2Z9ZA

Crystal structure of cert start domain(n504a mutant), in complex with c10-diacylglycerol
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
235
structure length
235
Chain Sequence
THRFVQKVEEMVQNHMTYSLQDVGGDANWQLVVEEGEMKVYRREVEENGIVLDPLKATHAVKGVTGHEVCNYFWNVDVRNDWETTIENFHVVETLADNAIIIYQTHKRVWPASQRDVLYLSVIRKIPALTENDPETWIVCAFSVDHDSAPLNNRCVRAKINVAMICQTLVSPPEGNQEISRDNILCKITYVANVNPGGWAPASVLRAVAKREYPKFLKRFTSYVQEKTAGKPILF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Lipid-transfer protein CERT
publication title Structural basis for specific lipid recognition by CERT responsible for nonvesicular trafficking of ceramide.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lipid transport
total genus 65
structure length 235
sequence length 235
ec nomenclature
pdb deposition date 2007-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01852 START START domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.530.20 Alpha Beta 2-Layer Sandwich Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4 Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4 2z9zA00
3KDHA 4PSBA 3WG8A 4C9IA 1LN2A 3NJ1A 4N3EA 4LGBA 2Z9ZA 4IGVA 3H3TA 2A1LA 4IH2A 4B9RA 4IGWA 2Q3QA 5JNNA 3E85A 1LLTA 2NN5A 3NEGA 3QSZA 4BTZA 4A80A 4A8VA 3P51A 5E46A 5JO1A 3NJ0A 2LUZA 3OJIA 4MNSA 5E4BA 4XRWA 1FM4A 2VNEA 2PSOA 4BKCA 2L9PA 2N4AA 3PU2A 4REJA 3TL1A 4QIPA 4LA7A 1T17A 1IFVA 5I8FA 2KCZA 3NMTA 4JDLA 2I9YA 3KAZA 4REIA 3KB0A 4A87A 2L8OA 2K5GA 3NS2A 3P0LA 3Q64A 1ICXA 1T27A 2L65A 3OQUA 4A8GA 4DSCA 5JO2A 3K90A 4XRTA 2KTEA 3W9RA 2LCGA 4MA6A 2QPVA 2N4BA 1B6FA 4RYVA 3KL1A 2RERA 3KDIA 4LGAA 2EJXA 1XN5A 2PCSA 1TXCA 2NS9A 3NR4A 3Q6AA 2E3PA 4MAPA 3K3KA 2LE1A 3C0VA 1TW0A 4A84A 4BKDA 3KLXA 3R6PA 2LGHA 3PUTA 4WVOA 3OTLA 2IL5A 3ZVUA 1VJHA 3KAYA 4C9CA 4DSBA 4IGXA 2GKDA 2D4RA 2VQ5A 1XDFA 3NMNA 4IGYA 3UIDA 4BK7A 3RT2A 3NEFA 3RT0C 3F08A 4M9WA 2LDKA 3QN1A 4C94A 2FFSA 4GY9A 3TFZA 4IH0A 3GGNA 3P9VA 4JHGA 3NMPA 3Q63A 3W9KA 3KDJA 4LG5A 4OICA 1Z94A 4Y31A 1FSKA 4FPWA 5E4DA 4A83A 2QIMA 2KF2A 4A86A 3JRQB 1E09A 4IHRA 4BK6A 1XN6A 2K7HA 2M47A 2MOUA 2WQLA 3RD6A 4A8UA 1XUVA 2E3NA 2E3MA 2LEQA 2R55A 4Z3LA 2E3SA 2Z9YA 3FO5A 3NMVA 5I9JA 3TVQA 1BV1A 3UQHA 1JSSA 5BRLA 2E3RA 3H3RA 4JHIA 2M89A 3NMHA 1LN1A 3TVRA 5AMWA 4JHHA 2REZA 4N0GC 2LAKA 3CNWA 4DS8A 5E4MA 3ELIA 3H3SA 4A85A 1QMRA 4REHA 3JRSA 3NJOA 4A88A 1EM2A 4R7KA 3IE5A 3IJTA 1BTVA 2BK0A 1LN3A 1X53A 2LIOA 4A81A 1XFSA 1H2OA 1UW5A 2E3OA 1KCMA 3H3QA 2RESA 5C9YA 2KEWA 2E3QA 4Q0KA 1ZXFA 2LF2A 3UJLA 2FLHA 3OH8A 4JDAA 3KB3A 3NI8A 4M9BA 2LPXA
chains in the Genus database with same CATH superfamily
3KDHA 4PSBA 3WG8A 3HVRA 4C9IA 1LN2A 3NJ1A 4N3EA 4LGBA 2Z9ZA 4IGVA 3H3TA 4QCKA 2A1LA 4IH2A 4B9RA 3HO1A 4IGWA 2Q3QA 5JNNA 3E85A 1LLTA 2NN5A 3NEGA 3QSZA 4BTZA 3DLHA 4A80A 2YH6A 3P51A 3GKEA 4A8VA 5E46A 5JO1A 3NJ0A 2LUZA 3OJIA 4MNSA 5E4BA 4XRWA 1FM4A 2VNEA 2PSOA 4BKCA 2L9PA 2N4AA 2ZYLA 3PU2A 4N76A 4E6FA 4REJA 3TL1A 4QIPA 4LA7A 1T17A 1IFVA 5I8FA 2KCZA 3NMTA 4JDLA 2I9YA 3KAZA 4REIA 3KB0A 3GTSA 4A87A 2L8OA 4N41A 2K5GA 4QDCA 3NS2A 3P0LA 3Q64A 1ICXA 1T27A 2L65A 3OQUA 4A8GA 4DSCA 5EKQC 5JO2A 3HJFA 3K90A 4XRTA 2KTEA 3W9RA 3F73A 2LCGA 4MA6A 2QPVA 2N4BA 3GOBA 1B6FA 4RYVA 3KL1A 2RERA 3KDIA 4LGAA 2EJXA 1XN5A 2PCSA 1TXCA 2NS9A 3NR4A 3Q6AA 2E3PA 4MAPA 3K3KA 2LE1A 3C0VA 1TW0A 4A84A 4BKDA 3KLXA 3R6PA 2LGHA 3PUTA 4WVOA 3OTLA 2IL5A 3ZVUA 1VJHA 3GTEA 3KAYA 4C9CA 4DSBA 4IGXA 2GKDA 2D4RA 2VQ5A 1XDFA 3NMNA 4IGYA 3UIDA 4BK7A 3RT2A 4KPYA 3NQNA 3NEFA 3RT0C 3F08A 4M9WA 2LDKA 4QDFA 3QN1A 4C94A 2FFSA 4GY9A 3TFZA 4IH0A 3GGNA 3P9VA 4JHGA 3HK2A 3NMPA 3Q63A 3W9KA 3KDJA 4LG5A 4OICA 1Z94A 4Y31A 4NCBA 1FSKA 4FPWA 5E4DA 4A83A 2QIMA 2KF2A 4A86A 3JRQB 1E09A 4IHRA 4BK6A 1XN6A 2K7HA 2M47A 2MOUA 2WQLA 3RD6A 4A8UA 1XUVA 2E3NA 2E3MA 2LEQA 2R55A 4Z3LA 2E3SA 2Z9YA 3FO5A 3NMVA 5I9JA 3TVQA 1BV1A 3UQHA 1JSSA 5BRLA 2E3RA 3H3RA 4JHIA 2M89A 3GB4A 3NMHA 1LN1A 3TVRA 5AMWA 4JHHA 2REZA 4N47A 4N0GC 2LAKA 3CNWA 4DS8A 5E4MA 3ELIA 3H3SA 4A85A 1QMRA 4REHA 3GL2A 3JRSA 3NJOA 4A88A 1EM2A 4R7KA 3IE5A 3IJTA 1BTVA 2BK0A 4NCAA 1LN3A 1X53A 2LIOA 4QDDA 4A81A 1XFSA 3TGOC 1H2OA 3HXMA 1UW5A 2E3OA 4QDFB 3HM9A 1KCMA 3H3QA 2RESA 5C9YA 4JHYA 3GL0A 2LAFA 3DLBA 2KEWA 2E3QA 4Q0KA 1ZXFA 2LF2A 3UJLA 2FLHA 3OH8A 4JDAA 3KB3A 3NI8A 4M9BA 2LPXA
chains in the Genus database with same CATH topology
3KDHA 4PSBA 3WG8A 3HVRA 4C9IA 1LN2A 3NJ1A 4N3EA 4LGBA 2Z9ZA 4IGVA 3H3TA 4QCKA 2A1LA 4IH2A 4B9RA 3HO1A 4IGWA 2Q3QA 5JNNA 3E85A 1LLTA 2NN5A 3NEGA 3QSZA 4BTZA 3DLHA 4A80A 2YH6A 3P51A 3GKEA 4A8VA 5E46A 5JO1A 3NJ0A 2LUZA 3OJIA 4MNSA 5E4BA 4XRWA 1FM4A 2VNEA 2PSOA 4BKCA 2L9PA 2N4AA 2ZYLA 3PU2A 4N76A 4E6FA 4REJA 3TL1A 4QIPA 4LA7A 1T17A 1IFVA 5I8FA 2KCZA 3NMTA 4JDLA 2I9YA 3KAZA 4REIA 3KB0A 3GTSA 4A87A 2L8OA 4N41A 2K5GA 4QDCA 3NS2A 3P0LA 3Q64A 1ICXA 1T27A 2L65A 3OQUA 4A8GA 4DSCA 5EKQC 5JO2A 3HJFA 3K90A 4XRTA 2KTEA 3W9RA 3F73A 2LCGA 4MA6A 2QPVA 2N4BA 3GOBA 1B6FA 4RYVA 3KL1A 2RERA 3KDIA 4LGAA 2EJXA 1XN5A 2PCSA 1TXCA 2NS9A 3NR4A 3Q6AA 2E3PA 4MAPA 3K3KA 2LE1A 3C0VA 1TW0A 4A84A 4BKDA 3KLXA 3R6PA 2LGHA 3PUTA 4WVOA 3OTLA 2IL5A 3ZVUA 1VJHA 3GTEA 3KAYA 4C9CA 4DSBA 4IGXA 2GKDA 2D4RA 2VQ5A 1XDFA 3NMNA 4IGYA 3UIDA 4BK7A 3RT2A 4KPYA 3NQNA 3NEFA 3RT0C 3F08A 4M9WA 2LDKA 4QDFA 3QN1A 4C94A 2FFSA 4GY9A 3TFZA 4IH0A 3GGNA 3P9VA 4JHGA 3HK2A 3NMPA 3Q63A 3W9KA 3KDJA 4LG5A 4OICA 1Z94A 4Y31A 4NCBA 1FSKA 4FPWA 5E4DA 4A83A 2QIMA 2KF2A 4A86A 3JRQB 1E09A 4IHRA 4BK6A 1XN6A 2K7HA 2M47A 2MOUA 2WQLA 3RD6A 4A8UA 1XUVA 2E3NA 2E3MA 2LEQA 2R55A 4Z3LA 2E3SA 2Z9YA 3FO5A 3NMVA 5I9JA 3TVQA 1BV1A 3UQHA 1JSSA 5BRLA 2E3RA 3H3RA 4JHIA 2M89A 3GB4A 3NMHA 1LN1A 3TVRA 5AMWA 4JHHA 2REZA 4N47A 4N0GC 2LAKA 3CNWA 4DS8A 5E4MA 3ELIA 3H3SA 4A85A 1QMRA 4REHA 3GL2A 3JRSA 3NJOA 4A88A 1EM2A 4R7KA 3IE5A 3IJTA 1BTVA 2BK0A 4NCAA 1LN3A 1X53A 2LIOA 4QDDA 4A81A 1XFSA 3TGOC 1H2OA 3HXMA 1UW5A 2E3OA 4QDFB 3HM9A 1KCMA 3H3QA 2RESA 5C9YA 4JHYA 3GL0A 2LAFA 3DLBA 2KEWA 2E3QA 4Q0KA 1ZXFA 2LF2A 3UJLA 2FLHA 3OH8A 4JDAA 3KB3A 3NI8A 4M9BA 2LPXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KDH A;  4PSB A;  3WG8 A;  4C9I A;  1LN2 A;  3NJ1 A;  4N3E A;  4LGB A;  2Z9Z A;  4IGV A;  3H3T A;  2A1L A;  4IH2 A;  4B9R A;  4IGW A;  2Q3Q A;  5JNN A;  3E85 A;  1LLT A;  2NN5 A;  3NEG A;  3QSZ A;  4BTZ A;  4A80 A;  4A8V A;  3P51 A;  5E46 A;  5JO1 A;  3NJ0 A;  2LUZ A;  3OJI A;  4MNS A;  5E4B A;  4XRW A;  1FM4 A;  2VNE A;  2PSO A;  4BKC A;  2L9P A;  2N4A A;  3PU2 A;  4REJ A;  3TL1 A;  4QIP A;  4LA7 A;  1T17 A;  1IFV A;  5I8F A;  2KCZ A;  3NMT A;  4JDL A;  2I9Y A;  3KAZ A;  4REI A;  3KB0 A;  4A87 A;  2L8O A;  2K5G A;  3NS2 A;  3P0L A;  3Q64 A;  1ICX A;  1T27 A;  2L65 A;  3OQU A;  4A8G A;  4DSC A;  5JO2 A;  3K90 A;  4XRT A;  2KTE A;  3W9R A;  2LCG A;  4MA6 A;  2QPV A;  2N4B A;  1B6F A;  4RYV A;  3KL1 A;  2RER A;  3KDI A;  4LGA A;  2EJX A;  1XN5 A;  2PCS A;  1TXC A;  2NS9 A;  3NR4 A;  3Q6A A;  2E3P A;  4MAP A;  3K3K A;  2LE1 A;  3C0V A;  1TW0 A;  4A84 A;  4BKD A;  3KLX A;  3R6P A;  2LGH A;  3PUT A;  4WVO A;  3OTL A;  2IL5 A;  3ZVU A;  1VJH A;  3KAY A;  4C9C A;  4DSB A;  4IGX A;  2GKD A;  2D4R A;  2VQ5 A;  1XDF A;  3NMN A;  4IGY A;  3UID A;  4BK7 A;  3RT2 A;  3NEF A;  3RT0 C;  3F08 A;  4M9W A;  2LDK A;  3QN1 A;  4C94 A;  2FFS A;  4GY9 A;  3TFZ A;  4IH0 A;  3GGN A;  3P9V A;  4JHG A;  3NMP A;  3Q63 A;  3W9K A;  3KDJ A;  4LG5 A;  4OIC A;  1Z94 A;  4Y31 A;  1FSK A;  4FPW A;  5E4D A;  4A83 A;  2QIM A;  2KF2 A;  4A86 A;  3JRQ B;  1E09 A;  4IHR A;  4BK6 A;  1XN6 A;  2K7H A;  2M47 A;  2MOU A;  2WQL A;  3RD6 A;  4A8U A;  1XUV A;  2E3N A;  2E3M A;  2LEQ A;  2R55 A;  4Z3L A;  2E3S A;  2Z9Y A;  3FO5 A;  3NMV A;  5I9J A;  3TVQ A;  1BV1 A;  3UQH A;  1JSS A;  5BRL A;  2E3R A;  3H3R A;  4JHI A;  2M89 A;  3NMH A;  1LN1 A;  3TVR A;  5AMW A;  4JHH A;  2REZ A;  4N0G C;  2LAK A;  3CNW A;  4DS8 A;  5E4M A;  3ELI A;  3H3S A;  4A85 A;  1QMR A;  4REH A;  3JRS A;  3NJO A;  4A88 A;  1EM2 A;  4R7K A;  3IE5 A;  3IJT A;  1BTV A;  2BK0 A;  1LN3 A;  1X53 A;  2LIO A;  4A81 A;  1XFS A;  1H2O A;  1UW5 A;  2E3O A;  1KCM A;  3H3Q A;  2RES A;  5C9Y A;  2KEW A;  2E3Q A;  4Q0K A;  1ZXF A;  2LF2 A;  3UJL A;  2FLH A;  3OH8 A;  4JDA A;  3KB3 A;  3NI8 A;  4M9B A;  2LPX A; 
#chains in the Genus database with same CATH topology
 3KDH A;  4PSB A;  3WG8 A;  3HVR A;  4C9I A;  1LN2 A;  3NJ1 A;  4N3E A;  4LGB A;  2Z9Z A;  4IGV A;  3H3T A;  4QCK A;  2A1L A;  4IH2 A;  4B9R A;  3HO1 A;  4IGW A;  2Q3Q A;  5JNN A;  3E85 A;  1LLT A;  2NN5 A;  3NEG A;  3QSZ A;  4BTZ A;  3DLH A;  4A80 A;  2YH6 A;  3P51 A;  3GKE A;  4A8V A;  5E46 A;  5JO1 A;  3NJ0 A;  2LUZ A;  3OJI A;  4MNS A;  5E4B A;  4XRW A;  1FM4 A;  2VNE A;  2PSO A;  4BKC A;  2L9P A;  2N4A A;  2ZYL A;  3PU2 A;  4N76 A;  4E6F A;  4REJ A;  3TL1 A;  4QIP A;  4LA7 A;  1T17 A;  1IFV A;  5I8F A;  2KCZ A;  3NMT A;  4JDL A;  2I9Y A;  3KAZ A;  4REI A;  3KB0 A;  3GTS A;  4A87 A;  2L8O A;  4N41 A;  2K5G A;  4QDC A;  3NS2 A;  3P0L A;  3Q64 A;  1ICX A;  1T27 A;  2L65 A;  3OQU A;  4A8G A;  4DSC A;  5EKQ C;  5JO2 A;  3HJF A;  3K90 A;  4XRT A;  2KTE A;  3W9R A;  3F73 A;  2LCG A;  4MA6 A;  2QPV A;  2N4B A;  3GOB A;  1B6F A;  4RYV A;  3KL1 A;  2RER A;  3KDI A;  4LGA A;  2EJX A;  1XN5 A;  2PCS A;  1TXC A;  2NS9 A;  3NR4 A;  3Q6A A;  2E3P A;  4MAP A;  3K3K A;  2LE1 A;  3C0V A;  1TW0 A;  4A84 A;  4BKD A;  3KLX A;  3R6P A;  2LGH A;  3PUT A;  4WVO A;  3OTL A;  2IL5 A;  3ZVU A;  1VJH A;  3GTE A;  3KAY A;  4C9C A;  4DSB A;  4IGX A;  2GKD A;  2D4R A;  2VQ5 A;  1XDF A;  3NMN A;  4IGY A;  3UID A;  4BK7 A;  3RT2 A;  4KPY A;  3NQN A;  3NEF A;  3RT0 C;  3F08 A;  4M9W A;  2LDK A;  4QDF A;  3QN1 A;  4C94 A;  2FFS A;  4GY9 A;  3TFZ A;  4IH0 A;  3GGN A;  3P9V A;  4JHG A;  3HK2 A;  3NMP A;  3Q63 A;  3W9K A;  3KDJ A;  4LG5 A;  4OIC A;  1Z94 A;  4Y31 A;  4NCB A;  1FSK A;  4FPW A;  5E4D A;  4A83 A;  2QIM A;  2KF2 A;  4A86 A;  3JRQ B;  1E09 A;  4IHR A;  4BK6 A;  1XN6 A;  2K7H A;  2M47 A;  2MOU A;  2WQL A;  3RD6 A;  4A8U A;  1XUV A;  2E3N A;  2E3M A;  2LEQ A;  2R55 A;  4Z3L A;  2E3S A;  2Z9Y A;  3FO5 A;  3NMV A;  5I9J A;  3TVQ A;  1BV1 A;  3UQH A;  1JSS A;  5BRL A;  2E3R A;  3H3R A;  4JHI A;  2M89 A;  3GB4 A;  3NMH A;  1LN1 A;  3TVR A;  5AMW A;  4JHH A;  2REZ A;  4N47 A;  4N0G C;  2LAK A;  3CNW A;  4DS8 A;  5E4M A;  3ELI A;  3H3S A;  4A85 A;  1QMR A;  4REH A;  3GL2 A;  3JRS A;  3NJO A;  4A88 A;  1EM2 A;  4R7K A;  3IE5 A;  3IJT A;  1BTV A;  2BK0 A;  4NCA A;  1LN3 A;  1X53 A;  2LIO A;  4QDD A;  4A81 A;  1XFS A;  3TGO C;  1H2O A;  3HXM A;  1UW5 A;  2E3O A;  4QDF B;  3HM9 A;  1KCM A;  3H3Q A;  2RES A;  5C9Y A;  4JHY A;  3GL0 A;  2LAF A;  3DLB A;  2KEW A;  2E3Q A;  4Q0K A;  1ZXF A;  2LF2 A;  3UJL A;  2FLH A;  3OH8 A;  4JDA A;  3KB3 A;  3NI8 A;  4M9B A;  2LPX A; 
#chains in the Genus database with same CATH homology
 3KDH A;  4PSB A;  3WG8 A;  3HVR A;  4C9I A;  1LN2 A;  3NJ1 A;  4N3E A;  4LGB A;  2Z9Z A;  4IGV A;  3H3T A;  4QCK A;  2A1L A;  4IH2 A;  4B9R A;  3HO1 A;  4IGW A;  2Q3Q A;  5JNN A;  3E85 A;  1LLT A;  2NN5 A;  3NEG A;  3QSZ A;  4BTZ A;  3DLH A;  4A80 A;  2YH6 A;  3P51 A;  3GKE A;  4A8V A;  5E46 A;  5JO1 A;  3NJ0 A;  2LUZ A;  3OJI A;  4MNS A;  5E4B A;  4XRW A;  1FM4 A;  2VNE A;  2PSO A;  4BKC A;  2L9P A;  2N4A A;  2ZYL A;  3PU2 A;  4N76 A;  4E6F A;  4REJ A;  3TL1 A;  4QIP A;  4LA7 A;  1T17 A;  1IFV A;  5I8F A;  2KCZ A;  3NMT A;  4JDL A;  2I9Y A;  3KAZ A;  4REI A;  3KB0 A;  3GTS A;  4A87 A;  2L8O A;  4N41 A;  2K5G A;  4QDC A;  3NS2 A;  3P0L A;  3Q64 A;  1ICX A;  1T27 A;  2L65 A;  3OQU A;  4A8G A;  4DSC A;  5EKQ C;  5JO2 A;  3HJF A;  3K90 A;  4XRT A;  2KTE A;  3W9R A;  3F73 A;  2LCG A;  4MA6 A;  2QPV A;  2N4B A;  3GOB A;  1B6F A;  4RYV A;  3KL1 A;  2RER A;  3KDI A;  4LGA A;  2EJX A;  1XN5 A;  2PCS A;  1TXC A;  2NS9 A;  3NR4 A;  3Q6A A;  2E3P A;  4MAP A;  3K3K A;  2LE1 A;  3C0V A;  1TW0 A;  4A84 A;  4BKD A;  3KLX A;  3R6P A;  2LGH A;  3PUT A;  4WVO A;  3OTL A;  2IL5 A;  3ZVU A;  1VJH A;  3GTE A;  3KAY A;  4C9C A;  4DSB A;  4IGX A;  2GKD A;  2D4R A;  2VQ5 A;  1XDF A;  3NMN A;  4IGY A;  3UID A;  4BK7 A;  3RT2 A;  4KPY A;  3NQN A;  3NEF A;  3RT0 C;  3F08 A;  4M9W A;  2LDK A;  4QDF A;  3QN1 A;  4C94 A;  2FFS A;  4GY9 A;  3TFZ A;  4IH0 A;  3GGN A;  3P9V A;  4JHG A;  3HK2 A;  3NMP A;  3Q63 A;  3W9K A;  3KDJ A;  4LG5 A;  4OIC A;  1Z94 A;  4Y31 A;  4NCB A;  1FSK A;  4FPW A;  5E4D A;  4A83 A;  2QIM A;  2KF2 A;  4A86 A;  3JRQ B;  1E09 A;  4IHR A;  4BK6 A;  1XN6 A;  2K7H A;  2M47 A;  2MOU A;  2WQL A;  3RD6 A;  4A8U A;  1XUV A;  2E3N A;  2E3M A;  2LEQ A;  2R55 A;  4Z3L A;  2E3S A;  2Z9Y A;  3FO5 A;  3NMV A;  5I9J A;  3TVQ A;  1BV1 A;  3UQH A;  1JSS A;  5BRL A;  2E3R A;  3H3R A;  4JHI A;  2M89 A;  3GB4 A;  3NMH A;  1LN1 A;  3TVR A;  5AMW A;  4JHH A;  2REZ A;  4N47 A;  4N0G C;  2LAK A;  3CNW A;  4DS8 A;  5E4M A;  3ELI A;  3H3S A;  4A85 A;  1QMR A;  4REH A;  3GL2 A;  3JRS A;  3NJO A;  4A88 A;  1EM2 A;  4R7K A;  3IE5 A;  3IJT A;  1BTV A;  2BK0 A;  4NCA A;  1LN3 A;  1X53 A;  2LIO A;  4QDD A;  4A81 A;  1XFS A;  3TGO C;  1H2O A;  3HXM A;  1UW5 A;  2E3O A;  4QDF B;  3HM9 A;  1KCM A;  3H3Q A;  2RES A;  5C9Y A;  4JHY A;  3GL0 A;  2LAF A;  3DLB A;  2KEW A;  2E3Q A;  4Q0K A;  1ZXF A;  2LF2 A;  3UJL A;  2FLH A;  3OH8 A;  4JDA A;  3KB3 A;  3NI8 A;  4M9B A;  2LPX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...