2Z9WA

Crystal structure of pyridoxamine-pyruvate aminotransferase complexed with pyridoxal
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
392
structure length
392
Chain Sequence
MRYPEHADPVITLTAGPVNAYPEVLRGLGRTVLYDYDPAFQLLYEKVVDKAQKAMRLSNKPVILHGEPVLGLEAAAASLISPDDVVLNLASGVYGKGFGYWAKRYSPHLLEIEVPYNEAIDPQAVADMLKAHPEITVVSVCHHDTPSGTINPIDAIGALVSAHGAYLIVDAVSSFGGMKTHPEDCKADIYVTGPNKCLGAPPGLTMMGVSERAWAKMKANPLAPRASMLSIVDWENAWSRDKPFPFTPSVSEINGLDVALDLYLNEGPEAVWARHALTAKAMRAGVTAMGLSVWAASDSIASPTTTAVRTPDGVDEKALRQAARARYGVVFSSGRGETLGKLTRIGHMGPTAQPIYAIAALTALGGAMNAAGRKLAIGKGIEAALAVIDADA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aspartate aminotransferase
publication title Crystal structure of pyridoxamine-pyruvate aminotransferase from Mesorhizobium loti MAFF303099
pubmed doi rcsb
source organism Mesorhizobium loti
molecule tags Transferase
total genus 138
structure length 392
sequence length 392
chains with identical sequence B
ec nomenclature ec 2.6.1.30: Pyridoxamine--pyruvate transaminase.
pdb deposition date 2007-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00266 Aminotran_5 Aminotransferase class-V
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 2z9wA02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 2z9wA01
3UE8A 1PG8A 1Z7DA 1BS0A 1ZOBA 2CJDA 3AELA 1KKJA 4XK1A 3EI8A 2BIEA 5EAVA 4DBCA 4OT8A 4ADEA 2VI8A 3ZZKA 2PB2A 1Y4IA 3QHXA 1G4XA 4WXBA 3PDBB 4AO4A 1EQBA 1SZSA 3FDDA 2Z67A 1O62A 1B4XA 2C0RA 4CXQA 2C44A 3AENB 2O1BA 2R5CB 1WYVB 2GMUA 3OP7A 1CS1A 1BKGA 2FM1A 3COGA 4O6ZA 4F5MA 1W7NA 1O4SA 4MQRA 5EIGA 1GDEA 2ZC0A 4NOGA 1DTYA 2W8WA 1AAWA 2VGZA 1QZ9A 3N0LA 4FL0A 3GJUA 1RVYA 3GZDC 3BB8A 2D61A 2BYLA 4ZDPA 4E1OA 1FG7A 3E6GA 4TV7A 1YIYA 1S06A 5G09A 3WKSA 2VLFA 1OXPA 1ASMA 3TFUA 4HVKA 3DXWA 1G7XA 4R5FA 1SZKA 2FN6A 4UHMA 1DJEA 3AEOA 2AY2A 5BJ3A 1WKGA 1AHGA 2VMNA 3HQTA 1UKJA 4XJMA 1M0NA 2WK7A 1GCKA 2QMAA 4RITA 5C6UA 3BWOA 4AZJA 1I43A 1CJ0A 3FZ8A 4IX8A 4MGRA 3FQ8A 2BKWA 3WY7A 4OYTA 4XJPA 4A72A 1AMAA 1GD9A 4A6TA 1YJZA 1AJSB 3CQ6A 4EMYA 1B9IA 1N31A 4PVFA 1FG3A 4A0FA 1BT4A 2FQ6A 4RKCA 2VMZA 2YCNA 3GZDA 3WLXA 1ZODA 5DX5A 3G8MA 4CBRA 3W1JA 2Z9WA 2W7DA 1V2EA 3A2BA 4F5LA 2DGKA 1C0NA 2W7JA 1M7YA 3DXVA 3F9TA 5G4JA 1TOEA 2ZY4A 2Z20A 3FCRA 3E2YA 4ITGA 3WX9A 4GRXA 2DGMA 4L0OA 4F5JA 2OQXA 1OATA 4EB5A 1FC4A 2XH1A 1C7OA 1MGVA 1JS3A 2CANA 3DZZA 5EIGB 4IW7A 3FFHA 1I48A 4E77A 2PB0A 3NTJA 3GSBA 1BQDA 2VMXA 3FRKA 4ADDA 3B1EA 2HOYA 2VGTA 1GC4A 4BA5A 2JJFA 1DJUA 3W1HA 3H14A 3RUYA 4F5FA 3L8AA 1ASLA 1P3WA 2W8TA 4WYEA 2VIAA 3FZ7A 3BN1A 1QJ3A 2W7IA 4CXRA 1IAXA 1M0OA 4XQ2A 4IXZA 3NUIA 4W8IA 1TASA 3PDBA 1S0AA 1X0MA 3EUCA 3WCNA 3B8XA 3FTBA 3TQXA 2W7HA 4ADCA 1AJRA 4EFFA 3EI6A 4WLHA 1ASEA 3AENA 4DQ6A 2R5CA 1YNUA 1WYVA 4MQQA 2VMSA 3IHJA 4A00A 1IBJA 3I5TA 1MDOA 5EUNA 4XJOA 2HUUA 2JGTA 1ASBA 1MDZA 2AEUA 3FZ6A 3HMUA 4J5UA 1AHEA 1B5OA 2CH1A 2Z61A 4ZSWA 4QGRA 1CL2A 1KL2A 4M2JA 1JF9A 2E54A 4Q6RA 1IVRA 2Z1YA 3ZZJA 3TATA 4A0GA 2OKJA 1GEXA 2ZJGA 2HUIA 4AO9A 3LY1A 3ELPA 4E3RA 3PD6B 2ZP7A 2AY6A 2VMQA 5HDMA 2XBNA 2OGAA 3JZLA 3RI6A 5JAYA 4KAMA 1W23A 2HOXA 4K2BA 2JISA 2V1PA 4GE4A 3DRDA 3R4TA 3IF2A 1OHWA 3E9KA 3LVKA 1PFFA 2O7CA 4OBUA 2VGWA 2ZY5A 1TPLA 2EPJA 1J32A 3QM2A 4IY7A 5M49A 1G7WA 2CFBA 2HZPA 3NDNA 4GE7A 4MKKA 2AY1A 1IAYA 1YAAA 1AHXA 3JWAA 4JF1A 2Z9UA 1OHVA 1MAPA 3KKIA 2W7FA 3NU7A 4MY5A 4UQVA 1VEFA 4LC3A 4EU1A 1Z3ZA 2BI1A 3FVUA 4WXGA 1ASAA 3B46A 3WGBA 1LS3A 1SFFA 1ZC9A 2CH2A 3ATHA 1IUGA 3OKSA 5M4DA 1TOJA 1ASNA 4KYOA 8AATA 2BIGA 5FT5A 3MKJA 1LK9A 1BW0A 4J8LA 4GSAA 4LNMA 5FT8A 2WKAA 4GEBA 5FT6A 2JJHA 1DJ9A 3RBFA 2GB3A 1GBNA 1BQAA 3G7QA 2EGYA 4LW2A 1GEWA 1E5FA 3QPGA 3HBXA 1ELUA 4ZWVA 3I16A 4WYCA 2VYCA 3N5MA 1AKAA 1S07A 2W7GA 5DB5A 1WYTA 2AY7A 3CBFA 4OC9A 4K2MA 4WBTA 1ECXA 3A9XA 3L44A 1WKHA 2BWNA 3FFRA 2AATA 1C7NA 2GQNA 4Q75A 1WYUB 4ZAHA 7AATA 2JG2A 1YJYA 2DKJA 3A8UX 3VOMA 2VMPA 2YRRA 2VMYA 4R2NA 1DFOA 2ZSLA 5BJ4A 5AX8A 4ZM4A 1N8PA 1ASGA 4BA4A 1EG5A 1D7VA 4JE5D 1QITA 2VMVA 3HVYA 1M32A 2BHXA 2YHKA 1CZEA 1AMRA 1OHYA 3RCHB 4P7YA 3W1IA 1UU2A 1VP4A 1TOIA 2HP1A 4M2MA 2VMWA 1AICA 2DGLA 1UU0A 3A9YA 3PD6A 1MDXA 2ORDA 3A9ZA 4IXSA 1ARSA 4GDYA 4BHDA 2EZ1A 1QIRA 1XI9A 4Q76A 2C7TA 3LV2A 1X2AA 3F6TA 1GC2A 4Q31A 1N2TA 3AEJA 4WB0B 2DR1A 3MAUA 1GEYA 3E77A 3FSLA 2BWOA 4XJLA 4ATQA 3LVJA 2D63A 3DU4A 4ISYA 1V2FA 3EI9A 1M4NA 2QB2A 3ZRQA 3R9AA 3KE3A 1MLYA 2VI9A 1WYTB 2G6WA 3MBBA 5EQCA 4I8AA 3AV7A 1PMOA 3HDOA 4U2HA 5G2PA 5DJ9A 5M46A 4MQPA 1CL1A 2AY3A 3QBOA 2NMPA 1SVVA 2CINA 5G4IA 3NYSA 1W7LA 4W1WA 4A0RA 4WD2A 4IYOB 2PO3A 4UOYA 2W7KA 3FVSA 1O61A 4WLJA 4F4EA 4TN4A 3WCOA 1MAQA 1BJOB 2YCPA 1IX7A 3HT4A 2BI2A 1V2DA 3AEMA 1D7SA 1YOOA 3B1DA 3WKRA 4MSOA 5TF5A 1AY5A 5D5SA 1BJ4A 5K8BA 3USFA 1GC0A 3VK3A 4H51A 5G0AA 3RQ1A 9AATA 4RLGA 5IWQA 3PIUA 3VK4A 4BMKA 1AKBA 3MADA 4AZKA 2ZY2A 3T32A 2W7LA 2GMSA 1QGNA 2O0RA 1LW5A 3K28A 3QGUA 4WYFA 3EIAA 1C4KA 5EAAA 1ORDA 2F8JA 1WYUA 1T3IA 3GWPA 4R5ZA 2CY8A 3E2FA 4UHOA 1W3UA 2W8VA 4KXKA 4PIWA 3NUBA 3HL2A 3LG0A 5J8QA 3G0TA 3GZCA 4RAEA 1O69A 3M5UA 3F0HA 5HXXA 3NYUA 1TOKA 2X8UA 5E3KA 2YKUA 3ACZA 4IXOA 1H1CA 3II0A 3RCHA 2VMUA 3TFTA 1TOGA 3LVMA 2FNUA 3BV0A 2VIBA 2BIAA 4PFFA 1W7MA 4JF0A 1C7GA 2VMOA 5F9SA 1CQ6A 1LC7A 1U08A 2W8UA 3AEPA 2YRIA 4E3QA 3VP6A 1J04A 1SF2A 1PMMA 3HLMA 4F5KA 1JS6A 1DKAA 4ZWMA 4WB0A 3K7YA 1S09A 2DKBA 2BI9A 4LNJA 4AH3A 4CBSA 1ARTA 2RFVA 1ARGA 1AY4A 2Z9XA 1B5PA 1ASDA 1KMKA 4Y0HA 4ZM3A 1AAMA 4RJYA 2D7ZA 1D7UA 2ZSMA 1YIZA 2E7IA 1I29A 2HOZA 2OKKA 1AX4A 2QBTA 2X5DA 3JTXA 4FFCA 4JEVA 4U1TA 1BJWA 4WYGA 3ZRPA 4JEXA 3N75A 3D6KA 1G4VA 3ECDA 1AHYA 3FQAA 3NU8A 5G2QA 1EJIA 4WYDA 3GBXA 3PJ0A 3NYTA 3VAXA 2WK9A 1IJIA 3AEJC 1TARA 2EZ2A 3BS8A 2Q7WA 4IYOA 1C9CA 2CB1A 5EFSA 4EB7A 4F5HA 5LH9A 3MAFB 1BJOA 4RM1A 1B8GA 3FKDA 3BCBA 4F5IA 3DYDA 2R0TA 4ZLVA 1QISA 2D64A 3DR7A 5E5IA 2YKVA 1XEYA 2ZUKA 1YJSA 4B98A 4A6RA 3FDBA 1D7RA 1OXOA 4XEWA 3MEBA 4UHNA 1KL1A 3GETA 4P3MA 4XAUA 3CQ4A 1X29A 5HHYA 4RIZA 1CQ7A 1AKCA 1AIBA 2D5YA 4R8DA 4BQ0A 3DR4A 2AY9A 4PFNA 5E4ZA 5FT4A 1JG8A 2X3LA 1AIAA 2BI5A 3P1TA 2BI3A 1ELQA 3E2ZB 4K2IA 1I41A 4HF8A 2E7UA 3GR9A 4AOAA 3ISLA 3CAIA 3WGCA 3H7FA 1SZUA 1M0PA 3BC8A 2FNIA 3ZRRA 4B9BA 2AY5A 3KGWA 3QN6A 3CQ5A 4CVQA 4WXFA 1B9HA 2CTZA 5I92A 3ASBA 3FQ7A 2R2NA 1SPAA 3AEMC 1AMSA 1D2FA 2V0YA 2FYFA 3PDXA 4RKDA 3TCMA 3BCXA 2YKYA 4LNLA 3FD0A 3PA9A 3NNKA 2Z1ZA 2BWPA 4ZASA 2VMRA 1S08A 4ZDOA 2WK8A 3JW9A 2HP2A 2YCTA 3WZFA 2Z9VA 3BWNC 2AY4A 3FVXA 2QLRA 2QB3A 2W8JA 3EIBA 4W91A 4Y0DA 1IX8A 1KKPA 4JEYA 1GC3A 3DC1A 3JU7A 1LC8A 1KMJA 1DGDA 5F8VA 4ZDLA 4Y0IA 5EUEA 5EUDA 3MC6C 3RBLA 5DJ1A 1M0QA 3PGYA 5M4BA 2CSTA 2VGVA 1IX6A 1LKCA 1X28A 4OMAA 2EH6A 2CJHA 3UAKA 1MLZA 4F5GA 2VLHA 3AATA 4OTLA 1V72A 2R5EA 2AEVA 3EI5A 2VGUA 1RV3A 2JJGA 3DODA 3LVLB 2E7JA 2YOBA 4RJ0A 3K40A 2VMTA 2ZY3A 2DOUA 1ARIA 3QI6A 2D66A 4ZSYA 3VK2A 4MKJA 4W1XA 4M2KA 3NRAA 3BWNA 5LHAA 3EI7A 5D95A 2ZYJA 1ARHA 3EZ1A 2C81A 1AY8A 1AMQA 2D7YA 3Q8NA 2CJGA 2EO5A 3JWBA 2QA3A 1VJOA 3MC6A 3AOWA 4N0WA 3EZSA 1QJ5A 1TATA 3ASAA 4WYAA 2W7MA 3MAFA 3AOVA 4JEZA 2HUFA 3PPLA 1LW4A 3B1CA 4A0HA 1AHFA 3LWSA 4TMRA 1RVUA 3P6KA 2HORA 3ELEA 4A6UA 3NX3A 1ASFA 2D65A 3UWCA 4ATPA 2AY8A 2JJEA 1LC5A 1UU1A 4GE9A 4LW4A 4OCAA 4JEWA 4ITXA 4N0BA 2VGSA 3KGXA 2OGEA 1WSTA 2GSAA 2BYJA 3E2ZA 1DGEA 3BCAA 4WP0A 4DGTA 1RV4A 3PAAA 2X5FA 4W1VA 1BJNA 2TPLA 4W5KA 1CQ8A 1ASCA 2W7EA 2OATA 3I4JA 4ADBA 1H0CA 4JE5A 1E5EA 2YKXA 1CZCA 4OBVA 1M6SA 1AJSA
chains in the Genus database with same CATH superfamily
3UE8A 1PG8A 1Z7DA 1BS0A 1ZOBA 2CJDA 3AELA 1KKJA 4XK1A 3EI8A 2BIEA 5EAVA 4DBCA 4OT8A 4ADEA 2VI8A 3ZZKA 2PB2A 1Y4IA 3QHXA 1G4XA 4WXBA 3PDBB 4AO4A 1EQBA 1SZSA 3FDDA 2Z67A 1O62A 1B4XA 2C0RA 4CXQA 2C44A 3AENB 2O1BA 2R5CB 1WYVB 2GMUA 3OP7A 1CS1A 1BKGA 2FM1A 2A1VA 3COGA 4O6ZA 4F5MA 1W7NA 1O4SA 4MQRA 5EIGA 1GDEA 2ZC0A 4NOGA 3N4XA 1DTYA 2W8WA 1AAWA 2VGZA 1QZ9A 3N0LA 4FL0A 3GJUA 1RVYA 3GZDC 3BB8A 2D61A 2BYLA 4ZDPA 4E1OA 1FG7A 3E6GA 4TV7A 1YIYA 1S06A 5G09A 3WKSA 2VLFA 1OXPA 1ASMA 3TFUA 4HVKA 3DXWA 1G7XA 4R5FA 1SZKA 2FN6A 4UHMA 1DJEA 3AEOA 2AY2A 5BJ3A 1WKGA 1AHGA 2VMNA 3HQTA 1UKJA 4XJMA 1M0NA 2WK7A 1GCKA 2QMAA 4RITA 5C6UA 3BWOA 4AZJA 1I43A 1CJ0A 3FZ8A 4IX8A 4MGRA 3FQ8A 2BKWA 3WY7A 4OYTA 4XJPA 4A72A 1AMAA 1GD9A 4A6TA 1YJZA 1AJSB 3CQ6A 4EMYA 1B9IA 1N31A 4PVFA 1FG3A 4A0FA 1BT4A 2FQ6A 4RKCA 2VMZA 2YCNA 3GZDA 3WLXA 1ZODA 5DX5A 3G8MA 4CBRA 3W1JA 2Z9WA 2W7DA 1V2EA 3A2BA 4F5LA 2DGKA 1C0NA 2W7JA 1M7YA 3DXVA 3F9TA 5G4JA 1TOEA 2ZY4A 2Z20A 3FCRA 3E2YA 4ITGA 3WX9A 4GRXA 2DGMA 4L0OA 4F5JA 2OQXA 1OATA 4EB5A 1FC4A 2XH1A 1C7OA 1MGVA 1JS3A 2CANA 3DZZA 5EIGB 4IW7A 3FFHA 1I48A 4E77A 2PB0A 3NTJA 3GSBA 1BQDA 2VMXA 3FRKA 4ADDA 3B1EA 2WB6A 2HOYA 2VGTA 1GC4A 4BA5A 1KAFA 2JJFA 1DJUA 3W1HA 3H14A 3RUYA 4F5FA 3L8AA 1ASLA 1P3WA 2W8TA 4WYEA 2VIAA 3FZ7A 3BN1A 1QJ3A 2W7IA 4CXRA 1IAXA 1M0OA 4XQ2A 4IXZA 3NUIA 4W8IA 1TASA 3PDBA 1S0AA 1X0MA 3EUCA 3WCNA 3B8XA 3FTBA 3TQXA 2W7HA 4ADCA 1AJRA 4EFFA 4K05A 3EI6A 4WLHA 1ASEA 3AENA 4DQ6A 2R5CA 1YNUA 1WYVA 4MQQA 2VMSA 3IHJA 4A00A 1IBJA 3I5TA 1MDOA 5EUNA 4XJOA 2HUUA 2JGTA 1ASBA 1MDZA 2AEUA 3FZ6A 3HMUA 4J5UA 1AHEA 1B5OA 2CH1A 2Z61A 4ZSWA 4QGRA 1CL2A 1KL2A 4M2JA 1JF9A 2E54A 4Q6RA 1IVRA 2Z1YA 3ZZJA 3TATA 4A0GA 2OKJA 1GEXA 2ZJGA 2HUIA 4AO9A 3LY1A 3ELPA 4E3RA 3PD6B 2ZP7A 2AY6A 2VMQA 5HDMA 2XBNA 2OGAA 3JZLA 3RI6A 5JAYA 4KAMA 1W23A 2HOXA 4K2BA 2JISA 2V1PA 4GE4A 3DRDA 3R4TA 3IF2A 1OHWA 3E9KA 3LVKA 1PFFA 2O7CA 4OBUA 2VGWA 2ZY5A 1TPLA 2EPJA 1J32A 3QM2A 4IY7A 5M49A 1G7WA 2CFBA 2HZPA 3NDNA 4GE7A 4MKKA 2AY1A 1IAYA 1YAAA 1AHXA 3JWAA 4JF1A 2Z9UA 1OHVA 1MAPA 3KKIA 2W7FA 3NU7A 4MY5A 4UQVA 1VEFA 4LC3A 4EU1A 1Z3ZA 2BI1A 3FVUA 4WXGA 1ASAA 3B46A 3WGBA 1LS3A 1SFFA 1ZC9A 2CH2A 3ATHA 1IUGA 3OKSA 5M4DA 5KTBA 1TOJA 1ASNA 4KYOA 8AATA 2BIGA 5FT5A 3MKJA 1LK9A 1BW0A 4J8LA 4GSAA 4LNMA 5FT8A 2WKAA 4GEBA 5FT6A 2JJHA 1DJ9A 3RBFA 2GB3A 1GBNA 1BQAA 3G7QA 2EGYA 4LW2A 1GEWA 1E5FA 3QPGA 3HBXA 1ELUA 4ZWVA 3I16A 4WYCA 2VYCA 3N5MA 1AKAA 1S07A 2W7GA 5DB5A 1WYTA 2AY7A 3CBFA 4OC9A 4K2MA 4WBTA 1ECXA 3A9XA 3L44A 1WKHA 2BWNA 3FFRA 2AATA 1C7NA 2GQNA 4Q75A 1WYUB 4ZAHA 7AATA 2JG2A 1YJYA 2DKJA 3A8UX 3VOMA 2VMPA 2YRRA 2VMYA 4R2NA 1DFOA 2ZSLA 5BJ4A 5AX8A 4ZM4A 1N8PA 1ASGA 4BA4A 1EG5A 1D7VA 4JE5D 1QITA 2VMVA 3HVYA 1M32A 2BHXA 2YHKA 1CZEA 1AMRA 1OHYA 3RCHB 2QSRA 4P7YA 3W1IA 1UU2A 1VP4A 1TOIA 2HP1A 4M2MA 2VMWA 1AICA 2DGLA 1UU0A 3A9YA 3PD6A 1MDXA 2ORDA 3A9ZA 4IXSA 1ARSA 4GDYA 4BHDA 2EZ1A 1QIRA 1XI9A 4Q76A 2C7TA 3LV2A 1X2AA 3F6TA 1GC2A 4Q31A 1N2TA 3AEJA 4WB0B 2DR1A 3MAUA 1GEYA 3E77A 3FSLA 2BWOA 4XJLA 4ATQA 3LVJA 2D63A 3DU4A 4ISYA 1V2FA 3EI9A 1M4NA 2QB2A 3ZRQA 3R9AA 3KE3A 1MLYA 2VI9A 1WYTB 2G6WA 3MBBA 5EQCA 4I8AA 3AV7A 1PMOA 3HDOA 4U2HA 5G2PA 5DJ9A 5M46A 4MQPA 1CL1A 2AY3A 3QBOA 2NMPA 1SVVA 2CINA 5G4IA 3NYSA 1W7LA 4W1WA 4A0RA 4WD2A 4IYOB 2PO3A 4UOYA 2W7KA 3FVSA 1O61A 4WLJA 4F4EA 4TN4A 3WCOA 1MAQA 1BJOB 3N4SA 2YCPA 1IX7A 3HT4A 2BI2A 1V2DA 3AEMA 1D7SA 1YOOA 3B1DA 3WKRA 4MSOA 5TF5A 1AY5A 5D5SA 1BJ4A 5K8BA 3USFA 1GC0A 3VK3A 4H51A 5G0AA 3RQ1A 9AATA 4RLGA 5IWQA 3PIUA 3VK4A 4BMKA 1AKBA 3MADA 4AZKA 2ZY2A 3T32A 2W7LA 2GMSA 1QGNA 2O0RA 1LW5A 3K28A 3QGUA 4WYFA 3EIAA 1C4KA 5EAAA 1ORDA 2F8JA 1WYUA 1T3IA 3GWPA 4R5ZA 2CY8A 3E2FA 4UHOA 1W3UA 2W8VA 4KXKA 4PIWA 3NUBA 3HL2A 3LG0A 5J8QA 3G0TA 3GZCA 4RAEA 1O69A 3M5UA 3F0HA 5HXXA 3NYUA 1TOKA 2X8UA 5E3KA 2YKUA 3ACZA 4IXOA 1H1CA 3II0A 3RCHA 2VMUA 3TFTA 1TOGA 3LVMA 2FNUA 3BV0A 2VIBA 2BIAA 4PFFA 1W7MA 4JF0A 1C7GA 2VMOA 5F9SA 1CQ6A 1LC7A 1U08A 2W8UA 3AEPA 2YRIA 4E3QA 3VP6A 4H63Q 1J04A 1SF2A 1PMMA 3HLMA 4F5KA 1JS6A 1DKAA 4ZWMA 4WB0A 3K7YA 1S09A 2DKBA 2BI9A 4LNJA 4AH3A 4CBSA 1ARTA 2RFVA 1ARGA 1AY4A 2Z9XA 1B5PA 1ASDA 1KMKA 4Y0HA 4ZM3A 1AAMA 4RJYA 2D7ZA 1D7UA 2ZSMA 1YIZA 2E7IA 1I29A 2HOZA 2OKKA 1AX4A 2QBTA 2X5DA 3JTXA 4FFCA 4JEVA 4U1TA 1BJWA 4WYGA 3ZRPA 4JEXA 3N75A 3D6KA 1G4VA 3ECDA 1AHYA 3FQAA 3NU8A 5G2QA 1EJIA 3N4RA 4WYDA 3GBXA 3PJ0A 3NYTA 3VAXA 2WK9A 1IJIA 3AEJC 1TARA 2EZ2A 3BS8A 2Q7WA 4IYOA 1C9CA 2CB1A 5EFSA 4EB7A 4F5HA 5LH9A 3MAFB 3H9XA 1BJOA 4RM1A 1B8GA 3FKDA 3BCBA 4F5IA 3DYDA 2R0TA 4ZLVA 1QISA 2D64A 3DR7A 5E5IA 2YKVA 1XEYA 2ZUKA 1YJSA 4B98A 4A6RA 3FDBA 1D7RA 1OXOA 4XEWA 3MEBA 4UHNA 1KL1A 3GETA 4P3MA 4XAUA 3CQ4A 1X29A 5HHYA 4RIZA 1CQ7A 1AKCA 1AIBA 2D5YA 4R8DA 4BQ0A 3DR4A 2AY9A 4PFNA 5E4ZA 5FT4A 1JG8A 2X3LA 1AIAA 2BI5A 3P1TA 2BI3A 1ELQA 3E2ZB 4K2IA 1I41A 4HF8A 2E7UA 3GR9A 4AOAA 3ISLA 3CAIA 3WGCA 3H7FA 1SZUA 1M0PA 3BC8A 2FNIA 3ZRRA 4B9BA 2AY5A 3KGWA 3QN6A 3CQ5A 4CVQA 4WXFA 1B9HA 2CTZA 5I92A 3ASBA 3FQ7A 2R2NA 1SPAA 3AEMC 1AMSA 1D2FA 2V0YA 2FYFA 3PDXA 4RKDA 3TCMA 3BCXA 2YKYA 4LNLA 3FD0A 3PA9A 3NNKA 2Z1ZA 2BWPA 4ZASA 2VMRA 1S08A 4ZDOA 2WK8A 3JW9A 2HP2A 2YCTA 3WZFA 2Z9VA 3BWNC 2AY4A 3FVXA 2QLRA 2QB3A 2W8JA 3EIBA 4W91A 4Y0DA 1IX8A 1KKPA 4JEYA 1GC3A 3DC1A 3JU7A 1LC8A 1KMJA 1DGDA 5F8VA 4ZDLA 2KFPA 4Y0IA 5EUEA 5EUDA 3MC6C 3RBLA 5DJ1A 1M0QA 3PGYA 5M4BA 2CSTA 2VGVA 1IX6A 1LKCA 1X28A 4OMAA 2EH6A 2CJHA 3UAKA 1MLZA 4F5GA 2VLHA 3AATA 4OTLA 1V72A 2R5EA 2AEVA 3EI5A 2VGUA 1RV3A 2JJGA 3DODA 3LVLB 2E7JA 2YOBA 4RJ0A 3K40A 2VMTA 2FKIA 2ZY3A 2DOUA 1ARIA 3QI6A 2D66A 4ZSYA 3VK2A 4MKJA 4W1XA 4M2KA 3NRAA 3BWNA 5LHAA 3EI7A 5D95A 2ZYJA 1ARHA 3EZ1A 2C81A 1AY8A 1AMQA 2D7YA 3Q8NA 2CJGA 2EO5A 3JWBA 2QA3A 1VJOA 3MC6A 3AOWA 4N0WA 3EZSA 1QJ5A 1TATA 3ASAA 4WYAA 2W7MA 3MAFA 2EYQA 3AOVA 4JEZA 2HUFA 3PPLA 1LW4A 3B1CA 4A0HA 2G7JA 1AHFA 3LWSA 4TMRA 1RVUA 3P6KA 2HORA 3ELEA 4A6UA 3N7NA 3NX3A 1ASFA 2D65A 3UWCA 4ATPA 2AY8A 2JJEA 1LC5A 1UU1A 4GE9A 4LW4A 4OCAA 4JEWA 4ITXA 4N0BA 2VGSA 3KGXA 2OGEA 1WSTA 2GSAA 2BYJA 3E2ZA 1DGEA 3BCAA 4WP0A 4DGTA 1RV4A 3PAAA 2X5FA 4W1VA 1BJNA 2TPLA 4W5KA 1CQ8A 1ASCA 2W7EA 2OATA 3I4JA 4ADBA 1H0CA 4JE5A 1E5EA 2YKXA 1CZCA 4OBVA 1M6SA 1AJSA
chains in the Genus database with same CATH topology
3UE8A 1PG8A 1Z7DA 1BS0A 1ZOBA 2CJDA 3AELA 1KKJA 4XK1A 3EI8A 2BIEA 5EAVA 4DBCA 4OT8A 4ADEA 2VI8A 3ZZKA 2PB2A 1Y4IA 3QHXA 1G4XA 4WXBA 3PDBB 4AO4A 1EQBA 1SZSA 3FDDA 2Z67A 1O62A 1B4XA 2C0RA 4CXQA 2C44A 3AENB 2O1BA 2R5CB 1WYVB 2GMUA 3OP7A 1CS1A 1BKGA 2FM1A 2A1VA 3COGA 4O6ZA 4F5MA 1W7NA 1O4SA 4MQRA 5EIGA 1GDEA 2ZC0A 4NOGA 3N4XA 1DTYA 2W8WA 1AAWA 2VGZA 1QZ9A 3N0LA 4FL0A 3GJUA 1RVYA 3GZDC 3BB8A 2D61A 2BYLA 4ZDPA 4E1OA 1FG7A 3E6GA 4TV7A 1YIYA 1S06A 5G09A 3WKSA 2VLFA 1OXPA 1ASMA 3TFUA 4HVKA 3DXWA 1G7XA 4R5FA 1SZKA 2FN6A 4UHMA 1DJEA 3AEOA 2AY2A 5BJ3A 1WKGA 1AHGA 2VMNA 3HQTA 1UKJA 4XJMA 1M0NA 2WK7A 1GCKA 2QMAA 4RITA 5C6UA 3BWOA 4AZJA 1I43A 1CJ0A 3FZ8A 4IX8A 4MGRA 3FQ8A 2BKWA 3WY7A 4OYTA 4XJPA 4A72A 1AMAA 1GD9A 4A6TA 1YJZA 1AJSB 3CQ6A 4EMYA 1B9IA 1N31A 4PVFA 1FG3A 4A0FA 1BT4A 2FQ6A 4RKCA 2VMZA 2YCNA 3GZDA 3WLXA 1ZODA 5DX5A 3G8MA 4CBRA 3W1JA 2Z9WA 2W7DA 1V2EA 3A2BA 4F5LA 2DGKA 1C0NA 2W7JA 1M7YA 3DXVA 3F9TA 5G4JA 1TOEA 2ZY4A 2Z20A 3FCRA 3E2YA 4ITGA 3WX9A 4GRXA 2DGMA 4L0OA 4F5JA 2OQXA 1OATA 4EB5A 1FC4A 2XH1A 1C7OA 1MGVA 1JS3A 2CANA 3DZZA 5EIGB 4IW7A 3FFHA 1I48A 4E77A 2PB0A 3NTJA 3GSBA 1BQDA 2VMXA 3FRKA 4ADDA 3B1EA 2WB6A 2HOYA 2VGTA 1GC4A 4BA5A 2JJFA 1DJUA 3W1HA 3H14A 3RUYA 4F5FA 3L8AA 1ASLA 1P3WA 2W8TA 4WYEA 2VIAA 3FZ7A 3BN1A 1QJ3A 2W7IA 4CXRA 1IAXA 1M0OA 4XQ2A 4IXZA 3NUIA 4W8IA 1TASA 3PDBA 1S0AA 1X0MA 3EUCA 3WCNA 3B8XA 3FTBA 3TQXA 2W7HA 4ADCA 1AJRA 4EFFA 4K05A 3EI6A 4WLHA 1ASEA 3AENA 4DQ6A 2R5CA 1YNUA 1WYVA 4MQQA 2VMSA 3IHJA 4A00A 1IBJA 3I5TA 1MDOA 5EUNA 4XJOA 2HUUA 2JGTA 1ASBA 1MDZA 2AEUA 3FZ6A 3HMUA 4J5UA 1AHEA 1B5OA 2CH1A 2Z61A 4ZSWA 4QGRA 1CL2A 1KL2A 4M2JA 1JF9A 2E54A 4Q6RA 1IVRA 2Z1YA 3ZZJA 3TATA 4A0GA 2OKJA 1GEXA 2ZJGA 2HUIA 4AO9A 3LY1A 3ELPA 4E3RA 3PD6B 2ZP7A 2AY6A 2VMQA 5HDMA 2XBNA 2OGAA 3JZLA 3RI6A 5JAYA 4KAMA 1W23A 2HOXA 4K2BA 2JISA 2V1PA 4GE4A 3DRDA 3R4TA 3IF2A 1OHWA 3E9KA 3LVKA 1PFFA 2O7CA 4OBUA 2VGWA 2ZY5A 1TPLA 2EPJA 1J32A 3QM2A 4IY7A 5M49A 1G7WA 2CFBA 2HZPA 3NDNA 4GE7A 4MKKA 2AY1A 1IAYA 1YAAA 1AHXA 3JWAA 4JF1A 2Z9UA 1OHVA 1MAPA 3KKIA 2W7FA 3NU7A 4MY5A 4UQVA 1VEFA 4LC3A 4EU1A 1Z3ZA 2BI1A 3FVUA 4WXGA 1ASAA 3B46A 3WGBA 1LS3A 1SFFA 1ZC9A 2CH2A 3ATHA 1IUGA 3OKSA 5M4DA 5KTBA 1TOJA 1ASNA 4KYOA 8AATA 2BIGA 5FT5A 3MKJA 1LK9A 1BW0A 4J8LA 4GSAA 4LNMA 5FT8A 2WKAA 4GEBA 5FT6A 2JJHA 1DJ9A 3RBFA 2GB3A 1GBNA 1BQAA 3G7QA 2EGYA 4LW2A 1GEWA 1E5FA 3QPGA 3HBXA 1ELUA 4ZWVA 3I16A 4WYCA 2VYCA 3N5MA 1AKAA 1S07A 2W7GA 5DB5A 1WYTA 2AY7A 3CBFA 4OC9A 4K2MA 4WBTA 1ECXA 3A9XA 3L44A 1WKHA 2BWNA 3FFRA 2AATA 1C7NA 2GQNA 4Q75A 1WYUB 4ZAHA 7AATA 2JG2A 1YJYA 2DKJA 3A8UX 3VOMA 2VMPA 2YRRA 2VMYA 4R2NA 1DFOA 2ZSLA 5BJ4A 5AX8A 4ZM4A 1N8PA 1ASGA 4BA4A 1EG5A 1D7VA 4JE5D 1QITA 2VMVA 3HVYA 1M32A 2BHXA 2YHKA 1CZEA 1AMRA 1OHYA 3RCHB 2QSRA 4P7YA 3W1IA 1UU2A 1VP4A 1TOIA 2HP1A 4M2MA 2VMWA 1AICA 2DGLA 1UU0A 3A9YA 3PD6A 1MDXA 2ORDA 3A9ZA 4IXSA 1ARSA 4GDYA 4BHDA 2EZ1A 1QIRA 1XI9A 4Q76A 2C7TA 3LV2A 1X2AA 3F6TA 1GC2A 4Q31A 1N2TA 3AEJA 4WB0B 2DR1A 3MAUA 1GEYA 3E77A 3FSLA 2BWOA 4XJLA 4ATQA 3LVJA 2D63A 3DU4A 4ISYA 1V2FA 3EI9A 1M4NA 2QB2A 3ZRQA 3R9AA 3KE3A 1MLYA 2VI9A 1WYTB 2G6WA 3MBBA 5EQCA 4I8AA 3AV7A 1PMOA 3HDOA 4U2HA 5G2PA 5DJ9A 5M46A 4MQPA 1CL1A 2AY3A 3QBOA 2NMPA 1SVVA 2CINA 5G4IA 3NYSA 1W7LA 4W1WA 4A0RA 4WD2A 4IYOB 2PO3A 4UOYA 2W7KA 3FVSA 1O61A 4WLJA 4F4EA 4TN4A 3WCOA 1MAQA 1BJOB 3N4SA 2YCPA 1IX7A 3HT4A 2BI2A 1V2DA 3AEMA 1D7SA 1YOOA 3B1DA 3WKRA 4MSOA 5TF5A 1AY5A 5D5SA 1BJ4A 5K8BA 3USFA 1GC0A 3VK3A 4H51A 5G0AA 3RQ1A 9AATA 4RLGA 5IWQA 3PIUA 3VK4A 4BMKA 1AKBA 3MADA 4AZKA 2ZY2A 3T32A 2W7LA 2GMSA 1QGNA 2O0RA 1LW5A 3K28A 3QGUA 4WYFA 3EIAA 1C4KA 5EAAA 1ORDA 2F8JA 1WYUA 1T3IA 3GWPA 4R5ZA 2CY8A 3E2FA 4UHOA 1W3UA 2W8VA 4KXKA 4PIWA 3NUBA 3HL2A 3LG0A 5J8QA 3G0TA 3GZCA 4RAEA 1O69A 3M5UA 3F0HA 5HXXA 3NYUA 1TOKA 2X8UA 5E3KA 2YKUA 3ACZA 4IXOA 1H1CA 3II0A 3RCHA 2VMUA 3TFTA 1TOGA 3LVMA 2FNUA 3BV0A 2VIBA 2BIAA 4PFFA 1W7MA 4JF0A 1C7GA 2VMOA 5F9SA 1CQ6A 1LC7A 1U08A 2W8UA 3AEPA 2YRIA 4E3QA 3VP6A 4H63Q 1J04A 1SF2A 1PMMA 3HLMA 4F5KA 1JS6A 1DKAA 4ZWMA 4WB0A 3K7YA 1S09A 2DKBA 2BI9A 4LNJA 4AH3A 4CBSA 1ARTA 2RFVA 1ARGA 1AY4A 2Z9XA 1B5PA 1ASDA 1KMKA 4Y0HA 4ZM3A 1AAMA 4RJYA 2D7ZA 1D7UA 2ZSMA 1YIZA 2E7IA 1I29A 2HOZA 2OKKA 1AX4A 2QBTA 2X5DA 3JTXA 4FFCA 4JEVA 4U1TA 1BJWA 4WYGA 3ZRPA 4JEXA 3N75A 3D6KA 1G4VA 3ECDA 1AHYA 3FQAA 3NU8A 5G2QA 1EJIA 3N4RA 4WYDA 3GBXA 3PJ0A 3NYTA 3VAXA 2WK9A 1IJIA 3AEJC 1TARA 2EZ2A 3BS8A 2Q7WA 4IYOA 1C9CA 2CB1A 5EFSA 4EB7A 4F5HA 5LH9A 3MAFB 3H9XA 1BJOA 4RM1A 1B8GA 3FKDA 3BCBA 4F5IA 3DYDA 2R0TA 4ZLVA 1QISA 2D64A 3DR7A 5E5IA 2YKVA 1XEYA 2ZUKA 1YJSA 4B98A 4A6RA 3FDBA 1D7RA 1OXOA 4XEWA 3MEBA 4UHNA 1KL1A 3GETA 4P3MA 4XAUA 3CQ4A 1X29A 5HHYA 4RIZA 1CQ7A 1AKCA 1AIBA 2D5YA 4R8DA 4BQ0A 3DR4A 2AY9A 4PFNA 5E4ZA 5FT4A 1JG8A 2X3LA 1AIAA 2BI5A 3P1TA 2BI3A 1ELQA 3E2ZB 4K2IA 1I41A 4HF8A 2E7UA 3GR9A 4AOAA 3ISLA 3CAIA 3WGCA 3H7FA 1SZUA 1M0PA 3BC8A 2FNIA 3ZRRA 4B9BA 2AY5A 3KGWA 3QN6A 3CQ5A 4CVQA 4WXFA 1B9HA 2CTZA 5I92A 3ASBA 3FQ7A 2R2NA 1SPAA 3AEMC 1AMSA 1D2FA 2V0YA 2FYFA 3PDXA 4RKDA 3TCMA 3BCXA 2YKYA 4LNLA 3FD0A 3PA9A 3NNKA 2Z1ZA 2BWPA 4ZASA 2VMRA 1S08A 4ZDOA 2WK8A 3JW9A 2HP2A 2YCTA 3WZFA 2Z9VA 3BWNC 2AY4A 3FVXA 2QLRA 2QB3A 2W8JA 3EIBA 4W91A 4Y0DA 1IX8A 1KKPA 4JEYA 1GC3A 3DC1A 3JU7A 1LC8A 1KMJA 1DGDA 5F8VA 4ZDLA 2KFPA 4Y0IA 5EUEA 5EUDA 3MC6C 3RBLA 5DJ1A 1M0QA 3PGYA 5M4BA 2CSTA 2VGVA 1IX6A 1LKCA 1X28A 4OMAA 2EH6A 2CJHA 3UAKA 1MLZA 4F5GA 2VLHA 3AATA 4OTLA 1V72A 2R5EA 2AEVA 3EI5A 2VGUA 1RV3A 2JJGA 3DODA 3LVLB 2E7JA 2YOBA 4RJ0A 3K40A 2VMTA 2FKIA 2ZY3A 2DOUA 1ARIA 3QI6A 2D66A 4ZSYA 3VK2A 4MKJA 4W1XA 4M2KA 3NRAA 3BWNA 5LHAA 3EI7A 5D95A 2ZYJA 1ARHA 3EZ1A 2C81A 1AY8A 1AMQA 2D7YA 3Q8NA 2CJGA 2EO5A 3JWBA 2QA3A 1VJOA 3MC6A 3AOWA 4N0WA 3EZSA 1QJ5A 1TATA 3ASAA 4WYAA 2W7MA 3MAFA 2EYQA 3AOVA 4JEZA 2HUFA 3PPLA 1LW4A 3B1CA 4A0HA 2G7JA 1AHFA 3LWSA 4TMRA 1RVUA 3P6KA 2HORA 3ELEA 4A6UA 3N7NA 3NX3A 1ASFA 2D65A 3UWCA 4ATPA 2AY8A 2JJEA 1LC5A 1UU1A 4GE9A 4LW4A 4OCAA 4JEWA 4ITXA 4N0BA 2VGSA 3KGXA 2OGEA 1WSTA 2GSAA 2BYJA 3E2ZA 1DGEA 3BCAA 4WP0A 4DGTA 1RV4A 3PAAA 2X5FA 4W1VA 1BJNA 2TPLA 4W5KA 1CQ8A 1ASCA 2W7EA 2OATA 3I4JA 4ADBA 1H0CA 4JE5A 1E5EA 2YKXA 1CZCA 4OBVA 1M6SA 1AJSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UE8 A;  1PG8 A;  1Z7D A;  1BS0 A;  1ZOB A;  2CJD A;  3AEL A;  1KKJ A;  4XK1 A;  3EI8 A;  2BIE A;  5EAV A;  4DBC A;  4OT8 A;  4ADE A;  2VI8 A;  3ZZK A;  2PB2 A;  1Y4I A;  3QHX A;  1G4X A;  4WXB A;  3PDB B;  4AO4 A;  1EQB A;  1SZS A;  3FDD A;  2Z67 A;  1O62 A;  1B4X A;  2C0R A;  4CXQ A;  2C44 A;  3AEN B;  2O1B A;  2R5C B;  1WYV B;  2GMU A;  3OP7 A;  1CS1 A;  1BKG A;  2FM1 A;  3COG A;  4O6Z A;  4F5M A;  1W7N A;  1O4S A;  4MQR A;  5EIG A;  1GDE A;  2ZC0 A;  4NOG A;  1DTY A;  2W8W A;  1AAW A;  2VGZ A;  1QZ9 A;  3N0L A;  4FL0 A;  3GJU A;  1RVY A;  3GZD C;  3BB8 A;  2D61 A;  2BYL A;  4ZDP A;  4E1O A;  1FG7 A;  3E6G A;  4TV7 A;  1YIY A;  1S06 A;  5G09 A;  3WKS A;  2VLF A;  1OXP A;  1ASM A;  3TFU A;  4HVK A;  3DXW A;  1G7X A;  4R5F A;  1SZK A;  2FN6 A;  4UHM A;  1DJE A;  3AEO A;  2AY2 A;  5BJ3 A;  1WKG A;  1AHG A;  2VMN A;  3HQT A;  1UKJ A;  4XJM A;  1M0N A;  2WK7 A;  1GCK A;  2QMA A;  4RIT A;  5C6U A;  3BWO A;  4AZJ A;  1I43 A;  1CJ0 A;  3FZ8 A;  4IX8 A;  4MGR A;  3FQ8 A;  2BKW A;  3WY7 A;  4OYT A;  4XJP A;  4A72 A;  1AMA A;  1GD9 A;  4A6T A;  1YJZ A;  1AJS B;  3CQ6 A;  4EMY A;  1B9I A;  1N31 A;  4PVF A;  1FG3 A;  4A0F A;  1BT4 A;  2FQ6 A;  4RKC A;  2VMZ A;  2YCN A;  3GZD A;  3WLX A;  1ZOD A;  5DX5 A;  3G8M A;  4CBR A;  3W1J A;  2Z9W A;  2W7D A;  1V2E A;  3A2B A;  4F5L A;  2DGK A;  1C0N A;  2W7J A;  1M7Y A;  3DXV A;  3F9T A;  5G4J A;  1TOE A;  2ZY4 A;  2Z20 A;  3FCR A;  3E2Y A;  4ITG A;  3WX9 A;  4GRX A;  2DGM A;  4L0O A;  4F5J A;  2OQX A;  1OAT A;  4EB5 A;  1FC4 A;  2XH1 A;  1C7O A;  1MGV A;  1JS3 A;  2CAN A;  3DZZ A;  5EIG B;  4IW7 A;  3FFH A;  1I48 A;  4E77 A;  2PB0 A;  3NTJ A;  3GSB A;  1BQD A;  2VMX A;  3FRK A;  4ADD A;  3B1E A;  2HOY A;  2VGT A;  1GC4 A;  4BA5 A;  2JJF A;  1DJU A;  3W1H A;  3H14 A;  3RUY A;  4F5F A;  3L8A A;  1ASL A;  1P3W A;  2W8T A;  4WYE A;  2VIA A;  3FZ7 A;  3BN1 A;  1QJ3 A;  2W7I A;  4CXR A;  1IAX A;  1M0O A;  4XQ2 A;  4IXZ A;  3NUI A;  4W8I A;  1TAS A;  3PDB A;  1S0A A;  1X0M A;  3EUC A;  3WCN A;  3B8X A;  3FTB A;  3TQX A;  2W7H A;  4ADC A;  1AJR A;  4EFF A;  3EI6 A;  4WLH A;  1ASE A;  3AEN A;  4DQ6 A;  2R5C A;  1YNU A;  1WYV A;  4MQQ A;  2VMS A;  3IHJ A;  4A00 A;  1IBJ A;  3I5T A;  1MDO A;  5EUN A;  4XJO A;  2HUU A;  2JGT A;  1ASB A;  1MDZ A;  2AEU A;  3FZ6 A;  3HMU A;  4J5U A;  1AHE A;  1B5O A;  2CH1 A;  2Z61 A;  4ZSW A;  4QGR A;  1CL2 A;  1KL2 A;  4M2J A;  1JF9 A;  2E54 A;  4Q6R A;  1IVR A;  2Z1Y A;  3ZZJ A;  3TAT A;  4A0G A;  2OKJ A;  1GEX A;  2ZJG A;  2HUI A;  4AO9 A;  3LY1 A;  3ELP A;  4E3R A;  3PD6 B;  2ZP7 A;  2AY6 A;  2VMQ A;  5HDM A;  2XBN A;  2OGA A;  3JZL A;  3RI6 A;  5JAY A;  4KAM A;  1W23 A;  2HOX A;  4K2B A;  2JIS A;  2V1P A;  4GE4 A;  3DRD A;  3R4T A;  3IF2 A;  1OHW A;  3E9K A;  3LVK A;  1PFF A;  2O7C A;  4OBU A;  2VGW A;  2ZY5 A;  1TPL A;  2EPJ A;  1J32 A;  3QM2 A;  4IY7 A;  5M49 A;  1G7W A;  2CFB A;  2HZP A;  3NDN A;  4GE7 A;  4MKK A;  2AY1 A;  1IAY A;  1YAA A;  1AHX A;  3JWA A;  4JF1 A;  2Z9U A;  1OHV A;  1MAP A;  3KKI A;  2W7F A;  3NU7 A;  4MY5 A;  4UQV A;  1VEF A;  4LC3 A;  4EU1 A;  1Z3Z A;  2BI1 A;  3FVU A;  4WXG A;  1ASA A;  3B46 A;  3WGB A;  1LS3 A;  1SFF A;  1ZC9 A;  2CH2 A;  3ATH A;  1IUG A;  3OKS A;  5M4D A;  1TOJ A;  1ASN A;  4KYO A;  8AAT A;  2BIG A;  5FT5 A;  3MKJ A;  1LK9 A;  1BW0 A;  4J8L A;  4GSA A;  4LNM A;  5FT8 A;  2WKA A;  4GEB A;  5FT6 A;  2JJH A;  1DJ9 A;  3RBF A;  2GB3 A;  1GBN A;  1BQA A;  3G7Q A;  2EGY A;  4LW2 A;  1GEW A;  1E5F A;  3QPG A;  3HBX A;  1ELU A;  4ZWV A;  3I16 A;  4WYC A;  2VYC A;  3N5M A;  1AKA A;  1S07 A;  2W7G A;  5DB5 A;  1WYT A;  2AY7 A;  3CBF A;  4OC9 A;  4K2M A;  4WBT A;  1ECX A;  3A9X A;  3L44 A;  1WKH A;  2BWN A;  3FFR A;  2AAT A;  1C7N A;  2GQN A;  4Q75 A;  1WYU B;  4ZAH A;  7AAT A;  2JG2 A;  1YJY A;  2DKJ A;  3A8U X;  3VOM A;  2VMP A;  2YRR A;  2VMY A;  4R2N A;  1DFO A;  2ZSL A;  5BJ4 A;  5AX8 A;  4ZM4 A;  1N8P A;  1ASG A;  4BA4 A;  1EG5 A;  1D7V A;  4JE5 D;  1QIT A;  2VMV A;  3HVY A;  1M32 A;  2BHX A;  2YHK A;  1CZE A;  1AMR A;  1OHY A;  3RCH B;  4P7Y A;  3W1I A;  1UU2 A;  1VP4 A;  1TOI A;  2HP1 A;  4M2M A;  2VMW A;  1AIC A;  2DGL A;  1UU0 A;  3A9Y A;  3PD6 A;  1MDX A;  2ORD A;  3A9Z A;  4IXS A;  1ARS A;  4GDY A;  4BHD A;  2EZ1 A;  1QIR A;  1XI9 A;  4Q76 A;  2C7T A;  3LV2 A;  1X2A A;  3F6T A;  1GC2 A;  4Q31 A;  1N2T A;  3AEJ A;  4WB0 B;  2DR1 A;  3MAU A;  1GEY A;  3E77 A;  3FSL A;  2BWO A;  4XJL A;  4ATQ A;  3LVJ A;  2D63 A;  3DU4 A;  4ISY A;  1V2F A;  3EI9 A;  1M4N A;  2QB2 A;  3ZRQ A;  3R9A A;  3KE3 A;  1MLY A;  2VI9 A;  1WYT B;  2G6W A;  3MBB A;  5EQC A;  4I8A A;  3AV7 A;  1PMO A;  3HDO A;  4U2H A;  5G2P A;  5DJ9 A;  5M46 A;  4MQP A;  1CL1 A;  2AY3 A;  3QBO A;  2NMP A;  1SVV A;  2CIN A;  5G4I A;  3NYS A;  1W7L A;  4W1W A;  4A0R A;  4WD2 A;  4IYO B;  2PO3 A;  4UOY A;  2W7K A;  3FVS A;  1O61 A;  4WLJ A;  4F4E A;  4TN4 A;  3WCO A;  1MAQ A;  1BJO B;  2YCP A;  1IX7 A;  3HT4 A;  2BI2 A;  1V2D A;  3AEM A;  1D7S A;  1YOO A;  3B1D A;  3WKR A;  4MSO A;  5TF5 A;  1AY5 A;  5D5S A;  1BJ4 A;  5K8B A;  3USF A;  1GC0 A;  3VK3 A;  4H51 A;  5G0A A;  3RQ1 A;  9AAT A;  4RLG A;  5IWQ A;  3PIU A;  3VK4 A;  4BMK A;  1AKB A;  3MAD A;  4AZK A;  2ZY2 A;  3T32 A;  2W7L A;  2GMS A;  1QGN A;  2O0R A;  1LW5 A;  3K28 A;  3QGU A;  4WYF A;  3EIA A;  1C4K A;  5EAA A;  1ORD A;  2F8J A;  1WYU A;  1T3I A;  3GWP A;  4R5Z A;  2CY8 A;  3E2F A;  4UHO A;  1W3U A;  2W8V A;  4KXK A;  4PIW A;  3NUB A;  3HL2 A;  3LG0 A;  5J8Q A;  3G0T A;  3GZC A;  4RAE A;  1O69 A;  3M5U A;  3F0H A;  5HXX A;  3NYU A;  1TOK A;  2X8U A;  5E3K A;  2YKU A;  3ACZ A;  4IXO A;  1H1C A;  3II0 A;  3RCH A;  2VMU A;  3TFT A;  1TOG A;  3LVM A;  2FNU A;  3BV0 A;  2VIB A;  2BIA A;  4PFF A;  1W7M A;  4JF0 A;  1C7G A;  2VMO A;  5F9S A;  1CQ6 A;  1LC7 A;  1U08 A;  2W8U A;  3AEP A;  2YRI A;  4E3Q A;  3VP6 A;  1J04 A;  1SF2 A;  1PMM A;  3HLM A;  4F5K A;  1JS6 A;  1DKA A;  4ZWM A;  4WB0 A;  3K7Y A;  1S09 A;  2DKB A;  2BI9 A;  4LNJ A;  4AH3 A;  4CBS A;  1ART A;  2RFV A;  1ARG A;  1AY4 A;  2Z9X A;  1B5P A;  1ASD A;  1KMK A;  4Y0H A;  4ZM3 A;  1AAM A;  4RJY A;  2D7Z A;  1D7U A;  2ZSM A;  1YIZ A;  2E7I A;  1I29 A;  2HOZ A;  2OKK A;  1AX4 A;  2QBT A;  2X5D A;  3JTX A;  4FFC A;  4JEV A;  4U1T A;  1BJW A;  4WYG A;  3ZRP A;  4JEX A;  3N75 A;  3D6K A;  1G4V A;  3ECD A;  1AHY A;  3FQA A;  3NU8 A;  5G2Q A;  1EJI A;  4WYD A;  3GBX A;  3PJ0 A;  3NYT A;  3VAX A;  2WK9 A;  1IJI A;  3AEJ C;  1TAR A;  2EZ2 A;  3BS8 A;  2Q7W A;  4IYO A;  1C9C A;  2CB1 A;  5EFS A;  4EB7 A;  4F5H A;  5LH9 A;  3MAF B;  1BJO A;  4RM1 A;  1B8G A;  3FKD A;  3BCB A;  4F5I A;  3DYD A;  2R0T A;  4ZLV A;  1QIS A;  2D64 A;  3DR7 A;  5E5I A;  2YKV A;  1XEY A;  2ZUK A;  1YJS A;  4B98 A;  4A6R A;  3FDB A;  1D7R A;  1OXO A;  4XEW A;  3MEB A;  4UHN A;  1KL1 A;  3GET A;  4P3M A;  4XAU A;  3CQ4 A;  1X29 A;  5HHY A;  4RIZ A;  1CQ7 A;  1AKC A;  1AIB A;  2D5Y A;  4R8D A;  4BQ0 A;  3DR4 A;  2AY9 A;  4PFN A;  5E4Z A;  5FT4 A;  1JG8 A;  2X3L A;  1AIA A;  2BI5 A;  3P1T A;  2BI3 A;  1ELQ A;  3E2Z B;  4K2I A;  1I41 A;  4HF8 A;  2E7U A;  3GR9 A;  4AOA A;  3ISL A;  3CAI A;  3WGC A;  3H7F A;  1SZU A;  1M0P A;  3BC8 A;  2FNI A;  3ZRR A;  4B9B A;  2AY5 A;  3KGW A;  3QN6 A;  3CQ5 A;  4CVQ A;  4WXF A;  1B9H A;  2CTZ A;  5I92 A;  3ASB A;  3FQ7 A;  2R2N A;  1SPA A;  3AEM C;  1AMS A;  1D2F A;  2V0Y A;  2FYF A;  3PDX A;  4RKD A;  3TCM A;  3BCX A;  2YKY A;  4LNL A;  3FD0 A;  3PA9 A;  3NNK A;  2Z1Z A;  2BWP A;  4ZAS A;  2VMR A;  1S08 A;  4ZDO A;  2WK8 A;  3JW9 A;  2HP2 A;  2YCT A;  3WZF A;  2Z9V A;  3BWN C;  2AY4 A;  3FVX A;  2QLR A;  2QB3 A;  2W8J A;  3EIB A;  4W91 A;  4Y0D A;  1IX8 A;  1KKP A;  4JEY A;  1GC3 A;  3DC1 A;  3JU7 A;  1LC8 A;  1KMJ A;  1DGD A;  5F8V A;  4ZDL A;  4Y0I A;  5EUE A;  5EUD A;  3MC6 C;  3RBL A;  5DJ1 A;  1M0Q A;  3PGY A;  5M4B A;  2CST A;  2VGV A;  1IX6 A;  1LKC A;  1X28 A;  4OMA A;  2EH6 A;  2CJH A;  3UAK A;  1MLZ A;  4F5G A;  2VLH A;  3AAT A;  4OTL A;  1V72 A;  2R5E A;  2AEV A;  3EI5 A;  2VGU A;  1RV3 A;  2JJG A;  3DOD A;  3LVL B;  2E7J A;  2YOB A;  4RJ0 A;  3K40 A;  2VMT A;  2ZY3 A;  2DOU A;  1ARI A;  3QI6 A;  2D66 A;  4ZSY A;  3VK2 A;  4MKJ A;  4W1X A;  4M2K A;  3NRA A;  3BWN A;  5LHA A;  3EI7 A;  5D95 A;  2ZYJ A;  1ARH A;  3EZ1 A;  2C81 A;  1AY8 A;  1AMQ A;  2D7Y A;  3Q8N A;  2CJG A;  2EO5 A;  3JWB A;  2QA3 A;  1VJO A;  3MC6 A;  3AOW A;  4N0W A;  3EZS A;  1QJ5 A;  1TAT A;  3ASA A;  4WYA A;  2W7M A;  3MAF A;  3AOV A;  4JEZ A;  2HUF A;  3PPL A;  1LW4 A;  3B1C A;  4A0H A;  1AHF A;  3LWS A;  4TMR A;  1RVU A;  3P6K A;  2HOR A;  3ELE A;  4A6U A;  3NX3 A;  1ASF A;  2D65 A;  3UWC A;  4ATP A;  2AY8 A;  2JJE A;  1LC5 A;  1UU1 A;  4GE9 A;  4LW4 A;  4OCA A;  4JEW A;  4ITX A;  4N0B A;  2VGS A;  3KGX A;  2OGE A;  1WST A;  2GSA A;  2BYJ A;  3E2Z A;  1DGE A;  3BCA A;  4WP0 A;  4DGT A;  1RV4 A;  3PAA A;  2X5F A;  4W1V A;  1BJN A;  2TPL A;  4W5K A;  1CQ8 A;  1ASC A;  2W7E A;  2OAT A;  3I4J A;  4ADB A;  1H0C A;  4JE5 A;  1E5E A;  2YKX A;  1CZC A;  4OBV A;  1M6S A;  1AJS A; 
#chains in the Genus database with same CATH topology
 3UE8 A;  1PG8 A;  1Z7D A;  1BS0 A;  1ZOB A;  2CJD A;  3AEL A;  1KKJ A;  4XK1 A;  3EI8 A;  2BIE A;  5EAV A;  4DBC A;  4OT8 A;  4ADE A;  2VI8 A;  3ZZK A;  2PB2 A;  1Y4I A;  3QHX A;  1G4X A;  4WXB A;  3PDB B;  4AO4 A;  1EQB A;  1SZS A;  3FDD A;  2Z67 A;  1O62 A;  1B4X A;  2C0R A;  4CXQ A;  2C44 A;  3AEN B;  2O1B A;  2R5C B;  1WYV B;  2GMU A;  3OP7 A;  1CS1 A;  1BKG A;  2FM1 A;  2A1V A;  3COG A;  4O6Z A;  4F5M A;  1W7N A;  1O4S A;  4MQR A;  5EIG A;  1GDE A;  2ZC0 A;  4NOG A;  3N4X A;  1DTY A;  2W8W A;  1AAW A;  2VGZ A;  1QZ9 A;  3N0L A;  4FL0 A;  3GJU A;  1RVY A;  3GZD C;  3BB8 A;  2D61 A;  2BYL A;  4ZDP A;  4E1O A;  1FG7 A;  3E6G A;  4TV7 A;  1YIY A;  1S06 A;  5G09 A;  3WKS A;  2VLF A;  1OXP A;  1ASM A;  3TFU A;  4HVK A;  3DXW A;  1G7X A;  4R5F A;  1SZK A;  2FN6 A;  4UHM A;  1DJE A;  3AEO A;  2AY2 A;  5BJ3 A;  1WKG A;  1AHG A;  2VMN A;  3HQT A;  1UKJ A;  4XJM A;  1M0N A;  2WK7 A;  1GCK A;  2QMA A;  4RIT A;  5C6U A;  3BWO A;  4AZJ A;  1I43 A;  1CJ0 A;  3FZ8 A;  4IX8 A;  4MGR A;  3FQ8 A;  2BKW A;  3WY7 A;  4OYT A;  4XJP A;  4A72 A;  1AMA A;  1GD9 A;  4A6T A;  1YJZ A;  1AJS B;  3CQ6 A;  4EMY A;  1B9I A;  1N31 A;  4PVF A;  1FG3 A;  4A0F A;  1BT4 A;  2FQ6 A;  4RKC A;  2VMZ A;  2YCN A;  3GZD A;  3WLX A;  1ZOD A;  5DX5 A;  3G8M A;  4CBR A;  3W1J A;  2Z9W A;  2W7D A;  1V2E A;  3A2B A;  4F5L A;  2DGK A;  1C0N A;  2W7J A;  1M7Y A;  3DXV A;  3F9T A;  5G4J A;  1TOE A;  2ZY4 A;  2Z20 A;  3FCR A;  3E2Y A;  4ITG A;  3WX9 A;  4GRX A;  2DGM A;  4L0O A;  4F5J A;  2OQX A;  1OAT A;  4EB5 A;  1FC4 A;  2XH1 A;  1C7O A;  1MGV A;  1JS3 A;  2CAN A;  3DZZ A;  5EIG B;  4IW7 A;  3FFH A;  1I48 A;  4E77 A;  2PB0 A;  3NTJ A;  3GSB A;  1BQD A;  2VMX A;  3FRK A;  4ADD A;  3B1E A;  2WB6 A;  2HOY A;  2VGT A;  1GC4 A;  4BA5 A;  1KAF A;  2JJF A;  1DJU A;  3W1H A;  3H14 A;  3RUY A;  4F5F A;  3L8A A;  1ASL A;  1P3W A;  2W8T A;  4WYE A;  2VIA A;  3FZ7 A;  3BN1 A;  1QJ3 A;  2W7I A;  4CXR A;  1IAX A;  1M0O A;  4XQ2 A;  4IXZ A;  3NUI A;  4W8I A;  1TAS A;  3PDB A;  1S0A A;  1X0M A;  3EUC A;  3WCN A;  3B8X A;  3FTB A;  3TQX A;  2W7H A;  4ADC A;  1AJR A;  4EFF A;  4K05 A;  3EI6 A;  4WLH A;  1ASE A;  3AEN A;  4DQ6 A;  2R5C A;  1YNU A;  1WYV A;  4MQQ A;  2VMS A;  3IHJ A;  4A00 A;  1IBJ A;  3I5T A;  1MDO A;  5EUN A;  4XJO A;  2HUU A;  2JGT A;  1ASB A;  1MDZ A;  2AEU A;  3FZ6 A;  3HMU A;  4J5U A;  1AHE A;  1B5O A;  2CH1 A;  2Z61 A;  4ZSW A;  4QGR A;  1CL2 A;  1KL2 A;  4M2J A;  1JF9 A;  2E54 A;  4Q6R A;  1IVR A;  2Z1Y A;  3ZZJ A;  3TAT A;  4A0G A;  2OKJ A;  1GEX A;  2ZJG A;  2HUI A;  4AO9 A;  3LY1 A;  3ELP A;  4E3R A;  3PD6 B;  2ZP7 A;  2AY6 A;  2VMQ A;  5HDM A;  2XBN A;  2OGA A;  3JZL A;  3RI6 A;  5JAY A;  4KAM A;  1W23 A;  2HOX A;  4K2B A;  2JIS A;  2V1P A;  4GE4 A;  3DRD A;  3R4T A;  3IF2 A;  1OHW A;  3E9K A;  3LVK A;  1PFF A;  2O7C A;  4OBU A;  2VGW A;  2ZY5 A;  1TPL A;  2EPJ A;  1J32 A;  3QM2 A;  4IY7 A;  5M49 A;  1G7W A;  2CFB A;  2HZP A;  3NDN A;  4GE7 A;  4MKK A;  2AY1 A;  1IAY A;  1YAA A;  1AHX A;  3JWA A;  4JF1 A;  2Z9U A;  1OHV A;  1MAP A;  3KKI A;  2W7F A;  3NU7 A;  4MY5 A;  4UQV A;  1VEF A;  4LC3 A;  4EU1 A;  1Z3Z A;  2BI1 A;  3FVU A;  4WXG A;  1ASA A;  3B46 A;  3WGB A;  1LS3 A;  1SFF A;  1ZC9 A;  2CH2 A;  3ATH A;  1IUG A;  3OKS A;  5M4D A;  5KTB A;  1TOJ A;  1ASN A;  4KYO A;  8AAT A;  2BIG A;  5FT5 A;  3MKJ A;  1LK9 A;  1BW0 A;  4J8L A;  4GSA A;  4LNM A;  5FT8 A;  2WKA A;  4GEB A;  5FT6 A;  2JJH A;  1DJ9 A;  3RBF A;  2GB3 A;  1GBN A;  1BQA A;  3G7Q A;  2EGY A;  4LW2 A;  1GEW A;  1E5F A;  3QPG A;  3HBX A;  1ELU A;  4ZWV A;  3I16 A;  4WYC A;  2VYC A;  3N5M A;  1AKA A;  1S07 A;  2W7G A;  5DB5 A;  1WYT A;  2AY7 A;  3CBF A;  4OC9 A;  4K2M A;  4WBT A;  1ECX A;  3A9X A;  3L44 A;  1WKH A;  2BWN A;  3FFR A;  2AAT A;  1C7N A;  2GQN A;  4Q75 A;  1WYU B;  4ZAH A;  7AAT A;  2JG2 A;  1YJY A;  2DKJ A;  3A8U X;  3VOM A;  2VMP A;  2YRR A;  2VMY A;  4R2N A;  1DFO A;  2ZSL A;  5BJ4 A;  5AX8 A;  4ZM4 A;  1N8P A;  1ASG A;  4BA4 A;  1EG5 A;  1D7V A;  4JE5 D;  1QIT A;  2VMV A;  3HVY A;  1M32 A;  2BHX A;  2YHK A;  1CZE A;  1AMR A;  1OHY A;  3RCH B;  2QSR A;  4P7Y A;  3W1I A;  1UU2 A;  1VP4 A;  1TOI A;  2HP1 A;  4M2M A;  2VMW A;  1AIC A;  2DGL A;  1UU0 A;  3A9Y A;  3PD6 A;  1MDX A;  2ORD A;  3A9Z A;  4IXS A;  1ARS A;  4GDY A;  4BHD A;  2EZ1 A;  1QIR A;  1XI9 A;  4Q76 A;  2C7T A;  3LV2 A;  1X2A A;  3F6T A;  1GC2 A;  4Q31 A;  1N2T A;  3AEJ A;  4WB0 B;  2DR1 A;  3MAU A;  1GEY A;  3E77 A;  3FSL A;  2BWO A;  4XJL A;  4ATQ A;  3LVJ A;  2D63 A;  3DU4 A;  4ISY A;  1V2F A;  3EI9 A;  1M4N A;  2QB2 A;  3ZRQ A;  3R9A A;  3KE3 A;  1MLY A;  2VI9 A;  1WYT B;  2G6W A;  3MBB A;  5EQC A;  4I8A A;  3AV7 A;  1PMO A;  3HDO A;  4U2H A;  5G2P A;  5DJ9 A;  5M46 A;  4MQP A;  1CL1 A;  2AY3 A;  3QBO A;  2NMP A;  1SVV A;  2CIN A;  5G4I A;  3NYS A;  1W7L A;  4W1W A;  4A0R A;  4WD2 A;  4IYO B;  2PO3 A;  4UOY A;  2W7K A;  3FVS A;  1O61 A;  4WLJ A;  4F4E A;  4TN4 A;  3WCO A;  1MAQ A;  1BJO B;  3N4S A;  2YCP A;  1IX7 A;  3HT4 A;  2BI2 A;  1V2D A;  3AEM A;  1D7S A;  1YOO A;  3B1D A;  3WKR A;  4MSO A;  5TF5 A;  1AY5 A;  5D5S A;  1BJ4 A;  5K8B A;  3USF A;  1GC0 A;  3VK3 A;  4H51 A;  5G0A A;  3RQ1 A;  9AAT A;  4RLG A;  5IWQ A;  3PIU A;  3VK4 A;  4BMK A;  1AKB A;  3MAD A;  4AZK A;  2ZY2 A;  3T32 A;  2W7L A;  2GMS A;  1QGN A;  2O0R A;  1LW5 A;  3K28 A;  3QGU A;  4WYF A;  3EIA A;  1C4K A;  5EAA A;  1ORD A;  2F8J A;  1WYU A;  1T3I A;  3GWP A;  4R5Z A;  2CY8 A;  3E2F A;  4UHO A;  1W3U A;  2W8V A;  4KXK A;  4PIW A;  3NUB A;  3HL2 A;  3LG0 A;  5J8Q A;  3G0T A;  3GZC A;  4RAE A;  1O69 A;  3M5U A;  3F0H A;  5HXX A;  3NYU A;  1TOK A;  2X8U A;  5E3K A;  2YKU A;  3ACZ A;  4IXO A;  1H1C A;  3II0 A;  3RCH A;  2VMU A;  3TFT A;  1TOG A;  3LVM A;  2FNU A;  3BV0 A;  2VIB A;  2BIA A;  4PFF A;  1W7M A;  4JF0 A;  1C7G A;  2VMO A;  5F9S A;  1CQ6 A;  1LC7 A;  1U08 A;  2W8U A;  3AEP A;  2YRI A;  4E3Q A;  3VP6 A;  4H63 Q;  1J04 A;  1SF2 A;  1PMM A;  3HLM A;  4F5K A;  1JS6 A;  1DKA A;  4ZWM A;  4WB0 A;  3K7Y A;  1S09 A;  2DKB A;  2BI9 A;  4LNJ A;  4AH3 A;  4CBS A;  1ART A;  2RFV A;  1ARG A;  1AY4 A;  2Z9X A;  1B5P A;  1ASD A;  1KMK A;  4Y0H A;  4ZM3 A;  1AAM A;  4RJY A;  2D7Z A;  1D7U A;  2ZSM A;  1YIZ A;  2E7I A;  1I29 A;  2HOZ A;  2OKK A;  1AX4 A;  2QBT A;  2X5D A;  3JTX A;  4FFC A;  4JEV A;  4U1T A;  1BJW A;  4WYG A;  3ZRP A;  4JEX A;  3N75 A;  3D6K A;  1G4V A;  3ECD A;  1AHY A;  3FQA A;  3NU8 A;  5G2Q A;  1EJI A;  3N4R A;  4WYD A;  3GBX A;  3PJ0 A;  3NYT A;  3VAX A;  2WK9 A;  1IJI A;  3AEJ C;  1TAR A;  2EZ2 A;  3BS8 A;  2Q7W A;  4IYO A;  1C9C A;  2CB1 A;  5EFS A;  4EB7 A;  4F5H A;  5LH9 A;  3MAF B;  3H9X A;  1BJO A;  4RM1 A;  1B8G A;  3FKD A;  3BCB A;  4F5I A;  3DYD A;  2R0T A;  4ZLV A;  1QIS A;  2D64 A;  3DR7 A;  5E5I A;  2YKV A;  1XEY A;  2ZUK A;  1YJS A;  4B98 A;  4A6R A;  3FDB A;  1D7R A;  1OXO A;  4XEW A;  3MEB A;  4UHN A;  1KL1 A;  3GET A;  4P3M A;  4XAU A;  3CQ4 A;  1X29 A;  5HHY A;  4RIZ A;  1CQ7 A;  1AKC A;  1AIB A;  2D5Y A;  4R8D A;  4BQ0 A;  3DR4 A;  2AY9 A;  4PFN A;  5E4Z A;  5FT4 A;  1JG8 A;  2X3L A;  1AIA A;  2BI5 A;  3P1T A;  2BI3 A;  1ELQ A;  3E2Z B;  4K2I A;  1I41 A;  4HF8 A;  2E7U A;  3GR9 A;  4AOA A;  3ISL A;  3CAI A;  3WGC A;  3H7F A;  1SZU A;  1M0P A;  3BC8 A;  2FNI A;  3ZRR A;  4B9B A;  2AY5 A;  3KGW A;  3QN6 A;  3CQ5 A;  4CVQ A;  4WXF A;  1B9H A;  2CTZ A;  5I92 A;  3ASB A;  3FQ7 A;  2R2N A;  1SPA A;  3AEM C;  1AMS A;  1D2F A;  2V0Y A;  2FYF A;  3PDX A;  4RKD A;  3TCM A;  3BCX A;  2YKY A;  4LNL A;  3FD0 A;  3PA9 A;  3NNK A;  2Z1Z A;  2BWP A;  4ZAS A;  2VMR A;  1S08 A;  4ZDO A;  2WK8 A;  3JW9 A;  2HP2 A;  2YCT A;  3WZF A;  2Z9V A;  3BWN C;  2AY4 A;  3FVX A;  2QLR A;  2QB3 A;  2W8J A;  3EIB A;  4W91 A;  4Y0D A;  1IX8 A;  1KKP A;  4JEY A;  1GC3 A;  3DC1 A;  3JU7 A;  1LC8 A;  1KMJ A;  1DGD A;  5F8V A;  4ZDL A;  2KFP A;  4Y0I A;  5EUE A;  5EUD A;  3MC6 C;  3RBL A;  5DJ1 A;  1M0Q A;  3PGY A;  5M4B A;  2CST A;  2VGV A;  1IX6 A;  1LKC A;  1X28 A;  4OMA A;  2EH6 A;  2CJH A;  3UAK A;  1MLZ A;  4F5G A;  2VLH A;  3AAT A;  4OTL A;  1V72 A;  2R5E A;  2AEV A;  3EI5 A;  2VGU A;  1RV3 A;  2JJG A;  3DOD A;  3LVL B;  2E7J A;  2YOB A;  4RJ0 A;  3K40 A;  2VMT A;  2FKI A;  2ZY3 A;  2DOU A;  1ARI A;  3QI6 A;  2D66 A;  4ZSY A;  3VK2 A;  4MKJ A;  4W1X A;  4M2K A;  3NRA A;  3BWN A;  5LHA A;  3EI7 A;  5D95 A;  2ZYJ A;  1ARH A;  3EZ1 A;  2C81 A;  1AY8 A;  1AMQ A;  2D7Y A;  3Q8N A;  2CJG A;  2EO5 A;  3JWB A;  2QA3 A;  1VJO A;  3MC6 A;  3AOW A;  4N0W A;  3EZS A;  1QJ5 A;  1TAT A;  3ASA A;  4WYA A;  2W7M A;  3MAF A;  2EYQ A;  3AOV A;  4JEZ A;  2HUF A;  3PPL A;  1LW4 A;  3B1C A;  4A0H A;  2G7J A;  1AHF A;  3LWS A;  4TMR A;  1RVU A;  3P6K A;  2HOR A;  3ELE A;  4A6U A;  3N7N A;  3NX3 A;  1ASF A;  2D65 A;  3UWC A;  4ATP A;  2AY8 A;  2JJE A;  1LC5 A;  1UU1 A;  4GE9 A;  4LW4 A;  4OCA A;  4JEW A;  4ITX A;  4N0B A;  2VGS A;  3KGX A;  2OGE A;  1WST A;  2GSA A;  2BYJ A;  3E2Z A;  1DGE A;  3BCA A;  4WP0 A;  4DGT A;  1RV4 A;  3PAA A;  2X5F A;  4W1V A;  1BJN A;  2TPL A;  4W5K A;  1CQ8 A;  1ASC A;  2W7E A;  2OAT A;  3I4J A;  4ADB A;  1H0C A;  4JE5 A;  1E5E A;  2YKX A;  1CZC A;  4OBV A;  1M6S A;  1AJS A; 
#chains in the Genus database with same CATH homology
 3UE8 A;  1PG8 A;  1Z7D A;  1BS0 A;  1ZOB A;  2CJD A;  3AEL A;  1KKJ A;  4XK1 A;  3EI8 A;  2BIE A;  5EAV A;  4DBC A;  4OT8 A;  4ADE A;  2VI8 A;  3ZZK A;  2PB2 A;  1Y4I A;  3QHX A;  1G4X A;  4WXB A;  3PDB B;  4AO4 A;  1EQB A;  1SZS A;  3FDD A;  2Z67 A;  1O62 A;  1B4X A;  2C0R A;  4CXQ A;  2C44 A;  3AEN B;  2O1B A;  2R5C B;  1WYV B;  2GMU A;  3OP7 A;  1CS1 A;  1BKG A;  2FM1 A;  2A1V A;  3COG A;  4O6Z A;  4F5M A;  1W7N A;  1O4S A;  4MQR A;  5EIG A;  1GDE A;  2ZC0 A;  4NOG A;  3N4X A;  1DTY A;  2W8W A;  1AAW A;  2VGZ A;  1QZ9 A;  3N0L A;  4FL0 A;  3GJU A;  1RVY A;  3GZD C;  3BB8 A;  2D61 A;  2BYL A;  4ZDP A;  4E1O A;  1FG7 A;  3E6G A;  4TV7 A;  1YIY A;  1S06 A;  5G09 A;  3WKS A;  2VLF A;  1OXP A;  1ASM A;  3TFU A;  4HVK A;  3DXW A;  1G7X A;  4R5F A;  1SZK A;  2FN6 A;  4UHM A;  1DJE A;  3AEO A;  2AY2 A;  5BJ3 A;  1WKG A;  1AHG A;  2VMN A;  3HQT A;  1UKJ A;  4XJM A;  1M0N A;  2WK7 A;  1GCK A;  2QMA A;  4RIT A;  5C6U A;  3BWO A;  4AZJ A;  1I43 A;  1CJ0 A;  3FZ8 A;  4IX8 A;  4MGR A;  3FQ8 A;  2BKW A;  3WY7 A;  4OYT A;  4XJP A;  4A72 A;  1AMA A;  1GD9 A;  4A6T A;  1YJZ A;  1AJS B;  3CQ6 A;  4EMY A;  1B9I A;  1N31 A;  4PVF A;  1FG3 A;  4A0F A;  1BT4 A;  2FQ6 A;  4RKC A;  2VMZ A;  2YCN A;  3GZD A;  3WLX A;  1ZOD A;  5DX5 A;  3G8M A;  4CBR A;  3W1J A;  2Z9W A;  2W7D A;  1V2E A;  3A2B A;  4F5L A;  2DGK A;  1C0N A;  2W7J A;  1M7Y A;  3DXV A;  3F9T A;  5G4J A;  1TOE A;  2ZY4 A;  2Z20 A;  3FCR A;  3E2Y A;  4ITG A;  3WX9 A;  4GRX A;  2DGM A;  4L0O A;  4F5J A;  2OQX A;  1OAT A;  4EB5 A;  1FC4 A;  2XH1 A;  1C7O A;  1MGV A;  1JS3 A;  2CAN A;  3DZZ A;  5EIG B;  4IW7 A;  3FFH A;  1I48 A;  4E77 A;  2PB0 A;  3NTJ A;  3GSB A;  1BQD A;  2VMX A;  3FRK A;  4ADD A;  3B1E A;  2WB6 A;  2HOY A;  2VGT A;  1GC4 A;  4BA5 A;  2JJF A;  1DJU A;  3W1H A;  3H14 A;  3RUY A;  4F5F A;  3L8A A;  1ASL A;  1P3W A;  2W8T A;  4WYE A;  2VIA A;  3FZ7 A;  3BN1 A;  1QJ3 A;  2W7I A;  4CXR A;  1IAX A;  1M0O A;  4XQ2 A;  4IXZ A;  3NUI A;  4W8I A;  1TAS A;  3PDB A;  1S0A A;  1X0M A;  3EUC A;  3WCN A;  3B8X A;  3FTB A;  3TQX A;  2W7H A;  4ADC A;  1AJR A;  4EFF A;  4K05 A;  3EI6 A;  4WLH A;  1ASE A;  3AEN A;  4DQ6 A;  2R5C A;  1YNU A;  1WYV A;  4MQQ A;  2VMS A;  3IHJ A;  4A00 A;  1IBJ A;  3I5T A;  1MDO A;  5EUN A;  4XJO A;  2HUU A;  2JGT A;  1ASB A;  1MDZ A;  2AEU A;  3FZ6 A;  3HMU A;  4J5U A;  1AHE A;  1B5O A;  2CH1 A;  2Z61 A;  4ZSW A;  4QGR A;  1CL2 A;  1KL2 A;  4M2J A;  1JF9 A;  2E54 A;  4Q6R A;  1IVR A;  2Z1Y A;  3ZZJ A;  3TAT A;  4A0G A;  2OKJ A;  1GEX A;  2ZJG A;  2HUI A;  4AO9 A;  3LY1 A;  3ELP A;  4E3R A;  3PD6 B;  2ZP7 A;  2AY6 A;  2VMQ A;  5HDM A;  2XBN A;  2OGA A;  3JZL A;  3RI6 A;  5JAY A;  4KAM A;  1W23 A;  2HOX A;  4K2B A;  2JIS A;  2V1P A;  4GE4 A;  3DRD A;  3R4T A;  3IF2 A;  1OHW A;  3E9K A;  3LVK A;  1PFF A;  2O7C A;  4OBU A;  2VGW A;  2ZY5 A;  1TPL A;  2EPJ A;  1J32 A;  3QM2 A;  4IY7 A;  5M49 A;  1G7W A;  2CFB A;  2HZP A;  3NDN A;  4GE7 A;  4MKK A;  2AY1 A;  1IAY A;  1YAA A;  1AHX A;  3JWA A;  4JF1 A;  2Z9U A;  1OHV A;  1MAP A;  3KKI A;  2W7F A;  3NU7 A;  4MY5 A;  4UQV A;  1VEF A;  4LC3 A;  4EU1 A;  1Z3Z A;  2BI1 A;  3FVU A;  4WXG A;  1ASA A;  3B46 A;  3WGB A;  1LS3 A;  1SFF A;  1ZC9 A;  2CH2 A;  3ATH A;  1IUG A;  3OKS A;  5M4D A;  5KTB A;  1TOJ A;  1ASN A;  4KYO A;  8AAT A;  2BIG A;  5FT5 A;  3MKJ A;  1LK9 A;  1BW0 A;  4J8L A;  4GSA A;  4LNM A;  5FT8 A;  2WKA A;  4GEB A;  5FT6 A;  2JJH A;  1DJ9 A;  3RBF A;  2GB3 A;  1GBN A;  1BQA A;  3G7Q A;  2EGY A;  4LW2 A;  1GEW A;  1E5F A;  3QPG A;  3HBX A;  1ELU A;  4ZWV A;  3I16 A;  4WYC A;  2VYC A;  3N5M A;  1AKA A;  1S07 A;  2W7G A;  5DB5 A;  1WYT A;  2AY7 A;  3CBF A;  4OC9 A;  4K2M A;  4WBT A;  1ECX A;  3A9X A;  3L44 A;  1WKH A;  2BWN A;  3FFR A;  2AAT A;  1C7N A;  2GQN A;  4Q75 A;  1WYU B;  4ZAH A;  7AAT A;  2JG2 A;  1YJY A;  2DKJ A;  3A8U X;  3VOM A;  2VMP A;  2YRR A;  2VMY A;  4R2N A;  1DFO A;  2ZSL A;  5BJ4 A;  5AX8 A;  4ZM4 A;  1N8P A;  1ASG A;  4BA4 A;  1EG5 A;  1D7V A;  4JE5 D;  1QIT A;  2VMV A;  3HVY A;  1M32 A;  2BHX A;  2YHK A;  1CZE A;  1AMR A;  1OHY A;  3RCH B;  2QSR A;  4P7Y A;  3W1I A;  1UU2 A;  1VP4 A;  1TOI A;  2HP1 A;  4M2M A;  2VMW A;  1AIC A;  2DGL A;  1UU0 A;  3A9Y A;  3PD6 A;  1MDX A;  2ORD A;  3A9Z A;  4IXS A;  1ARS A;  4GDY A;  4BHD A;  2EZ1 A;  1QIR A;  1XI9 A;  4Q76 A;  2C7T A;  3LV2 A;  1X2A A;  3F6T A;  1GC2 A;  4Q31 A;  1N2T A;  3AEJ A;  4WB0 B;  2DR1 A;  3MAU A;  1GEY A;  3E77 A;  3FSL A;  2BWO A;  4XJL A;  4ATQ A;  3LVJ A;  2D63 A;  3DU4 A;  4ISY A;  1V2F A;  3EI9 A;  1M4N A;  2QB2 A;  3ZRQ A;  3R9A A;  3KE3 A;  1MLY A;  2VI9 A;  1WYT B;  2G6W A;  3MBB A;  5EQC A;  4I8A A;  3AV7 A;  1PMO A;  3HDO A;  4U2H A;  5G2P A;  5DJ9 A;  5M46 A;  4MQP A;  1CL1 A;  2AY3 A;  3QBO A;  2NMP A;  1SVV A;  2CIN A;  5G4I A;  3NYS A;  1W7L A;  4W1W A;  4A0R A;  4WD2 A;  4IYO B;  2PO3 A;  4UOY A;  2W7K A;  3FVS A;  1O61 A;  4WLJ A;  4F4E A;  4TN4 A;  3WCO A;  1MAQ A;  1BJO B;  3N4S A;  2YCP A;  1IX7 A;  3HT4 A;  2BI2 A;  1V2D A;  3AEM A;  1D7S A;  1YOO A;  3B1D A;  3WKR A;  4MSO A;  5TF5 A;  1AY5 A;  5D5S A;  1BJ4 A;  5K8B A;  3USF A;  1GC0 A;  3VK3 A;  4H51 A;  5G0A A;  3RQ1 A;  9AAT A;  4RLG A;  5IWQ A;  3PIU A;  3VK4 A;  4BMK A;  1AKB A;  3MAD A;  4AZK A;  2ZY2 A;  3T32 A;  2W7L A;  2GMS A;  1QGN A;  2O0R A;  1LW5 A;  3K28 A;  3QGU A;  4WYF A;  3EIA A;  1C4K A;  5EAA A;  1ORD A;  2F8J A;  1WYU A;  1T3I A;  3GWP A;  4R5Z A;  2CY8 A;  3E2F A;  4UHO A;  1W3U A;  2W8V A;  4KXK A;  4PIW A;  3NUB A;  3HL2 A;  3LG0 A;  5J8Q A;  3G0T A;  3GZC A;  4RAE A;  1O69 A;  3M5U A;  3F0H A;  5HXX A;  3NYU A;  1TOK A;  2X8U A;  5E3K A;  2YKU A;  3ACZ A;  4IXO A;  1H1C A;  3II0 A;  3RCH A;  2VMU A;  3TFT A;  1TOG A;  3LVM A;  2FNU A;  3BV0 A;  2VIB A;  2BIA A;  4PFF A;  1W7M A;  4JF0 A;  1C7G A;  2VMO A;  5F9S A;  1CQ6 A;  1LC7 A;  1U08 A;  2W8U A;  3AEP A;  2YRI A;  4E3Q A;  3VP6 A;  4H63 Q;  1J04 A;  1SF2 A;  1PMM A;  3HLM A;  4F5K A;  1JS6 A;  1DKA A;  4ZWM A;  4WB0 A;  3K7Y A;  1S09 A;  2DKB A;  2BI9 A;  4LNJ A;  4AH3 A;  4CBS A;  1ART A;  2RFV A;  1ARG A;  1AY4 A;  2Z9X A;  1B5P A;  1ASD A;  1KMK A;  4Y0H A;  4ZM3 A;  1AAM A;  4RJY A;  2D7Z A;  1D7U A;  2ZSM A;  1YIZ A;  2E7I A;  1I29 A;  2HOZ A;  2OKK A;  1AX4 A;  2QBT A;  2X5D A;  3JTX A;  4FFC A;  4JEV A;  4U1T A;  1BJW A;  4WYG A;  3ZRP A;  4JEX A;  3N75 A;  3D6K A;  1G4V A;  3ECD A;  1AHY A;  3FQA A;  3NU8 A;  5G2Q A;  1EJI A;  3N4R A;  4WYD A;  3GBX A;  3PJ0 A;  3NYT A;  3VAX A;  2WK9 A;  1IJI A;  3AEJ C;  1TAR A;  2EZ2 A;  3BS8 A;  2Q7W A;  4IYO A;  1C9C A;  2CB1 A;  5EFS A;  4EB7 A;  4F5H A;  5LH9 A;  3MAF B;  3H9X A;  1BJO A;  4RM1 A;  1B8G A;  3FKD A;  3BCB A;  4F5I A;  3DYD A;  2R0T A;  4ZLV A;  1QIS A;  2D64 A;  3DR7 A;  5E5I A;  2YKV A;  1XEY A;  2ZUK A;  1YJS A;  4B98 A;  4A6R A;  3FDB A;  1D7R A;  1OXO A;  4XEW A;  3MEB A;  4UHN A;  1KL1 A;  3GET A;  4P3M A;  4XAU A;  3CQ4 A;  1X29 A;  5HHY A;  4RIZ A;  1CQ7 A;  1AKC A;  1AIB A;  2D5Y A;  4R8D A;  4BQ0 A;  3DR4 A;  2AY9 A;  4PFN A;  5E4Z A;  5FT4 A;  1JG8 A;  2X3L A;  1AIA A;  2BI5 A;  3P1T A;  2BI3 A;  1ELQ A;  3E2Z B;  4K2I A;  1I41 A;  4HF8 A;  2E7U A;  3GR9 A;  4AOA A;  3ISL A;  3CAI A;  3WGC A;  3H7F A;  1SZU A;  1M0P A;  3BC8 A;  2FNI A;  3ZRR A;  4B9B A;  2AY5 A;  3KGW A;  3QN6 A;  3CQ5 A;  4CVQ A;  4WXF A;  1B9H A;  2CTZ A;  5I92 A;  3ASB A;  3FQ7 A;  2R2N A;  1SPA A;  3AEM C;  1AMS A;  1D2F A;  2V0Y A;  2FYF A;  3PDX A;  4RKD A;  3TCM A;  3BCX A;  2YKY A;  4LNL A;  3FD0 A;  3PA9 A;  3NNK A;  2Z1Z A;  2BWP A;  4ZAS A;  2VMR A;  1S08 A;  4ZDO A;  2WK8 A;  3JW9 A;  2HP2 A;  2YCT A;  3WZF A;  2Z9V A;  3BWN C;  2AY4 A;  3FVX A;  2QLR A;  2QB3 A;  2W8J A;  3EIB A;  4W91 A;  4Y0D A;  1IX8 A;  1KKP A;  4JEY A;  1GC3 A;  3DC1 A;  3JU7 A;  1LC8 A;  1KMJ A;  1DGD A;  5F8V A;  4ZDL A;  2KFP A;  4Y0I A;  5EUE A;  5EUD A;  3MC6 C;  3RBL A;  5DJ1 A;  1M0Q A;  3PGY A;  5M4B A;  2CST A;  2VGV A;  1IX6 A;  1LKC A;  1X28 A;  4OMA A;  2EH6 A;  2CJH A;  3UAK A;  1MLZ A;  4F5G A;  2VLH A;  3AAT A;  4OTL A;  1V72 A;  2R5E A;  2AEV A;  3EI5 A;  2VGU A;  1RV3 A;  2JJG A;  3DOD A;  3LVL B;  2E7J A;  2YOB A;  4RJ0 A;  3K40 A;  2VMT A;  2FKI A;  2ZY3 A;  2DOU A;  1ARI A;  3QI6 A;  2D66 A;  4ZSY A;  3VK2 A;  4MKJ A;  4W1X A;  4M2K A;  3NRA A;  3BWN A;  5LHA A;  3EI7 A;  5D95 A;  2ZYJ A;  1ARH A;  3EZ1 A;  2C81 A;  1AY8 A;  1AMQ A;  2D7Y A;  3Q8N A;  2CJG A;  2EO5 A;  3JWB A;  2QA3 A;  1VJO A;  3MC6 A;  3AOW A;  4N0W A;  3EZS A;  1QJ5 A;  1TAT A;  3ASA A;  4WYA A;  2W7M A;  3MAF A;  2EYQ A;  3AOV A;  4JEZ A;  2HUF A;  3PPL A;  1LW4 A;  3B1C A;  4A0H A;  2G7J A;  1AHF A;  3LWS A;  4TMR A;  1RVU A;  3P6K A;  2HOR A;  3ELE A;  4A6U A;  3N7N A;  3NX3 A;  1ASF A;  2D65 A;  3UWC A;  4ATP A;  2AY8 A;  2JJE A;  1LC5 A;  1UU1 A;  4GE9 A;  4LW4 A;  4OCA A;  4JEW A;  4ITX A;  4N0B A;  2VGS A;  3KGX A;  2OGE A;  1WST A;  2GSA A;  2BYJ A;  3E2Z A;  1DGE A;  3BCA A;  4WP0 A;  4DGT A;  1RV4 A;  3PAA A;  2X5F A;  4W1V A;  1BJN A;  2TPL A;  4W5K A;  1CQ8 A;  1ASC A;  2W7E A;  2OAT A;  3I4J A;  4ADB A;  1H0C A;  4JE5 A;  1E5E A;  2YKX A;  1CZC A;  4OBV A;  1M6S A;  1AJS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...