2Z9UA

Crystal structure of pyridoxamine-pyruvate aminotransferase from mesorhizobium loti at 2.0 a resolution
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
392
structure length
392
Chain Sequence
MRYPEHADPVITLTAGPVNAYPEVLRGLGRTVLYDYDPAFQLLYEKVVDKAQKAMRLSNKPVILHGEPVLGLEAAAASLISPDDVVLNLASGVYGKGFGYWAKRYSPHLLEIEVPYNEAIDPQAVADMLKAHPEITVVSVCHHDTPSGTINPIDAIGALVSAHGAYLIVDAVSSFGGMKTHPEDCKADIYVTGPNKCLGAPPGLTMMGVSERAWAKMKANPLAPRASMLSIVDWENAWSRDKPFPFTPSVSEINGLDVALDLYLNEGPEAVWARHALTAKAMRAGVTAMGLSVWAASDSIASPTTTAVRTPDGVDEKALRQAARARYGVVFSSGRGETLGKLTRIGHMGPTAQPIYAIAALTALGGAMNAAGRKLAIGKGIEAALAVIDADA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of pyridoxamine-pyruvate aminotransferase from Mesorhizobium loti MAFF303099
pubmed doi rcsb
source organism Mesorhizobium loti
molecule tags Transferase
molecule keywords Aspartate aminotransferase
total genus 142
structure length 392
sequence length 392
chains with identical sequence B
ec nomenclature ec 2.6.1.30: Pyridoxamine--pyruvate transaminase.
pdb deposition date 2007-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00266 Aminotran_5 Aminotransferase class-V
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 2z9uA02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 2z9uA01
5HXXA 1LW4A 1PG8A 2CB1A 4A72A 2VMZA 2PB2A 3FDBA 4ZSYA 1IAXA 5G4IA 3DODA 4WB0B 9AATA 1AMSA 1IX8A 4FFCA 3KKIA 4R8DA 1D7UA 2Z1YA 4XJMA 3RCHB 1EG5A 2VIAA 1V2DA 4ZAHA 5M46A 1M32A 1V2EA 2ZSLA 4W1WA 2Z67A 3F0HA 1GC4A 3FCRA 3ISLA 3NU7A 1WKGA 3EUCA 4WYDA 2D64A 3NUIA 4GDYA 4LW4A 2D7ZA 1M6SA 1FG7A 3LY1A 2HUUA 2W7LA 3R4TA 2VGUA 4JEXA 1XEYA 2W7EA 1OXPA 3ZZJA 4W5KA 1MAPA 2DKJA 3PDXA 1DJUA 2C0RA 2YCNA 3IHJA 3KGXA 2YKUA 5FT4A 3PGYA 7AATA 1AIBA 2V0YA 3A8UX 3ATHA 3NDNA 3UAKA 1YAAA 3G8MA 4TMRA 4Y0IA 1YIYA 4A6UA 1CQ7A 3DZZA 3NRAA 3ACZA 1M0NA 4ITGA 2W7KA 4CBRA 3BWNA 2ZY5A 1JG8A 3ZRQA 3H7FA 1SF2A 4TV7A 1TATA 3II0A 3A9XA 2FNIA 2JISA 5G0AA 4ATPA 1CL2A 1W7MA 4EU1A 4GSAA 2RFVA 2EZ2A 1AHGA 2D61A 3BCXA 3E2YA 1I41A 1H0CA 4XQ2A 4WP0A 1D7RA 5E4ZA 1V72A 4ZM3A 1I29A 4E77A 4F5GA 4OTLA 3FSLA 1C7OA 1AHXA 4WXGA 3FVUA 1WYVA 1IX7A 3LV2A 5G2QA 1YIZA 2BI3A 2X5FA 4J5UA 4K2IA 4LNJA 2OKKA 2VIBA 5E3KA 1ASFA 2GSAA 2YKXA 3LVKA 4BHDA 2VMRA 2HP1A 1MDOA 1TASA 1TOJA 2X3LA 3FQ8A 5K8BA 1AJRA 1IBJA 1DGEA 3WX9A 1AIAA 3A2BA 3PJ0A 1IVRA 2YCTA 2BIEA 4LNLA 1WYTA 4PFNA 3AV7A 3USFA 1V2FA 3WZFA 1B4XA 4LW2A 1OATA 4H51A 4ADBA 3LG0A 4A6RA 1UKJA 3MC6C 2NMPA 4TN4A 1S06A 4R2NA 4ADDA 1GEWA 3HQTA 2QB3A 1BQDA 1MLZA 3AEMA 1QZ9A 2VI8A 3A9YA 3A9ZA 2O7CA 2OATA 3K28A 2W7HA 1C7NA 5G4JA 3GETA 4UHNA 2ZJGA 3JU7A 1VEFA 1AHYA 1BQAA 1AHFA 2W8VA 4RM1A 4UQVA 1U08A 1DJEA 3E2ZB 3AEPA 3NUBA 1X2AA 3PAAA 4OT8A 3I4JA 1SZKA 2YKYA 1GC2A 4A6TA 3EIBA 3L8AA 3DC1A 2BHXA 3AEJC 4N0WA 1CL1A 3VAXA 3RQ1A 1AKAA 1MLYA 3B1CA 1ARSA 3MBBA 4ZWVA 4U1TA 5HDMA 5DJ9A 2EO5A 4I8AA 4JE5A 4E3QA 1WKHA 4P7YA 1BT4A 2HUIA 2BYJA 3WKSA 2BWPA 2Z61A 1YNUA 2GQNA 4JEVA 3EI5A 4ZWMA 1GD9A 1C7GA 3F9TA 4ADEA 2ZY2A 2AY7A 3GR9A 4WYFA 5HHYA 3BCBA 1ARGA 3K7YA 4WBTA 4F5JA 4PFFA 1ARHA 1CZCA 2BIAA 2YKVA 3P6KA 2AEUA 1MGVA 2DGMA 2BI5A 4RKCA 4Q75A 4N0BA 4GE9A 4WXFA 2QA3A 2G6WA 3LWSA 2HOZA 1LW5A 2W7MA 4MY5A 4XAUA 4ZSWA 4P3MA 4Q76A 5DX5A 3AOVA 1SZUA 4WLJA 3F6TA 4JF1A 4RLGA 1Z7DA 4RAEA 3TFUA 4RITA 4AZKA 3VK4A 3DXWA 2YCPA 4IXSA 1G4XA 3FTBA 5EUDA 3M5UA 1QISA 1BJNA 1YJZA 4RJYA 4BA4A 3GJUA 4W1XA 2OGAA 4IXZA 3B8XA 2VMUA 3EI6A 2GMSA 3PDBA 4MQQA 1AAWA 1XI9A 5C6UA 1OXOA 3PIUA 1GEXA 1CQ6A 3BN1A 5M4DA 1WYTB 1O62A 1OHWA 1P3WA 4BA5A 2ZY4A 2DKBA 2DGLA 2D63A 3W1JA 1D7SA 5F8VA 2VMXA 2AY3A 2D5YA 1AMQA 3AATA 3AOWA 4ZDOA 3IF2A 2O0RA 1UU1A 1AY4A 1B5PA 1ECXA 4XJPA 2HOYA 4F5HA 1T3IA 4ISYA 1W3UA 2OGEA 4K2BA 2VMWA 4CXQA 1OHVA 1UU0A 2D7YA 4LC3A 4A0GA 2VGZA 3EIAA 1QGNA 3CQ5A 3FZ8A 2CSTA 4F5FA 5IWQA 2W7JA 3B1DA 1AKCA 3ELPA 3L44A 4F4EA 5FT5A 2EPJA 3LVLB 1BKGA 4M2KA 1IAYA 4U2HA 4E3RA 1ARTA 1LC7A 4OYTA 3RBLA 2VYCA 2AY9A 1FG3A 1SZSA 2AY8A 2BI9A 3G7QA 4RIZA 3WKRA 2ZY3A 5FT6A 4HF8A 1ZOBA 3VP6A 2VMTA 1GC3A 1O61A 3MAFA 1ASLA 1LC5A 1TARA 1N2TA 2O1BA 1MDXA 3GSBA 5EUEA 3QM2A 5LHAA 3AEJA 3OP7A 3QN6A 3UE8A 3CAIA 1ASNA 1ASMA 3H14A 4WB0A 2XH1A 1ARIA 3CBFA 5G2PA 4WLHA 4EB7A 1WYUA 4E1OA 1AHEA 1TOKA 3FQAA 1WYUB 4KAMA 5AX8A 1YJSA 3E2ZA 3I16A 4MKJA 3NTJA 1DJ9A 3MAUA 3I5TA 2CJHA 4QGRA 2DGKA 1DTYA 3BWNC 3WLXA 1EJIA 2FYFA 1BS0A 1O69A 5I92A 3ZRRA 5FT8A 1C0NA 2CANA 1YJYA 3FZ6A 2GMUA 3QI6A 1AMAA 5M49A 4OBUA 4CBSA 1B9HA 2OQXA 3DRDA 2AY6A 2EZ1A 2FN6A 1UU2A 1M4NA 3AENB 4IW7A 1AY8A 3FKDA 4JEYA 1X29A 2ZSMA 1IJIA 4Y0HA 1B8GA 1KL1A 2Z9WA 4OCAA 2WK7A 4HVKA 1KKJA 5DB5A 5E5IA 2CY8A 2WK9A 3GZDC 2VLFA 3E77A 3G0TA 4JEWA 3BS8A 4RKDA 3PDBB 1OHYA 4MKKA 1E5EA 1VP4A 3QGUA 4W91A 1CZEA 2AY2A 4WYGA 2R5EA 5TF5A 2BI2A 5BJ3A 1WSTA 4OC9A 4CXRA 4M2JA 4NOGA 1CQ8A 4PVFA 2OKJA 2D66A 3WGCA 2BYLA 2W7FA 3E2FA 5EAAA 1MAQA 3FVSA 3T32A 2TPLA 1KMJA 1ELUA 1KL2A 1PMOA 4R5ZA 2BIGA 1TOGA 3GZCA 1QJ5A 4A0HA 2R2NA 3BCAA 1QJ3A 2Q7WA 3VK3A 1QIRA 3BB8A 3NX3A 5EIGB 4IX8A 2ZC0A 2R5CA 1G4VA 3HDOA 1G7XA 1AX4A 3ZRPA 2JG2A 1QITA 2VMVA 3EI8A 5D5SA 3CQ4A 4O6ZA 1S09A 2E7JA 4ZLVA 2JGTA 1AICA 4B9BA 2VLHA 1E5FA 3QPGA 2PB0A 4A0FA 5BJ4A 1Y4IA 3MAFB 2V1PA 1W7LA 3BC8A 2AEVA 4IXOA 3NU8A 1MDZA 1M7YA 3FQ7A 1RVUA 4AO4A 4AZJA 2VMNA 3BWOA 1ZODA 3ASBA 3JW9A 3WY7A 1DGDA 3NYTA 2CJDA 4JF0A 2BWOA 4WXBA 1B9IA 1W7NA 5LH9A 3JWBA 1KMKA 3FD0A 4ATQA 4ZM4A 1H1CA 2C81A 1ASDA 1AJSB 2W8TA 1D7VA 2HZPA 4ADCA 2E7IA 2BWNA 1BW0A 1TOEA 4A0RA 2BI1A 5M4BA 3GBXA 3FDDA 3ECDA 1FC4A 4ZASA 1AAMA 4F5LA 3TATA 2Z20A 1DFOA 3COGA 4IYOA 1EQBA 3K40A 1SVVA 4W8IA 1RV4A 2QLRA 3AELA 3E6GA 5EFSA 4OBVA 2JJFA 1ASAA 2AY5A 1KKPA 2VGVA 3RUYA 3AENA 1B5OA 2CJGA 3NYSA 4KXKA 4WD2A 3PA9A 3D6KA 4JEZA 2Z9UA 4LNMA 2CTZA 2VI9A 1RV3A 3B46A 3LVMA 4Q31A 4WYEA 2C7TA 1ASGA 2E54A 3GWPA 3DR7A 4EMYA 3QHXA 1N8PA 3MADA 1ASCA 4PIWA 3FRKA 2ORDA 4ITXA 2VMPA 4XEWA 4BMKA 3JTXA 3MKJA 4EB5A 1PMMA 4WYAA 3RCHA 3ELEA 2VMSA 2W7GA 1BJ4A 4EFFA 2CFBA 4MSOA 3HMUA 4W1VA 2BKWA 2DOUA 1IUGA 3PD6A 4M2MA 2F8JA 1C9CA 1GDEA 1DKAA 3DXVA 3QBOA 2X5DA 5DJ1A 8AATA 3MC6A 3PPLA 1CJ0A 1GCKA 2YRRA 3DU4A 4Y0DA 3ZZKA 1M0QA 1CS1A 1LKCA 1ORDA 2HUFA 4F5IA 4MQPA 4L0OA 5F9SA 3LVJA 2EGYA 2R5CB 3EI9A 1M0PA 2QB2A 4A00A 1BJOB 2X8UA 2FNUA 3ASAA 2YOBA 2VGSA 2VMQA 4J8LA 4MGRA 2D65A 3P1TA 3RBFA 2ZUKA 3HT4A 4GRXA 4GE7A 4XJLA 1PFFA 1TPLA 1ZC9A 3B1EA 4JE5D 3HVYA 3FFRA 1M0OA 2W8UA 4UHMA 1ASEA 2AY1A 4F5MA 3E9KA 2JJHA 4OMAA 4ZDLA 4XJOA 1X0MA 2EH6A 3WGBA 2HP2A 5G09A 3AEOA 4CVQA 2FM1A 1Z3ZA 5D95A 5EIGA 2QMAA 1SPAA 3OKSA 4RJ0A 3RI6A 1I43A 1AY5A 1WYVB 4MQRA 2YRIA 4XK1A 1J04A 3DR4A 3VK2A 4AO9A 1S0AA 2WKAA 1J32A 4B98A 1AMRA 4UOYA 4FL0A 5EQCA 2ZP7A 3WCNA 2HORA 1D2FA 2W7DA 1SFFA 5J8QA 1S07A 2W8WA 4GEBA 1GC0A 1VJOA 1LK9A 4IY7A 3NYUA 1W23A 3TCMA 2E7UA 1JS6A 1JS3A 4AOAA 2R0TA 3UWCA 3W1IA 1ASBA 1LC8A 3N0LA 2DR1A 1ELQA 3BV0A 2FQ6A 1LS3A 3FVXA 3HLMA 3JZLA 3FFHA 3TQXA 1S08A 1YOOA 2HOXA 1GEYA 3N75A 4R5FA 3R9AA 1AJSA 3KE3A 3CQ6A 1X28A 2XBNA 3JWAA 2QBTA 3VOMA 1O4SA 1G7WA 3GZDA 2VMOA 3EZ1A 1N31A 3EZSA 2Z9VA 5EAVA 4DBCA 4IYOB 2AATA 2AY4A 2CH1A 4AH3A 2VGTA 1BJWA 4Q6RA 4DQ6A 3KGWA 3MEBA 2PO3A 2CH2A 2GB3A 2ZYJA 3HBXA 3DYDA 1RVYA 3TFTA 3W1HA 4KYOA 5EUNA 3N5MA 1TOIA 4BQ0A 3WCOA 4DGTA 4WYCA 1GBNA 2JJEA 4GE4A 2YHKA 3PD6B 4F5KA 1I48A 1AKBA 3EI7A 2VMYA 5JAYA 1JF9A 2W8JA 3FZ7A 3AEMC 3Q8NA 2W7IA 2C44A 2CINA 1IX6A 4K2MA 2VGWA 4ZDPA 4UHOA 2WK8A 3NNKA 2JJGA 2Z1ZA 2Z9XA 3HL2A 1C4KA 1BJOA
chains in the Genus database with same CATH superfamily
5HXXA 1LW4A 1PG8A 2CB1A 4A72A 2VMZA 2PB2A 3FDBA 4ZSYA 1IAXA 5G4IA 3DODA 4WB0B 9AATA 1AMSA 1IX8A 4FFCA 3KKIA 4R8DA 1D7UA 2Z1YA 4XJMA 3RCHB 1EG5A 2VIAA 1V2DA 4ZAHA 5M46A 1M32A 1V2EA 2ZSLA 4W1WA 2Z67A 3F0HA 1GC4A 3FCRA 3ISLA 3NU7A 1WKGA 3EUCA 4WYDA 2D64A 3NUIA 4GDYA 4LW4A 2D7ZA 1M6SA 1FG7A 3LY1A 2HUUA 2W7LA 3R4TA 2VGUA 4JEXA 1XEYA 4K05A 2W7EA 1OXPA 3ZZJA 4W5KA 1MAPA 2DKJA 3PDXA 1DJUA 2C0RA 2YCNA 3IHJA 3KGXA 2YKUA 5FT4A 3PGYA 7AATA 1AIBA 2V0YA 3A8UX 3ATHA 3NDNA 3UAKA 1YAAA 3G8MA 4TMRA 4Y0IA 1YIYA 4A6UA 1CQ7A 3DZZA 3NRAA 3ACZA 1M0NA 4ITGA 2W7KA 4CBRA 3BWNA 2ZY5A 1JG8A 3ZRQA 3H7FA 1SF2A 4TV7A 1TATA 3II0A 3A9XA 2FNIA 2JISA 5G0AA 4ATPA 1CL2A 1W7MA 4EU1A 4GSAA 2RFVA 2EZ2A 1AHGA 2D61A 3BCXA 3E2YA 1I41A 1H0CA 4XQ2A 4WP0A 1D7RA 5E4ZA 1V72A 4ZM3A 1I29A 4E77A 4F5GA 4OTLA 3FSLA 1C7OA 1AHXA 4WXGA 3FVUA 1WYVA 1IX7A 3LV2A 5G2QA 1YIZA 2BI3A 2X5FA 4J5UA 4K2IA 4LNJA 2OKKA 2VIBA 5E3KA 1ASFA 2GSAA 2YKXA 3LVKA 4BHDA 2VMRA 2HP1A 1MDOA 1TASA 1TOJA 2X3LA 3FQ8A 5K8BA 1AJRA 1IBJA 1DGEA 3WX9A 1AIAA 3A2BA 3PJ0A 1IVRA 2YCTA 2BIEA 4LNLA 1WYTA 4PFNA 3AV7A 3USFA 1V2FA 3WZFA 1B4XA 4LW2A 1OATA 4H51A 4ADBA 3LG0A 4A6RA 1UKJA 3MC6C 2NMPA 4TN4A 1S06A 4R2NA 4ADDA 1GEWA 3HQTA 2QB3A 1BQDA 1MLZA 3AEMA 1QZ9A 2VI8A 3A9YA 3A9ZA 2O7CA 2OATA 3K28A 2W7HA 1C7NA 5G4JA 3GETA 4UHNA 2ZJGA 3JU7A 1VEFA 1AHYA 1BQAA 1AHFA 2W8VA 4RM1A 4UQVA 1U08A 1DJEA 3E2ZB 3AEPA 3NUBA 1X2AA 3PAAA 4OT8A 3I4JA 1SZKA 2YKYA 1GC2A 4A6TA 3EIBA 3L8AA 3DC1A 2BHXA 3AEJC 4N0WA 1CL1A 3VAXA 3RQ1A 1AKAA 1MLYA 3B1CA 1ARSA 3MBBA 4ZWVA 4U1TA 5HDMA 5DJ9A 2EO5A 4I8AA 4JE5A 4E3QA 1WKHA 4P7YA 1BT4A 2HUIA 2BYJA 3WKSA 2BWPA 2Z61A 1YNUA 2GQNA 4JEVA 3EI5A 4ZWMA 1GD9A 1C7GA 3F9TA 4ADEA 2ZY2A 2AY7A 3GR9A 4WYFA 5HHYA 3BCBA 1ARGA 3K7YA 4WBTA 4F5JA 4PFFA 1ARHA 1CZCA 2BIAA 2YKVA 3P6KA 2AEUA 1MGVA 2DGMA 2BI5A 4RKCA 4Q75A 4N0BA 4GE9A 4WXFA 2QA3A 2G6WA 3LWSA 2HOZA 1LW5A 2W7MA 4MY5A 4XAUA 4ZSWA 4P3MA 4Q76A 5DX5A 3AOVA 1SZUA 4WLJA 3F6TA 4JF1A 4RLGA 3N4SA 1Z7DA 4RAEA 3TFUA 4RITA 4AZKA 3VK4A 3DXWA 2YCPA 4IXSA 1G4XA 3FTBA 5EUDA 3M5UA 1QISA 1BJNA 1YJZA 4RJYA 3N4RA 4BA4A 3GJUA 4W1XA 2OGAA 4IXZA 3B8XA 2VMUA 3EI6A 2GMSA 3PDBA 4MQQA 1AAWA 1XI9A 5C6UA 1OXOA 3PIUA 1GEXA 1CQ6A 3BN1A 5M4DA 1WYTB 1O62A 1OHWA 1P3WA 4BA5A 2ZY4A 2DKBA 2DGLA 2D63A 3W1JA 1D7SA 5F8VA 2VMXA 2AY3A 2D5YA 1AMQA 3AATA 3AOWA 4ZDOA 3IF2A 2O0RA 1UU1A 1AY4A 1B5PA 1ECXA 4XJPA 2HOYA 4F5HA 1T3IA 2FKIA 4ISYA 1W3UA 2OGEA 4K2BA 2VMWA 4CXQA 1OHVA 1UU0A 2D7YA 4LC3A 4A0GA 2VGZA 3EIAA 1QGNA 3CQ5A 3FZ8A 2CSTA 4F5FA 5IWQA 2W7JA 3B1DA 1AKCA 3ELPA 3L44A 4F4EA 5FT5A 2EPJA 3LVLB 1BKGA 4M2KA 1IAYA 4U2HA 4E3RA 1ARTA 1LC7A 4OYTA 3RBLA 2VYCA 2AY9A 1FG3A 1SZSA 2AY8A 2BI9A 3G7QA 4RIZA 3WKRA 2ZY3A 5FT6A 4HF8A 1ZOBA 3VP6A 2VMTA 1GC3A 1O61A 3MAFA 1ASLA 1LC5A 1TARA 1N2TA 2O1BA 1MDXA 3GSBA 5EUEA 3QM2A 5LHAA 3AEJA 3OP7A 3QN6A 3UE8A 3CAIA 1ASNA 1ASMA 3H14A 4WB0A 2XH1A 1ARIA 3CBFA 5G2PA 4WLHA 4EB7A 1WYUA 4E1OA 1AHEA 1TOKA 3FQAA 2KFPA 1WYUB 4KAMA 5AX8A 1YJSA 3E2ZA 3I16A 4MKJA 3NTJA 1DJ9A 3MAUA 3I5TA 2CJHA 4QGRA 2DGKA 1DTYA 3BWNC 3WLXA 1EJIA 2FYFA 1BS0A 2EYQA 1O69A 5I92A 3ZRRA 5FT8A 1C0NA 2CANA 1YJYA 3FZ6A 2GMUA 3QI6A 1AMAA 5M49A 4OBUA 4CBSA 1B9HA 2OQXA 3DRDA 2AY6A 2EZ1A 2FN6A 1UU2A 1M4NA 3AENB 4IW7A 1AY8A 3FKDA 4JEYA 1X29A 2ZSMA 1IJIA 4Y0HA 1B8GA 1KL1A 2Z9WA 4OCAA 2WK7A 4HVKA 1KKJA 2WB6A 5DB5A 5E5IA 2CY8A 2WK9A 3N7NA 3GZDC 2VLFA 2A1VA 3E77A 3G0TA 4JEWA 3BS8A 4RKDA 3PDBB 1OHYA 4MKKA 1E5EA 1VP4A 3QGUA 4W91A 1CZEA 2AY2A 4WYGA 2R5EA 5TF5A 2BI2A 5BJ3A 1WSTA 4OC9A 4CXRA 4M2JA 4NOGA 5KTBA 1CQ8A 4PVFA 2OKJA 2D66A 3WGCA 2BYLA 2W7FA 3E2FA 5EAAA 2QSRA 1MAQA 3FVSA 3T32A 2TPLA 1KMJA 1ELUA 1KL2A 1PMOA 4R5ZA 2BIGA 1TOGA 3GZCA 1QJ5A 4A0HA 2R2NA 3BCAA 1QJ3A 2Q7WA 3VK3A 1QIRA 3BB8A 3NX3A 5EIGB 4IX8A 2ZC0A 2R5CA 1G4VA 3HDOA 1G7XA 1AX4A 3ZRPA 1KAFA 2JG2A 1QITA 2VMVA 3EI8A 5D5SA 3CQ4A 4O6ZA 1S09A 2E7JA 4ZLVA 2JGTA 1AICA 4B9BA 2VLHA 1E5FA 3QPGA 2PB0A 4A0FA 5BJ4A 1Y4IA 3MAFB 2V1PA 1W7LA 3BC8A 2AEVA 4IXOA 3NU8A 1MDZA 1M7YA 3FQ7A 1RVUA 4AO4A 4AZJA 2VMNA 3BWOA 1ZODA 3ASBA 3JW9A 3WY7A 1DGDA 3NYTA 2CJDA 4JF0A 2BWOA 4WXBA 1B9IA 1W7NA 5LH9A 3JWBA 1KMKA 3FD0A 4ATQA 4ZM4A 1H1CA 2C81A 1ASDA 1AJSB 2W8TA 1D7VA 2HZPA 4ADCA 2E7IA 2BWNA 1BW0A 1TOEA 4A0RA 2BI1A 5M4BA 3GBXA 3FDDA 3ECDA 1FC4A 4ZASA 1AAMA 4F5LA 3TATA 2Z20A 1DFOA 3COGA 4IYOA 1EQBA 3K40A 1SVVA 4W8IA 1RV4A 2QLRA 3AELA 3E6GA 5EFSA 4OBVA 2JJFA 1ASAA 3N4XA 2AY5A 1KKPA 2VGVA 3RUYA 3AENA 1B5OA 2CJGA 3NYSA 4KXKA 4WD2A 3PA9A 3D6KA 4JEZA 2Z9UA 4LNMA 2CTZA 2VI9A 1RV3A 3B46A 3LVMA 4Q31A 4WYEA 2C7TA 1ASGA 2E54A 3GWPA 3DR7A 4EMYA 3QHXA 1N8PA 3MADA 1ASCA 4PIWA 3FRKA 2ORDA 4ITXA 2VMPA 4XEWA 4BMKA 3JTXA 3MKJA 4EB5A 1PMMA 4WYAA 3RCHA 3ELEA 2VMSA 2W7GA 1BJ4A 4EFFA 2CFBA 4MSOA 3HMUA 4W1VA 2BKWA 2DOUA 1IUGA 3PD6A 4M2MA 2F8JA 1C9CA 1GDEA 1DKAA 3DXVA 3QBOA 2X5DA 5DJ1A 8AATA 3MC6A 3PPLA 1CJ0A 1GCKA 2YRRA 3DU4A 4Y0DA 3ZZKA 1M0QA 1CS1A 2G7JA 1LKCA 1ORDA 2HUFA 4F5IA 4MQPA 4L0OA 5F9SA 3LVJA 2EGYA 2R5CB 3EI9A 1M0PA 2QB2A 4A00A 1BJOB 2X8UA 2FNUA 3ASAA 2YOBA 2VGSA 2VMQA 4J8LA 4MGRA 2D65A 3P1TA 3RBFA 2ZUKA 3HT4A 4GRXA 4GE7A 4XJLA 1PFFA 1TPLA 1ZC9A 3B1EA 4JE5D 3HVYA 3FFRA 1M0OA 2W8UA 4UHMA 1ASEA 2AY1A 4F5MA 3E9KA 2JJHA 4OMAA 4ZDLA 4XJOA 1X0MA 2EH6A 3WGBA 2HP2A 5G09A 3AEOA 4CVQA 2FM1A 1Z3ZA 5D95A 5EIGA 2QMAA 1SPAA 3OKSA 4RJ0A 3RI6A 1I43A 1AY5A 1WYVB 4MQRA 2YRIA 4XK1A 1J04A 3DR4A 3VK2A 4AO9A 1S0AA 2WKAA 1J32A 4B98A 1AMRA 4UOYA 4FL0A 5EQCA 2ZP7A 3WCNA 2HORA 1D2FA 2W7DA 1SFFA 5J8QA 1S07A 2W8WA 4GEBA 1GC0A 1VJOA 1LK9A 4IY7A 3NYUA 1W23A 3TCMA 2E7UA 1JS6A 1JS3A 4AOAA 2R0TA 3UWCA 3W1IA 1ASBA 1LC8A 3N0LA 2DR1A 1ELQA 3BV0A 2FQ6A 1LS3A 3FVXA 3HLMA 3JZLA 3FFHA 3TQXA 1S08A 1YOOA 2HOXA 1GEYA 3N75A 4R5FA 3R9AA 1AJSA 3KE3A 3CQ6A 1X28A 2XBNA 3JWAA 2QBTA 3VOMA 1O4SA 1G7WA 3GZDA 2VMOA 3EZ1A 3H9XA 1N31A 3EZSA 2Z9VA 5EAVA 4DBCA 4IYOB 2AATA 2AY4A 2CH1A 4AH3A 2VGTA 1BJWA 4Q6RA 4DQ6A 3KGWA 3MEBA 2PO3A 2CH2A 2GB3A 2ZYJA 3HBXA 3DYDA 1RVYA 3TFTA 3W1HA 4KYOA 5EUNA 3N5MA 1TOIA 4BQ0A 3WCOA 4DGTA 4WYCA 1GBNA 2JJEA 4GE4A 2YHKA 3PD6B 4F5KA 1I48A 1AKBA 3EI7A 2VMYA 5JAYA 1JF9A 2W8JA 3FZ7A 3AEMC 3Q8NA 2W7IA 2C44A 2CINA 1IX6A 4K2MA 2VGWA 4H63Q 4ZDPA 4UHOA 2WK8A 3NNKA 2JJGA 2Z1ZA 2Z9XA 3HL2A 1C4KA 1BJOA
chains in the Genus database with same CATH topology
5HXXA 1LW4A 1PG8A 2CB1A 4A72A 2VMZA 2PB2A 3FDBA 4ZSYA 1IAXA 5G4IA 3DODA 4WB0B 9AATA 1AMSA 1IX8A 4FFCA 3KKIA 4R8DA 1D7UA 2Z1YA 4XJMA 3RCHB 1EG5A 2VIAA 1V2DA 4ZAHA 5M46A 1M32A 1V2EA 2ZSLA 4W1WA 2Z67A 3F0HA 1GC4A 3FCRA 3ISLA 3NU7A 1WKGA 3EUCA 4WYDA 2D64A 3NUIA 4GDYA 4LW4A 2D7ZA 1M6SA 1FG7A 3LY1A 2HUUA 2W7LA 3R4TA 2VGUA 4JEXA 1XEYA 4K05A 2W7EA 1OXPA 3ZZJA 4W5KA 1MAPA 2DKJA 3PDXA 1DJUA 2C0RA 2YCNA 3IHJA 3KGXA 2YKUA 5FT4A 3PGYA 7AATA 1AIBA 2V0YA 3A8UX 3ATHA 3NDNA 3UAKA 1YAAA 3G8MA 4TMRA 4Y0IA 1YIYA 4A6UA 1CQ7A 3DZZA 3NRAA 3ACZA 1M0NA 4ITGA 2W7KA 4CBRA 3BWNA 2ZY5A 1JG8A 3ZRQA 3H7FA 1SF2A 4TV7A 1TATA 3II0A 3A9XA 2FNIA 2JISA 5G0AA 4ATPA 1CL2A 1W7MA 4EU1A 4GSAA 2RFVA 2EZ2A 1AHGA 2D61A 3BCXA 3E2YA 1I41A 1H0CA 4XQ2A 4WP0A 1D7RA 5E4ZA 1V72A 4ZM3A 1I29A 4E77A 4F5GA 4OTLA 3FSLA 1C7OA 1AHXA 4WXGA 3FVUA 1WYVA 1IX7A 3LV2A 5G2QA 1YIZA 2BI3A 2X5FA 4J5UA 4K2IA 4LNJA 2OKKA 2VIBA 5E3KA 1ASFA 2GSAA 2YKXA 3LVKA 4BHDA 2VMRA 2HP1A 1MDOA 1TASA 1TOJA 2X3LA 3FQ8A 5K8BA 1AJRA 1IBJA 1DGEA 3WX9A 1AIAA 3A2BA 3PJ0A 1IVRA 2YCTA 2BIEA 4LNLA 1WYTA 4PFNA 3AV7A 3USFA 1V2FA 3WZFA 1B4XA 4LW2A 1OATA 4H51A 4ADBA 3LG0A 4A6RA 1UKJA 3MC6C 2NMPA 4TN4A 1S06A 4R2NA 4ADDA 1GEWA 3HQTA 2QB3A 1BQDA 1MLZA 3AEMA 1QZ9A 2VI8A 3A9YA 3A9ZA 2O7CA 2OATA 3K28A 2W7HA 1C7NA 5G4JA 3GETA 4UHNA 2ZJGA 3JU7A 1VEFA 1AHYA 1BQAA 1AHFA 2W8VA 4RM1A 4UQVA 1U08A 1DJEA 3E2ZB 3AEPA 3NUBA 1X2AA 3PAAA 4OT8A 3I4JA 1SZKA 2YKYA 1GC2A 4A6TA 3EIBA 3L8AA 3DC1A 2BHXA 3AEJC 4N0WA 1CL1A 3VAXA 3RQ1A 1AKAA 1MLYA 3B1CA 1ARSA 3MBBA 4ZWVA 4U1TA 5HDMA 5DJ9A 2EO5A 4I8AA 4JE5A 4E3QA 1WKHA 4P7YA 1BT4A 2HUIA 2BYJA 3WKSA 2BWPA 2Z61A 1YNUA 2GQNA 4JEVA 3EI5A 4ZWMA 1GD9A 1C7GA 3F9TA 4ADEA 2ZY2A 2AY7A 3GR9A 4WYFA 5HHYA 3BCBA 1ARGA 3K7YA 4WBTA 4F5JA 4PFFA 1ARHA 1CZCA 2BIAA 2YKVA 3P6KA 2AEUA 1MGVA 2DGMA 2BI5A 4RKCA 4Q75A 4N0BA 4GE9A 4WXFA 2QA3A 2G6WA 3LWSA 2HOZA 1LW5A 2W7MA 4MY5A 4XAUA 4ZSWA 4P3MA 4Q76A 5DX5A 3AOVA 1SZUA 4WLJA 3F6TA 4JF1A 4RLGA 3N4SA 1Z7DA 4RAEA 3TFUA 4RITA 4AZKA 3VK4A 3DXWA 2YCPA 4IXSA 1G4XA 3FTBA 5EUDA 3M5UA 1QISA 1BJNA 1YJZA 4RJYA 3N4RA 4BA4A 3GJUA 4W1XA 2OGAA 4IXZA 3B8XA 2VMUA 3EI6A 2GMSA 3PDBA 4MQQA 1AAWA 1XI9A 5C6UA 1OXOA 3PIUA 1GEXA 1CQ6A 3BN1A 5M4DA 1WYTB 1O62A 1OHWA 1P3WA 4BA5A 2ZY4A 2DKBA 2DGLA 2D63A 3W1JA 1D7SA 5F8VA 2VMXA 2AY3A 2D5YA 1AMQA 3AATA 3AOWA 4ZDOA 3IF2A 2O0RA 1UU1A 1AY4A 1B5PA 1ECXA 4XJPA 2HOYA 4F5HA 1T3IA 2FKIA 4ISYA 1W3UA 2OGEA 4K2BA 2VMWA 4CXQA 1OHVA 1UU0A 2D7YA 4LC3A 4A0GA 2VGZA 3EIAA 1QGNA 3CQ5A 3FZ8A 2CSTA 4F5FA 5IWQA 2W7JA 3B1DA 1AKCA 3ELPA 3L44A 4F4EA 5FT5A 2EPJA 3LVLB 1BKGA 4M2KA 1IAYA 4U2HA 4E3RA 1ARTA 1LC7A 4OYTA 3RBLA 2VYCA 2AY9A 1FG3A 1SZSA 2AY8A 2BI9A 3G7QA 4RIZA 3WKRA 2ZY3A 5FT6A 4HF8A 1ZOBA 3VP6A 2VMTA 1GC3A 1O61A 3MAFA 1ASLA 1LC5A 1TARA 1N2TA 2O1BA 1MDXA 3GSBA 5EUEA 3QM2A 5LHAA 3AEJA 3OP7A 3QN6A 3UE8A 3CAIA 1ASNA 1ASMA 3H14A 4WB0A 2XH1A 1ARIA 3CBFA 5G2PA 4WLHA 4EB7A 1WYUA 4E1OA 1AHEA 1TOKA 3FQAA 2KFPA 1WYUB 4KAMA 5AX8A 1YJSA 3E2ZA 3I16A 4MKJA 3NTJA 1DJ9A 3MAUA 3I5TA 2CJHA 4QGRA 2DGKA 1DTYA 3BWNC 3WLXA 1EJIA 2FYFA 1BS0A 2EYQA 1O69A 5I92A 3ZRRA 5FT8A 1C0NA 2CANA 1YJYA 3FZ6A 2GMUA 3QI6A 1AMAA 5M49A 4OBUA 4CBSA 1B9HA 2OQXA 3DRDA 2AY6A 2EZ1A 2FN6A 1UU2A 1M4NA 3AENB 4IW7A 1AY8A 3FKDA 4JEYA 1X29A 2ZSMA 1IJIA 4Y0HA 1B8GA 1KL1A 2Z9WA 4OCAA 2WK7A 4HVKA 1KKJA 2WB6A 5DB5A 5E5IA 2CY8A 2WK9A 3N7NA 3GZDC 2VLFA 2A1VA 3E77A 3G0TA 4JEWA 3BS8A 4RKDA 3PDBB 1OHYA 4MKKA 1E5EA 1VP4A 3QGUA 4W91A 1CZEA 2AY2A 4WYGA 2R5EA 5TF5A 2BI2A 5BJ3A 1WSTA 4OC9A 4CXRA 4M2JA 4NOGA 5KTBA 1CQ8A 4PVFA 2OKJA 2D66A 3WGCA 2BYLA 2W7FA 3E2FA 5EAAA 2QSRA 1MAQA 3FVSA 3T32A 2TPLA 1KMJA 1ELUA 1KL2A 1PMOA 4R5ZA 2BIGA 1TOGA 3GZCA 1QJ5A 4A0HA 2R2NA 3BCAA 1QJ3A 2Q7WA 3VK3A 1QIRA 3BB8A 3NX3A 5EIGB 4IX8A 2ZC0A 2R5CA 1G4VA 3HDOA 1G7XA 1AX4A 3ZRPA 2JG2A 1QITA 2VMVA 3EI8A 5D5SA 3CQ4A 4O6ZA 1S09A 2E7JA 4ZLVA 2JGTA 1AICA 4B9BA 2VLHA 1E5FA 3QPGA 2PB0A 4A0FA 5BJ4A 1Y4IA 3MAFB 2V1PA 1W7LA 3BC8A 2AEVA 4IXOA 3NU8A 1MDZA 1M7YA 3FQ7A 1RVUA 4AO4A 4AZJA 2VMNA 3BWOA 1ZODA 3ASBA 3JW9A 3WY7A 1DGDA 3NYTA 2CJDA 4JF0A 2BWOA 4WXBA 1B9IA 1W7NA 5LH9A 3JWBA 1KMKA 3FD0A 4ATQA 4ZM4A 1H1CA 2C81A 1ASDA 1AJSB 2W8TA 1D7VA 2HZPA 4ADCA 2E7IA 2BWNA 1BW0A 1TOEA 4A0RA 2BI1A 5M4BA 3GBXA 3FDDA 3ECDA 1FC4A 4ZASA 1AAMA 4F5LA 3TATA 2Z20A 1DFOA 3COGA 4IYOA 1EQBA 3K40A 1SVVA 4W8IA 1RV4A 2QLRA 3AELA 3E6GA 5EFSA 4OBVA 2JJFA 1ASAA 3N4XA 2AY5A 1KKPA 2VGVA 3RUYA 3AENA 1B5OA 2CJGA 3NYSA 4KXKA 4WD2A 3PA9A 3D6KA 4JEZA 2Z9UA 4LNMA 2CTZA 2VI9A 1RV3A 3B46A 3LVMA 4Q31A 4WYEA 2C7TA 1ASGA 2E54A 3GWPA 3DR7A 4EMYA 3QHXA 1N8PA 3MADA 1ASCA 4PIWA 3FRKA 2ORDA 4ITXA 2VMPA 4XEWA 4BMKA 3JTXA 3MKJA 4EB5A 1PMMA 4WYAA 3RCHA 3ELEA 2VMSA 2W7GA 1BJ4A 4EFFA 2CFBA 4MSOA 3HMUA 4W1VA 2BKWA 2DOUA 1IUGA 3PD6A 4M2MA 2F8JA 1C9CA 1GDEA 1DKAA 3DXVA 3QBOA 2X5DA 5DJ1A 8AATA 3MC6A 3PPLA 1CJ0A 1GCKA 2YRRA 3DU4A 4Y0DA 3ZZKA 1M0QA 1CS1A 2G7JA 1LKCA 1ORDA 2HUFA 4F5IA 4MQPA 4L0OA 5F9SA 3LVJA 2EGYA 2R5CB 3EI9A 1M0PA 2QB2A 4A00A 1BJOB 2X8UA 2FNUA 3ASAA 2YOBA 2VGSA 2VMQA 4J8LA 4MGRA 2D65A 3P1TA 3RBFA 2ZUKA 3HT4A 4GRXA 4GE7A 4XJLA 1PFFA 1TPLA 1ZC9A 3B1EA 4JE5D 3HVYA 3FFRA 1M0OA 2W8UA 4UHMA 1ASEA 2AY1A 4F5MA 3E9KA 2JJHA 4OMAA 4ZDLA 4XJOA 1X0MA 2EH6A 3WGBA 2HP2A 5G09A 3AEOA 4CVQA 2FM1A 1Z3ZA 5D95A 5EIGA 2QMAA 1SPAA 3OKSA 4RJ0A 3RI6A 1I43A 1AY5A 1WYVB 4MQRA 2YRIA 4XK1A 1J04A 3DR4A 3VK2A 4AO9A 1S0AA 2WKAA 1J32A 4B98A 1AMRA 4UOYA 4FL0A 5EQCA 2ZP7A 3WCNA 2HORA 1D2FA 2W7DA 1SFFA 5J8QA 1S07A 2W8WA 4GEBA 1GC0A 1VJOA 1LK9A 4IY7A 3NYUA 1W23A 3TCMA 2E7UA 1JS6A 1JS3A 4AOAA 2R0TA 3UWCA 3W1IA 1ASBA 1LC8A 3N0LA 2DR1A 1ELQA 3BV0A 2FQ6A 1LS3A 3FVXA 3HLMA 3JZLA 3FFHA 3TQXA 1S08A 1YOOA 2HOXA 1GEYA 3N75A 4R5FA 3R9AA 1AJSA 3KE3A 3CQ6A 1X28A 2XBNA 3JWAA 2QBTA 3VOMA 1O4SA 1G7WA 3GZDA 2VMOA 3EZ1A 3H9XA 1N31A 3EZSA 2Z9VA 5EAVA 4DBCA 4IYOB 2AATA 2AY4A 2CH1A 4AH3A 2VGTA 1BJWA 4Q6RA 4DQ6A 3KGWA 3MEBA 2PO3A 2CH2A 2GB3A 2ZYJA 3HBXA 3DYDA 1RVYA 3TFTA 3W1HA 4KYOA 5EUNA 3N5MA 1TOIA 4BQ0A 3WCOA 4DGTA 4WYCA 1GBNA 2JJEA 4GE4A 2YHKA 3PD6B 4F5KA 1I48A 1AKBA 3EI7A 2VMYA 5JAYA 1JF9A 2W8JA 3FZ7A 3AEMC 3Q8NA 2W7IA 2C44A 2CINA 1IX6A 4K2MA 2VGWA 4H63Q 4ZDPA 4UHOA 2WK8A 3NNKA 2JJGA 2Z1ZA 2Z9XA 3HL2A 1C4KA 1BJOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HXX A;  1LW4 A;  1PG8 A;  2CB1 A;  4A72 A;  2VMZ A;  2PB2 A;  3FDB A;  4ZSY A;  1IAX A;  5G4I A;  3DOD A;  4WB0 B;  9AAT A;  1AMS A;  1IX8 A;  4FFC A;  3KKI A;  4R8D A;  1D7U A;  2Z1Y A;  4XJM A;  3RCH B;  1EG5 A;  2VIA A;  1V2D A;  4ZAH A;  5M46 A;  1M32 A;  1V2E A;  2ZSL A;  4W1W A;  2Z67 A;  3F0H A;  1GC4 A;  3FCR A;  3ISL A;  3NU7 A;  1WKG A;  3EUC A;  4WYD A;  2D64 A;  3NUI A;  4GDY A;  4LW4 A;  2D7Z A;  1M6S A;  1FG7 A;  3LY1 A;  2HUU A;  2W7L A;  3R4T A;  2VGU A;  4JEX A;  1XEY A;  2W7E A;  1OXP A;  3ZZJ A;  4W5K A;  1MAP A;  2DKJ A;  3PDX A;  1DJU A;  2C0R A;  2YCN A;  3IHJ A;  3KGX A;  2YKU A;  5FT4 A;  3PGY A;  7AAT A;  1AIB A;  2V0Y A;  3A8U X;  3ATH A;  3NDN A;  3UAK A;  1YAA A;  3G8M A;  4TMR A;  4Y0I A;  1YIY A;  4A6U A;  1CQ7 A;  3DZZ A;  3NRA A;  3ACZ A;  1M0N A;  4ITG A;  2W7K A;  4CBR A;  3BWN A;  2ZY5 A;  1JG8 A;  3ZRQ A;  3H7F A;  1SF2 A;  4TV7 A;  1TAT A;  3II0 A;  3A9X A;  2FNI A;  2JIS A;  5G0A A;  4ATP A;  1CL2 A;  1W7M A;  4EU1 A;  4GSA A;  2RFV A;  2EZ2 A;  1AHG A;  2D61 A;  3BCX A;  3E2Y A;  1I41 A;  1H0C A;  4XQ2 A;  4WP0 A;  1D7R A;  5E4Z A;  1V72 A;  4ZM3 A;  1I29 A;  4E77 A;  4F5G A;  4OTL A;  3FSL A;  1C7O A;  1AHX A;  4WXG A;  3FVU A;  1WYV A;  1IX7 A;  3LV2 A;  5G2Q A;  1YIZ A;  2BI3 A;  2X5F A;  4J5U A;  4K2I A;  4LNJ A;  2OKK A;  2VIB A;  5E3K A;  1ASF A;  2GSA A;  2YKX A;  3LVK A;  4BHD A;  2VMR A;  2HP1 A;  1MDO A;  1TAS A;  1TOJ A;  2X3L A;  3FQ8 A;  5K8B A;  1AJR A;  1IBJ A;  1DGE A;  3WX9 A;  1AIA A;  3A2B A;  3PJ0 A;  1IVR A;  2YCT A;  2BIE A;  4LNL A;  1WYT A;  4PFN A;  3AV7 A;  3USF A;  1V2F A;  3WZF A;  1B4X A;  4LW2 A;  1OAT A;  4H51 A;  4ADB A;  3LG0 A;  4A6R A;  1UKJ A;  3MC6 C;  2NMP A;  4TN4 A;  1S06 A;  4R2N A;  4ADD A;  1GEW A;  3HQT A;  2QB3 A;  1BQD A;  1MLZ A;  3AEM A;  1QZ9 A;  2VI8 A;  3A9Y A;  3A9Z A;  2O7C A;  2OAT A;  3K28 A;  2W7H A;  1C7N A;  5G4J A;  3GET A;  4UHN A;  2ZJG A;  3JU7 A;  1VEF A;  1AHY A;  1BQA A;  1AHF A;  2W8V A;  4RM1 A;  4UQV A;  1U08 A;  1DJE A;  3E2Z B;  3AEP A;  3NUB A;  1X2A A;  3PAA A;  4OT8 A;  3I4J A;  1SZK A;  2YKY A;  1GC2 A;  4A6T A;  3EIB A;  3L8A A;  3DC1 A;  2BHX A;  3AEJ C;  4N0W A;  1CL1 A;  3VAX A;  3RQ1 A;  1AKA A;  1MLY A;  3B1C A;  1ARS A;  3MBB A;  4ZWV A;  4U1T A;  5HDM A;  5DJ9 A;  2EO5 A;  4I8A A;  4JE5 A;  4E3Q A;  1WKH A;  4P7Y A;  1BT4 A;  2HUI A;  2BYJ A;  3WKS A;  2BWP A;  2Z61 A;  1YNU A;  2GQN A;  4JEV A;  3EI5 A;  4ZWM A;  1GD9 A;  1C7G A;  3F9T A;  4ADE A;  2ZY2 A;  2AY7 A;  3GR9 A;  4WYF A;  5HHY A;  3BCB A;  1ARG A;  3K7Y A;  4WBT A;  4F5J A;  4PFF A;  1ARH A;  1CZC A;  2BIA A;  2YKV A;  3P6K A;  2AEU A;  1MGV A;  2DGM A;  2BI5 A;  4RKC A;  4Q75 A;  4N0B A;  4GE9 A;  4WXF A;  2QA3 A;  2G6W A;  3LWS A;  2HOZ A;  1LW5 A;  2W7M A;  4MY5 A;  4XAU A;  4ZSW A;  4P3M A;  4Q76 A;  5DX5 A;  3AOV A;  1SZU A;  4WLJ A;  3F6T A;  4JF1 A;  4RLG A;  1Z7D A;  4RAE A;  3TFU A;  4RIT A;  4AZK A;  3VK4 A;  3DXW A;  2YCP A;  4IXS A;  1G4X A;  3FTB A;  5EUD A;  3M5U A;  1QIS A;  1BJN A;  1YJZ A;  4RJY A;  4BA4 A;  3GJU A;  4W1X A;  2OGA A;  4IXZ A;  3B8X A;  2VMU A;  3EI6 A;  2GMS A;  3PDB A;  4MQQ A;  1AAW A;  1XI9 A;  5C6U A;  1OXO A;  3PIU A;  1GEX A;  1CQ6 A;  3BN1 A;  5M4D A;  1WYT B;  1O62 A;  1OHW A;  1P3W A;  4BA5 A;  2ZY4 A;  2DKB A;  2DGL A;  2D63 A;  3W1J A;  1D7S A;  5F8V A;  2VMX A;  2AY3 A;  2D5Y A;  1AMQ A;  3AAT A;  3AOW A;  4ZDO A;  3IF2 A;  2O0R A;  1UU1 A;  1AY4 A;  1B5P A;  1ECX A;  4XJP A;  2HOY A;  4F5H A;  1T3I A;  4ISY A;  1W3U A;  2OGE A;  4K2B A;  2VMW A;  4CXQ A;  1OHV A;  1UU0 A;  2D7Y A;  4LC3 A;  4A0G A;  2VGZ A;  3EIA A;  1QGN A;  3CQ5 A;  3FZ8 A;  2CST A;  4F5F A;  5IWQ A;  2W7J A;  3B1D A;  1AKC A;  3ELP A;  3L44 A;  4F4E A;  5FT5 A;  2EPJ A;  3LVL B;  1BKG A;  4M2K A;  1IAY A;  4U2H A;  4E3R A;  1ART A;  1LC7 A;  4OYT A;  3RBL A;  2VYC A;  2AY9 A;  1FG3 A;  1SZS A;  2AY8 A;  2BI9 A;  3G7Q A;  4RIZ A;  3WKR A;  2ZY3 A;  5FT6 A;  4HF8 A;  1ZOB A;  3VP6 A;  2VMT A;  1GC3 A;  1O61 A;  3MAF A;  1ASL A;  1LC5 A;  1TAR A;  1N2T A;  2O1B A;  1MDX A;  3GSB A;  5EUE A;  3QM2 A;  5LHA A;  3AEJ A;  3OP7 A;  3QN6 A;  3UE8 A;  3CAI A;  1ASN A;  1ASM A;  3H14 A;  4WB0 A;  2XH1 A;  1ARI A;  3CBF A;  5G2P A;  4WLH A;  4EB7 A;  1WYU A;  4E1O A;  1AHE A;  1TOK A;  3FQA A;  1WYU B;  4KAM A;  5AX8 A;  1YJS A;  3E2Z A;  3I16 A;  4MKJ A;  3NTJ A;  1DJ9 A;  3MAU A;  3I5T A;  2CJH A;  4QGR A;  2DGK A;  1DTY A;  3BWN C;  3WLX A;  1EJI A;  2FYF A;  1BS0 A;  1O69 A;  5I92 A;  3ZRR A;  5FT8 A;  1C0N A;  2CAN A;  1YJY A;  3FZ6 A;  2GMU A;  3QI6 A;  1AMA A;  5M49 A;  4OBU A;  4CBS A;  1B9H A;  2OQX A;  3DRD A;  2AY6 A;  2EZ1 A;  2FN6 A;  1UU2 A;  1M4N A;  3AEN B;  4IW7 A;  1AY8 A;  3FKD A;  4JEY A;  1X29 A;  2ZSM A;  1IJI A;  4Y0H A;  1B8G A;  1KL1 A;  2Z9W A;  4OCA A;  2WK7 A;  4HVK A;  1KKJ A;  5DB5 A;  5E5I A;  2CY8 A;  2WK9 A;  3GZD C;  2VLF A;  3E77 A;  3G0T A;  4JEW A;  3BS8 A;  4RKD A;  3PDB B;  1OHY A;  4MKK A;  1E5E A;  1VP4 A;  3QGU A;  4W91 A;  1CZE A;  2AY2 A;  4WYG A;  2R5E A;  5TF5 A;  2BI2 A;  5BJ3 A;  1WST A;  4OC9 A;  4CXR A;  4M2J A;  4NOG A;  1CQ8 A;  4PVF A;  2OKJ A;  2D66 A;  3WGC A;  2BYL A;  2W7F A;  3E2F A;  5EAA A;  1MAQ A;  3FVS A;  3T32 A;  2TPL A;  1KMJ A;  1ELU A;  1KL2 A;  1PMO A;  4R5Z A;  2BIG A;  1TOG A;  3GZC A;  1QJ5 A;  4A0H A;  2R2N A;  3BCA A;  1QJ3 A;  2Q7W A;  3VK3 A;  1QIR A;  3BB8 A;  3NX3 A;  5EIG B;  4IX8 A;  2ZC0 A;  2R5C A;  1G4V A;  3HDO A;  1G7X A;  1AX4 A;  3ZRP A;  2JG2 A;  1QIT A;  2VMV A;  3EI8 A;  5D5S A;  3CQ4 A;  4O6Z A;  1S09 A;  2E7J A;  4ZLV A;  2JGT A;  1AIC A;  4B9B A;  2VLH A;  1E5F A;  3QPG A;  2PB0 A;  4A0F A;  5BJ4 A;  1Y4I A;  3MAF B;  2V1P A;  1W7L A;  3BC8 A;  2AEV A;  4IXO A;  3NU8 A;  1MDZ A;  1M7Y A;  3FQ7 A;  1RVU A;  4AO4 A;  4AZJ A;  2VMN A;  3BWO A;  1ZOD A;  3ASB A;  3JW9 A;  3WY7 A;  1DGD A;  3NYT A;  2CJD A;  4JF0 A;  2BWO A;  4WXB A;  1B9I A;  1W7N A;  5LH9 A;  3JWB A;  1KMK A;  3FD0 A;  4ATQ A;  4ZM4 A;  1H1C A;  2C81 A;  1ASD A;  1AJS B;  2W8T A;  1D7V A;  2HZP A;  4ADC A;  2E7I A;  2BWN A;  1BW0 A;  1TOE A;  4A0R A;  2BI1 A;  5M4B A;  3GBX A;  3FDD A;  3ECD A;  1FC4 A;  4ZAS A;  1AAM A;  4F5L A;  3TAT A;  2Z20 A;  1DFO A;  3COG A;  4IYO A;  1EQB A;  3K40 A;  1SVV A;  4W8I A;  1RV4 A;  2QLR A;  3AEL A;  3E6G A;  5EFS A;  4OBV A;  2JJF A;  1ASA A;  2AY5 A;  1KKP A;  2VGV A;  3RUY A;  3AEN A;  1B5O A;  2CJG A;  3NYS A;  4KXK A;  4WD2 A;  3PA9 A;  3D6K A;  4JEZ A;  2Z9U A;  4LNM A;  2CTZ A;  2VI9 A;  1RV3 A;  3B46 A;  3LVM A;  4Q31 A;  4WYE A;  2C7T A;  1ASG A;  2E54 A;  3GWP A;  3DR7 A;  4EMY A;  3QHX A;  1N8P A;  3MAD A;  1ASC A;  4PIW A;  3FRK A;  2ORD A;  4ITX A;  2VMP A;  4XEW A;  4BMK A;  3JTX A;  3MKJ A;  4EB5 A;  1PMM A;  4WYA A;  3RCH A;  3ELE A;  2VMS A;  2W7G A;  1BJ4 A;  4EFF A;  2CFB A;  4MSO A;  3HMU A;  4W1V A;  2BKW A;  2DOU A;  1IUG A;  3PD6 A;  4M2M A;  2F8J A;  1C9C A;  1GDE A;  1DKA A;  3DXV A;  3QBO A;  2X5D A;  5DJ1 A;  8AAT A;  3MC6 A;  3PPL A;  1CJ0 A;  1GCK A;  2YRR A;  3DU4 A;  4Y0D A;  3ZZK A;  1M0Q A;  1CS1 A;  1LKC A;  1ORD A;  2HUF A;  4F5I A;  4MQP A;  4L0O A;  5F9S A;  3LVJ A;  2EGY A;  2R5C B;  3EI9 A;  1M0P A;  2QB2 A;  4A00 A;  1BJO B;  2X8U A;  2FNU A;  3ASA A;  2YOB A;  2VGS A;  2VMQ A;  4J8L A;  4MGR A;  2D65 A;  3P1T A;  3RBF A;  2ZUK A;  3HT4 A;  4GRX A;  4GE7 A;  4XJL A;  1PFF A;  1TPL A;  1ZC9 A;  3B1E A;  4JE5 D;  3HVY A;  3FFR A;  1M0O A;  2W8U A;  4UHM A;  1ASE A;  2AY1 A;  4F5M A;  3E9K A;  2JJH A;  4OMA A;  4ZDL A;  4XJO A;  1X0M A;  2EH6 A;  3WGB A;  2HP2 A;  5G09 A;  3AEO A;  4CVQ A;  2FM1 A;  1Z3Z A;  5D95 A;  5EIG A;  2QMA A;  1SPA A;  3OKS A;  4RJ0 A;  3RI6 A;  1I43 A;  1AY5 A;  1WYV B;  4MQR A;  2YRI A;  4XK1 A;  1J04 A;  3DR4 A;  3VK2 A;  4AO9 A;  1S0A A;  2WKA A;  1J32 A;  4B98 A;  1AMR A;  4UOY A;  4FL0 A;  5EQC A;  2ZP7 A;  3WCN A;  2HOR A;  1D2F A;  2W7D A;  1SFF A;  5J8Q A;  1S07 A;  2W8W A;  4GEB A;  1GC0 A;  1VJO A;  1LK9 A;  4IY7 A;  3NYU A;  1W23 A;  3TCM A;  2E7U A;  1JS6 A;  1JS3 A;  4AOA A;  2R0T A;  3UWC A;  3W1I A;  1ASB A;  1LC8 A;  3N0L A;  2DR1 A;  1ELQ A;  3BV0 A;  2FQ6 A;  1LS3 A;  3FVX A;  3HLM A;  3JZL A;  3FFH A;  3TQX A;  1S08 A;  1YOO A;  2HOX A;  1GEY A;  3N75 A;  4R5F A;  3R9A A;  1AJS A;  3KE3 A;  3CQ6 A;  1X28 A;  2XBN A;  3JWA A;  2QBT A;  3VOM A;  1O4S A;  1G7W A;  3GZD A;  2VMO A;  3EZ1 A;  1N31 A;  3EZS A;  2Z9V A;  5EAV A;  4DBC A;  4IYO B;  2AAT A;  2AY4 A;  2CH1 A;  4AH3 A;  2VGT A;  1BJW A;  4Q6R A;  4DQ6 A;  3KGW A;  3MEB A;  2PO3 A;  2CH2 A;  2GB3 A;  2ZYJ A;  3HBX A;  3DYD A;  1RVY A;  3TFT A;  3W1H A;  4KYO A;  5EUN A;  3N5M A;  1TOI A;  4BQ0 A;  3WCO A;  4DGT A;  4WYC A;  1GBN A;  2JJE A;  4GE4 A;  2YHK A;  3PD6 B;  4F5K A;  1I48 A;  1AKB A;  3EI7 A;  2VMY A;  5JAY A;  1JF9 A;  2W8J A;  3FZ7 A;  3AEM C;  3Q8N A;  2W7I A;  2C44 A;  2CIN A;  1IX6 A;  4K2M A;  2VGW A;  4ZDP A;  4UHO A;  2WK8 A;  3NNK A;  2JJG A;  2Z1Z A;  2Z9X A;  3HL2 A;  1C4K A;  1BJO A; 
#chains in the Genus database with same CATH topology
 5HXX A;  1LW4 A;  1PG8 A;  2CB1 A;  4A72 A;  2VMZ A;  2PB2 A;  3FDB A;  4ZSY A;  1IAX A;  5G4I A;  3DOD A;  4WB0 B;  9AAT A;  1AMS A;  1IX8 A;  4FFC A;  3KKI A;  4R8D A;  1D7U A;  2Z1Y A;  4XJM A;  3RCH B;  1EG5 A;  2VIA A;  1V2D A;  4ZAH A;  5M46 A;  1M32 A;  1V2E A;  2ZSL A;  4W1W A;  2Z67 A;  3F0H A;  1GC4 A;  3FCR A;  3ISL A;  3NU7 A;  1WKG A;  3EUC A;  4WYD A;  2D64 A;  3NUI A;  4GDY A;  4LW4 A;  2D7Z A;  1M6S A;  1FG7 A;  3LY1 A;  2HUU A;  2W7L A;  3R4T A;  2VGU A;  4JEX A;  1XEY A;  4K05 A;  2W7E A;  1OXP A;  3ZZJ A;  4W5K A;  1MAP A;  2DKJ A;  3PDX A;  1DJU A;  2C0R A;  2YCN A;  3IHJ A;  3KGX A;  2YKU A;  5FT4 A;  3PGY A;  7AAT A;  1AIB A;  2V0Y A;  3A8U X;  3ATH A;  3NDN A;  3UAK A;  1YAA A;  3G8M A;  4TMR A;  4Y0I A;  1YIY A;  4A6U A;  1CQ7 A;  3DZZ A;  3NRA A;  3ACZ A;  1M0N A;  4ITG A;  2W7K A;  4CBR A;  3BWN A;  2ZY5 A;  1JG8 A;  3ZRQ A;  3H7F A;  1SF2 A;  4TV7 A;  1TAT A;  3II0 A;  3A9X A;  2FNI A;  2JIS A;  5G0A A;  4ATP A;  1CL2 A;  1W7M A;  4EU1 A;  4GSA A;  2RFV A;  2EZ2 A;  1AHG A;  2D61 A;  3BCX A;  3E2Y A;  1I41 A;  1H0C A;  4XQ2 A;  4WP0 A;  1D7R A;  5E4Z A;  1V72 A;  4ZM3 A;  1I29 A;  4E77 A;  4F5G A;  4OTL A;  3FSL A;  1C7O A;  1AHX A;  4WXG A;  3FVU A;  1WYV A;  1IX7 A;  3LV2 A;  5G2Q A;  1YIZ A;  2BI3 A;  2X5F A;  4J5U A;  4K2I A;  4LNJ A;  2OKK A;  2VIB A;  5E3K A;  1ASF A;  2GSA A;  2YKX A;  3LVK A;  4BHD A;  2VMR A;  2HP1 A;  1MDO A;  1TAS A;  1TOJ A;  2X3L A;  3FQ8 A;  5K8B A;  1AJR A;  1IBJ A;  1DGE A;  3WX9 A;  1AIA A;  3A2B A;  3PJ0 A;  1IVR A;  2YCT A;  2BIE A;  4LNL A;  1WYT A;  4PFN A;  3AV7 A;  3USF A;  1V2F A;  3WZF A;  1B4X A;  4LW2 A;  1OAT A;  4H51 A;  4ADB A;  3LG0 A;  4A6R A;  1UKJ A;  3MC6 C;  2NMP A;  4TN4 A;  1S06 A;  4R2N A;  4ADD A;  1GEW A;  3HQT A;  2QB3 A;  1BQD A;  1MLZ A;  3AEM A;  1QZ9 A;  2VI8 A;  3A9Y A;  3A9Z A;  2O7C A;  2OAT A;  3K28 A;  2W7H A;  1C7N A;  5G4J A;  3GET A;  4UHN A;  2ZJG A;  3JU7 A;  1VEF A;  1AHY A;  1BQA A;  1AHF A;  2W8V A;  4RM1 A;  4UQV A;  1U08 A;  1DJE A;  3E2Z B;  3AEP A;  3NUB A;  1X2A A;  3PAA A;  4OT8 A;  3I4J A;  1SZK A;  2YKY A;  1GC2 A;  4A6T A;  3EIB A;  3L8A A;  3DC1 A;  2BHX A;  3AEJ C;  4N0W A;  1CL1 A;  3VAX A;  3RQ1 A;  1AKA A;  1MLY A;  3B1C A;  1ARS A;  3MBB A;  4ZWV A;  4U1T A;  5HDM A;  5DJ9 A;  2EO5 A;  4I8A A;  4JE5 A;  4E3Q A;  1WKH A;  4P7Y A;  1BT4 A;  2HUI A;  2BYJ A;  3WKS A;  2BWP A;  2Z61 A;  1YNU A;  2GQN A;  4JEV A;  3EI5 A;  4ZWM A;  1GD9 A;  1C7G A;  3F9T A;  4ADE A;  2ZY2 A;  2AY7 A;  3GR9 A;  4WYF A;  5HHY A;  3BCB A;  1ARG A;  3K7Y A;  4WBT A;  4F5J A;  4PFF A;  1ARH A;  1CZC A;  2BIA A;  2YKV A;  3P6K A;  2AEU A;  1MGV A;  2DGM A;  2BI5 A;  4RKC A;  4Q75 A;  4N0B A;  4GE9 A;  4WXF A;  2QA3 A;  2G6W A;  3LWS A;  2HOZ A;  1LW5 A;  2W7M A;  4MY5 A;  4XAU A;  4ZSW A;  4P3M A;  4Q76 A;  5DX5 A;  3AOV A;  1SZU A;  4WLJ A;  3F6T A;  4JF1 A;  4RLG A;  3N4S A;  1Z7D A;  4RAE A;  3TFU A;  4RIT A;  4AZK A;  3VK4 A;  3DXW A;  2YCP A;  4IXS A;  1G4X A;  3FTB A;  5EUD A;  3M5U A;  1QIS A;  1BJN A;  1YJZ A;  4RJY A;  3N4R A;  4BA4 A;  3GJU A;  4W1X A;  2OGA A;  4IXZ A;  3B8X A;  2VMU A;  3EI6 A;  2GMS A;  3PDB A;  4MQQ A;  1AAW A;  1XI9 A;  5C6U A;  1OXO A;  3PIU A;  1GEX A;  1CQ6 A;  3BN1 A;  5M4D A;  1WYT B;  1O62 A;  1OHW A;  1P3W A;  4BA5 A;  2ZY4 A;  2DKB A;  2DGL A;  2D63 A;  3W1J A;  1D7S A;  5F8V A;  2VMX A;  2AY3 A;  2D5Y A;  1AMQ A;  3AAT A;  3AOW A;  4ZDO A;  3IF2 A;  2O0R A;  1UU1 A;  1AY4 A;  1B5P A;  1ECX A;  4XJP A;  2HOY A;  4F5H A;  1T3I A;  2FKI A;  4ISY A;  1W3U A;  2OGE A;  4K2B A;  2VMW A;  4CXQ A;  1OHV A;  1UU0 A;  2D7Y A;  4LC3 A;  4A0G A;  2VGZ A;  3EIA A;  1QGN A;  3CQ5 A;  3FZ8 A;  2CST A;  4F5F A;  5IWQ A;  2W7J A;  3B1D A;  1AKC A;  3ELP A;  3L44 A;  4F4E A;  5FT5 A;  2EPJ A;  3LVL B;  1BKG A;  4M2K A;  1IAY A;  4U2H A;  4E3R A;  1ART A;  1LC7 A;  4OYT A;  3RBL A;  2VYC A;  2AY9 A;  1FG3 A;  1SZS A;  2AY8 A;  2BI9 A;  3G7Q A;  4RIZ A;  3WKR A;  2ZY3 A;  5FT6 A;  4HF8 A;  1ZOB A;  3VP6 A;  2VMT A;  1GC3 A;  1O61 A;  3MAF A;  1ASL A;  1LC5 A;  1TAR A;  1N2T A;  2O1B A;  1MDX A;  3GSB A;  5EUE A;  3QM2 A;  5LHA A;  3AEJ A;  3OP7 A;  3QN6 A;  3UE8 A;  3CAI A;  1ASN A;  1ASM A;  3H14 A;  4WB0 A;  2XH1 A;  1ARI A;  3CBF A;  5G2P A;  4WLH A;  4EB7 A;  1WYU A;  4E1O A;  1AHE A;  1TOK A;  3FQA A;  2KFP A;  1WYU B;  4KAM A;  5AX8 A;  1YJS A;  3E2Z A;  3I16 A;  4MKJ A;  3NTJ A;  1DJ9 A;  3MAU A;  3I5T A;  2CJH A;  4QGR A;  2DGK A;  1DTY A;  3BWN C;  3WLX A;  1EJI A;  2FYF A;  1BS0 A;  2EYQ A;  1O69 A;  5I92 A;  3ZRR A;  5FT8 A;  1C0N A;  2CAN A;  1YJY A;  3FZ6 A;  2GMU A;  3QI6 A;  1AMA A;  5M49 A;  4OBU A;  4CBS A;  1B9H A;  2OQX A;  3DRD A;  2AY6 A;  2EZ1 A;  2FN6 A;  1UU2 A;  1M4N A;  3AEN B;  4IW7 A;  1AY8 A;  3FKD A;  4JEY A;  1X29 A;  2ZSM A;  1IJI A;  4Y0H A;  1B8G A;  1KL1 A;  2Z9W A;  4OCA A;  2WK7 A;  4HVK A;  1KKJ A;  2WB6 A;  5DB5 A;  5E5I A;  2CY8 A;  2WK9 A;  3N7N A;  3GZD C;  2VLF A;  2A1V A;  3E77 A;  3G0T A;  4JEW A;  3BS8 A;  4RKD A;  3PDB B;  1OHY A;  4MKK A;  1E5E A;  1VP4 A;  3QGU A;  4W91 A;  1CZE A;  2AY2 A;  4WYG A;  2R5E A;  5TF5 A;  2BI2 A;  5BJ3 A;  1WST A;  4OC9 A;  4CXR A;  4M2J A;  4NOG A;  5KTB A;  1CQ8 A;  4PVF A;  2OKJ A;  2D66 A;  3WGC A;  2BYL A;  2W7F A;  3E2F A;  5EAA A;  2QSR A;  1MAQ A;  3FVS A;  3T32 A;  2TPL A;  1KMJ A;  1ELU A;  1KL2 A;  1PMO A;  4R5Z A;  2BIG A;  1TOG A;  3GZC A;  1QJ5 A;  4A0H A;  2R2N A;  3BCA A;  1QJ3 A;  2Q7W A;  3VK3 A;  1QIR A;  3BB8 A;  3NX3 A;  5EIG B;  4IX8 A;  2ZC0 A;  2R5C A;  1G4V A;  3HDO A;  1G7X A;  1AX4 A;  3ZRP A;  1KAF A;  2JG2 A;  1QIT A;  2VMV A;  3EI8 A;  5D5S A;  3CQ4 A;  4O6Z A;  1S09 A;  2E7J A;  4ZLV A;  2JGT A;  1AIC A;  4B9B A;  2VLH A;  1E5F A;  3QPG A;  2PB0 A;  4A0F A;  5BJ4 A;  1Y4I A;  3MAF B;  2V1P A;  1W7L A;  3BC8 A;  2AEV A;  4IXO A;  3NU8 A;  1MDZ A;  1M7Y A;  3FQ7 A;  1RVU A;  4AO4 A;  4AZJ A;  2VMN A;  3BWO A;  1ZOD A;  3ASB A;  3JW9 A;  3WY7 A;  1DGD A;  3NYT A;  2CJD A;  4JF0 A;  2BWO A;  4WXB A;  1B9I A;  1W7N A;  5LH9 A;  3JWB A;  1KMK A;  3FD0 A;  4ATQ A;  4ZM4 A;  1H1C A;  2C81 A;  1ASD A;  1AJS B;  2W8T A;  1D7V A;  2HZP A;  4ADC A;  2E7I A;  2BWN A;  1BW0 A;  1TOE A;  4A0R A;  2BI1 A;  5M4B A;  3GBX A;  3FDD A;  3ECD A;  1FC4 A;  4ZAS A;  1AAM A;  4F5L A;  3TAT A;  2Z20 A;  1DFO A;  3COG A;  4IYO A;  1EQB A;  3K40 A;  1SVV A;  4W8I A;  1RV4 A;  2QLR A;  3AEL A;  3E6G A;  5EFS A;  4OBV A;  2JJF A;  1ASA A;  3N4X A;  2AY5 A;  1KKP A;  2VGV A;  3RUY A;  3AEN A;  1B5O A;  2CJG A;  3NYS A;  4KXK A;  4WD2 A;  3PA9 A;  3D6K A;  4JEZ A;  2Z9U A;  4LNM A;  2CTZ A;  2VI9 A;  1RV3 A;  3B46 A;  3LVM A;  4Q31 A;  4WYE A;  2C7T A;  1ASG A;  2E54 A;  3GWP A;  3DR7 A;  4EMY A;  3QHX A;  1N8P A;  3MAD A;  1ASC A;  4PIW A;  3FRK A;  2ORD A;  4ITX A;  2VMP A;  4XEW A;  4BMK A;  3JTX A;  3MKJ A;  4EB5 A;  1PMM A;  4WYA A;  3RCH A;  3ELE A;  2VMS A;  2W7G A;  1BJ4 A;  4EFF A;  2CFB A;  4MSO A;  3HMU A;  4W1V A;  2BKW A;  2DOU A;  1IUG A;  3PD6 A;  4M2M A;  2F8J A;  1C9C A;  1GDE A;  1DKA A;  3DXV A;  3QBO A;  2X5D A;  5DJ1 A;  8AAT A;  3MC6 A;  3PPL A;  1CJ0 A;  1GCK A;  2YRR A;  3DU4 A;  4Y0D A;  3ZZK A;  1M0Q A;  1CS1 A;  2G7J A;  1LKC A;  1ORD A;  2HUF A;  4F5I A;  4MQP A;  4L0O A;  5F9S A;  3LVJ A;  2EGY A;  2R5C B;  3EI9 A;  1M0P A;  2QB2 A;  4A00 A;  1BJO B;  2X8U A;  2FNU A;  3ASA A;  2YOB A;  2VGS A;  2VMQ A;  4J8L A;  4MGR A;  2D65 A;  3P1T A;  3RBF A;  2ZUK A;  3HT4 A;  4GRX A;  4GE7 A;  4XJL A;  1PFF A;  1TPL A;  1ZC9 A;  3B1E A;  4JE5 D;  3HVY A;  3FFR A;  1M0O A;  2W8U A;  4UHM A;  1ASE A;  2AY1 A;  4F5M A;  3E9K A;  2JJH A;  4OMA A;  4ZDL A;  4XJO A;  1X0M A;  2EH6 A;  3WGB A;  2HP2 A;  5G09 A;  3AEO A;  4CVQ A;  2FM1 A;  1Z3Z A;  5D95 A;  5EIG A;  2QMA A;  1SPA A;  3OKS A;  4RJ0 A;  3RI6 A;  1I43 A;  1AY5 A;  1WYV B;  4MQR A;  2YRI A;  4XK1 A;  1J04 A;  3DR4 A;  3VK2 A;  4AO9 A;  1S0A A;  2WKA A;  1J32 A;  4B98 A;  1AMR A;  4UOY A;  4FL0 A;  5EQC A;  2ZP7 A;  3WCN A;  2HOR A;  1D2F A;  2W7D A;  1SFF A;  5J8Q A;  1S07 A;  2W8W A;  4GEB A;  1GC0 A;  1VJO A;  1LK9 A;  4IY7 A;  3NYU A;  1W23 A;  3TCM A;  2E7U A;  1JS6 A;  1JS3 A;  4AOA A;  2R0T A;  3UWC A;  3W1I A;  1ASB A;  1LC8 A;  3N0L A;  2DR1 A;  1ELQ A;  3BV0 A;  2FQ6 A;  1LS3 A;  3FVX A;  3HLM A;  3JZL A;  3FFH A;  3TQX A;  1S08 A;  1YOO A;  2HOX A;  1GEY A;  3N75 A;  4R5F A;  3R9A A;  1AJS A;  3KE3 A;  3CQ6 A;  1X28 A;  2XBN A;  3JWA A;  2QBT A;  3VOM A;  1O4S A;  1G7W A;  3GZD A;  2VMO A;  3EZ1 A;  3H9X A;  1N31 A;  3EZS A;  2Z9V A;  5EAV A;  4DBC A;  4IYO B;  2AAT A;  2AY4 A;  2CH1 A;  4AH3 A;  2VGT A;  1BJW A;  4Q6R A;  4DQ6 A;  3KGW A;  3MEB A;  2PO3 A;  2CH2 A;  2GB3 A;  2ZYJ A;  3HBX A;  3DYD A;  1RVY A;  3TFT A;  3W1H A;  4KYO A;  5EUN A;  3N5M A;  1TOI A;  4BQ0 A;  3WCO A;  4DGT A;  4WYC A;  1GBN A;  2JJE A;  4GE4 A;  2YHK A;  3PD6 B;  4F5K A;  1I48 A;  1AKB A;  3EI7 A;  2VMY A;  5JAY A;  1JF9 A;  2W8J A;  3FZ7 A;  3AEM C;  3Q8N A;  2W7I A;  2C44 A;  2CIN A;  1IX6 A;  4K2M A;  2VGW A;  4H63 Q;  4ZDP A;  4UHO A;  2WK8 A;  3NNK A;  2JJG A;  2Z1Z A;  2Z9X A;  3HL2 A;  1C4K A;  1BJO A; 
#chains in the Genus database with same CATH homology
 5HXX A;  1LW4 A;  1PG8 A;  2CB1 A;  4A72 A;  2VMZ A;  2PB2 A;  3FDB A;  4ZSY A;  1IAX A;  5G4I A;  3DOD A;  4WB0 B;  9AAT A;  1AMS A;  1IX8 A;  4FFC A;  3KKI A;  4R8D A;  1D7U A;  2Z1Y A;  4XJM A;  3RCH B;  1EG5 A;  2VIA A;  1V2D A;  4ZAH A;  5M46 A;  1M32 A;  1V2E A;  2ZSL A;  4W1W A;  2Z67 A;  3F0H A;  1GC4 A;  3FCR A;  3ISL A;  3NU7 A;  1WKG A;  3EUC A;  4WYD A;  2D64 A;  3NUI A;  4GDY A;  4LW4 A;  2D7Z A;  1M6S A;  1FG7 A;  3LY1 A;  2HUU A;  2W7L A;  3R4T A;  2VGU A;  4JEX A;  1XEY A;  4K05 A;  2W7E A;  1OXP A;  3ZZJ A;  4W5K A;  1MAP A;  2DKJ A;  3PDX A;  1DJU A;  2C0R A;  2YCN A;  3IHJ A;  3KGX A;  2YKU A;  5FT4 A;  3PGY A;  7AAT A;  1AIB A;  2V0Y A;  3A8U X;  3ATH A;  3NDN A;  3UAK A;  1YAA A;  3G8M A;  4TMR A;  4Y0I A;  1YIY A;  4A6U A;  1CQ7 A;  3DZZ A;  3NRA A;  3ACZ A;  1M0N A;  4ITG A;  2W7K A;  4CBR A;  3BWN A;  2ZY5 A;  1JG8 A;  3ZRQ A;  3H7F A;  1SF2 A;  4TV7 A;  1TAT A;  3II0 A;  3A9X A;  2FNI A;  2JIS A;  5G0A A;  4ATP A;  1CL2 A;  1W7M A;  4EU1 A;  4GSA A;  2RFV A;  2EZ2 A;  1AHG A;  2D61 A;  3BCX A;  3E2Y A;  1I41 A;  1H0C A;  4XQ2 A;  4WP0 A;  1D7R A;  5E4Z A;  1V72 A;  4ZM3 A;  1I29 A;  4E77 A;  4F5G A;  4OTL A;  3FSL A;  1C7O A;  1AHX A;  4WXG A;  3FVU A;  1WYV A;  1IX7 A;  3LV2 A;  5G2Q A;  1YIZ A;  2BI3 A;  2X5F A;  4J5U A;  4K2I A;  4LNJ A;  2OKK A;  2VIB A;  5E3K A;  1ASF A;  2GSA A;  2YKX A;  3LVK A;  4BHD A;  2VMR A;  2HP1 A;  1MDO A;  1TAS A;  1TOJ A;  2X3L A;  3FQ8 A;  5K8B A;  1AJR A;  1IBJ A;  1DGE A;  3WX9 A;  1AIA A;  3A2B A;  3PJ0 A;  1IVR A;  2YCT A;  2BIE A;  4LNL A;  1WYT A;  4PFN A;  3AV7 A;  3USF A;  1V2F A;  3WZF A;  1B4X A;  4LW2 A;  1OAT A;  4H51 A;  4ADB A;  3LG0 A;  4A6R A;  1UKJ A;  3MC6 C;  2NMP A;  4TN4 A;  1S06 A;  4R2N A;  4ADD A;  1GEW A;  3HQT A;  2QB3 A;  1BQD A;  1MLZ A;  3AEM A;  1QZ9 A;  2VI8 A;  3A9Y A;  3A9Z A;  2O7C A;  2OAT A;  3K28 A;  2W7H A;  1C7N A;  5G4J A;  3GET A;  4UHN A;  2ZJG A;  3JU7 A;  1VEF A;  1AHY A;  1BQA A;  1AHF A;  2W8V A;  4RM1 A;  4UQV A;  1U08 A;  1DJE A;  3E2Z B;  3AEP A;  3NUB A;  1X2A A;  3PAA A;  4OT8 A;  3I4J A;  1SZK A;  2YKY A;  1GC2 A;  4A6T A;  3EIB A;  3L8A A;  3DC1 A;  2BHX A;  3AEJ C;  4N0W A;  1CL1 A;  3VAX A;  3RQ1 A;  1AKA A;  1MLY A;  3B1C A;  1ARS A;  3MBB A;  4ZWV A;  4U1T A;  5HDM A;  5DJ9 A;  2EO5 A;  4I8A A;  4JE5 A;  4E3Q A;  1WKH A;  4P7Y A;  1BT4 A;  2HUI A;  2BYJ A;  3WKS A;  2BWP A;  2Z61 A;  1YNU A;  2GQN A;  4JEV A;  3EI5 A;  4ZWM A;  1GD9 A;  1C7G A;  3F9T A;  4ADE A;  2ZY2 A;  2AY7 A;  3GR9 A;  4WYF A;  5HHY A;  3BCB A;  1ARG A;  3K7Y A;  4WBT A;  4F5J A;  4PFF A;  1ARH A;  1CZC A;  2BIA A;  2YKV A;  3P6K A;  2AEU A;  1MGV A;  2DGM A;  2BI5 A;  4RKC A;  4Q75 A;  4N0B A;  4GE9 A;  4WXF A;  2QA3 A;  2G6W A;  3LWS A;  2HOZ A;  1LW5 A;  2W7M A;  4MY5 A;  4XAU A;  4ZSW A;  4P3M A;  4Q76 A;  5DX5 A;  3AOV A;  1SZU A;  4WLJ A;  3F6T A;  4JF1 A;  4RLG A;  3N4S A;  1Z7D A;  4RAE A;  3TFU A;  4RIT A;  4AZK A;  3VK4 A;  3DXW A;  2YCP A;  4IXS A;  1G4X A;  3FTB A;  5EUD A;  3M5U A;  1QIS A;  1BJN A;  1YJZ A;  4RJY A;  3N4R A;  4BA4 A;  3GJU A;  4W1X A;  2OGA A;  4IXZ A;  3B8X A;  2VMU A;  3EI6 A;  2GMS A;  3PDB A;  4MQQ A;  1AAW A;  1XI9 A;  5C6U A;  1OXO A;  3PIU A;  1GEX A;  1CQ6 A;  3BN1 A;  5M4D A;  1WYT B;  1O62 A;  1OHW A;  1P3W A;  4BA5 A;  2ZY4 A;  2DKB A;  2DGL A;  2D63 A;  3W1J A;  1D7S A;  5F8V A;  2VMX A;  2AY3 A;  2D5Y A;  1AMQ A;  3AAT A;  3AOW A;  4ZDO A;  3IF2 A;  2O0R A;  1UU1 A;  1AY4 A;  1B5P A;  1ECX A;  4XJP A;  2HOY A;  4F5H A;  1T3I A;  2FKI A;  4ISY A;  1W3U A;  2OGE A;  4K2B A;  2VMW A;  4CXQ A;  1OHV A;  1UU0 A;  2D7Y A;  4LC3 A;  4A0G A;  2VGZ A;  3EIA A;  1QGN A;  3CQ5 A;  3FZ8 A;  2CST A;  4F5F A;  5IWQ A;  2W7J A;  3B1D A;  1AKC A;  3ELP A;  3L44 A;  4F4E A;  5FT5 A;  2EPJ A;  3LVL B;  1BKG A;  4M2K A;  1IAY A;  4U2H A;  4E3R A;  1ART A;  1LC7 A;  4OYT A;  3RBL A;  2VYC A;  2AY9 A;  1FG3 A;  1SZS A;  2AY8 A;  2BI9 A;  3G7Q A;  4RIZ A;  3WKR A;  2ZY3 A;  5FT6 A;  4HF8 A;  1ZOB A;  3VP6 A;  2VMT A;  1GC3 A;  1O61 A;  3MAF A;  1ASL A;  1LC5 A;  1TAR A;  1N2T A;  2O1B A;  1MDX A;  3GSB A;  5EUE A;  3QM2 A;  5LHA A;  3AEJ A;  3OP7 A;  3QN6 A;  3UE8 A;  3CAI A;  1ASN A;  1ASM A;  3H14 A;  4WB0 A;  2XH1 A;  1ARI A;  3CBF A;  5G2P A;  4WLH A;  4EB7 A;  1WYU A;  4E1O A;  1AHE A;  1TOK A;  3FQA A;  2KFP A;  1WYU B;  4KAM A;  5AX8 A;  1YJS A;  3E2Z A;  3I16 A;  4MKJ A;  3NTJ A;  1DJ9 A;  3MAU A;  3I5T A;  2CJH A;  4QGR A;  2DGK A;  1DTY A;  3BWN C;  3WLX A;  1EJI A;  2FYF A;  1BS0 A;  2EYQ A;  1O69 A;  5I92 A;  3ZRR A;  5FT8 A;  1C0N A;  2CAN A;  1YJY A;  3FZ6 A;  2GMU A;  3QI6 A;  1AMA A;  5M49 A;  4OBU A;  4CBS A;  1B9H A;  2OQX A;  3DRD A;  2AY6 A;  2EZ1 A;  2FN6 A;  1UU2 A;  1M4N A;  3AEN B;  4IW7 A;  1AY8 A;  3FKD A;  4JEY A;  1X29 A;  2ZSM A;  1IJI A;  4Y0H A;  1B8G A;  1KL1 A;  2Z9W A;  4OCA A;  2WK7 A;  4HVK A;  1KKJ A;  2WB6 A;  5DB5 A;  5E5I A;  2CY8 A;  2WK9 A;  3N7N A;  3GZD C;  2VLF A;  2A1V A;  3E77 A;  3G0T A;  4JEW A;  3BS8 A;  4RKD A;  3PDB B;  1OHY A;  4MKK A;  1E5E A;  1VP4 A;  3QGU A;  4W91 A;  1CZE A;  2AY2 A;  4WYG A;  2R5E A;  5TF5 A;  2BI2 A;  5BJ3 A;  1WST A;  4OC9 A;  4CXR A;  4M2J A;  4NOG A;  5KTB A;  1CQ8 A;  4PVF A;  2OKJ A;  2D66 A;  3WGC A;  2BYL A;  2W7F A;  3E2F A;  5EAA A;  2QSR A;  1MAQ A;  3FVS A;  3T32 A;  2TPL A;  1KMJ A;  1ELU A;  1KL2 A;  1PMO A;  4R5Z A;  2BIG A;  1TOG A;  3GZC A;  1QJ5 A;  4A0H A;  2R2N A;  3BCA A;  1QJ3 A;  2Q7W A;  3VK3 A;  1QIR A;  3BB8 A;  3NX3 A;  5EIG B;  4IX8 A;  2ZC0 A;  2R5C A;  1G4V A;  3HDO A;  1G7X A;  1AX4 A;  3ZRP A;  2JG2 A;  1QIT A;  2VMV A;  3EI8 A;  5D5S A;  3CQ4 A;  4O6Z A;  1S09 A;  2E7J A;  4ZLV A;  2JGT A;  1AIC A;  4B9B A;  2VLH A;  1E5F A;  3QPG A;  2PB0 A;  4A0F A;  5BJ4 A;  1Y4I A;  3MAF B;  2V1P A;  1W7L A;  3BC8 A;  2AEV A;  4IXO A;  3NU8 A;  1MDZ A;  1M7Y A;  3FQ7 A;  1RVU A;  4AO4 A;  4AZJ A;  2VMN A;  3BWO A;  1ZOD A;  3ASB A;  3JW9 A;  3WY7 A;  1DGD A;  3NYT A;  2CJD A;  4JF0 A;  2BWO A;  4WXB A;  1B9I A;  1W7N A;  5LH9 A;  3JWB A;  1KMK A;  3FD0 A;  4ATQ A;  4ZM4 A;  1H1C A;  2C81 A;  1ASD A;  1AJS B;  2W8T A;  1D7V A;  2HZP A;  4ADC A;  2E7I A;  2BWN A;  1BW0 A;  1TOE A;  4A0R A;  2BI1 A;  5M4B A;  3GBX A;  3FDD A;  3ECD A;  1FC4 A;  4ZAS A;  1AAM A;  4F5L A;  3TAT A;  2Z20 A;  1DFO A;  3COG A;  4IYO A;  1EQB A;  3K40 A;  1SVV A;  4W8I A;  1RV4 A;  2QLR A;  3AEL A;  3E6G A;  5EFS A;  4OBV A;  2JJF A;  1ASA A;  3N4X A;  2AY5 A;  1KKP A;  2VGV A;  3RUY A;  3AEN A;  1B5O A;  2CJG A;  3NYS A;  4KXK A;  4WD2 A;  3PA9 A;  3D6K A;  4JEZ A;  2Z9U A;  4LNM A;  2CTZ A;  2VI9 A;  1RV3 A;  3B46 A;  3LVM A;  4Q31 A;  4WYE A;  2C7T A;  1ASG A;  2E54 A;  3GWP A;  3DR7 A;  4EMY A;  3QHX A;  1N8P A;  3MAD A;  1ASC A;  4PIW A;  3FRK A;  2ORD A;  4ITX A;  2VMP A;  4XEW A;  4BMK A;  3JTX A;  3MKJ A;  4EB5 A;  1PMM A;  4WYA A;  3RCH A;  3ELE A;  2VMS A;  2W7G A;  1BJ4 A;  4EFF A;  2CFB A;  4MSO A;  3HMU A;  4W1V A;  2BKW A;  2DOU A;  1IUG A;  3PD6 A;  4M2M A;  2F8J A;  1C9C A;  1GDE A;  1DKA A;  3DXV A;  3QBO A;  2X5D A;  5DJ1 A;  8AAT A;  3MC6 A;  3PPL A;  1CJ0 A;  1GCK A;  2YRR A;  3DU4 A;  4Y0D A;  3ZZK A;  1M0Q A;  1CS1 A;  2G7J A;  1LKC A;  1ORD A;  2HUF A;  4F5I A;  4MQP A;  4L0O A;  5F9S A;  3LVJ A;  2EGY A;  2R5C B;  3EI9 A;  1M0P A;  2QB2 A;  4A00 A;  1BJO B;  2X8U A;  2FNU A;  3ASA A;  2YOB A;  2VGS A;  2VMQ A;  4J8L A;  4MGR A;  2D65 A;  3P1T A;  3RBF A;  2ZUK A;  3HT4 A;  4GRX A;  4GE7 A;  4XJL A;  1PFF A;  1TPL A;  1ZC9 A;  3B1E A;  4JE5 D;  3HVY A;  3FFR A;  1M0O A;  2W8U A;  4UHM A;  1ASE A;  2AY1 A;  4F5M A;  3E9K A;  2JJH A;  4OMA A;  4ZDL A;  4XJO A;  1X0M A;  2EH6 A;  3WGB A;  2HP2 A;  5G09 A;  3AEO A;  4CVQ A;  2FM1 A;  1Z3Z A;  5D95 A;  5EIG A;  2QMA A;  1SPA A;  3OKS A;  4RJ0 A;  3RI6 A;  1I43 A;  1AY5 A;  1WYV B;  4MQR A;  2YRI A;  4XK1 A;  1J04 A;  3DR4 A;  3VK2 A;  4AO9 A;  1S0A A;  2WKA A;  1J32 A;  4B98 A;  1AMR A;  4UOY A;  4FL0 A;  5EQC A;  2ZP7 A;  3WCN A;  2HOR A;  1D2F A;  2W7D A;  1SFF A;  5J8Q A;  1S07 A;  2W8W A;  4GEB A;  1GC0 A;  1VJO A;  1LK9 A;  4IY7 A;  3NYU A;  1W23 A;  3TCM A;  2E7U A;  1JS6 A;  1JS3 A;  4AOA A;  2R0T A;  3UWC A;  3W1I A;  1ASB A;  1LC8 A;  3N0L A;  2DR1 A;  1ELQ A;  3BV0 A;  2FQ6 A;  1LS3 A;  3FVX A;  3HLM A;  3JZL A;  3FFH A;  3TQX A;  1S08 A;  1YOO A;  2HOX A;  1GEY A;  3N75 A;  4R5F A;  3R9A A;  1AJS A;  3KE3 A;  3CQ6 A;  1X28 A;  2XBN A;  3JWA A;  2QBT A;  3VOM A;  1O4S A;  1G7W A;  3GZD A;  2VMO A;  3EZ1 A;  3H9X A;  1N31 A;  3EZS A;  2Z9V A;  5EAV A;  4DBC A;  4IYO B;  2AAT A;  2AY4 A;  2CH1 A;  4AH3 A;  2VGT A;  1BJW A;  4Q6R A;  4DQ6 A;  3KGW A;  3MEB A;  2PO3 A;  2CH2 A;  2GB3 A;  2ZYJ A;  3HBX A;  3DYD A;  1RVY A;  3TFT A;  3W1H A;  4KYO A;  5EUN A;  3N5M A;  1TOI A;  4BQ0 A;  3WCO A;  4DGT A;  4WYC A;  1GBN A;  2JJE A;  4GE4 A;  2YHK A;  3PD6 B;  4F5K A;  1I48 A;  1AKB A;  3EI7 A;  2VMY A;  5JAY A;  1JF9 A;  2W8J A;  3FZ7 A;  3AEM C;  3Q8N A;  2W7I A;  2C44 A;  2CIN A;  1IX6 A;  4K2M A;  2VGW A;  4H63 Q;  4ZDP A;  4UHO A;  2WK8 A;  3NNK A;  2JJG A;  2Z1Z A;  2Z9X A;  3HL2 A;  1C4K A;  1BJO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...