2ZA4A

Crystal structural analysis of barnase-barstar complex
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
108
structure length
108
Chain Sequence
b'VINTFDGVADYLQTYHKLPDNYITKSEAQALGWVASKGNLADVAPGKSIGGDIFSNREGKLPGKSGRTWREADINYTSGFRNSDRILYSSDWLIYATTDHYQTFTKIR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease
publication title Crystal structural analysis of protein-protein interactions drastically destabilized by a single mutation
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
molecule tags Hydrolase/hydrolase inhibitor
total genus 33
structure length 108
sequence length 108
chains with identical sequence C
ec nomenclature ec 3.1.27.-:
pdb deposition date 2007-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 2za4A00
1MGRA 2F4YA 1BRKA 1RMSA 1C54A 2RBIA 4J5KA 1B2UA 3DGYA 1BVIA 3BIRA 2AADA 1FYSA 1BGSA 1BANA 1LOWA 3BU4A 2F5MA 1X1YA 1AQZA 3Q3FA 1BRNL 3D5IA 3HOHA 1BSCA 6GSPA 2AAEA 1I2EA 1GOUA 1BNFA 1YVSA 5RNTA 3URPA 1X1XA 1YGWA 1RN1A 1UCLA 2KF5A 1RLSA 4HOHA 2KF6A 1BNIA 1RGEA 1RGGA 1BUJA 1UCIA 5HOHA 1DETA 4GHOA 1TTOA 3A5EA 1LRAA 1X1WA 1Q9EA 1BAOA 1RCLA 1RGCA 1LNIA 1I8VA 1BOXA 1FUTA 1RNTA 1I0VA 3D5GA 2BIRA 1TRQA 1I2GA 1X1UA 3RNTA 1PY3A 1B2MA 7GSPA 1RCKA 3D4AA 1B20A 1AY7A 1BNSA 1BNJA 1I3IA 2KF3A 1BRGA 1R4YA 7RNTA 1JBTA 1FZUA 5BU4A 2BU4A 2F5WA 2F56A 1BU4A 3WR2A 1UCJA 2GSPA 4BIRA 5BIRA 1BRHA 1BRIA 1CH0A 1UCKA 1RGAA 1T2HA 2KAAA 1I0XA 1IYYA 2RNTA 1TRPA 2HOHA 1B2SA 1BSAA 1FUSA 1BNEA 1JBSA 1B2XA 1RNBA 1PYLA 3AGOA 1RGFA 2C4BA 1RSNA 1B3SA 1DE3A 8RNTA 1A2PA 1RGHA 1RHLA 2KF4A 3KCHA 1LOYA 1BRJA 1T2IA 1FW7A 3AHWA 1BSBA 1RTUA 1RGLA 3WHOA 1YNVX 1I70A 3SYUA 1HYFA 4RNTA 1HZ1A 1ZGXA 3DH2A 1G02A 1BSDA 2SARA 1RGKA 1B27A 1GMRA 1GMQA 1I3FA 3GSPA 1GOYA 4BU4A 1BNRA 3AHSA 1JBRA 1RDSA 1BIRA 1I2FA 1SARA 1BRSA 1GSPA 4GSPA 9RNTA 1B2ZA 1BNGA 1MGWA 1GOVA 1RN4A 1B21A 2ZA4A 6RNTA 4HAAA 3AGNA 4J5GA 1LOVA 1BSEA 5GSPA 1GMPA
chains in the Genus database with same CATH superfamily
1TIJA 1MGRA 1LOXA 1O7NB 3G4S3 1CYUA 1NJI4 2RBIA 4J5KA 4XM4A 1B2UA 1M904 2CW9A 2AADA 3BIRA 1IVXA 3H51A 3V98A 4HM6B 3BNBA 1VQP3 2OCTA 3GWRA 1DMNA 1M9GA 3BU4A 7STDA 3S5CA 1FGRA 3LYGA 5DRVA 3CU3A 3D5IA 3OX9A 3ZG0A 5HGRA 1CEWI 3FGYA 1LNHA 1QMAA 3EN8A 2AAEA 4H61A 1MNLA 1BNFA 1IT7A 2Q07A 2XSOB 4R9KA 4BTXA 5RNTA 3X40A 1AVKA 4PEJA 1C7HA 2SBLA 3DGLA 1WMNA 1NU3A 2KF5A 4R9LA 1KQS2 4HOHA 5IG5A 3G713 1GY6A 2YFJB 1BUJA 1YJW3 2CFKA 3G6E3 3IJEB 3BB9A 3D3LA 1FGQA 3SEDA 2K0MA 1OGZA 1LRAA 3JUPA 1AR0A 1BUQA 3EBYA 2CFWA 1A90A 1LNIA 1I8VA 1BOXA 1FUTA 3Q2PA 1I0VA 1EA2A 3F14A 3HIGA 4EBGA 1TRQA 3NBBA 1VQL3 1O7MB 4LYLB 3S27A 1IQXA 1NDOB 1QALA 7GSPA 3T0UA 3VSYA 4O2HA 5JBSA 1EQKA 2LQVA 4EXRA 1BNSA 1FGMA 1I3IA 3UJMA 2CWVA 4CPKA 1EKMA 1OF5A 3FH1A 2BU4A 4BL2A 2INXA 3FKAA 1OHPA 3HZPA 3WR2A 2P05A 5A0OB 1CH0A 3MYTA 3EF8A 4NPBA 1O7HB 3PCRA 2UGIA 1TRPA 1SPUA 2CX0A 3EHCA 5KP4A 1RNBA 2OOVC 3I563 4JF8A 1OHSA 1OUNA 3AGOA 4HM0B 1RGFA 2P0MA 3LOYA 1RSNA 3FG3A 5CK6A 1QVF2 1Q814 4MJDA 3KN4A 1IT8A 4WFOA 8RNTA 2F86B 1R4CA 1VQQA 3LMLA 2UX0A 2XFTA 1PU4A 3F40A 4R4KA 3G8ZA 2QIYA 5EQLA 4BL3A 1W2B2 3WODG 5TGNA 1BRJA 3V99A 1A2VA 1OF5B 4HM7B 4K61A 3AHWA 3O8YA 3SVAA 5IW9A 3BNCA 1STFI 4MMZB 1I70A 3GRDA 1DVCA 4XDVA 1BSDA 4AKYA 2SARA 3PS8A 1B27A 2RGQA 1I3FA 1Y4KA 1GOYA 3GZYB 4FR9A 1W6CA 3BLZA 2R4IA 1BIRA 2W2CA 1SARA 5FW5A 1OHOA 2B24B 4GSPA 4EC6A 4FMBA 1ZS7A 4N3VA 3CCV3 1UW1A 4KZ1A 4N6NB 3ZFZA 5DREA 1LQGC 3J7Yd 2FGTA 2ZA4A 1K8A4 5CLKA 3B4PA 4HBRA 2ML5A 4J5GA 3IPTA 1TFOA 1BSEA 3FLJA 2O9UX 1K28A 5CXOA 3WA2X 1ULJB 2CG0A 4XBXA 3AMOA 4O3VA 1C54A 4X2OA 4CCVA 1JJ22 3DGYA 1BVIA 1DYUA 1BGSA 1LOWA 4AKZA 2KRTA 1MWUA 3ALAA 3CCR3 1G96A 3EB8A 5LC6A 2PNCA 2QGUA 3Q3FA 1JKGB 1O7GB 1BRNL 3B8LA 2IYJA 2K54A 1TFKA 2HMJB 3D79A 6GSPA 2C11A 2IMJA 4GL6A 4I4KA 5IG3A 3V92A 2E2UA 8CHOA 1RLSA 1W01A 3OXAA 1K734 3E99A 3IMAB 4XBTA 3DGMA 1DETA 4GHOA 1GS3A 1UGIA 2E2TA 5G1KA 4KT3B 3ZG5A 3LTAA 5BXQA 1Q824 5AIIA 1YJN3 1Q9EA 1HKXA 5EEOA 1BAOA 1RCLA 3WMDA 4KFDA 4EYCA 3NBRA 4KVHA 4XDWA 2IA7A 3I0YA 1RNTA 3DUKA 3B7CA 2BIRA 2UUGC 2CG1A 1IK3A 2ZDJA 4HYZA 1I2GA 1VQN3 2HMKB 4IT7A 1VQ53 1RCKA 4TX4A 4NREA 3EE1A 3KFQC 1B20A 1V57A 4KFFA 2OQEA 5IENA 3LZAA 1JNQA 2Z6BA 2KF3A 4KFEA 4U13A 3LTDA 1E3RA 1FZUA 1LQMB 2BHMA 4N6OB 5FGOA 4BTWA 1YI23 2P09A 4XBYA 2IY2A 3KSED 1QJGA 2BMOB 4OVMA 5IEPA 1AVLA 2RCDA 1OPYA 1WTHA 3TDGA 2HOHA 1ZO2A 1FUSA 2Z76A 3BNEA 2Z77A 2MF7A 1JB2A 3FG4A 1PYLA 4HM4B 1YHQ3 1B3SA 1JB5A 3CXC2 1DE3A 1GY5A 2CX1A 3MPHA 3ECFA 3DXOA 1Q42A 1W00A 3KCHA 3UB1A 4X2HA 3F8HA 5I97A 5LC7A 1N5PA 3MG2A 1T2IA 3CNMA 1N5HA 3CCE3 3D9RA 1YIT3 2W0QA 5AEUB 3X3YA 1KD14 1IV7A 2BO9B 3KIIA 1ZGXA 3K0ZA 3WOFB 1SQWA 1W2ZA 2XSHB 3EC9A 3GAXA 4K90B 2W03A 1K41A 1GMRA 1RGKA 1K9M4 1RN7A 3UL6A 3KZTA 4HJLB 1BNRA 1RJOA 1G0TA 1JZDA 1ISKA 1RRHA 1RRLA 1GSPA 3LXUX 1ROVA 3MWZA 4R1KA 1RN4A 1TUHA 2P0XA 3G16A 4ILFA 1M1K4 5KP1A 1A67A 3NX0A 3PGBA 3LT9A 4FCZA 4HAAA 5JPPA 1W7CA 2QA43 1NO3A 1STDA 1DVDA 3NUVA 2XEPA 2F4YA 2WGQA 1BRKA 4HM8B 1RMSA 3K7CA 3EBTA 1MOLA 3CD63 3NM2A 3OWUA 2HMOB 2WOHA 4LGQA 1FYSA 2C10A 3NHXA 2CFDA 2PZVA 4N6UA 2XRXB 3N8BA 1VQ63 5CF2A 2Z7AA 5AIFA 2GEXA 2F5MA 2RSXA 4ORLA 1X1YA 1WQLB 3M8CA 1VQK3 1AQZA 3OWYA 1D6UA 1ASKA 3X41A 1Q40A 1UI8A 5AIGA 1BSCA 1QVG2 1I2EA 1GOUA 3LTBA 1YVSA 2YFLB 5JPUA 1W6YA 3NV0A 1L5GB 3STDA 3HIIA 5D83A 1UCLA 4RZMA 2WGOA 3CPW2 2F98A 1LVNA 2GEYA 3NQZA 3X42A 1RGGA 1UDII 1M1XB 4XB5A 5HOHA 4EW5A 1OCVA 2K3DA 3QRDA 2D1WA 3WOEB 3A5EA 4IIAA 2LYXA 3LH4A 3N54B 3OWSA 2HMLB 3CCQ3 5EVHA 4L7KA 2CH9A 5ELJA 1IV9A 1JV2B 1W5ZA 1T5YA 2OWPA 3D5GA 3X3ZA 1Q40B 3KSPA 4HZBB 4IPBA 4R80A 1X1UA 2D42A 2W6JH 4STDA 1B2MA 1NB5I 1WNHA 2IUKA 1IQ8A 3OW22 1E3VA 3NV0B 1AY7A 3S28A 3DY5A 1BNJA 1EG9B 5KP3A 1VZZA 4FMDA 4WWUC 3K9MC 3SOYA 1EUIC 4K1VA 2F5WA 3AMOB 1UGHI 4LSOA 1PFPA 3DGNA 3OV4A 4BIRA 3CCS3 1UCJA 2GSPA 5BIRA 1FUWA 1BRIA 1UCKA 1RGAA 1T2HA 1F8NA 1SIHA 2KAAA 2RNTA 3ER7A 3G0KA 3CCJ3 2F99A 3HI7A 4WYKA 1IYYA 4L8OA 1BNEA 3U97A 1JBSA 3F8XA 4FMAA 1UUWB 1WMPA 2YFIB 4NHFA 1UI7A 1ROAA 2C4BA 1TU5A 1D6ZA 2BNGA 2GU1A 4HKVB 4K1UA 4HZ9B 4OK0A 5IF6A 4L8PA 1US1A 2E2VA 1A2PA 5G1LA 2HMNB 1VQ93 1FGOA 4I5QA 1JN5A 5M18A 1LOYA 1KWIA 4H3UA 3RGAA 3SOAA 1Q7Y4 1BSBA 1GD4A 1RTUA 2MC8A 2GU3A 3WHOA 2CWTA 3NQYA 3CC43 1NWWA 2O3OA 4RNTA 3RGRA 2CFGA 1HZ1A 3DH2A 5IEOA 3SYUA 5IERA 3NBJA 5CF1A 1GMQA 2H0HA 3GSPA 3CC23 1JBRA 1RDSA 3FCSB 4WYKB 2HMMB 1NNVA 1Z1SA 2KCDA 3WDGB 1BRSA 2QEX3 4DKIA 3SX1A 4FCMA 2OQEC 4O02B 1GYBA 2Y73A 1GOVA 1JRQA 1SIIA 2ZHXB 3U1WA 1U5OA 2OTL3 1JN5B 4RNZA 1RKYA 4RBNA 5AIHA 1LOVA 2XFSA 5GSPA 4HVNA 1GMPA 2ZL8A 4WHAA 3S67A 5AI1A 1IDPA 2CIUA 2ML6A 2GBXB 2L4VA 2BMRB 2FNQA 3CME3 1JZOA 3K63A 4ZM8A 2XGNA 4CDLA 2W56A 3RDEA 2CC3A 1BANA 4AEQA 2BMQB 6STDA 5IG4A 4MEIA 3HK4A 1FA3A 2FXTA 1N8QA 3S29A 3DGOA 3K5TA 1WMOA 3UL5A 3F7SA 1V58A 5M19A 4CJNA 3EX9A 1J2BA 1W02A 2GBWB 1YJ93 1DMQA 2JQ5A 3T8UA 3CCL3 3HOHA 2L1SA 1QAFA 3PZWA 4OUQA 3FF2A 2OOVA 1EEJA 1KC84 2CWUA 1S5AA 3URPA 1X1XA 2OTJ3 1YGWA 1YVBI 1RN1A 2IUJA 3L0RA 4J9AA 1NB3I 1VQO3 1IVVA 1N9EA 2KF6A 4WP5A 1QAKA 3MG1A 1BNIA 1RGEA 3GZBA 2KXGA 5IG0A 2W04A 1UCIA 2CK3H 2XF3A 1IU7A 2W56B 1VQM3 3CMA3 1TTOA 2J8XB 4J8TA 3JUNA 2I9WA 3B4OA 3CCU3 1S723 1X1WA 1AV4A 3DMCA 3GZXB 1OGXA 3JVCA 1RGCA 1IVWA 3MG3A 4QWTA 3PXMA 3ROBA 1U8CB 3NXJA 1KSIA 1LXEA 1OACA 3JUOA 3VF1A 3QK9A 1O7WB 1CYVA 3F9SA 3RNTA 3X3XA 1PY3A 2R41A 5BVBA 3D4AA 2XH9A 1UUGB 2CFLA 3EJVA 1TP6A 3Q1CA 1DMMA 1GD3A 5STDA 2M7OA 1IQYA 5D82A 1BRGA 1R4YA 7RNTA 3JUQA 4HM1B 4MMYB 1FGTA 1JBTA 1E97A 4MMXB 4O8SA 5BU4A 3VGNA 3CC73 4EV5A 3LTCA 2F56A 3CNXA 4HM5B 5G2GA 1SJWA 3FF0A 5M1AA 2W9PA 1BU4A 3CPOA 1N8R4 2Y74A 3DM8A 1BRHA 3MSOA 2JDIH 4EV2A 1V74A 3WA3A 1N9JA 3A76A 1I0XA 3PCSA 5D81A 1MWSA 2WOFA 5AYRB 1B2SA 1BSAA 1T3BA 2YX9A 3EQQB 1B2XA 2B1XB 1JKGA 1ZX2A 1D6YA 2STDA 2XR8B 3FG1A 4LZIA 4RNYA 4FCJA 1Q864 3JUMA 2GXFA 1MWTA 3GZRA 3Q90A 3CCM3 4N6TA 1W6GA 5AYSC 1YIJ3 3DZLA 1RGHA 2KF4A 1RHLA 2V1LA 5ELUA 1GY7A 1MWRA 3FZWA 5AEWB 3KKGA 4N6MA 2H0IA 1FW7A 3NM7A 4HM3B 1VQ73 1RGLA 3N9HA 3FSDA 1YNVX 1HYFA 1HU9A 1A2KA 1ULIB 1G02A 2W9QA 4JRFA 3BNDA 1W4NA 4BU4A 4Q53A 1OH0A 4FMCA 3AHSA 2CHCA 3H3HA 3F7XA 3EN1B 1I2FA 1JB4A 2WO0A 4N6LA 2BT3A 2RFRA 3SLUA 3I553 2A15A 1B2ZA 1BNGA 1CQSA 1MGWA 3MKIA 4G1MB 3T8NA 9RNTA 1IVUA 3PYJA 1O7PB 4N6V0 2H0GA 1B21A 2XGLA 3LT8A 1UUVB 4GB5A 1VQ83 4HM2B 1Q7HA 2CKFB 2P38A 4LEHA 6RNTA 1TJDA 1YGEA 3AGNA 3HX8A 3SXXA 4LMIA 4BTYA 3MHEA 3UNLA 1VQ43 3KE7A
chains in the Genus database with same CATH topology
1MGRA 2F4YA 1BRKA 1RMSA 1C54A 2RBIA 4J5KA 1B2UA 3DGYA 1BVIA 3BIRA 2AADA 1FYSA 1BGSA 1BANA 1LOWA 3BU4A 2F5MA 1X1YA 1AQZA 3Q3FA 1BRNL 3D5IA 3HOHA 1BSCA 6GSPA 2AAEA 1I2EA 1GOUA 1BNFA 1YVSA 5RNTA 3URPA 1X1XA 1YGWA 1RN1A 1UCLA 2KF5A 1RLSA 4HOHA 2KF6A 1BNIA 1RGEA 1RGGA 1BUJA 1UCIA 5HOHA 1DETA 4GHOA 1TTOA 3A5EA 1LRAA 1X1WA 1Q9EA 1BAOA 1RCLA 1RGCA 1LNIA 1I8VA 1BOXA 1FUTA 1RNTA 1I0VA 3D5GA 2BIRA 1TRQA 1I2GA 1X1UA 3RNTA 1PY3A 1B2MA 7GSPA 1RCKA 3D4AA 1B20A 1AY7A 1BNSA 1BNJA 1I3IA 2KF3A 1BRGA 1R4YA 7RNTA 1JBTA 1FZUA 5BU4A 2BU4A 2F5WA 2F56A 1BU4A 3WR2A 1UCJA 2GSPA 4BIRA 5BIRA 1BRHA 1BRIA 1CH0A 1UCKA 1RGAA 1T2HA 2KAAA 1I0XA 1IYYA 2RNTA 1TRPA 2HOHA 1B2SA 1BSAA 1FUSA 1BNEA 1JBSA 1B2XA 1RNBA 1PYLA 3AGOA 1RGFA 2C4BA 1RSNA 1B3SA 1DE3A 8RNTA 1A2PA 1RGHA 1RHLA 2KF4A 3KCHA 1LOYA 1BRJA 1T2IA 1FW7A 3AHWA 1BSBA 1RTUA 1RGLA 3WHOA 1YNVX 1I70A 3SYUA 1HYFA 4RNTA 1HZ1A 1ZGXA 3DH2A 1G02A 1BSDA 2SARA 1RGKA 1B27A 1GMRA 1GMQA 1I3FA 3GSPA 1GOYA 4BU4A 1BNRA 3AHSA 1JBRA 1RDSA 1BIRA 1I2FA 1SARA 1BRSA 1GSPA 4GSPA 9RNTA 1B2ZA 1BNGA 1MGWA 1GOVA 1RN4A 1B21A 2ZA4A 6RNTA 4HAAA 3AGNA 4J5GA 1LOVA 1BSEA 5GSPA 1GMPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MGR A;  2F4Y A;  1BRK A;  1RMS A;  1C54 A;  2RBI A;  4J5K A;  1B2U A;  3DGY A;  1BVI A;  3BIR A;  2AAD A;  1FYS A;  1BGS A;  1BAN A;  1LOW A;  3BU4 A;  2F5M A;  1X1Y A;  1AQZ A;  3Q3F A;  1BRN L;  3D5I A;  3HOH A;  1BSC A;  6GSP A;  2AAE A;  1I2E A;  1GOU A;  1BNF A;  1YVS A;  5RNT A;  3URP A;  1X1X A;  1YGW A;  1RN1 A;  1UCL A;  2KF5 A;  1RLS A;  4HOH A;  2KF6 A;  1BNI A;  1RGE A;  1RGG A;  1BUJ A;  1UCI A;  5HOH A;  1DET A;  4GHO A;  1TTO A;  3A5E A;  1LRA A;  1X1W A;  1Q9E A;  1BAO A;  1RCL A;  1RGC A;  1LNI A;  1I8V A;  1BOX A;  1FUT A;  1RNT A;  1I0V A;  3D5G A;  2BIR A;  1TRQ A;  1I2G A;  1X1U A;  3RNT A;  1PY3 A;  1B2M A;  7GSP A;  1RCK A;  3D4A A;  1B20 A;  1AY7 A;  1BNS A;  1BNJ A;  1I3I A;  2KF3 A;  1BRG A;  1R4Y A;  7RNT A;  1JBT A;  1FZU A;  5BU4 A;  2BU4 A;  2F5W A;  2F56 A;  1BU4 A;  3WR2 A;  1UCJ A;  2GSP A;  4BIR A;  5BIR A;  1BRH A;  1BRI A;  1CH0 A;  1UCK A;  1RGA A;  1T2H A;  2KAA A;  1I0X A;  1IYY A;  2RNT A;  1TRP A;  2HOH A;  1B2S A;  1BSA A;  1FUS A;  1BNE A;  1JBS A;  1B2X A;  1RNB A;  1PYL A;  3AGO A;  1RGF A;  2C4B A;  1RSN A;  1B3S A;  1DE3 A;  8RNT A;  1A2P A;  1RGH A;  1RHL A;  2KF4 A;  3KCH A;  1LOY A;  1BRJ A;  1T2I A;  1FW7 A;  3AHW A;  1BSB A;  1RTU A;  1RGL A;  3WHO A;  1YNV X;  1I70 A;  3SYU A;  1HYF A;  4RNT A;  1HZ1 A;  1ZGX A;  3DH2 A;  1G02 A;  1BSD A;  2SAR A;  1RGK A;  1B27 A;  1GMR A;  1GMQ A;  1I3F A;  3GSP A;  1GOY A;  4BU4 A;  1BNR A;  3AHS A;  1JBR A;  1RDS A;  1BIR A;  1I2F A;  1SAR A;  1BRS A;  1GSP A;  4GSP A;  9RNT A;  1B2Z A;  1BNG A;  1MGW A;  1GOV A;  1RN4 A;  1B21 A;  2ZA4 A;  6RNT A;  4HAA A;  3AGN A;  4J5G A;  1LOV A;  1BSE A;  5GSP A;  1GMP A; 
#chains in the Genus database with same CATH topology
 1TIJ A;  1MGR A;  1LOX A;  1O7N B;  3G4S 3;  1CYU A;  1NJI 4;  2RBI A;  4J5K A;  4XM4 A;  1B2U A;  1M90 4;  2CW9 A;  2AAD A;  3BIR A;  1IVX A;  3H51 A;  3V98 A;  4HM6 B;  3BNB A;  1VQP 3;  2OCT A;  3GWR A;  1DMN A;  1M9G A;  3BU4 A;  7STD A;  3S5C A;  1FGR A;  3LYG A;  5DRV A;  3CU3 A;  3D5I A;  3OX9 A;  3ZG0 A;  5HGR A;  1CEW I;  3FGY A;  1LNH A;  1QMA A;  3EN8 A;  2AAE A;  4H61 A;  1MNL A;  1BNF A;  1IT7 A;  2Q07 A;  2XSO B;  4R9K A;  4BTX A;  5RNT A;  3X40 A;  1AVK A;  4PEJ A;  1C7H A;  2SBL A;  3DGL A;  1WMN A;  1NU3 A;  2KF5 A;  4R9L A;  1KQS 2;  4HOH A;  5IG5 A;  3G71 3;  1GY6 A;  2YFJ B;  1BUJ A;  1YJW 3;  2CFK A;  3G6E 3;  3IJE B;  3BB9 A;  3D3L A;  1FGQ A;  3SED A;  2K0M A;  1OGZ A;  1LRA A;  3JUP A;  1AR0 A;  1BUQ A;  3EBY A;  2CFW A;  1A90 A;  1LNI A;  1I8V A;  1BOX A;  1FUT A;  3Q2P A;  1I0V A;  1EA2 A;  3F14 A;  3HIG A;  4EBG A;  1TRQ A;  3NBB A;  1VQL 3;  1O7M B;  4LYL B;  3S27 A;  1IQX A;  1NDO B;  1QAL A;  7GSP A;  3T0U A;  3VSY A;  4O2H A;  5JBS A;  1EQK A;  2LQV A;  4EXR A;  1BNS A;  1FGM A;  1I3I A;  3UJM A;  2CWV A;  4CPK A;  1EKM A;  1OF5 A;  3FH1 A;  2BU4 A;  4BL2 A;  2INX A;  3FKA A;  1OHP A;  3HZP A;  3WR2 A;  2P05 A;  5A0O B;  1CH0 A;  3MYT A;  3EF8 A;  4NPB A;  1O7H B;  3PCR A;  2UGI A;  1TRP A;  1SPU A;  2CX0 A;  3EHC A;  5KP4 A;  1RNB A;  2OOV C;  3I56 3;  4JF8 A;  1OHS A;  1OUN A;  3AGO A;  4HM0 B;  1RGF A;  2P0M A;  3LOY A;  1RSN A;  3FG3 A;  5CK6 A;  1QVF 2;  1Q81 4;  4MJD A;  3KN4 A;  1IT8 A;  4WFO A;  8RNT A;  2F86 B;  1R4C A;  1VQQ A;  3LML A;  2UX0 A;  2XFT A;  1PU4 A;  3F40 A;  4R4K A;  3G8Z A;  2QIY A;  5EQL A;  4BL3 A;  1W2B 2;  3WOD G;  5TGN A;  1BRJ A;  3V99 A;  1A2V A;  1OF5 B;  4HM7 B;  4K61 A;  3AHW A;  3O8Y A;  3SVA A;  5IW9 A;  3BNC A;  1STF I;  4MMZ B;  1I70 A;  3GRD A;  1DVC A;  4XDV A;  1BSD A;  4AKY A;  2SAR A;  3PS8 A;  1B27 A;  2RGQ A;  1I3F A;  1Y4K A;  1GOY A;  3GZY B;  4FR9 A;  1W6C A;  3BLZ A;  2R4I A;  1BIR A;  2W2C A;  1SAR A;  5FW5 A;  1OHO A;  2B24 B;  4GSP A;  4EC6 A;  4FMB A;  1ZS7 A;  4N3V A;  3CCV 3;  1UW1 A;  4KZ1 A;  4N6N B;  3ZFZ A;  5DRE A;  1LQG C;  3J7Y d;  2FGT A;  2ZA4 A;  1K8A 4;  5CLK A;  3B4P A;  4HBR A;  2ML5 A;  4J5G A;  3IPT A;  1TFO A;  1BSE A;  3FLJ A;  2O9U X;  1K28 A;  5CXO A;  3WA2 X;  1ULJ B;  2CG0 A;  4XBX A;  3AMO A;  4O3V A;  1C54 A;  4X2O A;  4CCV A;  1JJ2 2;  3DGY A;  1BVI A;  1DYU A;  1BGS A;  1LOW A;  4AKZ A;  2KRT A;  1MWU A;  3ALA A;  3CCR 3;  1G96 A;  3EB8 A;  5LC6 A;  2PNC A;  2QGU A;  3Q3F A;  1JKG B;  1O7G B;  1BRN L;  3B8L A;  2IYJ A;  2K54 A;  1TFK A;  2HMJ B;  3D79 A;  6GSP A;  2C11 A;  2IMJ A;  4GL6 A;  4I4K A;  5IG3 A;  3V92 A;  2E2U A;  8CHO A;  1RLS A;  1W01 A;  3OXA A;  1K73 4;  3E99 A;  3IMA B;  4XBT A;  3DGM A;  1DET A;  4GHO A;  1GS3 A;  1UGI A;  2E2T A;  5G1K A;  4KT3 B;  3ZG5 A;  3LTA A;  5BXQ A;  1Q82 4;  5AII A;  1YJN 3;  1Q9E A;  1HKX A;  5EEO A;  1BAO A;  1RCL A;  3WMD A;  4KFD A;  4EYC A;  3NBR A;  4KVH A;  4XDW A;  2IA7 A;  3I0Y A;  1RNT A;  3DUK A;  3B7C A;  2BIR A;  2UUG C;  2CG1 A;  1IK3 A;  2ZDJ A;  4HYZ A;  1I2G A;  1VQN 3;  2HMK B;  4IT7 A;  1VQ5 3;  1RCK A;  4TX4 A;  4NRE A;  3EE1 A;  3KFQ C;  1B20 A;  1V57 A;  4KFF A;  2OQE A;  5IEN A;  3LZA A;  1JNQ A;  2Z6B A;  2KF3 A;  4KFE A;  4U13 A;  3LTD A;  1E3R A;  1FZU A;  1LQM B;  2BHM A;  4N6O B;  5FGO A;  4BTW A;  1YI2 3;  2P09 A;  4XBY A;  2IY2 A;  3KSE D;  1QJG A;  2BMO B;  4OVM A;  5IEP A;  1AVL A;  2RCD A;  1OPY A;  1WTH A;  3TDG A;  2HOH A;  1ZO2 A;  1FUS A;  2Z76 A;  3BNE A;  2Z77 A;  2MF7 A;  1JB2 A;  3FG4 A;  1PYL A;  4HM4 B;  1YHQ 3;  1B3S A;  1JB5 A;  3CXC 2;  1DE3 A;  1GY5 A;  2CX1 A;  3MPH A;  3ECF A;  3DXO A;  1Q42 A;  1W00 A;  3KCH A;  3UB1 A;  4X2H A;  3F8H A;  5I97 A;  5LC7 A;  1N5P A;  3MG2 A;  1T2I A;  3CNM A;  1N5H A;  3CCE 3;  3D9R A;  1YIT 3;  2W0Q A;  5AEU B;  3X3Y A;  1KD1 4;  1IV7 A;  2BO9 B;  3KII A;  1ZGX A;  3K0Z A;  3WOF B;  1SQW A;  1W2Z A;  2XSH B;  3EC9 A;  3GAX A;  4K90 B;  2W03 A;  1K41 A;  1GMR A;  1RGK A;  1K9M 4;  1RN7 A;  3UL6 A;  3KZT A;  4HJL B;  1BNR A;  1RJO A;  1G0T A;  1JZD A;  1ISK A;  1RRH A;  1RRL A;  1GSP A;  3LXU X;  1ROV A;  3MWZ A;  4R1K A;  1RN4 A;  1TUH A;  2P0X A;  3G16 A;  4ILF A;  1M1K 4;  5KP1 A;  1A67 A;  3NX0 A;  3PGB A;  3LT9 A;  4FCZ A;  4HAA A;  5JPP A;  1W7C A;  2QA4 3;  1NO3 A;  1STD A;  1DVD A;  3NUV A;  2XEP A;  2F4Y A;  2WGQ A;  1BRK A;  4HM8 B;  1RMS A;  3K7C A;  3EBT A;  1MOL A;  3CD6 3;  3NM2 A;  3OWU A;  2HMO B;  2WOH A;  4LGQ A;  1FYS A;  2C10 A;  3NHX A;  2CFD A;  2PZV A;  4N6U A;  2XRX B;  3N8B A;  1VQ6 3;  5CF2 A;  2Z7A A;  5AIF A;  2GEX A;  2F5M A;  2RSX A;  4ORL A;  1X1Y A;  1WQL B;  3M8C A;  1VQK 3;  1AQZ A;  3OWY A;  1D6U A;  1ASK A;  3X41 A;  1Q40 A;  1UI8 A;  5AIG A;  1BSC A;  1QVG 2;  1I2E A;  1GOU A;  3LTB A;  1YVS A;  2YFL B;  5JPU A;  1W6Y A;  3NV0 A;  1L5G B;  3STD A;  3HII A;  5D83 A;  1UCL A;  4RZM A;  2WGO A;  3CPW 2;  2F98 A;  1LVN A;  2GEY A;  3NQZ A;  3X42 A;  1RGG A;  1UDI I;  1M1X B;  4XB5 A;  5HOH A;  4EW5 A;  1OCV A;  2K3D A;  3QRD A;  2D1W A;  3WOE B;  3A5E A;  4IIA A;  2LYX A;  3LH4 A;  3N54 B;  3OWS A;  2HML B;  3CCQ 3;  5EVH A;  4L7K A;  2CH9 A;  5ELJ A;  1IV9 A;  1JV2 B;  1W5Z A;  1T5Y A;  2OWP A;  3D5G A;  3X3Z A;  1Q40 B;  3KSP A;  4HZB B;  4IPB A;  4R80 A;  1X1U A;  2D42 A;  2W6J H;  4STD A;  1B2M A;  1NB5 I;  1WNH A;  2IUK A;  1IQ8 A;  3OW2 2;  1E3V A;  3NV0 B;  1AY7 A;  3S28 A;  3DY5 A;  1BNJ A;  1EG9 B;  5KP3 A;  1VZZ A;  4FMD A;  4WWU C;  3K9M C;  3SOY A;  1EUI C;  4K1V A;  2F5W A;  3AMO B;  1UGH I;  4LSO A;  1PFP A;  3DGN A;  3OV4 A;  4BIR A;  3CCS 3;  1UCJ A;  2GSP A;  5BIR A;  1FUW A;  1BRI A;  1UCK A;  1RGA A;  1T2H A;  1F8N A;  1SIH A;  2KAA A;  2RNT A;  3ER7 A;  3G0K A;  3CCJ 3;  2F99 A;  3HI7 A;  4WYK A;  1IYY A;  4L8O A;  1BNE A;  3U97 A;  1JBS A;  3F8X A;  4FMA A;  1UUW B;  1WMP A;  2YFI B;  4NHF A;  1UI7 A;  1ROA A;  2C4B A;  1TU5 A;  1D6Z A;  2BNG A;  2GU1 A;  4HKV B;  4K1U A;  4HZ9 B;  4OK0 A;  5IF6 A;  4L8P A;  1US1 A;  2E2V A;  1A2P A;  5G1L A;  2HMN B;  1VQ9 3;  1FGO A;  4I5Q A;  1JN5 A;  5M18 A;  1LOY A;  1KWI A;  4H3U A;  3RGA A;  3SOA A;  1Q7Y 4;  1BSB A;  1GD4 A;  1RTU A;  2MC8 A;  2GU3 A;  3WHO A;  2CWT A;  3NQY A;  3CC4 3;  1NWW A;  2O3O A;  4RNT A;  3RGR A;  2CFG A;  1HZ1 A;  3DH2 A;  5IEO A;  3SYU A;  5IER A;  3NBJ A;  5CF1 A;  1GMQ A;  2H0H A;  3GSP A;  3CC2 3;  1JBR A;  1RDS A;  3FCS B;  4WYK B;  2HMM B;  1NNV A;  1Z1S A;  2KCD A;  3WDG B;  1BRS A;  2QEX 3;  4DKI A;  3SX1 A;  4FCM A;  2OQE C;  4O02 B;  1GYB A;  2Y73 A;  1GOV A;  1JRQ A;  1SII A;  2ZHX B;  3U1W A;  1U5O A;  2OTL 3;  1JN5 B;  4RNZ A;  1RKY A;  4RBN A;  5AIH A;  1LOV A;  2XFS A;  5GSP A;  4HVN A;  1GMP A;  2ZL8 A;  4WHA A;  3S67 A;  5AI1 A;  1IDP A;  2CIU A;  2ML6 A;  2GBX B;  2L4V A;  2BMR B;  2FNQ A;  3CME 3;  1JZO A;  3K63 A;  4ZM8 A;  2XGN A;  4CDL A;  2W56 A;  3RDE A;  2CC3 A;  1BAN A;  4AEQ A;  2BMQ B;  6STD A;  5IG4 A;  4MEI A;  3HK4 A;  1FA3 A;  2FXT A;  1N8Q A;  3S29 A;  3DGO A;  3K5T A;  1WMO A;  3UL5 A;  3F7S A;  1V58 A;  5M19 A;  4CJN A;  3EX9 A;  1J2B A;  1W02 A;  2GBW B;  1YJ9 3;  1DMQ A;  2JQ5 A;  3T8U A;  3CCL 3;  3HOH A;  2L1S A;  1QAF A;  3PZW A;  4OUQ A;  3FF2 A;  2OOV A;  1EEJ A;  1KC8 4;  2CWU A;  1S5A A;  3URP A;  1X1X A;  2OTJ 3;  1YGW A;  1YVB I;  1RN1 A;  2IUJ A;  3L0R A;  4J9A A;  1NB3 I;  1VQO 3;  1IVV A;  1N9E A;  2KF6 A;  4WP5 A;  1QAK A;  3MG1 A;  1BNI A;  1RGE A;  3GZB A;  2KXG A;  5IG0 A;  2W04 A;  1UCI A;  2CK3 H;  2XF3 A;  1IU7 A;  2W56 B;  1VQM 3;  3CMA 3;  1TTO A;  2J8X B;  4J8T A;  3JUN A;  2I9W A;  3B4O A;  3CCU 3;  1S72 3;  1X1W A;  1AV4 A;  3DMC A;  3GZX B;  1OGX A;  3JVC A;  1RGC A;  1IVW A;  3MG3 A;  4QWT A;  3PXM A;  3ROB A;  1U8C B;  3NXJ A;  1KSI A;  1LXE A;  1OAC A;  3JUO A;  3VF1 A;  3QK9 A;  1O7W B;  1CYV A;  3F9S A;  3RNT A;  3X3X A;  1PY3 A;  2R41 A;  5BVB A;  3D4A A;  2XH9 A;  1UUG B;  2CFL A;  3EJV A;  1TP6 A;  3Q1C A;  1DMM A;  1GD3 A;  5STD A;  2M7O A;  1IQY A;  5D82 A;  1BRG A;  1R4Y A;  7RNT A;  3JUQ A;  4HM1 B;  4MMY B;  1FGT A;  1JBT A;  1E97 A;  4MMX B;  4O8S A;  5BU4 A;  3VGN A;  3CC7 3;  4EV5 A;  3LTC A;  2F56 A;  3CNX A;  4HM5 B;  5G2G A;  1SJW A;  3FF0 A;  5M1A A;  2W9P A;  1BU4 A;  3CPO A;  1N8R 4;  2Y74 A;  3DM8 A;  1BRH A;  3MSO A;  2JDI H;  4EV2 A;  1V74 A;  3WA3 A;  1N9J A;  3A76 A;  1I0X A;  3PCS A;  5D81 A;  1MWS A;  2WOF A;  5AYR B;  1B2S A;  1BSA A;  1T3B A;  2YX9 A;  3EQQ B;  1B2X A;  2B1X B;  1JKG A;  1ZX2 A;  1D6Y A;  2STD A;  2XR8 B;  3FG1 A;  4LZI A;  4RNY A;  4FCJ A;  1Q86 4;  3JUM A;  2GXF A;  1MWT A;  3GZR A;  3Q90 A;  3CCM 3;  4N6T A;  1W6G A;  5AYS C;  1YIJ 3;  3DZL A;  1RGH A;  2KF4 A;  1RHL A;  2V1L A;  5ELU A;  1GY7 A;  1MWR A;  3FZW A;  5AEW B;  3KKG A;  4N6M A;  2H0I A;  1FW7 A;  3NM7 A;  4HM3 B;  1VQ7 3;  1RGL A;  3N9H A;  3FSD A;  1YNV X;  1HYF A;  1HU9 A;  1A2K A;  1ULI B;  1G02 A;  2W9Q A;  4JRF A;  3BND A;  1W4N A;  4BU4 A;  4Q53 A;  1OH0 A;  4FMC A;  3AHS A;  2CHC A;  3H3H A;  3F7X A;  3EN1 B;  1I2F A;  1JB4 A;  2WO0 A;  4N6L A;  2BT3 A;  2RFR A;  3SLU A;  3I55 3;  2A15 A;  1B2Z A;  1BNG A;  1CQS A;  1MGW A;  3MKI A;  4G1M B;  3T8N A;  9RNT A;  1IVU A;  3PYJ A;  1O7P B;  4N6V 0;  2H0G A;  1B21 A;  2XGL A;  3LT8 A;  1UUV B;  4GB5 A;  1VQ8 3;  4HM2 B;  1Q7H A;  2CKF B;  2P38 A;  4LEH A;  6RNT A;  1TJD A;  1YGE A;  3AGN A;  3HX8 A;  3SXX A;  4LMI A;  4BTY A;  3MHE A;  3UNL A;  1VQ4 3;  3KE7 A; 
#chains in the Genus database with same CATH homology
 1MGR A;  2F4Y A;  1BRK A;  1RMS A;  1C54 A;  2RBI A;  4J5K A;  1B2U A;  3DGY A;  1BVI A;  3BIR A;  2AAD A;  1FYS A;  1BGS A;  1BAN A;  1LOW A;  3BU4 A;  2F5M A;  1X1Y A;  1AQZ A;  3Q3F A;  1BRN L;  3D5I A;  3HOH A;  1BSC A;  6GSP A;  2AAE A;  1I2E A;  1GOU A;  1BNF A;  1YVS A;  5RNT A;  3URP A;  1X1X A;  1YGW A;  1RN1 A;  1UCL A;  2KF5 A;  1RLS A;  4HOH A;  2KF6 A;  1BNI A;  1RGE A;  1RGG A;  1BUJ A;  1UCI A;  5HOH A;  1DET A;  4GHO A;  1TTO A;  3A5E A;  1LRA A;  1X1W A;  1Q9E A;  1BAO A;  1RCL A;  1RGC A;  1LNI A;  1I8V A;  1BOX A;  1FUT A;  1RNT A;  1I0V A;  3D5G A;  2BIR A;  1TRQ A;  1I2G A;  1X1U A;  3RNT A;  1PY3 A;  1B2M A;  7GSP A;  1RCK A;  3D4A A;  1B20 A;  1AY7 A;  1BNS A;  1BNJ A;  1I3I A;  2KF3 A;  1BRG A;  1R4Y A;  7RNT A;  1JBT A;  1FZU A;  5BU4 A;  2BU4 A;  2F5W A;  2F56 A;  1BU4 A;  3WR2 A;  1UCJ A;  2GSP A;  4BIR A;  5BIR A;  1BRH A;  1BRI A;  1CH0 A;  1UCK A;  1RGA A;  1T2H A;  2KAA A;  1I0X A;  1IYY A;  2RNT A;  1TRP A;  2HOH A;  1B2S A;  1BSA A;  1FUS A;  1BNE A;  1JBS A;  1B2X A;  1RNB A;  1PYL A;  3AGO A;  1RGF A;  2C4B A;  1RSN A;  1B3S A;  1DE3 A;  8RNT A;  1A2P A;  1RGH A;  1RHL A;  2KF4 A;  3KCH A;  1LOY A;  1BRJ A;  1T2I A;  1FW7 A;  3AHW A;  1BSB A;  1RTU A;  1RGL A;  3WHO A;  1YNV X;  1I70 A;  3SYU A;  1HYF A;  4RNT A;  1HZ1 A;  1ZGX A;  3DH2 A;  1G02 A;  1BSD A;  2SAR A;  1RGK A;  1B27 A;  1GMR A;  1GMQ A;  1I3F A;  3GSP A;  1GOY A;  4BU4 A;  1BNR A;  3AHS A;  1JBR A;  1RDS A;  1BIR A;  1I2F A;  1SAR A;  1BRS A;  1GSP A;  4GSP A;  9RNT A;  1B2Z A;  1BNG A;  1MGW A;  1GOV A;  1RN4 A;  1B21 A;  2ZA4 A;  6RNT A;  4HAA A;  3AGN A;  4J5G A;  1LOV A;  1BSE A;  5GSP A;  1GMP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...