 5T6DA 3P6ZB 2A4GA 1ELBA 1P3CA 1ZHPA 1MTVA 3UPEA 4NWKA 1AMHA 2LPRA 2OQ5A 1GBCA 4DVAU 1SLXB 2TPIZ 4B71A 1CBWC 1YLCA 3UFAA 2F9OA 2FOBA 1TRYA 2WUCA 3F9HA 1LHFH 1P10A 1TABE 1QL8A 4A5TS 1KDQA 5DGJA 1S0QA 1W7GH 2GD4B 2BZAA 1OWDA 4ZH8A 4XSKU 3MMGA 1TWXB 5K0HA 4X1PU 3TPIZ 2QXJA 4OS1A 4X6MA 1J16A 5FPYA 1Z1IA 2QXHA 3RUOA 5EG4A 3PROA 1MKXK 4MDSA 3P8OA 1C1SA 3UOPA 2GVFA 3ZZAA 1GJ5H 2ZGJA 3A7VA 3F68H 4FU9A 3UQVA 3AVZA 1Z8RA 1O3CA 3QZRA 1IQGA 5JDUB 1Z6EA 1HRTH 3VB6A 5C5NA 1TNLA 2ZC9H 1SFIA 5GJ4B 1JRSA 1CO7E 1JBUH 5TCCA 3BN9A 5L6NH 1F5LA 3BV9B 3OSYA 2ZHFH 1S85A 1GHXH 2ZO3H 5EXMA 3L3TA 1DLKB 2ZQ2A 2AIPA 4AZ2B 1PFXC 1YKTA 3BEIB 1A46H 2Y5GA 3P95A 3ZVFA 2PSXA 3NWUA 1EUFA 1AU8A 1QHRB 2CMYA 3ODDA 2BX4A 3MFJA 1P9SA 1FQ3A 2TGAA 1GG6C 3Q3YA 5DP3A 3LU9B 1CBWB 1SGNE 2GV6A 3PO1C 4O3TA 1PYTC 3QLPH 4LK4A 1UK2A 1HAGE 4D9RA 2VWNA 1C2JA 1SGFA 3STJA 1SGIB 2WPKS 2BY7X 3PTNA 1ZTJA 1QTFA 3GY7A 4JYVH 1MCTA 2HNTC 3M37A 4XOJA 1MUEB 1KYNA 2WV5A 2OBQA 4O97A 2J38A 1BHXF 1TONA 3AW1A 1C2HA 1WQVH 3RC6A 1SQTA 3FZDA 1DXWA 1CGIE 1Z6JH 2JETC 4E05H 1DFPA 4DJZB 5FX5A 1NTPA 4ABJA 4KTSA 3SJIA 4AX9H 1GWAA 1O3JA 1CGHA 3LGTA 3ZVGA 1KXEA 5E2PA 1UVPA 3CENA 4X6NA 1O38A 3F9FA 1GVZA 2BDHA 4JK6A 4X2VA 4UD9H 2XC5A 3RXJA 3V0XA 1LVBA 5A0BA 1PPCE 1GJ6A 1X7AC 3DA9B 3FAOA 2GCTC 3MI4A 3V13A 2A0QB 1TLDA 4KTCA 1TAWA 3KHVA 3O8BA 1EASA 1WYKA 1OWIA 3RXOA 1OSSA 1SGTA 1C2GA 1EZSC 2KAIA 3MU4A 3O8RA 1W11U 2QIQA 3GCOA 1AI8H 3FZZA 3LJJA 1C2MA 1GG6B 1AY6H 1ID5H 1O5GH 1EAXA 1BRAA 3S0NA 3UY9A 3IWMA 5T6GA 1Z8IB 3PO1B 1J9CH 1H1BA 1UTKA 2QXIA 1YCPK 1IOEA 3SOSA 2BYAX 3M5LA 3ZVBA 2FLRH 1H9IE 1LVMA 1GBJA 1C4Y2 1ZHMA 1HDTH 1O2XA 1P02A 4Y0YE 3TK6A 4BAHB 1HAPH 4I8GA 2SNWA 1N6YA 4BXSA 3PV4A 3SGBE 2PFEA 3BTKE 4TPIZ 2Y5HA 1BBRH 2JETB 1V2WT 4MNVA 1ANBA 4NSVA 2ASUB 1TNHA 2ZHWH 5TCAA 3T28A 1WTHD 4WXIA 2THFB 1GJ4H 2Z9GA 1O3EA 5HMAA 1BJUA 1YPLH 1BMLA 1MKWH 1HFDA 1ELAA 7GCHF 1FIWA 3M5MA 3MU5A 3UR6A 5ABWA 1O2LA 1BZXE 1BT7A 3GY8A 1ETSH 3M35A 1BUIA 3T26A 1BA8B 2GCTB 1GI8B 5DP8A 2ZPQA 2BD5A 1GI3A 1Z71A 5A0CA 2FS8A 4K1TA 3P8FA 4JZEH 2A7CA 4IW4E 2P93A 4X0WU 3RXTA 1GBIA 3RU4T 4U30A 3EYDA 4Y0ZE 2ZZUH 2PKAA 1GJAB 1V2QT 2FMJA 5A8XA 2F9PA 3G01A 2ODPA 1PPGE 1MTNC 3ESTA 6CHAC 5I25A 2SNVA 1A0LA 1GHAF 3ATKA 1B7XB 4UFGH 3RXKA 1QL7A 1HIAB 1D3TB 1WOFA 2EC9H 2RA0A 3SGAE 3T29A 3CP7A 1FDPA 1K1JA 4NGAH 4YT7H 1FY4A 3RXCA 2PKSC 4D76A 2ILNA 3O8CA 2FXRA 1IQJA 3KEEA 2FP7B 1C5YB 1DLEA 1HJAC 4CRCA 4X2XA 4CR9A 1GBHA 1MZDA 2BVSH 1SG8B 3MU8A 1BDAA 3A7TA 4JYUH 1UO6A 1QQ4A 2W5EA 1MQ5A 1EPTA 3BTHE 3U1IB 3DT0H 1G3EA 1RIWC 1GJBB 5C3NA 2PR3A 1UVOA 4Z6AH 1THPB 4X8VH 1FAKH 1Z8JB 4ZHMU 3RMMH 1C5PA 2OLGA 3DFJA 1GMHG 2OTVA 1SQOA 5EW1H 1JIMA 1V2KT 1RTKA 2BOHB 3QTVH 1SGDE 3SV8A 2F9UA 1Y3XA 1C5SA 1HYLA 4A92A 4AG1A 1IHSH 1O37A