2ZA4A

Crystal structural analysis of barnase-barstar complex
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
108
structure length
108
Chain Sequence
VINTFDGVADYLQTYHKLPDNYITKSEAQALGWVASKGNLADVAPGKSIGGDIFSNREGKLPGKSGRTWREADINYTSGFRNSDRILYSSDWLIYATTDHYQTFTKIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structural analysis of protein-protein interactions drastically destabilized by a single mutation
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Ribonuclease
total genus 33
structure length 108
sequence length 108
chains with identical sequence C
ec nomenclature ec 3.1.27.-:
pdb deposition date 2007-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 2za4A00
1B20A 2HOHA 6RNTA 1HZ1A 3A5EA 2KF6A 1FZUA 3WHOA 1I70A 1PYLA 1JBSA 1BRSA 1RGKA 1RGHA 3D5GA 1AY7A 2AADA 2GSPA 1RGFA 1BNSA 3WR2A 1RDSA 6GSPA 1RHLA 1X1YA 1BSEA 1FUSA 1GMRA 5HOHA 1T2HA 1BUJA 1YGWA 2KF5A 1BRIA 2KF3A 1HYFA 2RNTA 1LOYA 1LNIA 1CH0A 5BU4A 3KCHA 1X1UA 1RMSA 2RBIA 4GSPA 1I0VA 2C4BA 5RNTA 2F4YA 1BSAA 4J5KA 3D4AA 2KAAA 1RNBA 1RTUA 3DH2A 1RGEA 1MGRA 2F5WA 1GOUA 3AHSA 1BNEA 1RGGA 1BNFA 7RNTA 1BSDA 1BRGA 4J5GA 3BIRA 1B3SA 1GMQA 1X1XA 3DGYA 1RNTA 1TRPA 1UCIA 1FW7A 1DETA 1FYSA 1I2FA 1R4YA 4RNTA 3URPA 1GOYA 1MGWA 3AGOA 1X1WA 3GSPA 1BRJA 4BIRA 1I0XA 4BU4A 4HOHA 1LRAA 1BRHA 1I2GA 1LOVA 1UCLA 1YVSA 1RLSA 1RN1A 1GOVA 1UCKA 1IYYA 1I3FA 1B2XA 1BRKA 3AGNA 1C54A 2KF4A 1BRNL 4HAAA 1DE3A 5GSPA 1GSPA 1FUTA 1BNRA 1BNJA 3SYUA 3RNTA 1RGLA 9RNTA 1RSNA 1SARA 1RCLA 1Q9EA 1I3IA 1ZGXA 3Q3FA 1YNVX 1BGSA 1BANA 3HOHA 1B2UA 2BU4A 1UCJA 3AHWA 1RGCA 3BU4A 4GHOA 1JBRA 1BSCA 1TRQA 1BOXA 1G02A 5BIRA 1I2EA 2BIRA 1BNGA 1PY3A 1JBTA 1BAOA 2F56A 7GSPA 1BIRA 1B27A 1TTOA 1BNIA 1I8VA 1LOWA 2SARA 1BVIA 1GMPA 2F5MA 1RGAA 1B21A 2AAEA 1AQZA 1RN4A 1T2IA 1BU4A 8RNTA 1BSBA 1A2PA 1B2ZA 2ZA4A 3D5IA 1B2MA 1RCKA 1B2SA
chains in the Genus database with same CATH superfamily
4IT7A 2SBLA 1UW1A 6RNTA 3I563 5G1LA 3PCRA 5JBSA 1DVDA 3ER7A 4O2HA 4R9KA 3HIGA 2WOHA 3EX9A 1JNQA 1MNLA 2CX1A 4OUQA 5D82A 1I70A 2BMQB 1M1K4 1PYLA 2W0QA 3AMOA 1Q814 3LMLA 1Y4KA 5IENA 2HMNB 3D5GA 4FMCA 2CG0A 5IF6A 4GL6A 2MF7A 3GRDA 1VQ73 2H0HA 1ZO2A 4LEHA 1W02A 4CCVA 1FUSA 4L8OA 1BUJA 1TJDA 1IU7A 3X3XA 1C7HA 4HBRA 2RNTA 1N5PA 1LNIA 1SJWA 2KXGA 5AEWB 5AYSC 2CFKA 1DMQA 3BNEA 3VF1A 1ROAA 3CCR3 3CNMA 3S29A 4EBGA 2C4BA 5AI1A 1K28A 3U97A 3O8YA 4CPKA 1VQP3 2IMJA 2QGUA 4FCJA 5EVHA 2YFIB 3VGNA 4TX4A 1PU4A 3BNBA 1RGEA 1GOUA 3FF2A 1VQO3 4N6TA 1N9JA 1UGIA 1BRGA 1V57A 3CNXA 4J5GA 3BIRA 2HMKB 2K3DA 1GS3A 1X1XA 2CH9A 3X41A 1G96A 2L4VA 2W9QA 5M18A 1A67A 1VQK3 3NV0B 4MJDA 4N6LA 1A90A 3PCSA 1WMOA 3Q2PA 3URPA 2ML5A 3EBTA 4RZMA 2UX0A 3AGOA 1X1WA 3Q1CA 3RDEA 2YFLB 5I97A 3DGMA 5EQLA 4BIRA 1WQLB 4XBYA 4HOHA 2BO9B 1I2GA 1OH0A 5CLKA 3STDA 1LNHA 1RN1A 1GOVA 1VQ93 3VSYA 1B2XA 4WWUC 5G2GA 3MSOA 4AKYA 1Q7HA 3M8CA 4FCZA 5JPPA 4EW5A 1UUWB 3SOYA 1TFOA 4U13A 1DE3A 3KN4A 3G6E3 3H3HA 4WYKB 2LQVA 3PS8A 3LTBA 3ZG5A 1EKMA 1Q864 1RGLA 2XRXB 3CMA3 1EG9B 2XSOB 1RSNA 2O9UX 3S28A 1K8A4 1I3IA 1ZGXA 1BGSA 2ZL8A 4CJNA 1W2ZA 4N6NB 2W04A 2Y74A 3AHWA 1JKGB 3BU4A 1RGCA 1JBRA 2GU3A 4H3UA 5TGNA 5AEUB 1TRQA 2HMMB 3BLZA 3U1WA 1I2EA 4HZBB 4O02B 3GZYB 5BIRA 4L8PA 3IPTA 1LVNA 1OHSA 1JBTA 1BAOA 1OHPA 4PEJA 4LSOA 3NV0A 3LH4A 1VZZA 1OF5B 2XFTA 2CWUA 3HI7A 1NDOB 2SARA 1BVIA 1GMPA 2C11A 1Q42A 2OQEA 3EBYA 7STDA 1AQZA 1O7PB 1T2IA 5A0OB 4STDA 3DMCA 1STDA 3DGNA 3D5IA 4OK0A 3LZAA 1B2MA 2F86B 1B2SA 2OTL3 3NX0A 1B20A 2I9WA 1AVLA 3EN8A 1HKXA 3A5EA 2KF6A 1FA3A 1K41A 1PFPA 3NHXA 2BMOB 2FGTA 5M1AA 1VQM3 4OVMA 3FCSB 5AIGA 3OWSA 1GYBA 1M1XB 3FKAA 1IT8A 4HM4B 4R1KA 5IG3A 3G4S3 2W03A 5ELUA 1JBSA 1RGKA 1RGHA 3B4PA 1AY7A 1O7HB 1UDII 2AADA 1YJ93 1ISKA 3ROBA 1TP6A 1IQXA 1BNSA 3WR2A 3V98A 6GSPA 2OOVC 3DM8A 1RHLA 2CFWA 1BSEA 3GWRA 3SVAA 1IVVA 1GMRA 2Q07A 1YGWA 4KVHA 2KF5A 3F9SA 1W5ZA 1O7MB 3CU3A 1W6GA 3JUOA 4R9LA 1K9M4 4I5QA 4JRFA 1Q824 4XB5A 3KCHA 3EJVA 1RMSA 3S27A 3MWZA 3NQZA 2RBIA 4O8SA 1MWTA 1GY6A 1KSIA 4L7KA 3K63A 4GSPA 5FW5A 1DVCA 3WOEB 2CWTA 5RNTA 3I553 1FGRA 1NNVA 1N5HA 2A15A 1IT7A 3UL5A 1STFI 2OTJ3 5D81A 1AV4A 2KAAA 1RTUA 3N8BA 3JUPA 1MGRA 3FSDA 2F5WA 2Z76A 3JUMA 3AHSA 1BNEA 3DGOA 3L0RA 3LYGA 3FLJA 2R4IA 1MOLA 2MC8A 3LTDA 2E2TA 3CPOA 4JF8A 1GY7A 2GU1A 3UB1A 1B3SA 2HMOB 1RNTA 3CCS3 2BT3A 3KSED 2E2VA 1UCIA 3FG1A 4J8TA 3QRDA 1DETA 2Z77A 3G0KA 2F98A 1RRHA 1A2VA 3CCE3 5LC7A 5KP4A 3T8UA 3LTCA 1EA2A 3NQYA 3TDGA 4HM7B 3WOFB 2CC3A 3CCJ3 3GSPA 2LYXA 1ZX2A 3F7SA 4QWTA 1JB5A 5AYRB 4WFOA 3FG4A 2JQ5A 1CYVA 1US1A 3N9HA 1JB4A 1BRHA 4BTYA 5IEOA 1LOVA 4N3VA 1OPYA 1IYYA 1UCKA 3OW22 2CG1A 2RFRA 1BRKA 2JDIH 3AGNA 4K90B 5AIIA 1CYUA 1JZDA 2M7OA 3GZRA 1IV7A 2H0IA 2OOVA 1C54A 4IIAA 3MKIA 1BRNL 4HAAA 1CEWI 1JN5A 2UGIA 1TU5A 2RSXA 5GSPA 1GSPA 1FUTA 2J8XB 3MG1A 2XH9A 3SYUA 2W56A 1MWRA 3K7CA 4K1VA 3SX1A 1FGMA 2OWPA 4IPBA 2IUJA 9RNTA 1VQ53 1QVF2 4HM8B 1J2BA 2Z6BA 1NU3A 1BUQA 6STDA 3F8XA 1GY5A 1YNVX 4R4KA 4N6OB 1TIJA 4H61A 3EF8A 1UCJA 4GHOA 1OHOA 2CK3H 1O7WB 1VQ43 1BSCA 4ORLA 1BOXA 1G02A 4MMZB 2BIRA 1BNGA 1MWUA 4MMXB 2XGNA 3CCU3 4LGQA 1U8CB 1PY3A 3KE7A 1W2B2 1TUHA 1UI8A 5HGRA 2CFLA 3NXJA 1JN5B 1N8QA 3EE1A 2CW9A 4N6V0 5BVBA 2F5MA 3MPHA 1RGAA 1RN4A 2YX9A 3F14A 3HZPA 2D1WA 5EEOA 1D6YA 2W9PA 1BSBA 1A2PA 2IUKA 2ZHXB 1E3VA 1S5AA 3F7XA 3OV4A 3DUKA 3WODG 5STDA 3NBJA 1L5GB 3Q90A 4LMIA 2UUGC 5CF2A 3OX9A 3PGBA 3N54B 4FMAA 1BRSA 1OGZA 3EQQB 3G8ZA 4HZ9B 2GSPA 5IG4A 4HJLB 3V99A 2B1XB 1K734 1W6CA 1V74A 1VQQA 1M904 1N9EA 1X1YA 2XEPA 1IV9A 2CFGA 5HOHA 1YIT3 1SQWA 3DZLA 1BRIA 3OWUA 2YFJB 4MEIA 1LOYA 1WNHA 5BU4A 1ROVA 1X1UA 3JVCA 1YIJ3 3ZG0A 4BL2A 2WOFA 1Q40B 5IG5A 3NM2A 2W56B 3CCM3 1I0VA 5KP1A 3I0YA 2INXA 2XR8B 1DYUA 1W00A 2CWVA 1DMNA 4KZ1A 3CXC2 4XDWA 1R4CA 3D4AA 2W2CA 3FG3A 1YI23 3UJMA 5G1KA 3DH2A 3G713 5IERA 2QIYA 4FR9A 1RGGA 1BNFA 7RNTA 4NHFA 1W6YA 1YGEA 2O3OA 4EV5A 5LC6A 1FUWA 4AKZA 1QALA 3DGYA 5M19A 1M9GA 3B7CA 3IJEB 3NM7A 3OXAA 5CF1A 1FGTA 1T3BA 1KC84 3WA2X 3LXUX 2XFSA 3CD63 2GEXA 1OF5A 4RNTA 4EYCA 3GZXB 2B24B 1GOYA 1LQGC 1RN7A 4HM2B 5CK6A 3JUNA 2P0XA 4CDLA 1VQL3 4EC6A 1WMNA 2KRTA 3GZBA 3PXMA 4BU4A 3FZWA 3CCL3 1UCLA 1YVSA 1KQS2 1RLSA 4ZM8A 2STDA 2QA43 1I3FA 4HM6B 1YJW3 5AIFA 2F99A 4BL3A 2K54A 2L1SA 3BB9A 1GD4A 3ALAA 1Z1SA 1W4NA 3ECFA 5IG0A 2RGQA 2ZDJA 1NO3A 2WO0A 3FF0A 4HVNA 4K61A 1BNJA 4KFFA 4LZIA 3EHCA 2RCDA 3K9MC 1SARA 4HM5B 1RCLA 2CX0A 1Q9EA 3LTAA 4HKVB 3RGRA 3Q3FA 1SPUA 3KFQC 1BANA 1GD3A 1KWIA 4KFDA 1VQ83 3HOHA 1W7CA 5DREA 3PZWA 4ILFA 1G0TA 3LOYA 1TFKA 3UL6A 2IA7A 3JUQA 1EEJA 3H51A 1O7GB 1N8R4 4RNYA 3X42A 2P0MA 2V1LA 3D79A 3WA3A 2BHMA 1EUIC 3HIIA 3T0UA 1AR0A 1QMAA 2F56A 2P09A 3X3ZA 1TTOA 4BTXA 1BNIA 3NUVA 2W6JH 3PYJA 4KFEA 4EXRA 2XF3A 1LOWA 4NPBA 2PZVA 1ASKA 1B21A 2AAEA 2PNCA 3D3LA 3S5CA 1V58A 1B2ZA 3X3YA 2IYJA 1RCKA 1I8VA 2GBWB 3SEDA 2HOHA 3MHEA 4GB5A 4XBTA 1T5YA 1HZ1A 1YHQ3 1FZUA 3CCQ3 3WHOA 1W01A 2D42A 3KIIA 4X2HA 4G1MB 1Q40A 3A76A 1OGXA 3F8HA 1U5OA 1RRLA 3LT8A 1QJGA 2K0MA 3SXXA 1RGFA 3CC43 4FCMA 1S723 5DRVA 1RDSA 1VQN3 2CHCA 2XGLA 1JJ22 2Y73A 3LT9A 1T2HA 1ULJB 2C10A 3DY5A 3FGYA 2KF3A 2CKFB 4LYLB 3X40A 1HYFA 2HMLB 2BNGA 1CQSA 1CH0A 1D6ZA 3KSPA 3DGLA 1OCVA 4J9AA 2H0GA 2XSHB 3CME3 1WTHA 4FMBA 3HK4A 2WGOA 4N6MA 1EQKA 3CC23 4X2OA 1DMMA 1YVBI 3KZTA 1JV2B 2F4YA 1IDPA 3WDGB 3T8NA 1BSAA 4J5KA 4DKIA 1RNBA 4R80A 1UI7A 1FGOA 3FH1A 1JKGA 3UNLA 1BSDA 1JRQA 3MYTA 1MWSA 1UUVB 1UUGB 3MG2A 1UGHI 3HX8A 4RBNA 1NJI4 1LQMB 1GMQA 3CCV3 1D6UA 1RJOA 1TRPA 2OQEC 3S67A 1IVUA 3B4OA 1FW7A 4WYKA 5ELJA 3EB8A 1LXEA 1FYSA 1I2FA 3AMOB 1R4YA 5JPUA 1O7NB 1QAKA 3D9RA 2FNQA 2ML6A 1OACA 4AEQA 2P05A 5KP3A 8CHOA 1F8NA 4HM1B 4BTWA 5CXOA 1MGWA 4N6UA 1OUNA 1HU9A 2BMRB 1NB5I 2IY2A 3G16A 3WMDA 1ULIB 3SOAA 1IQYA 1BRJA 3ZFZA 3K5TA 1I0XA 3NBBA 3OWYA 2OCTA 3QK9A 4WP5A 3SLUA 1LRAA 1LOXA 3BNDA 4HM3B 2QEX3 1KD14 1QAFA 1FGQA 1SIHA 5AIHA 1SIIA 3V92A 2KF4A 4HM0B 2WGQA 3KKGA 5BXQA 1JZOA 3CPW2 4EV2A 3GAXA 1QVG2 2FXTA 1IK3A 1BNRA 1JB2A 4O3VA 2E2UA 3BNCA 3RNTA 3K0ZA 5IW9A 3CC73 3B8LA 1NWWA 1E3RA 2P38A 5D83A 3NBRA 1WMPA 4XBXA 1YJN3 1A2KA 3E99A 2R41A 3MG3A 4MMYB 3IMAB 1B2UA 2BU4A 2GXFA 1IQ8A 3F40A 4KT3B 4XM4A 1Q7Y4 4WHAA 3J7Yd 4I4KA 4RNZA 3EC9A 3RGAA 1BIRA 1B27A 7GSPA 4NREA 1RKYA 5IEPA 1IVXA 2CFDA 1ZS7A 1AVKA 3EN1B 2Z7AA 1E97A 4XDVA 1VQ63 1BU4A 8RNTA 2HMJB 5FGOA 2GEYA 3DXOA 4HYZA 2CIUA 2ZA4A 1IVWA 1NB3I 2GBXB 2KCDA 4FMDA 4K1UA 4Q53A
chains in the Genus database with same CATH topology
1B20A 2HOHA 6RNTA 1HZ1A 3A5EA 2KF6A 1FZUA 3WHOA 1I70A 1PYLA 1JBSA 1BRSA 1RGKA 1RGHA 3D5GA 1AY7A 2AADA 2GSPA 1RGFA 1BNSA 3WR2A 1RDSA 6GSPA 1RHLA 1X1YA 1BSEA 1FUSA 1GMRA 5HOHA 1T2HA 1BUJA 1YGWA 2KF5A 1BRIA 2KF3A 1HYFA 2RNTA 1LOYA 1LNIA 1CH0A 5BU4A 3KCHA 1X1UA 1RMSA 2RBIA 4GSPA 1I0VA 2C4BA 5RNTA 2F4YA 1BSAA 4J5KA 3D4AA 2KAAA 1RNBA 1RTUA 3DH2A 1RGEA 1MGRA 2F5WA 1GOUA 3AHSA 1BNEA 1RGGA 1BNFA 7RNTA 1BSDA 1BRGA 4J5GA 3BIRA 1B3SA 1GMQA 1X1XA 3DGYA 1RNTA 1TRPA 1UCIA 1FW7A 1DETA 1FYSA 1I2FA 1R4YA 4RNTA 3URPA 1GOYA 1MGWA 3AGOA 1X1WA 3GSPA 1BRJA 4BIRA 1I0XA 4BU4A 4HOHA 1LRAA 1BRHA 1I2GA 1LOVA 1UCLA 1YVSA 1RLSA 1RN1A 1GOVA 1UCKA 1IYYA 1I3FA 1B2XA 1BRKA 3AGNA 1C54A 2KF4A 1BRNL 4HAAA 1DE3A 5GSPA 1GSPA 1FUTA 1BNRA 1BNJA 3SYUA 3RNTA 1RGLA 9RNTA 1RSNA 1SARA 1RCLA 1Q9EA 1I3IA 1ZGXA 3Q3FA 1YNVX 1BGSA 1BANA 3HOHA 1B2UA 2BU4A 1UCJA 3AHWA 1RGCA 3BU4A 4GHOA 1JBRA 1BSCA 1TRQA 1BOXA 1G02A 5BIRA 1I2EA 2BIRA 1BNGA 1PY3A 1JBTA 1BAOA 2F56A 7GSPA 1BIRA 1B27A 1TTOA 1BNIA 1I8VA 1LOWA 2SARA 1BVIA 1GMPA 2F5MA 1RGAA 1B21A 2AAEA 1AQZA 1RN4A 1T2IA 1BU4A 8RNTA 1BSBA 1A2PA 1B2ZA 2ZA4A 3D5IA 1B2MA 1RCKA 1B2SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B20 A;  2HOH A;  6RNT A;  1HZ1 A;  3A5E A;  2KF6 A;  1FZU A;  3WHO A;  1I70 A;  1PYL A;  1JBS A;  1BRS A;  1RGK A;  1RGH A;  3D5G A;  1AY7 A;  2AAD A;  2GSP A;  1RGF A;  1BNS A;  3WR2 A;  1RDS A;  6GSP A;  1RHL A;  1X1Y A;  1BSE A;  1FUS A;  1GMR A;  5HOH A;  1T2H A;  1BUJ A;  1YGW A;  2KF5 A;  1BRI A;  2KF3 A;  1HYF A;  2RNT A;  1LOY A;  1LNI A;  1CH0 A;  5BU4 A;  3KCH A;  1X1U A;  1RMS A;  2RBI A;  4GSP A;  1I0V A;  2C4B A;  5RNT A;  2F4Y A;  1BSA A;  4J5K A;  3D4A A;  2KAA A;  1RNB A;  1RTU A;  3DH2 A;  1RGE A;  1MGR A;  2F5W A;  1GOU A;  3AHS A;  1BNE A;  1RGG A;  1BNF A;  7RNT A;  1BSD A;  1BRG A;  4J5G A;  3BIR A;  1B3S A;  1GMQ A;  1X1X A;  3DGY A;  1RNT A;  1TRP A;  1UCI A;  1FW7 A;  1DET A;  1FYS A;  1I2F A;  1R4Y A;  4RNT A;  3URP A;  1GOY A;  1MGW A;  3AGO A;  1X1W A;  3GSP A;  1BRJ A;  4BIR A;  1I0X A;  4BU4 A;  4HOH A;  1LRA A;  1BRH A;  1I2G A;  1LOV A;  1UCL A;  1YVS A;  1RLS A;  1RN1 A;  1GOV A;  1UCK A;  1IYY A;  1I3F A;  1B2X A;  1BRK A;  3AGN A;  1C54 A;  2KF4 A;  1BRN L;  4HAA A;  1DE3 A;  5GSP A;  1GSP A;  1FUT A;  1BNR A;  1BNJ A;  3SYU A;  3RNT A;  1RGL A;  9RNT A;  1RSN A;  1SAR A;  1RCL A;  1Q9E A;  1I3I A;  1ZGX A;  3Q3F A;  1YNV X;  1BGS A;  1BAN A;  3HOH A;  1B2U A;  2BU4 A;  1UCJ A;  3AHW A;  1RGC A;  3BU4 A;  4GHO A;  1JBR A;  1BSC A;  1TRQ A;  1BOX A;  1G02 A;  5BIR A;  1I2E A;  2BIR A;  1BNG A;  1PY3 A;  1JBT A;  1BAO A;  2F56 A;  7GSP A;  1BIR A;  1B27 A;  1TTO A;  1BNI A;  1I8V A;  1LOW A;  2SAR A;  1BVI A;  1GMP A;  2F5M A;  1RGA A;  1B21 A;  2AAE A;  1AQZ A;  1RN4 A;  1T2I A;  1BU4 A;  8RNT A;  1BSB A;  1A2P A;  1B2Z A;  2ZA4 A;  3D5I A;  1B2M A;  1RCK A;  1B2S A; 
#chains in the Genus database with same CATH topology
 4IT7 A;  2SBL A;  1UW1 A;  6RNT A;  3I56 3;  5G1L A;  3PCR A;  5JBS A;  1DVD A;  3ER7 A;  4O2H A;  4R9K A;  3HIG A;  2WOH A;  3EX9 A;  1JNQ A;  1MNL A;  2CX1 A;  4OUQ A;  5D82 A;  1I70 A;  2BMQ B;  1M1K 4;  1PYL A;  2W0Q A;  3AMO A;  1Q81 4;  3LML A;  1Y4K A;  5IEN A;  2HMN B;  3D5G A;  4FMC A;  2CG0 A;  5IF6 A;  4GL6 A;  2MF7 A;  3GRD A;  1VQ7 3;  2H0H A;  1ZO2 A;  4LEH A;  1W02 A;  4CCV A;  1FUS A;  4L8O A;  1BUJ A;  1TJD A;  1IU7 A;  3X3X A;  1C7H A;  4HBR A;  2RNT A;  1N5P A;  1LNI A;  1SJW A;  2KXG A;  5AEW B;  5AYS C;  2CFK A;  1DMQ A;  3BNE A;  3VF1 A;  1ROA A;  3CCR 3;  3CNM A;  3S29 A;  4EBG A;  2C4B A;  5AI1 A;  1K28 A;  3U97 A;  3O8Y A;  4CPK A;  1VQP 3;  2IMJ A;  2QGU A;  4FCJ A;  5EVH A;  2YFI B;  3VGN A;  4TX4 A;  1PU4 A;  3BNB A;  1RGE A;  1GOU A;  3FF2 A;  1VQO 3;  4N6T A;  1N9J A;  1UGI A;  1BRG A;  1V57 A;  3CNX A;  4J5G A;  3BIR A;  2HMK B;  2K3D A;  1GS3 A;  1X1X A;  2CH9 A;  3X41 A;  1G96 A;  2L4V A;  2W9Q A;  5M18 A;  1A67 A;  1VQK 3;  3NV0 B;  4MJD A;  4N6L A;  1A90 A;  3PCS A;  1WMO A;  3Q2P A;  3URP A;  2ML5 A;  3EBT A;  4RZM A;  2UX0 A;  3AGO A;  1X1W A;  3Q1C A;  3RDE A;  2YFL B;  5I97 A;  3DGM A;  5EQL A;  4BIR A;  1WQL B;  4XBY A;  4HOH A;  2BO9 B;  1I2G A;  1OH0 A;  5CLK A;  3STD A;  1LNH A;  1RN1 A;  1GOV A;  1VQ9 3;  3VSY A;  1B2X A;  4WWU C;  5G2G A;  3MSO A;  4AKY A;  1Q7H A;  3M8C A;  4FCZ A;  5JPP A;  4EW5 A;  1UUW B;  3SOY A;  1TFO A;  4U13 A;  1DE3 A;  3KN4 A;  3G6E 3;  3H3H A;  4WYK B;  2LQV A;  3PS8 A;  3LTB A;  3ZG5 A;  1EKM A;  1Q86 4;  1RGL A;  2XRX B;  3CMA 3;  1EG9 B;  2XSO B;  1RSN A;  2O9U X;  3S28 A;  1K8A 4;  1I3I A;  1ZGX A;  1BGS A;  2ZL8 A;  4CJN A;  1W2Z A;  4N6N B;  2W04 A;  2Y74 A;  3AHW A;  1JKG B;  3BU4 A;  1RGC A;  1JBR A;  2GU3 A;  4H3U A;  5TGN A;  5AEU B;  1TRQ A;  2HMM B;  3BLZ A;  3U1W A;  1I2E A;  4HZB B;  4O02 B;  3GZY B;  5BIR A;  4L8P A;  3IPT A;  1LVN A;  1OHS A;  1JBT A;  1BAO A;  1OHP A;  4PEJ A;  4LSO A;  3NV0 A;  3LH4 A;  1VZZ A;  1OF5 B;  2XFT A;  2CWU A;  3HI7 A;  1NDO B;  2SAR A;  1BVI A;  1GMP A;  2C11 A;  1Q42 A;  2OQE A;  3EBY A;  7STD A;  1AQZ A;  1O7P B;  1T2I A;  5A0O B;  4STD A;  3DMC A;  1STD A;  3DGN A;  3D5I A;  4OK0 A;  3LZA A;  1B2M A;  2F86 B;  1B2S A;  2OTL 3;  3NX0 A;  1B20 A;  2I9W A;  1AVL A;  3EN8 A;  1HKX A;  3A5E A;  2KF6 A;  1FA3 A;  1K41 A;  1PFP A;  3NHX A;  2BMO B;  2FGT A;  5M1A A;  1VQM 3;  4OVM A;  3FCS B;  5AIG A;  3OWS A;  1GYB A;  1M1X B;  3FKA A;  1IT8 A;  4HM4 B;  4R1K A;  5IG3 A;  3G4S 3;  2W03 A;  5ELU A;  1JBS A;  1RGK A;  1RGH A;  3B4P A;  1AY7 A;  1O7H B;  1UDI I;  2AAD A;  1YJ9 3;  1ISK A;  3ROB A;  1TP6 A;  1IQX A;  1BNS A;  3WR2 A;  3V98 A;  6GSP A;  2OOV C;  3DM8 A;  1RHL A;  2CFW A;  1BSE A;  3GWR A;  3SVA A;  1IVV A;  1GMR A;  2Q07 A;  1YGW A;  4KVH A;  2KF5 A;  3F9S A;  1W5Z A;  1O7M B;  3CU3 A;  1W6G A;  3JUO A;  4R9L A;  1K9M 4;  4I5Q A;  4JRF A;  1Q82 4;  4XB5 A;  3KCH A;  3EJV A;  1RMS A;  3S27 A;  3MWZ A;  3NQZ A;  2RBI A;  4O8S A;  1MWT A;  1GY6 A;  1KSI A;  4L7K A;  3K63 A;  4GSP A;  5FW5 A;  1DVC A;  3WOE B;  2CWT A;  5RNT A;  3I55 3;  1FGR A;  1NNV A;  1N5H A;  2A15 A;  1IT7 A;  3UL5 A;  1STF I;  2OTJ 3;  5D81 A;  1AV4 A;  2KAA A;  1RTU A;  3N8B A;  3JUP A;  1MGR A;  3FSD A;  2F5W A;  2Z76 A;  3JUM A;  3AHS A;  1BNE A;  3DGO A;  3L0R A;  3LYG A;  3FLJ A;  2R4I A;  1MOL A;  2MC8 A;  3LTD A;  2E2T A;  3CPO A;  4JF8 A;  1GY7 A;  2GU1 A;  3UB1 A;  1B3S A;  2HMO B;  1RNT A;  3CCS 3;  2BT3 A;  3KSE D;  2E2V A;  1UCI A;  3FG1 A;  4J8T A;  3QRD A;  1DET A;  2Z77 A;  3G0K A;  2F98 A;  1RRH A;  1A2V A;  3CCE 3;  5LC7 A;  5KP4 A;  3T8U A;  3LTC A;  1EA2 A;  3NQY A;  3TDG A;  4HM7 B;  3WOF B;  2CC3 A;  3CCJ 3;  3GSP A;  2LYX A;  1ZX2 A;  3F7S A;  4QWT A;  1JB5 A;  5AYR B;  4WFO A;  3FG4 A;  2JQ5 A;  1CYV A;  1US1 A;  3N9H A;  1JB4 A;  1BRH A;  4BTY A;  5IEO A;  1LOV A;  4N3V A;  1OPY A;  1IYY A;  1UCK A;  3OW2 2;  2CG1 A;  2RFR A;  1BRK A;  2JDI H;  3AGN A;  4K90 B;  5AII A;  1CYU A;  1JZD A;  2M7O A;  3GZR A;  1IV7 A;  2H0I A;  2OOV A;  1C54 A;  4IIA A;  3MKI A;  1BRN L;  4HAA A;  1CEW I;  1JN5 A;  2UGI A;  1TU5 A;  2RSX A;  5GSP A;  1GSP A;  1FUT A;  2J8X B;  3MG1 A;  2XH9 A;  3SYU A;  2W56 A;  1MWR A;  3K7C A;  4K1V A;  3SX1 A;  1FGM A;  2OWP A;  4IPB A;  2IUJ A;  9RNT A;  1VQ5 3;  1QVF 2;  4HM8 B;  1J2B A;  2Z6B A;  1NU3 A;  1BUQ A;  6STD A;  3F8X A;  1GY5 A;  1YNV X;  4R4K A;  4N6O B;  1TIJ A;  4H61 A;  3EF8 A;  1UCJ A;  4GHO A;  1OHO A;  2CK3 H;  1O7W B;  1VQ4 3;  1BSC A;  4ORL A;  1BOX A;  1G02 A;  4MMZ B;  2BIR A;  1BNG A;  1MWU A;  4MMX B;  2XGN A;  3CCU 3;  4LGQ A;  1U8C B;  1PY3 A;  3KE7 A;  1W2B 2;  1TUH A;  1UI8 A;  5HGR A;  2CFL A;  3NXJ A;  1JN5 B;  1N8Q A;  3EE1 A;  2CW9 A;  4N6V 0;  5BVB A;  2F5M A;  3MPH A;  1RGA A;  1RN4 A;  2YX9 A;  3F14 A;  3HZP A;  2D1W A;  5EEO A;  1D6Y A;  2W9P A;  1BSB A;  1A2P A;  2IUK A;  2ZHX B;  1E3V A;  1S5A A;  3F7X A;  3OV4 A;  3DUK A;  3WOD G;  5STD A;  3NBJ A;  1L5G B;  3Q90 A;  4LMI A;  2UUG C;  5CF2 A;  3OX9 A;  3PGB A;  3N54 B;  4FMA A;  1BRS A;  1OGZ A;  3EQQ B;  3G8Z A;  4HZ9 B;  2GSP A;  5IG4 A;  4HJL B;  3V99 A;  2B1X B;  1K73 4;  1W6C A;  1V74 A;  1VQQ A;  1M90 4;  1N9E A;  1X1Y A;  2XEP A;  1IV9 A;  2CFG A;  5HOH A;  1YIT 3;  1SQW A;  3DZL A;  1BRI A;  3OWU A;  2YFJ B;  4MEI A;  1LOY A;  1WNH A;  5BU4 A;  1ROV A;  1X1U A;  3JVC A;  1YIJ 3;  3ZG0 A;  4BL2 A;  2WOF A;  1Q40 B;  5IG5 A;  3NM2 A;  2W56 B;  3CCM 3;  1I0V A;  5KP1 A;  3I0Y A;  2INX A;  2XR8 B;  1DYU A;  1W00 A;  2CWV A;  1DMN A;  4KZ1 A;  3CXC 2;  4XDW A;  1R4C A;  3D4A A;  2W2C A;  3FG3 A;  1YI2 3;  3UJM A;  5G1K A;  3DH2 A;  3G71 3;  5IER A;  2QIY A;  4FR9 A;  1RGG A;  1BNF A;  7RNT A;  4NHF A;  1W6Y A;  1YGE A;  2O3O A;  4EV5 A;  5LC6 A;  1FUW A;  4AKZ A;  1QAL A;  3DGY A;  5M19 A;  1M9G A;  3B7C A;  3IJE B;  3NM7 A;  3OXA A;  5CF1 A;  1FGT A;  1T3B A;  1KC8 4;  3WA2 X;  3LXU X;  2XFS A;  3CD6 3;  2GEX A;  1OF5 A;  4RNT A;  4EYC A;  3GZX B;  2B24 B;  1GOY A;  1LQG C;  1RN7 A;  4HM2 B;  5CK6 A;  3JUN A;  2P0X A;  4CDL A;  1VQL 3;  4EC6 A;  1WMN A;  2KRT A;  3GZB A;  3PXM A;  4BU4 A;  3FZW A;  3CCL 3;  1UCL A;  1YVS A;  1KQS 2;  1RLS A;  4ZM8 A;  2STD A;  2QA4 3;  1I3F A;  4HM6 B;  1YJW 3;  5AIF A;  2F99 A;  4BL3 A;  2K54 A;  2L1S A;  3BB9 A;  1GD4 A;  3ALA A;  1Z1S A;  1W4N A;  3ECF A;  5IG0 A;  2RGQ A;  2ZDJ A;  1NO3 A;  2WO0 A;  3FF0 A;  4HVN A;  4K61 A;  1BNJ A;  4KFF A;  4LZI A;  3EHC A;  2RCD A;  3K9M C;  1SAR A;  4HM5 B;  1RCL A;  2CX0 A;  1Q9E A;  3LTA A;  4HKV B;  3RGR A;  3Q3F A;  1SPU A;  3KFQ C;  1BAN A;  1GD3 A;  1KWI A;  4KFD A;  1VQ8 3;  3HOH A;  1W7C A;  5DRE A;  3PZW A;  4ILF A;  1G0T A;  3LOY A;  1TFK A;  3UL6 A;  2IA7 A;  3JUQ A;  1EEJ A;  3H51 A;  1O7G B;  1N8R 4;  4RNY A;  3X42 A;  2P0M A;  2V1L A;  3D79 A;  3WA3 A;  2BHM A;  1EUI C;  3HII A;  3T0U A;  1AR0 A;  1QMA A;  2F56 A;  2P09 A;  3X3Z A;  1TTO A;  4BTX A;  1BNI A;  3NUV A;  2W6J H;  3PYJ A;  4KFE A;  4EXR A;  2XF3 A;  1LOW A;  4NPB A;  2PZV A;  1ASK A;  1B21 A;  2AAE A;  2PNC A;  3D3L A;  3S5C A;  1V58 A;  1B2Z A;  3X3Y A;  2IYJ A;  1RCK A;  1I8V A;  2GBW B;  3SED A;  2HOH A;  3MHE A;  4GB5 A;  4XBT A;  1T5Y A;  1HZ1 A;  1YHQ 3;  1FZU A;  3CCQ 3;  3WHO A;  1W01 A;  2D42 A;  3KII A;  4X2H A;  4G1M B;  1Q40 A;  3A76 A;  1OGX A;  3F8H A;  1U5O A;  1RRL A;  3LT8 A;  1QJG A;  2K0M A;  3SXX A;  1RGF A;  3CC4 3;  4FCM A;  1S72 3;  5DRV A;  1RDS A;  1VQN 3;  2CHC A;  2XGL A;  1JJ2 2;  2Y73 A;  3LT9 A;  1T2H A;  1ULJ B;  2C10 A;  3DY5 A;  3FGY A;  2KF3 A;  2CKF B;  4LYL B;  3X40 A;  1HYF A;  2HML B;  2BNG A;  1CQS A;  1CH0 A;  1D6Z A;  3KSP A;  3DGL A;  1OCV A;  4J9A A;  2H0G A;  2XSH B;  3CME 3;  1WTH A;  4FMB A;  3HK4 A;  2WGO A;  4N6M A;  1EQK A;  3CC2 3;  4X2O A;  1DMM A;  1YVB I;  3KZT A;  1JV2 B;  2F4Y A;  1IDP A;  3WDG B;  3T8N A;  1BSA A;  4J5K A;  4DKI A;  1RNB A;  4R80 A;  1UI7 A;  1FGO A;  3FH1 A;  1JKG A;  3UNL A;  1BSD A;  1JRQ A;  3MYT A;  1MWS A;  1UUV B;  1UUG B;  3MG2 A;  1UGH I;  3HX8 A;  4RBN A;  1NJI 4;  1LQM B;  1GMQ A;  3CCV 3;  1D6U A;  1RJO A;  1TRP A;  2OQE C;  3S67 A;  1IVU A;  3B4O A;  1FW7 A;  4WYK A;  5ELJ A;  3EB8 A;  1LXE A;  1FYS A;  1I2F A;  3AMO B;  1R4Y A;  5JPU A;  1O7N B;  1QAK A;  3D9R A;  2FNQ A;  2ML6 A;  1OAC A;  4AEQ A;  2P05 A;  5KP3 A;  8CHO A;  1F8N A;  4HM1 B;  4BTW A;  5CXO A;  1MGW A;  4N6U A;  1OUN A;  1HU9 A;  2BMR B;  1NB5 I;  2IY2 A;  3G16 A;  3WMD A;  1ULI B;  3SOA A;  1IQY A;  1BRJ A;  3ZFZ A;  3K5T A;  1I0X A;  3NBB A;  3OWY A;  2OCT A;  3QK9 A;  4WP5 A;  3SLU A;  1LRA A;  1LOX A;  3BND A;  4HM3 B;  2QEX 3;  1KD1 4;  1QAF A;  1FGQ A;  1SIH A;  5AIH A;  1SII A;  3V92 A;  2KF4 A;  4HM0 B;  2WGQ A;  3KKG A;  5BXQ A;  1JZO A;  3CPW 2;  4EV2 A;  3GAX A;  1QVG 2;  2FXT A;  1IK3 A;  1BNR A;  1JB2 A;  4O3V A;  2E2U A;  3BNC A;  3RNT A;  3K0Z A;  5IW9 A;  3CC7 3;  3B8L A;  1NWW A;  1E3R A;  2P38 A;  5D83 A;  3NBR A;  1WMP A;  4XBX A;  1YJN 3;  1A2K A;  3E99 A;  2R41 A;  3MG3 A;  4MMY B;  3IMA B;  1B2U A;  2BU4 A;  2GXF A;  1IQ8 A;  3F40 A;  4KT3 B;  4XM4 A;  1Q7Y 4;  4WHA A;  3J7Y d;  4I4K A;  4RNZ A;  3EC9 A;  3RGA A;  1BIR A;  1B27 A;  7GSP A;  4NRE A;  1RKY A;  5IEP A;  1IVX A;  2CFD A;  1ZS7 A;  1AVK A;  3EN1 B;  2Z7A A;  1E97 A;  4XDV A;  1VQ6 3;  1BU4 A;  8RNT A;  2HMJ B;  5FGO A;  2GEY A;  3DXO A;  4HYZ A;  2CIU A;  2ZA4 A;  1IVW A;  1NB3 I;  2GBX B;  2KCD A;  4FMD A;  4K1U A;  4Q53 A; 
#chains in the Genus database with same CATH homology
 1B20 A;  2HOH A;  6RNT A;  1HZ1 A;  3A5E A;  2KF6 A;  1FZU A;  3WHO A;  1I70 A;  1PYL A;  1JBS A;  1BRS A;  1RGK A;  1RGH A;  3D5G A;  1AY7 A;  2AAD A;  2GSP A;  1RGF A;  1BNS A;  3WR2 A;  1RDS A;  6GSP A;  1RHL A;  1X1Y A;  1BSE A;  1FUS A;  1GMR A;  5HOH A;  1T2H A;  1BUJ A;  1YGW A;  2KF5 A;  1BRI A;  2KF3 A;  1HYF A;  2RNT A;  1LOY A;  1LNI A;  1CH0 A;  5BU4 A;  3KCH A;  1X1U A;  1RMS A;  2RBI A;  4GSP A;  1I0V A;  2C4B A;  5RNT A;  2F4Y A;  1BSA A;  4J5K A;  3D4A A;  2KAA A;  1RNB A;  1RTU A;  3DH2 A;  1RGE A;  1MGR A;  2F5W A;  1GOU A;  3AHS A;  1BNE A;  1RGG A;  1BNF A;  7RNT A;  1BSD A;  1BRG A;  4J5G A;  3BIR A;  1B3S A;  1GMQ A;  1X1X A;  3DGY A;  1RNT A;  1TRP A;  1UCI A;  1FW7 A;  1DET A;  1FYS A;  1I2F A;  1R4Y A;  4RNT A;  3URP A;  1GOY A;  1MGW A;  3AGO A;  1X1W A;  3GSP A;  1BRJ A;  4BIR A;  1I0X A;  4BU4 A;  4HOH A;  1LRA A;  1BRH A;  1I2G A;  1LOV A;  1UCL A;  1YVS A;  1RLS A;  1RN1 A;  1GOV A;  1UCK A;  1IYY A;  1I3F A;  1B2X A;  1BRK A;  3AGN A;  1C54 A;  2KF4 A;  1BRN L;  4HAA A;  1DE3 A;  5GSP A;  1GSP A;  1FUT A;  1BNR A;  1BNJ A;  3SYU A;  3RNT A;  1RGL A;  9RNT A;  1RSN A;  1SAR A;  1RCL A;  1Q9E A;  1I3I A;  1ZGX A;  3Q3F A;  1YNV X;  1BGS A;  1BAN A;  3HOH A;  1B2U A;  2BU4 A;  1UCJ A;  3AHW A;  1RGC A;  3BU4 A;  4GHO A;  1JBR A;  1BSC A;  1TRQ A;  1BOX A;  1G02 A;  5BIR A;  1I2E A;  2BIR A;  1BNG A;  1PY3 A;  1JBT A;  1BAO A;  2F56 A;  7GSP A;  1BIR A;  1B27 A;  1TTO A;  1BNI A;  1I8V A;  1LOW A;  2SAR A;  1BVI A;  1GMP A;  2F5M A;  1RGA A;  1B21 A;  2AAE A;  1AQZ A;  1RN4 A;  1T2I A;  1BU4 A;  8RNT A;  1BSB A;  1A2P A;  1B2Z A;  2ZA4 A;  3D5I A;  1B2M A;  1RCK A;  1B2S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...