2ZA4A

Crystal structural analysis of barnase-barstar complex
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
108
structure length
108
Chain Sequence
VINTFDGVADYLQTYHKLPDNYITKSEAQALGWVASKGNLADVAPGKSIGGDIFSNREGKLPGKSGRTWREADINYTSGFRNSDRILYSSDWLIYATTDHYQTFTKIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease
publication title Crystal structural analysis of protein-protein interactions drastically destabilized by a single mutation
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
molecule tags Hydrolase/hydrolase inhibitor
total genus 33
structure length 108
sequence length 108
chains with identical sequence C
ec nomenclature ec 3.1.27.-:
pdb deposition date 2007-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 2za4A00
1TRQA 1BNJA 1BU4A 1I70A 1RGGA 1FUSA 2BIRA 1BRGA 1RHLA 1ZGXA 1DETA 1BNGA 1B27A 1I3IA 1CH0A 2KF6A 1YNVX 1RGCA 1TRPA 1IYYA 3D5IA 1BSCA 1BNRA 1RLSA 3SYUA 1B2SA 1BSEA 1UCIA 2AAEA 3DH2A 1UCKA 5BU4A 1SARA 9RNTA 2KF4A 1LNIA 3BIRA 1YVSA 1I0XA 1JBRA 1FZUA 4J5KA 1BNSA 3AGOA 1GMPA 1FW7A 1GOYA 1RNBA 4J5GA 2BU4A 1UCLA 1HYFA 1RGAA 1RDSA 4GSPA 1TTOA 1BOXA 1RMSA 2C4BA 1GOUA 1UCJA 1B21A 1A2PA 4RNTA 1BGSA 1I2FA 1MGRA 1BRKA 1RN4A 2F5WA 1X1UA 1GOVA 5BIRA 1T2IA 6RNTA 5RNTA 2KAAA 3AHSA 1I3FA 2F5MA 1BAOA 1AY7A 3A5EA 4HAAA 1GMQA 1T2HA 1FUTA 1RGHA 3AHWA 1B2MA 1I8VA 1PYLA 1GSPA 2F4YA 2GSPA 1BNIA 1RGEA 1LOWA 1YGWA 1G02A 1FYSA 1X1WA 1JBSA 1RGLA 3URPA 1Q9EA 3DGYA 1DE3A 3GSPA 2HOHA 1JBTA 1I0VA 1BRHA 1PY3A 2F56A 1BUJA 1HZ1A 2SARA 3KCHA 1BRIA 3HOHA 1I2GA 1I2EA 1RNTA 7GSPA 6GSPA 1GMRA 5HOHA 4BIRA 1LRAA 1BANA 1RGKA 3D5GA 1BNEA 1BVIA 2RBIA 1RSNA 1RGFA 2RNTA 1B2XA 1LOYA 1X1YA 1BIRA 2KF5A 3AGNA 1B2UA 4HOHA 1BNFA 3WHOA 3D4AA 4BU4A 1BRNL 1B2ZA 1B20A 8RNTA 1BSDA 2AADA 3BU4A 1BRJA 1AQZA 1X1XA 1RN1A 2KF3A 1BRSA 1MGWA 1LOVA 5GSPA 1R4YA 3Q3FA 3RNTA 1RTUA 1BSAA 1RCLA 1RCKA 3WR2A 1B3SA 1C54A 7RNTA 1BSBA 2ZA4A 4GHOA
chains in the Genus database with same CATH superfamily
1R4CA 2H0GA 5IEPA 3UJMA 4EV5A 3EHCA 1I70A 3LTAA 4K61A 2BIRA 1ZGXA 3VSYA 3WODG 1DETA 3CCQ3 3CCL3 1TU5A 1CH0A 1RGCA 1N8QA 1TRPA 1W01A 3F8XA 3OWUA 4IPBA 3UB1A 1JB2A 3SYUA 1B2SA 3NXJA 1BSEA 1RJOA 5M18A 3Q90A 3STDA 1UUWB 1V57A 1SARA 2D1WA 4L8PA 3WOFB 4LMIA 1LNIA 1NU3A 2OTL3 4MMZB 1SIIA 1CYUA 1G0TA 3A76A 1K28A 1NJI4 2FGTA 3TDGA 1NO3A 1VQK3 4HBRA 3LZAA 4EW5A 4K1UA 3CNXA 3EBTA 1LQGC 3M8CA 1FW7A 3SXXA 4N6V0 3O8YA 1QJGA 5M1AA 1RN7A 4LSOA 1AVLA 3MHEA 3EC9A 3FG1A 4MMYB 3T0UA 1IT8A 3FG3A 1O7PB 1TTOA 2B1XB 2GU1A 4L8OA 2BNGA 3KE7A 5AYSC 4JRFA 4DKIA 1VQ73 1OACA 3SEDA 2KCDA 1O7HB 3AMOB 4CPKA 4I5QA 2XSOB 4RNTA 1PU4A 3G4S3 1QMAA 1WMOA 5D82A 4MJDA 1E97A 1YHQ3 4R80A 1YVBI 2IUKA 1JN5A 2KXGA 2W03A 2KAAA 2XSHB 2WGQA 1SPUA 2Z6BA 3FKAA 1CYVA 3A5EA 5EVHA 2P38A 4IT7A 1NB3I 3V99A 1T2HA 1A67A 3F7SA 1B2MA 1W2ZA 2GXFA 4NHFA 1IQYA 3CXC2 3NUVA 4OVMA 1YIT3 3UL5A 2CFLA 1SJWA 4HVNA 4AKZA 5CF1A 2C11A 3HIGA 4R1KA 1FYSA 1X1WA 3BNDA 1JKGA 4CDLA 2Q07A 1TUHA 5JPPA 1TFKA 3KKGA 3FF0A 2HOHA 2XF3A 4WWUC 1KD14 1JBTA 4EBGA 5IW9A 1BRHA 2QIYA 1PY3A 2F56A 2W9QA 3HOHA 3HIIA 4AEQA 3GZYB 7GSPA 4K1VA 3BNCA 1FGOA 1VQ63 3ZFZA 3NBBA 2CHCA 4WYKA 1BANA 3D5GA 5HGRA 4MEIA 1FGTA 1RSNA 1TIJA 4KFDA 3CCJ3 1WQLB 1STFI 1MNLA 1X1YA 2XFSA 1BIRA 4JF8A 3LYGA 3N8BA 2P05A 1B2UA 4N6MA 5LC7A 3U1WA 1BNFA 3BB9A 1JN5B 4BU4A 1B2ZA 1DMQA 5AIGA 1LNHA 1WTHA 3BU4A 3J7Yd 3UL6A 1X1XA 4O3VA 5IENA 1RN1A 2W04A 1LOVA 2H0IA 1BUQA 2CX0A 2ZDJA 3WDGB 1PFPA 3D3LA 3DGLA 2K3DA 1RCLA 4HKVB 3RDEA 4XBXA 3CPW2 3CU3A 1JKGB 4XM4A 3GWRA 2YFLB 4R9LA 1EG9B 7RNTA 2ZA4A 3JUQA 1T3BA 1QVG2 3SVAA 1BU4A 4IIAA 1IVWA 3MYTA 3FLJA 3SX1A 1BNGA 4L7KA 3CCU3 1I3IA 2IUJA 4EYCA 1YNVX 1Q864 1E3RA 4CJNA 3MWZA 4N6TA 1BNRA 2F86B 2CK3H 2L1SA 4FCJA 1UCIA 1UCKA 3G713 3CD63 3S29A 3E99A 3WA3A 1DYUA 1LVNA 2KF4A 1V74A 3H51A 3BIRA 1K41A 1DMNA 1YVSA 2F98A 1YJN3 1N8R4 1I0XA 3PS8A 3CCM3 3F14A 1HKXA 4FR9A 1QALA 3NQYA 2IA7A 2O9UX 3IPTA 2BMOB 3X3ZA 2WO0A 4FMDA 3BNEA 4XB5A 3WMDA 1Q814 3RGRA 2BU4A 3EB8A 5D83A 3DXOA 5ELUA 1IQXA 1BOXA 1OF5B 1UW1A 2E2TA 2C4BA 2Z76A 5G1KA 4XBYA 3LTDA 2CWVA 1GOUA 1OHSA 3T8NA 3B8LA 2P0MA 4GB5A 5FW5A 1MWTA 1E3VA 3GZXB 4BL2A 5BVBA 1A90A 1MOLA 3VF1A 2HMNB 1MGRA 4HM8B 1RN4A 2GEYA 2RFRA 1GOVA 2XR8B 3MG1A 3DM8A 1EKMA 1VQP3 1FUWA 1LXEA 1MWSA 1I3FA 5G1LA 1DVDA 2GU3A 1AY7A 2D42A 4HM6B 3DGNA 3AHWA 5AEWB 2K0MA 1DVCA 1PYLA 3K5TA 3PZWA 2WGOA 3LOYA 1VQ43 2E2UA 1LOWA 2Y73A 1RGLA 3KSED 5CXOA 3URPA 1WMNA 2W56A 2XGNA 1ZS7A 3B4OA 1DE3A 2RCDA 3SOAA 1N5HA 1GS3A 1UI8A 1Y4KA 3GSPA 2BMQB 4R4KA 1ASKA 1I0VA 3WOEB 1JV2B 1KSIA 1BUJA 1W7CA 2SARA 3GAXA 3FF2A 1M904 2BMRB 3EX9A 1I2GA 1I2EA 3NBRA 1RNTA 2I9WA 1T5YA 1VQQA 3G0KA 3K9MC 4BIRA 1LRAA 1N5PA 1RGKA 2CWTA 3KN4A 5AI1A 1A2KA 4X2HA 1GD4A 2OQEA 2CG0A 4N3VA 3ZG5A 2XEPA 1B2XA 4WP5A 2HMOB 4HM5B 1S5AA 1IV9A 2FNQA 3GZBA 1Q824 1EUIC 3DUKA 3WHOA 4EC6A 2PZVA 1BRNL 1LOXA 2OOVC 5KP4A 5ELJA 3OXAA 4HZ9B 2MC8A 3D79A 3OWSA 4NPBA 1FGMA 2CWUA 3BNBA 2KRTA 2INXA 3IMAB 4KFEA 3SOYA 1AVKA 4WHAA 1KWIA 1F8NA 1BRSA 4CCVA 2IMJA 5DREA 1WMPA 1WNHA 3K63A 1JB5A 1K8A4 5CF2A 1NDOB 1QVF2 3NHXA 3RNTA 3X42A 2YFJB 3N9HA 3JUPA 3OWYA 2R41A 5LC6A 1B3SA 1SIHA 5IG3A 1KC84 2W56B 3LTCA 1ISKA 1MWUA 3WA2X 1ZO2A 1JZDA 3LMLA 2WOFA 2CKFB 1BNJA 3DGOA 4HM7B 2E2VA 1RGGA 4HM1B 2UX0A 1RHLA 2RGQA 2YX9A 3DGMA 1O7NB 3B4PA 4H3UA 1B27A 3F40A 2STDA 1M1K4 2KF6A 3FG4A 4KT3B 1L5GB 2QGUA 3K0ZA 2BHMA 1IYYA 3D5IA 4HM2B 3QK9A 1BSCA 2F99A 3N54B 2LQVA 1EEJA 4KZ1A 4O2HA 3S27A 1K9M4 3S67A 4EV2A 2AAEA 3NV0A 3WR2A 5BU4A 1LQMB 2QEX3 1TP6A 1Q7HA 4HJLB 4FMAA 1GY5A 1S723 1GY7A 4RBNA 1AR0A 4BL3A 1JBRA 1UGHI 2CH9A 1U8CB 3DY5A 3GZRA 1UGIA 1ULJB 1Q40A 3D9RA 5IF6A 1JNQA 3OX9A 3LT9A 1HYFA 3CCE3 4HM0B 1RGAA 2BO9B 3IJEB 4TX4A 1GYBA 1Z1SA 3X3YA 1VQN3 3MSOA 4RZMA 1UCJA 3I553 2OOVA 1A2PA 3CPOA 2CFKA 4WYKB 2SBLA 4FMCA 1BRKA 2F5WA 5AIIA 6RNTA 4BTWA 3AHSA 2IY2A 4LGQA 1D6UA 2JDIH 3OW22 4KFFA 1GMQA 1NWWA 1UUVB 3X3XA 1FUTA 1US1A 3KFQC 3T8UA 2XFTA 1IU7A 1CQSA 1GY6A 1MWRA 1STDA 1QAFA 1N9EA 2F4YA 1BNIA 3NV0B 3LTBA 1YGWA 3ECFA 1KQS2 3NM7A 4N6OB 4PEJA 2YFIB 4ILFA 1Q9EA 2CW9A 3DGYA 1O7MB 1RRHA 2CIUA 3UNLA 3L0RA 7STDA 1JRQA 2W6JH 3ROBA 5DRVA 2PNCA 1TFOA 3FGYA 1YJW3 1Q7Y4 1YJ93 1W00A 1BRIA 4N6LA 2IYJA 1OCVA 4HM3B 2Z7AA 5IG5A 3ALAA 1TJDA 2UGIA 1GD3A 1OUNA 3S5CA 2ZHXB 1IV7A 1BVIA 5CLKA 2RBIA 5IEOA 1UI7A 3QRDA 3CCS3 1RGFA 2RNTA 2OCTA 3LH4A 5KP1A 1W4NA 1NNVA 3F7XA 1LOYA 5IERA 2CFGA 2W9PA 1IK3A 2ZL8A 3AGNA 1FGQA 1N9JA 1W6CA 4HOHA 1FA3A 4ORLA 2Y74A 5CK6A 4I4KA 2H0HA 1Q42A 1AV4A 1VQO3 1W6GA 3PYJA 2K54A 5BXQA 3V92A 1AQZA 3MG2A 4O02B 4FMBA 1D6ZA 5STDA 1YGEA 2XH9A 1ROVA 4LZIA 4NREA 4EXRA 5I97A 4RNYA 3DZLA 3HZPA 3X40A 1IVXA 1BSAA 1IVUA 1DMMA 1RCKA 1RTUA 2M7OA 3B7CA 4J9AA 2CFDA 4X2OA 8CHOA 4HYZA 3JUNA 1OHPA 3NX0A 1OH0A 1BSBA 3DMCA 1RRLA 1TRQA 1W2B2 1VQ93 5AIHA 1FUSA 2W2CA 1BRGA 5EQLA 1QAKA 3F8HA 5M19A 3MPHA 3EBYA 4GL6A 2GEXA 3GRDA 5IG0A 3SLUA 4ZM8A 1RLSA 3HK4A 3CNMA 4HZBB 2OTJ3 1W5ZA 3DH2A 4QWTA 1J2BA 1EQKA 3CCR3 1W6YA 5D81A 9RNTA 2C10A 2JQ5A 4OUQA 3FZWA 4R9KA 3CMA3 3KSPA 4XDVA 1D6YA 3EJVA 2V1LA 1JB4A 2FXTA 1FZUA 2CFWA 4J5KA 4N6UA 3X41A 1BNSA 3AGOA 1A2VA 1IT7A 2ML6A 1GMPA 3ER7A 2CG1A 1GOYA 3I0YA 3PCRA 4LYLB 3EN8A 2OWPA 6STDA 1RNBA 2GBWB 4J5GA 1UCLA 3G8ZA 3KIIA 2Z77A 1O7GB 1RDSA 1OPYA 4GSPA 1RMSA 3CCV3 1VQM3 5FGOA 1SQWA 1M1XB 3OV4A 1IDPA 3FH1A 1B21A 2UUGC 4STDA 1BGSA 1I2FA 2WOHA 3PCSA 2ML5A 2L4VA 1X1UA 5BIRA 3FSDA 1T2IA 2GBXB 3G16A 5IG4A 3EN1B 5RNTA 1C7HA 1JZOA 1ZX2A 3MKIA 1HU9A 3KZTA 2F5MA 1BAOA 1RKYA 1UUGB 5AEUB 1OHOA 4Q53A 1O7WB 3JUMA 1V58A 4HAAA 1ROAA 2A15A 1RGHA 1UDII 3Q1CA 1EA2A 5JBSA 1I8VA 3CC73 1YI23 3Q2PA 1OGZA 1GSPA 3EQQB 4H61A 1K734 2GSPA 5EEOA 1RGEA 4J8TA 4MMXB 3I563 3CC43 1G02A 1JBSA 4BTXA 2P0XA 4XBTA 2HMKB 5KP3A 1CEWI 2XRXB 5G2GA 4HM4B 3NBJA 1FGRA 3V98A 1HZ1A 2HMLB 3KCHA 1OF5A 1M9GA 3NM2A 3S28A 2LYXA 2R4IA 4AKYA 1VQL3 4N6NB 3EE1A 1VZZA 6GSPA 1GMRA 5HOHA 1YIJ3 1BNEA 4WFOA 4OK0A 3MG3A 5AIFA 3JUOA 2P09A 3K7CA 3NQZA 3BLZA 4O8SA 5A0OB 2KF5A 1W02A 3HX8A 5TGNA 4FCMA 1IVVA 2J8XB 2CX1A 3D4AA 2BT3A 1B20A 4XDWA 1G96A 3JVCA 3PGBA 4LEHA 8RNTA 3CC23 2HMJB 1BSDA 2AADA 3LT8A 4G1MB 2B24B 4KVHA 4U13A 5AYRB 3H3HA 1BRJA 3EF8A 4FCZA 3RGAA 1VQ83 2CC3A 3U97A 2XGLA 1U5OA 2KF3A 1MGWA 1Q40B 3F9SA 5GSPA 3VGNA 2W0QA 2RSXA 4RNZA 1ULIB 1R4YA 2HMMB 2OQEC 3Q3FA 3CME3 3AMOA 4K90B 4BTYA 1IQ8A 1OGXA 2O3OA 3PXMA 3G6E3 1JJ22 2MF7A 2QA43 1C54A 1VQ53 3FCSB 5JPUA 3LXUX 4GHOA 3HI7A 1NB5I 3ZG0A
chains in the Genus database with same CATH topology
1TRQA 1BNJA 1BU4A 1I70A 1RGGA 1FUSA 2BIRA 1BRGA 1RHLA 1ZGXA 1DETA 1BNGA 1B27A 1I3IA 1CH0A 2KF6A 1YNVX 1RGCA 1TRPA 1IYYA 3D5IA 1BSCA 1BNRA 1RLSA 3SYUA 1B2SA 1BSEA 1UCIA 2AAEA 3DH2A 1UCKA 5BU4A 1SARA 9RNTA 2KF4A 1LNIA 3BIRA 1YVSA 1I0XA 1JBRA 1FZUA 4J5KA 1BNSA 3AGOA 1GMPA 1FW7A 1GOYA 1RNBA 4J5GA 2BU4A 1UCLA 1HYFA 1RGAA 1RDSA 4GSPA 1TTOA 1BOXA 1RMSA 2C4BA 1GOUA 1UCJA 1B21A 1A2PA 4RNTA 1BGSA 1I2FA 1MGRA 1BRKA 1RN4A 2F5WA 1X1UA 1GOVA 5BIRA 1T2IA 6RNTA 5RNTA 2KAAA 3AHSA 1I3FA 2F5MA 1BAOA 1AY7A 3A5EA 4HAAA 1GMQA 1T2HA 1FUTA 1RGHA 3AHWA 1B2MA 1I8VA 1PYLA 1GSPA 2F4YA 2GSPA 1BNIA 1RGEA 1LOWA 1YGWA 1G02A 1FYSA 1X1WA 1JBSA 1RGLA 3URPA 1Q9EA 3DGYA 1DE3A 3GSPA 2HOHA 1JBTA 1I0VA 1BRHA 1PY3A 2F56A 1BUJA 1HZ1A 2SARA 3KCHA 1BRIA 3HOHA 1I2GA 1I2EA 1RNTA 7GSPA 6GSPA 1GMRA 5HOHA 4BIRA 1LRAA 1BANA 1RGKA 3D5GA 1BNEA 1BVIA 2RBIA 1RSNA 1RGFA 2RNTA 1B2XA 1LOYA 1X1YA 1BIRA 2KF5A 3AGNA 1B2UA 4HOHA 1BNFA 3WHOA 3D4AA 4BU4A 1BRNL 1B2ZA 1B20A 8RNTA 1BSDA 2AADA 3BU4A 1BRJA 1AQZA 1X1XA 1RN1A 2KF3A 1BRSA 1MGWA 1LOVA 5GSPA 1R4YA 3Q3FA 3RNTA 1RTUA 1BSAA 1RCLA 1RCKA 3WR2A 1B3SA 1C54A 7RNTA 1BSBA 2ZA4A 4GHOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TRQ A;  1BNJ A;  1BU4 A;  1I70 A;  1RGG A;  1FUS A;  2BIR A;  1BRG A;  1RHL A;  1ZGX A;  1DET A;  1BNG A;  1B27 A;  1I3I A;  1CH0 A;  2KF6 A;  1YNV X;  1RGC A;  1TRP A;  1IYY A;  3D5I A;  1BSC A;  1BNR A;  1RLS A;  3SYU A;  1B2S A;  1BSE A;  1UCI A;  2AAE A;  3DH2 A;  1UCK A;  5BU4 A;  1SAR A;  9RNT A;  2KF4 A;  1LNI A;  3BIR A;  1YVS A;  1I0X A;  1JBR A;  1FZU A;  4J5K A;  1BNS A;  3AGO A;  1GMP A;  1FW7 A;  1GOY A;  1RNB A;  4J5G A;  2BU4 A;  1UCL A;  1HYF A;  1RGA A;  1RDS A;  4GSP A;  1TTO A;  1BOX A;  1RMS A;  2C4B A;  1GOU A;  1UCJ A;  1B21 A;  1A2P A;  4RNT A;  1BGS A;  1I2F A;  1MGR A;  1BRK A;  1RN4 A;  2F5W A;  1X1U A;  1GOV A;  5BIR A;  1T2I A;  6RNT A;  5RNT A;  2KAA A;  3AHS A;  1I3F A;  2F5M A;  1BAO A;  1AY7 A;  3A5E A;  4HAA A;  1GMQ A;  1T2H A;  1FUT A;  1RGH A;  3AHW A;  1B2M A;  1I8V A;  1PYL A;  1GSP A;  2F4Y A;  2GSP A;  1BNI A;  1RGE A;  1LOW A;  1YGW A;  1G02 A;  1FYS A;  1X1W A;  1JBS A;  1RGL A;  3URP A;  1Q9E A;  3DGY A;  1DE3 A;  3GSP A;  2HOH A;  1JBT A;  1I0V A;  1BRH A;  1PY3 A;  2F56 A;  1BUJ A;  1HZ1 A;  2SAR A;  3KCH A;  1BRI A;  3HOH A;  1I2G A;  1I2E A;  1RNT A;  7GSP A;  6GSP A;  1GMR A;  5HOH A;  4BIR A;  1LRA A;  1BAN A;  1RGK A;  3D5G A;  1BNE A;  1BVI A;  2RBI A;  1RSN A;  1RGF A;  2RNT A;  1B2X A;  1LOY A;  1X1Y A;  1BIR A;  2KF5 A;  3AGN A;  1B2U A;  4HOH A;  1BNF A;  3WHO A;  3D4A A;  4BU4 A;  1BRN L;  1B2Z A;  1B20 A;  8RNT A;  1BSD A;  2AAD A;  3BU4 A;  1BRJ A;  1AQZ A;  1X1X A;  1RN1 A;  2KF3 A;  1BRS A;  1MGW A;  1LOV A;  5GSP A;  1R4Y A;  3Q3F A;  3RNT A;  1RTU A;  1BSA A;  1RCL A;  1RCK A;  3WR2 A;  1B3S A;  1C54 A;  7RNT A;  1BSB A;  2ZA4 A;  4GHO A; 
#chains in the Genus database with same CATH topology
 1R4C A;  2H0G A;  5IEP A;  3UJM A;  4EV5 A;  3EHC A;  1I70 A;  3LTA A;  4K61 A;  2BIR A;  1ZGX A;  3VSY A;  3WOD G;  1DET A;  3CCQ 3;  3CCL 3;  1TU5 A;  1CH0 A;  1RGC A;  1N8Q A;  1TRP A;  1W01 A;  3F8X A;  3OWU A;  4IPB A;  3UB1 A;  1JB2 A;  3SYU A;  1B2S A;  3NXJ A;  1BSE A;  1RJO A;  5M18 A;  3Q90 A;  3STD A;  1UUW B;  1V57 A;  1SAR A;  2D1W A;  4L8P A;  3WOF B;  4LMI A;  1LNI A;  1NU3 A;  2OTL 3;  4MMZ B;  1SII A;  1CYU A;  1G0T A;  3A76 A;  1K28 A;  1NJI 4;  2FGT A;  3TDG A;  1NO3 A;  1VQK 3;  4HBR A;  3LZA A;  4EW5 A;  4K1U A;  3CNX A;  3EBT A;  1LQG C;  3M8C A;  1FW7 A;  3SXX A;  4N6V 0;  3O8Y A;  1QJG A;  5M1A A;  1RN7 A;  4LSO A;  1AVL A;  3MHE A;  3EC9 A;  3FG1 A;  4MMY B;  3T0U A;  1IT8 A;  3FG3 A;  1O7P B;  1TTO A;  2B1X B;  2GU1 A;  4L8O A;  2BNG A;  3KE7 A;  5AYS C;  4JRF A;  4DKI A;  1VQ7 3;  1OAC A;  3SED A;  2KCD A;  1O7H B;  3AMO B;  4CPK A;  4I5Q A;  2XSO B;  4RNT A;  1PU4 A;  3G4S 3;  1QMA A;  1WMO A;  5D82 A;  4MJD A;  1E97 A;  1YHQ 3;  4R80 A;  1YVB I;  2IUK A;  1JN5 A;  2KXG A;  2W03 A;  2KAA A;  2XSH B;  2WGQ A;  1SPU A;  2Z6B A;  3FKA A;  1CYV A;  3A5E A;  5EVH A;  2P38 A;  4IT7 A;  1NB3 I;  3V99 A;  1T2H A;  1A67 A;  3F7S A;  1B2M A;  1W2Z A;  2GXF A;  4NHF A;  1IQY A;  3CXC 2;  3NUV A;  4OVM A;  1YIT 3;  3UL5 A;  2CFL A;  1SJW A;  4HVN A;  4AKZ A;  5CF1 A;  2C11 A;  3HIG A;  4R1K A;  1FYS A;  1X1W A;  3BND A;  1JKG A;  4CDL A;  2Q07 A;  1TUH A;  5JPP A;  1TFK A;  3KKG A;  3FF0 A;  2HOH A;  2XF3 A;  4WWU C;  1KD1 4;  1JBT A;  4EBG A;  5IW9 A;  1BRH A;  2QIY A;  1PY3 A;  2F56 A;  2W9Q A;  3HOH A;  3HII A;  4AEQ A;  3GZY B;  7GSP A;  4K1V A;  3BNC A;  1FGO A;  1VQ6 3;  3ZFZ A;  3NBB A;  2CHC A;  4WYK A;  1BAN A;  3D5G A;  5HGR A;  4MEI A;  1FGT A;  1RSN A;  1TIJ A;  4KFD A;  3CCJ 3;  1WQL B;  1STF I;  1MNL A;  1X1Y A;  2XFS A;  1BIR A;  4JF8 A;  3LYG A;  3N8B A;  2P05 A;  1B2U A;  4N6M A;  5LC7 A;  3U1W A;  1BNF A;  3BB9 A;  1JN5 B;  4BU4 A;  1B2Z A;  1DMQ A;  5AIG A;  1LNH A;  1WTH A;  3BU4 A;  3J7Y d;  3UL6 A;  1X1X A;  4O3V A;  5IEN A;  1RN1 A;  2W04 A;  1LOV A;  2H0I A;  1BUQ A;  2CX0 A;  2ZDJ A;  3WDG B;  1PFP A;  3D3L A;  3DGL A;  2K3D A;  1RCL A;  4HKV B;  3RDE A;  4XBX A;  3CPW 2;  3CU3 A;  1JKG B;  4XM4 A;  3GWR A;  2YFL B;  4R9L A;  1EG9 B;  7RNT A;  2ZA4 A;  3JUQ A;  1T3B A;  1QVG 2;  3SVA A;  1BU4 A;  4IIA A;  1IVW A;  3MYT A;  3FLJ A;  3SX1 A;  1BNG A;  4L7K A;  3CCU 3;  1I3I A;  2IUJ A;  4EYC A;  1YNV X;  1Q86 4;  1E3R A;  4CJN A;  3MWZ A;  4N6T A;  1BNR A;  2F86 B;  2CK3 H;  2L1S A;  4FCJ A;  1UCI A;  1UCK A;  3G71 3;  3CD6 3;  3S29 A;  3E99 A;  3WA3 A;  1DYU A;  1LVN A;  2KF4 A;  1V74 A;  3H51 A;  3BIR A;  1K41 A;  1DMN A;  1YVS A;  2F98 A;  1YJN 3;  1N8R 4;  1I0X A;  3PS8 A;  3CCM 3;  3F14 A;  1HKX A;  4FR9 A;  1QAL A;  3NQY A;  2IA7 A;  2O9U X;  3IPT A;  2BMO B;  3X3Z A;  2WO0 A;  4FMD A;  3BNE A;  4XB5 A;  3WMD A;  1Q81 4;  3RGR A;  2BU4 A;  3EB8 A;  5D83 A;  3DXO A;  5ELU A;  1IQX A;  1BOX A;  1OF5 B;  1UW1 A;  2E2T A;  2C4B A;  2Z76 A;  5G1K A;  4XBY A;  3LTD A;  2CWV A;  1GOU A;  1OHS A;  3T8N A;  3B8L A;  2P0M A;  4GB5 A;  5FW5 A;  1MWT A;  1E3V A;  3GZX B;  4BL2 A;  5BVB A;  1A90 A;  1MOL A;  3VF1 A;  2HMN B;  1MGR A;  4HM8 B;  1RN4 A;  2GEY A;  2RFR A;  1GOV A;  2XR8 B;  3MG1 A;  3DM8 A;  1EKM A;  1VQP 3;  1FUW A;  1LXE A;  1MWS A;  1I3F A;  5G1L A;  1DVD A;  2GU3 A;  1AY7 A;  2D42 A;  4HM6 B;  3DGN A;  3AHW A;  5AEW B;  2K0M A;  1DVC A;  1PYL A;  3K5T A;  3PZW A;  2WGO A;  3LOY A;  1VQ4 3;  2E2U A;  1LOW A;  2Y73 A;  1RGL A;  3KSE D;  5CXO A;  3URP A;  1WMN A;  2W56 A;  2XGN A;  1ZS7 A;  3B4O A;  1DE3 A;  2RCD A;  3SOA A;  1N5H A;  1GS3 A;  1UI8 A;  1Y4K A;  3GSP A;  2BMQ B;  4R4K A;  1ASK A;  1I0V A;  3WOE B;  1JV2 B;  1KSI A;  1BUJ A;  1W7C A;  2SAR A;  3GAX A;  3FF2 A;  1M90 4;  2BMR B;  3EX9 A;  1I2G A;  1I2E A;  3NBR A;  1RNT A;  2I9W A;  1T5Y A;  1VQQ A;  3G0K A;  3K9M C;  4BIR A;  1LRA A;  1N5P A;  1RGK A;  2CWT A;  3KN4 A;  5AI1 A;  1A2K A;  4X2H A;  1GD4 A;  2OQE A;  2CG0 A;  4N3V A;  3ZG5 A;  2XEP A;  1B2X A;  4WP5 A;  2HMO B;  4HM5 B;  1S5A A;  1IV9 A;  2FNQ A;  3GZB A;  1Q82 4;  1EUI C;  3DUK A;  3WHO A;  4EC6 A;  2PZV A;  1BRN L;  1LOX A;  2OOV C;  5KP4 A;  5ELJ A;  3OXA A;  4HZ9 B;  2MC8 A;  3D79 A;  3OWS A;  4NPB A;  1FGM A;  2CWU A;  3BNB A;  2KRT A;  2INX A;  3IMA B;  4KFE A;  3SOY A;  1AVK A;  4WHA A;  1KWI A;  1F8N A;  1BRS A;  4CCV A;  2IMJ A;  5DRE A;  1WMP A;  1WNH A;  3K63 A;  1JB5 A;  1K8A 4;  5CF2 A;  1NDO B;  1QVF 2;  3NHX A;  3RNT A;  3X42 A;  2YFJ B;  3N9H A;  3JUP A;  3OWY A;  2R41 A;  5LC6 A;  1B3S A;  1SIH A;  5IG3 A;  1KC8 4;  2W56 B;  3LTC A;  1ISK A;  1MWU A;  3WA2 X;  1ZO2 A;  1JZD A;  3LML A;  2WOF A;  2CKF B;  1BNJ A;  3DGO A;  4HM7 B;  2E2V A;  1RGG A;  4HM1 B;  2UX0 A;  1RHL A;  2RGQ A;  2YX9 A;  3DGM A;  1O7N B;  3B4P A;  4H3U A;  1B27 A;  3F40 A;  2STD A;  1M1K 4;  2KF6 A;  3FG4 A;  4KT3 B;  1L5G B;  2QGU A;  3K0Z A;  2BHM A;  1IYY A;  3D5I A;  4HM2 B;  3QK9 A;  1BSC A;  2F99 A;  3N54 B;  2LQV A;  1EEJ A;  4KZ1 A;  4O2H A;  3S27 A;  1K9M 4;  3S67 A;  4EV2 A;  2AAE A;  3NV0 A;  3WR2 A;  5BU4 A;  1LQM B;  2QEX 3;  1TP6 A;  1Q7H A;  4HJL B;  4FMA A;  1GY5 A;  1S72 3;  1GY7 A;  4RBN A;  1AR0 A;  4BL3 A;  1JBR A;  1UGH I;  2CH9 A;  1U8C B;  3DY5 A;  3GZR A;  1UGI A;  1ULJ B;  1Q40 A;  3D9R A;  5IF6 A;  1JNQ A;  3OX9 A;  3LT9 A;  1HYF A;  3CCE 3;  4HM0 B;  1RGA A;  2BO9 B;  3IJE B;  4TX4 A;  1GYB A;  1Z1S A;  3X3Y A;  1VQN 3;  3MSO A;  4RZM A;  1UCJ A;  3I55 3;  2OOV A;  1A2P A;  3CPO A;  2CFK A;  4WYK B;  2SBL A;  4FMC A;  1BRK A;  2F5W A;  5AII A;  6RNT A;  4BTW A;  3AHS A;  2IY2 A;  4LGQ A;  1D6U A;  2JDI H;  3OW2 2;  4KFF A;  1GMQ A;  1NWW A;  1UUV B;  3X3X A;  1FUT A;  1US1 A;  3KFQ C;  3T8U A;  2XFT A;  1IU7 A;  1CQS A;  1GY6 A;  1MWR A;  1STD A;  1QAF A;  1N9E A;  2F4Y A;  1BNI A;  3NV0 B;  3LTB A;  1YGW A;  3ECF A;  1KQS 2;  3NM7 A;  4N6O B;  4PEJ A;  2YFI B;  4ILF A;  1Q9E A;  2CW9 A;  3DGY A;  1O7M B;  1RRH A;  2CIU A;  3UNL A;  3L0R A;  7STD A;  1JRQ A;  2W6J H;  3ROB A;  5DRV A;  2PNC A;  1TFO A;  3FGY A;  1YJW 3;  1Q7Y 4;  1YJ9 3;  1W00 A;  1BRI A;  4N6L A;  2IYJ A;  1OCV A;  4HM3 B;  2Z7A A;  5IG5 A;  3ALA A;  1TJD A;  2UGI A;  1GD3 A;  1OUN A;  3S5C A;  2ZHX B;  1IV7 A;  1BVI A;  5CLK A;  2RBI A;  5IEO A;  1UI7 A;  3QRD A;  3CCS 3;  1RGF A;  2RNT A;  2OCT A;  3LH4 A;  5KP1 A;  1W4N A;  1NNV A;  3F7X A;  1LOY A;  5IER A;  2CFG A;  2W9P A;  1IK3 A;  2ZL8 A;  3AGN A;  1FGQ A;  1N9J A;  1W6C A;  4HOH A;  1FA3 A;  4ORL A;  2Y74 A;  5CK6 A;  4I4K A;  2H0H A;  1Q42 A;  1AV4 A;  1VQO 3;  1W6G A;  3PYJ A;  2K54 A;  5BXQ A;  3V92 A;  1AQZ A;  3MG2 A;  4O02 B;  4FMB A;  1D6Z A;  5STD A;  1YGE A;  2XH9 A;  1ROV A;  4LZI A;  4NRE A;  4EXR A;  5I97 A;  4RNY A;  3DZL A;  3HZP A;  3X40 A;  1IVX A;  1BSA A;  1IVU A;  1DMM A;  1RCK A;  1RTU A;  2M7O A;  3B7C A;  4J9A A;  2CFD A;  4X2O A;  8CHO A;  4HYZ A;  3JUN A;  1OHP A;  3NX0 A;  1OH0 A;  1BSB A;  3DMC A;  1RRL A;  1TRQ A;  1W2B 2;  1VQ9 3;  5AIH A;  1FUS A;  2W2C A;  1BRG A;  5EQL A;  1QAK A;  3F8H A;  5M19 A;  3MPH A;  3EBY A;  4GL6 A;  2GEX A;  3GRD A;  5IG0 A;  3SLU A;  4ZM8 A;  1RLS A;  3HK4 A;  3CNM A;  4HZB B;  2OTJ 3;  1W5Z A;  3DH2 A;  4QWT A;  1J2B A;  1EQK A;  3CCR 3;  1W6Y A;  5D81 A;  9RNT A;  2C10 A;  2JQ5 A;  4OUQ A;  3FZW A;  4R9K A;  3CMA 3;  3KSP A;  4XDV A;  1D6Y A;  3EJV A;  2V1L A;  1JB4 A;  2FXT A;  1FZU A;  2CFW A;  4J5K A;  4N6U A;  3X41 A;  1BNS A;  3AGO A;  1A2V A;  1IT7 A;  2ML6 A;  1GMP A;  3ER7 A;  2CG1 A;  1GOY A;  3I0Y A;  3PCR A;  4LYL B;  3EN8 A;  2OWP A;  6STD A;  1RNB A;  2GBW B;  4J5G A;  1UCL A;  3G8Z A;  3KII A;  2Z77 A;  1O7G B;  1RDS A;  1OPY A;  4GSP A;  1RMS A;  3CCV 3;  1VQM 3;  5FGO A;  1SQW A;  1M1X B;  3OV4 A;  1IDP A;  3FH1 A;  1B21 A;  2UUG C;  4STD A;  1BGS A;  1I2F A;  2WOH A;  3PCS A;  2ML5 A;  2L4V A;  1X1U A;  5BIR A;  3FSD A;  1T2I A;  2GBX B;  3G16 A;  5IG4 A;  3EN1 B;  5RNT A;  1C7H A;  1JZO A;  1ZX2 A;  3MKI A;  1HU9 A;  3KZT A;  2F5M A;  1BAO A;  1RKY A;  1UUG B;  5AEU B;  1OHO A;  4Q53 A;  1O7W B;  3JUM A;  1V58 A;  4HAA A;  1ROA A;  2A15 A;  1RGH A;  1UDI I;  3Q1C A;  1EA2 A;  5JBS A;  1I8V A;  3CC7 3;  1YI2 3;  3Q2P A;  1OGZ A;  1GSP A;  3EQQ B;  4H61 A;  1K73 4;  2GSP A;  5EEO A;  1RGE A;  4J8T A;  4MMX B;  3I56 3;  3CC4 3;  1G02 A;  1JBS A;  4BTX A;  2P0X A;  4XBT A;  2HMK B;  5KP3 A;  1CEW I;  2XRX B;  5G2G A;  4HM4 B;  3NBJ A;  1FGR A;  3V98 A;  1HZ1 A;  2HML B;  3KCH A;  1OF5 A;  1M9G A;  3NM2 A;  3S28 A;  2LYX A;  2R4I A;  4AKY A;  1VQL 3;  4N6N B;  3EE1 A;  1VZZ A;  6GSP A;  1GMR A;  5HOH A;  1YIJ 3;  1BNE A;  4WFO A;  4OK0 A;  3MG3 A;  5AIF A;  3JUO A;  2P09 A;  3K7C A;  3NQZ A;  3BLZ A;  4O8S A;  5A0O B;  2KF5 A;  1W02 A;  3HX8 A;  5TGN A;  4FCM A;  1IVV A;  2J8X B;  2CX1 A;  3D4A A;  2BT3 A;  1B20 A;  4XDW A;  1G96 A;  3JVC A;  3PGB A;  4LEH A;  8RNT A;  3CC2 3;  2HMJ B;  1BSD A;  2AAD A;  3LT8 A;  4G1M B;  2B24 B;  4KVH A;  4U13 A;  5AYR B;  3H3H A;  1BRJ A;  3EF8 A;  4FCZ A;  3RGA A;  1VQ8 3;  2CC3 A;  3U97 A;  2XGL A;  1U5O A;  2KF3 A;  1MGW A;  1Q40 B;  3F9S A;  5GSP A;  3VGN A;  2W0Q A;  2RSX A;  4RNZ A;  1ULI B;  1R4Y A;  2HMM B;  2OQE C;  3Q3F A;  3CME 3;  3AMO A;  4K90 B;  4BTY A;  1IQ8 A;  1OGX A;  2O3O A;  3PXM A;  3G6E 3;  1JJ2 2;  2MF7 A;  2QA4 3;  1C54 A;  1VQ5 3;  3FCS B;  5JPU A;  3LXU X;  4GHO A;  3HI7 A;  1NB5 I;  3ZG0 A; 
#chains in the Genus database with same CATH homology
 1TRQ A;  1BNJ A;  1BU4 A;  1I70 A;  1RGG A;  1FUS A;  2BIR A;  1BRG A;  1RHL A;  1ZGX A;  1DET A;  1BNG A;  1B27 A;  1I3I A;  1CH0 A;  2KF6 A;  1YNV X;  1RGC A;  1TRP A;  1IYY A;  3D5I A;  1BSC A;  1BNR A;  1RLS A;  3SYU A;  1B2S A;  1BSE A;  1UCI A;  2AAE A;  3DH2 A;  1UCK A;  5BU4 A;  1SAR A;  9RNT A;  2KF4 A;  1LNI A;  3BIR A;  1YVS A;  1I0X A;  1JBR A;  1FZU A;  4J5K A;  1BNS A;  3AGO A;  1GMP A;  1FW7 A;  1GOY A;  1RNB A;  4J5G A;  2BU4 A;  1UCL A;  1HYF A;  1RGA A;  1RDS A;  4GSP A;  1TTO A;  1BOX A;  1RMS A;  2C4B A;  1GOU A;  1UCJ A;  1B21 A;  1A2P A;  4RNT A;  1BGS A;  1I2F A;  1MGR A;  1BRK A;  1RN4 A;  2F5W A;  1X1U A;  1GOV A;  5BIR A;  1T2I A;  6RNT A;  5RNT A;  2KAA A;  3AHS A;  1I3F A;  2F5M A;  1BAO A;  1AY7 A;  3A5E A;  4HAA A;  1GMQ A;  1T2H A;  1FUT A;  1RGH A;  3AHW A;  1B2M A;  1I8V A;  1PYL A;  1GSP A;  2F4Y A;  2GSP A;  1BNI A;  1RGE A;  1LOW A;  1YGW A;  1G02 A;  1FYS A;  1X1W A;  1JBS A;  1RGL A;  3URP A;  1Q9E A;  3DGY A;  1DE3 A;  3GSP A;  2HOH A;  1JBT A;  1I0V A;  1BRH A;  1PY3 A;  2F56 A;  1BUJ A;  1HZ1 A;  2SAR A;  3KCH A;  1BRI A;  3HOH A;  1I2G A;  1I2E A;  1RNT A;  7GSP A;  6GSP A;  1GMR A;  5HOH A;  4BIR A;  1LRA A;  1BAN A;  1RGK A;  3D5G A;  1BNE A;  1BVI A;  2RBI A;  1RSN A;  1RGF A;  2RNT A;  1B2X A;  1LOY A;  1X1Y A;  1BIR A;  2KF5 A;  3AGN A;  1B2U A;  4HOH A;  1BNF A;  3WHO A;  3D4A A;  4BU4 A;  1BRN L;  1B2Z A;  1B20 A;  8RNT A;  1BSD A;  2AAD A;  3BU4 A;  1BRJ A;  1AQZ A;  1X1X A;  1RN1 A;  2KF3 A;  1BRS A;  1MGW A;  1LOV A;  5GSP A;  1R4Y A;  3Q3F A;  3RNT A;  1RTU A;  1BSA A;  1RCL A;  1RCK A;  3WR2 A;  1B3S A;  1C54 A;  7RNT A;  1BSB A;  2ZA4 A;  4GHO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...