2ZA4A

Crystal structural analysis of barnase-barstar complex
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
108
structure length
108
Chain Sequence
VINTFDGVADYLQTYHKLPDNYITKSEAQALGWVASKGNLADVAPGKSIGGDIFSNREGKLPGKSGRTWREADINYTSGFRNSDRILYSSDWLIYATTDHYQTFTKIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease
publication title Crystal structural analysis of protein-protein interactions drastically destabilized by a single mutation
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
molecule tags Hydrolase/hydrolase inhibitor
total genus 33
structure length 108
sequence length 108
chains with identical sequence C
ec nomenclature ec 3.1.27.-:
pdb deposition date 2007-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 2za4A00
1I3FA 1T2IA 1X1YA 2BIRA 2KF3A 4GSPA 3HOHA 5BIRA 1LOWA 1TRPA 1RNBA 1BNGA 2ZA4A 1BRHA 9RNTA 2F5WA 1BRIA 1B20A 3Q3FA 5RNTA 1RGLA 1RCLA 1BIRA 3WR2A 2F56A 1BRNL 1FZUA 1GOVA 1X1WA 1GMRA 1LOVA 1DE3A 1TRQA 1B21A 1MGRA 2BU4A 3KCHA 1BVIA 1JBTA 1AY7A 2F4YA 1LOYA 1GSPA 1GOYA 2KF6A 1BRKA 1BSDA 1BRGA 1BNRA 1LNIA 1I3IA 1YNVX 3BU4A 4HAAA 3D5GA 3URPA 4BIRA 1I8VA 1DETA 1I0VA 3AHWA 1RHLA 1JBSA 1B2UA 1GMPA 2F5MA 1GOUA 1FYSA 1C54A 1RGGA 3AHSA 1MGWA 1UCKA 1BSAA 1RN4A 1BSBA 1PY3A 3AGNA 1BUJA 1G02A 7GSPA 6RNTA 3WHOA 1TTOA 1BNIA 1RGKA 3RNTA 3AGOA 1B2XA 1BNJA 1RMSA 2RBIA 4BU4A 3D4AA 1LRAA 1RNTA 7RNTA 1FUTA 1BU4A 1HZ1A 1CH0A 1BRSA 1I2EA 1BAOA 2KF5A 2SARA 1I0XA 1GMQA 1YVSA 3D5IA 2KF4A 1UCIA 4GHOA 2RNTA 1B2SA 2HOHA 1A2PA 1HYFA 1RSNA 3GSPA 1RCKA 1X1UA 1T2HA 5HOHA 1B2MA 1BNFA 2AADA 1JBRA 1B3SA 1UCJA 1R4YA 3BIRA 1RN1A 3DGYA 1IYYA 1BSCA 1BANA 1RTUA 5GSPA 1FUSA 4J5KA 1RGHA 4RNTA 1I2FA 1RLSA 3DH2A 1B27A 1Q9EA 1AQZA 1ZGXA 1RGCA 3A5EA 1BOXA 1BSEA 1BRJA 1SARA 2C4BA 1RGAA 2KAAA 1RDSA 1B2ZA 6GSPA 4J5GA 1PYLA 1RGEA 1YGWA 1X1XA 2AAEA 5BU4A 1BGSA 1UCLA 8RNTA 1I70A 1FW7A 1RGFA 4HOHA 2GSPA 3SYUA 1BNEA 1BNSA 1I2GA
chains in the Genus database with same CATH superfamily
2XGLA 4HJLB 4HVNA 3LTCA 4NPBA 2L4VA 4HM6B 2W56B 4N6UA 5KP3A 2Z6BA 1LOWA 1E3VA 1IVUA 1VQN3 4ZM8A 1BRHA 1LQMB 1Q40B 5EEOA 2LYXA 4RZMA 1B20A 3F7SA 4AEQA 1GOVA 4WFOA 2F98A 4U13A 1IDPA 4L8OA 1GMRA 3G8ZA 3TDGA 2IY2A 1V57A 1DE3A 1JV2B 1TRQA 1B21A 3RGRA 1YJ93 1MGRA 2C10A 4TX4A 1O7GB 2BU4A 3L0RA 1WMPA 3K0ZA 3KCHA 2GEXA 4RNZA 4FCJA 1JN5B 4STDA 2CWVA 1GOYA 3OV4A 1Q7HA 4RBNA 1DYUA 3DM8A 4LZIA 5JBSA 3G6E3 1CYUA 1BRKA 1QVF2 3K63A 2L1SA 1OPYA 1OHOA 2WGOA 3EC9A 5G1KA 1VQK3 1DMQA 3EN1B 1LNIA 1S723 2D42A 4EV5A 5AI1A 3BU4A 1ZX2A 2YFIB 4OVMA 5FGOA 3D5GA 4BIRA 3BB9A 4EXRA 4XM4A 1ROAA 1JBSA 1CQSA 3H3HA 1W4NA 4HM5B 1ZS7A 4CCVA 1UW1A 1E97A 1G0TA 5CLKA 1BSAA 1WQLB 4HBRA 1V58A 1BSBA 3AGNA 1RRLA 2B24B 3PZWA 5IG0A 2OQEA 1BUJA 3FLJA 7GSPA 5IG5A 4BTWA 3LT9A 6RNTA 6STDA 3CCS3 2QGUA 3SX1A 2CIUA 1Q40A 1RGKA 2UUGC 1IVVA 4KZ1A 4O2HA 1AV4A 2P05A 1B2XA 1LQGC 2CHCA 1RMSA 4N6NB 8CHOA 3ECFA 1YVBI 5KP1A 1YIT3 3NUVA 4DKIA 3DY5A 1TU5A 3MPHA 4H3UA 5ELUA 3LYGA 4R4KA 2K0MA 1Q7Y4 4HM4B 3CXC2 3EBYA 3UNLA 1K9M4 1CH0A 1FGQA 4NHFA 1UI7A 2OTL3 2W6JH 1M9GA 1YVSA 3MWZA 3NBBA 1TP6A 4N6TA 2HMOB 2O9UX 1UCIA 4GHOA 2IMJA 1B2SA 1OH0A 5DREA 3J7Yd 3GSPA 2BMOB 1W02A 2WOFA 1RCKA 1X1UA 3ALAA 4BL2A 1AVKA 1NU3A 3NXJA 3I563 2CKFB 2F99A 3NM2A 4GL6A 4FMBA 5IENA 1JZOA 2XEPA 2C11A 3JUNA 1RN7A 1BSCA 3DGOA 3FCSB 3SXXA 5JPUA 3FG3A 1BANA 1NNVA 5BXQA 2RCDA 1KQS2 1RLSA 1MNLA 1W2ZA 1B27A 1Q9EA 1BSEA 1BRJA 3WDGB 1FA3A 3Q2PA 1GS3A 1JZDA 1QALA 1RDSA 3EE1A 3CCQ3 4J5GA 4XDWA 1PYLA 3RGAA 1RGEA 1EEJA 1SQWA 3GZYB 5TGNA 1K734 5BU4A 3HK4A 3NV0B 1FW7A 1GY6A 1IQ8A 2P0XA 1RKYA 1VQM3 3S67A 2CFGA 2HMMB 1T2IA 2RFRA 4K1VA 2K54A 2XSOB 3A76A 3FGYA 2KXGA 1GD4A 5AYRB 5IERA 4JF8A 3V92A 3X40A 5CF1A 3S5CA 4KFFA 3G0KA 4HZBB 2Z76A 1ULIB 1U5OA 2OOVC 4EV2A 3Q3FA 1RCLA 2GBWB 2F56A 1FZUA 2CH9A 5AEWB 1VQ93 1HKXA 1ZO2A 3WMDA 1IQXA 4IPBA 3M8CA 5A0OB 1DVCA 2STDA 4LGQA 4N6OB 3T8UA 5IW9A 3KSED 1FGMA 3VF1A 1JRQA 5M18A 1C7HA 3JVCA 4HYZA 1BVIA 3WA2X 2CFKA 3NBRA 1AY7A 7STDA 3X3ZA 2BMRB 3Q1CA 2I9WA 5CXOA 1M904 4XBXA 3MSOA 1GYBA 5EVHA 3FF0A 5AIGA 1UI8A 5EQLA 3S29A 1NWWA 2M7OA 4LSOA 3EHCA 3F8XA 3AMOA 1FGTA 1YNVX 1NDOB 3MKIA 3URPA 2CX1A 4L7KA 5M19A 3CC23 3BLZA 3CCV3 1RHLA 2W04A 1GMPA 1UUWB 1GOUA 2BT3A 2ZHXB 3AHSA 2V1LA 2PZVA 1PY3A 4NREA 3FSDA 1NJI4 3KN4A 2MC8A 4X2OA 1TTOA 3OXAA 3UL5A 2E2UA 4HKVB 3FH1A 1BNIA 3CD63 3KSPA 2CK3H 1D6YA 3AGOA 2BNGA 2XRXB 3GZBA 2W9PA 2Y74A 1YI23 2K3DA 1BNJA 3X41A 1LVNA 3PXMA 1GD3A 1Q864 5STDA 4HM1B 1HU9A 3B7CA 2FNQA 5M1AA 1VQP3 3HZPA 4X2HA 3T8NA 3LH4A 2XR8B 4WYKB 5CF2A 2W2CA 1BU4A 3EBTA 3IJEB 1BRSA 3WOEB 1S5AA 3B8LA 2ZL8A 1WMNA 4N6LA 2KF5A 3QRDA 3U1WA 1I0XA 1W2B2 1GMQA 4MMYB 2F86B 2E2VA 2W56A 4MMXB 3MG1A 4WP5A 1HYFA 4HM3B 1UGIA 1SIHA 2RSXA 1Q42A 2XH9A 2UGIA 3JUMA 3KIIA 5BVBA 1D6UA 3N8BA 5I97A 1W01A 2W03A 4KVHA 1B2MA 1OF5B 3N9HA 3NHXA 4BTYA 3UL6A 1B3SA 2J8XB 1UCJA 1VQ83 1R4YA 2O3OA 3WOFB 1RN1A 1STDA 2HMLB 3HI7A 1IYYA 2HMKB 3OWYA 4BL3A 2PNCA 3BNBA 3CPW2 1N9JA 3BNEA 1I2FA 2GU3A 1QAKA 1AQZA 3A5EA 2P38A 3G713 1TIJA 1OGZA 1YJW3 2C4BA 3CPOA 1F8NA 2OOVA 2HMJB 4AKYA 4BTXA 3DZLA 5AEUB 1JN5A 3FG4A 2BO9B 2R41A 1T3BA 2KCDA 1EG9B 1YGEA 3SLUA 1TFOA 1Z1SA 1MWSA 1IK3A 3VSYA 3PCSA 3ZG0A 4LEHA 3SYUA 2CW9A 5D81A 2WO0A 3X3XA 1I2GA 1I3FA 1JNQA 1X1YA 2BIRA 2KF3A 2KRTA 3EQQB 3N54B 3NBJA 3PYJA 4GSPA 4J8TA 5BIRA 2UX0A 3B4OA 1OUNA 3JUPA 5KP4A 4IIAA 3LTDA 1RNBA 1LOXA 1JB4A 2ZA4A 4R80A 1Q814 3DXOA 9RNTA 1QMAA 5LC6A 2H0HA 2F5WA 1BRIA 4HM2B 4XBYA 3CCL3 3MHEA 4PEJA 3WR2A 5AYSC 3FG1A 3Q90A 1X1WA 1OF5A 4XBTA 1IU7A 3EN8A 4FCMA 5D82A 1IT8A 1LOVA 2FGTA 2OWPA 3ER7A 3S28A 4HM0B 1UUVB 3MG2A 4H61A 3UJMA 3CCE3 1T5YA 3I0YA 3FZWA 1W5ZA 3F14A 4FR9A 3SOYA 4WWUC 1O7PB 2F4YA 1DMNA 1GSPA 2H0IA 4KFDA 3HIIA 1D6ZA 4HM7B 4CJNA 4HM8B 1BSDA 4Q53A 1K41A 4GB5A 4XB5A 4OUQA 1BRGA 3F9SA 5HGRA 1BNRA 1EUIC 1A2VA 1ASKA 1I3IA 1E3RA 4OK0A 2XSHB 1JB2A 3GAXA 2ZDJA 4HAAA 3CNMA 3D9RA 1I8VA 2W9QA 1DETA 1I0VA 3AHWA 3DGLA 4IT7A 1TUHA 3FKAA 1B2UA 2F5MA 1FYSA 5IG3A 1RGGA 2BMQB 4ORLA 3DGMA 1MGWA 1O7NB 2CG0A 3LT8A 1RJOA 1RN4A 4FMCA 1WTHA 1GY5A 1W6YA 2WGQA 3LTBA 3H51A 3FF2A 1G02A 1NB5I 2CWTA 3BNDA 3ZG5A 2CWUA 2IYJA 2CX0A 1VQ63 4JRFA 2YFJB 3EJVA 1NB3I 4BU4A 3D4AA 3NM7A 1O7WB 1RNTA 2CC3A 2GU1A 4N6V0 3MYTA 7RNTA 1A90A 3LXUX 2IUJA 1M1XB 4MMZB 1HZ1A 3NV0A 3VGNA 1I2EA 2D1WA 3F40A 2SARA 4WHAA 1EKMA 2LQVA 3CMA3 1ULJB 3LMLA 2RGQA 2R4IA 3HIGA 2RNTA 3QK9A 2ML5A 1A2PA 2IUKA 3CCM3 1RSNA 3I553 3NX0A 3IPTA 5HOHA 3CCU3 1M1K4 2AADA 2XF3A 3V98A 1JBRA 4FCZA 2INXA 1JKGB 3EB8A 3DGYA 2YX9A 1N8R4 2OTJ3 3LZAA 1FUSA 4J5KA 4FMAA 4CDLA 1RGHA 5CK6A 4RNTA 3SVAA 5G2GA 3JUQA 5JPPA 1ZGXA 1WNHA 4FMDA 2FXTA 1FUWA 3KE7A 4LYLB 1SARA 2OCTA 1ISKA 5AIFA 1MOLA 1Q824 3PGBA 6GSPA 2GXFA 2Z77A 3S27A 3JUOA 3KFQC 1X1XA 1RRHA 3MG3A 1A67A 1W6GA 3OX9A 1GY7A 1G96A 1JB5A 4LMIA 8RNTA 1I70A 2CFDA 1SJWA 1DVDA 4I5QA 1RGFA 3HX8A 5ELJA 1MWRA 1PFPA 3K9MC 4HOHA 3RDEA 1BNSA 4CPKA 2XFTA 3HOHA 1UGHI 3D79A 3F7XA 1TRPA 1KSIA 2H0GA 1N5PA 1N8QA 1BNGA 1FGOA 4RNYA 3KZTA 5D83A 2A15A 2P0MA 4AKZA 3E99A 5RNTA 1RGLA 1BIRA 3IMAB 1Y4KA 1BRNL 4XDVA 2WOHA 1W7CA 3OWUA 1US1A 1ROVA 3GRDA 4ILFA 1AVLA 4I4KA 1JKGA 4L8PA 5IG4A 3X3YA 4EBGA 3GZRA 2QIYA 2GBXB 1A2KA 1QAFA 1R4CA 4K1UA 1MWUA 4J9AA 4K61A 3F8HA 2CG1A 2QA43 1JBTA 1OGXA 1UDII 2Q07A 4G1MB 1LOYA 5G1LA 1N5HA 3GWRA 2KF6A 4WYKA 1VQ53 3SEDA 5FW5A 3STDA 1CEWI 1L5GB 1W00A 2BHMA 1YIJ3 1MWTA 3B4PA 3U97A 3ZFZA 1V74A 2E2TA 4KFEA 5DRVA 3EF8A 1C54A 3KKGA 1KWIA 1VQ73 4R9LA 4N6MA 1UCKA 5IEOA 3K7CA 3CNXA 2XGNA 1QVG2 1LNHA 1J2BA 3EX9A 1U8CB 1O7HB 3WHOA 1NO3A 1W6CA 2SBLA 2IA7A 3DMCA 4K90B 5IF6A 2ML6A 5AIIA 3CC43 1IT7A 1OACA 1N9EA 1SIIA 3RNTA 1CYVA 5LC7A 1PU4A 3T0UA 2RBIA 4N3VA 3CC73 2B1XB 1LRAA 1IVWA 3BNCA 2HMNB 2MF7A 3V99A 3DUKA 2Z7AA 1STFI 2CFLA 3G16A 3LTAA 2YFLB 1TFKA 2JDIH 1FUTA 3WA3A 3CCJ3 3OWSA 4MEIA 1OHPA 3AMOB 1YHQ3 1BAOA 1IVXA 3GZXB 1FGRA 1IV7A 3D5IA 3PCRA 2KF4A 3PS8A 1TJDA 1VQL3 3O8YA 4R9KA 4KT3B 1IV9A 1K28A 2HOHA 2OQEC 2XFSA 3CME3 2QEX3 1EA2A 1VQO3 1T2HA 2W0QA 3D3LA 1K8A4 3OW22 1EQKA 3K5TA 1BNFA 4QWTA 1KD14 3UB1A 1QJGA 3CU3A 1WMOA 3LOYA 4EYCA 1LXEA 2GEYA 5AIHA 3BIRA 4HZ9B 3SOAA 1VQQA 4O02B 1O7MB 1RTUA 5GSPA 3G4S3 1YJN3 1KC84 1UUGB 2JQ5A 3CCR3 3X42A 2P09A 3DH2A 1AR0A 1OCVA 1RGCA 5IEPA 1BOXA 4EC6A 1IQYA 3NQZA 1RGAA 2KAAA 3DGNA 3ROBA 1B2ZA 1VQ43 1OHSA 2CFWA 1BUQA 1SPUA 4MJDA 1VZZA 1YGWA 3WODG 4EW5A 2AAEA 1BGSA 1UCLA 4O3VA 1DMMA 1JJ22 2Y73A 4O8SA 4R1KA 2GSPA 1BNEA 3NQYA
chains in the Genus database with same CATH topology
1I3FA 1T2IA 1X1YA 2BIRA 2KF3A 4GSPA 3HOHA 5BIRA 1LOWA 1TRPA 1RNBA 1BNGA 2ZA4A 1BRHA 9RNTA 2F5WA 1BRIA 1B20A 3Q3FA 5RNTA 1RGLA 1RCLA 1BIRA 3WR2A 2F56A 1BRNL 1FZUA 1GOVA 1X1WA 1GMRA 1LOVA 1DE3A 1TRQA 1B21A 1MGRA 2BU4A 3KCHA 1BVIA 1JBTA 1AY7A 2F4YA 1LOYA 1GSPA 1GOYA 2KF6A 1BRKA 1BSDA 1BRGA 1BNRA 1LNIA 1I3IA 1YNVX 3BU4A 4HAAA 3D5GA 3URPA 4BIRA 1I8VA 1DETA 1I0VA 3AHWA 1RHLA 1JBSA 1B2UA 1GMPA 2F5MA 1GOUA 1FYSA 1C54A 1RGGA 3AHSA 1MGWA 1UCKA 1BSAA 1RN4A 1BSBA 1PY3A 3AGNA 1BUJA 1G02A 7GSPA 6RNTA 3WHOA 1TTOA 1BNIA 1RGKA 3RNTA 3AGOA 1B2XA 1BNJA 1RMSA 2RBIA 4BU4A 3D4AA 1LRAA 1RNTA 7RNTA 1FUTA 1BU4A 1HZ1A 1CH0A 1BRSA 1I2EA 1BAOA 2KF5A 2SARA 1I0XA 1GMQA 1YVSA 3D5IA 2KF4A 1UCIA 4GHOA 2RNTA 1B2SA 2HOHA 1A2PA 1HYFA 1RSNA 3GSPA 1RCKA 1X1UA 1T2HA 5HOHA 1B2MA 1BNFA 2AADA 1JBRA 1B3SA 1UCJA 1R4YA 3BIRA 1RN1A 3DGYA 1IYYA 1BSCA 1BANA 1RTUA 5GSPA 1FUSA 4J5KA 1RGHA 4RNTA 1I2FA 1RLSA 3DH2A 1B27A 1Q9EA 1AQZA 1ZGXA 1RGCA 3A5EA 1BOXA 1BSEA 1BRJA 1SARA 2C4BA 1RGAA 2KAAA 1RDSA 1B2ZA 6GSPA 4J5GA 1PYLA 1RGEA 1YGWA 1X1XA 2AAEA 5BU4A 1BGSA 1UCLA 8RNTA 1I70A 1FW7A 1RGFA 4HOHA 2GSPA 3SYUA 1BNEA 1BNSA 1I2GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I3F A;  1T2I A;  1X1Y A;  2BIR A;  2KF3 A;  4GSP A;  3HOH A;  5BIR A;  1LOW A;  1TRP A;  1RNB A;  1BNG A;  2ZA4 A;  1BRH A;  9RNT A;  2F5W A;  1BRI A;  1B20 A;  3Q3F A;  5RNT A;  1RGL A;  1RCL A;  1BIR A;  3WR2 A;  2F56 A;  1BRN L;  1FZU A;  1GOV A;  1X1W A;  1GMR A;  1LOV A;  1DE3 A;  1TRQ A;  1B21 A;  1MGR A;  2BU4 A;  3KCH A;  1BVI A;  1JBT A;  1AY7 A;  2F4Y A;  1LOY A;  1GSP A;  1GOY A;  2KF6 A;  1BRK A;  1BSD A;  1BRG A;  1BNR A;  1LNI A;  1I3I A;  1YNV X;  3BU4 A;  4HAA A;  3D5G A;  3URP A;  4BIR A;  1I8V A;  1DET A;  1I0V A;  3AHW A;  1RHL A;  1JBS A;  1B2U A;  1GMP A;  2F5M A;  1GOU A;  1FYS A;  1C54 A;  1RGG A;  3AHS A;  1MGW A;  1UCK A;  1BSA A;  1RN4 A;  1BSB A;  1PY3 A;  3AGN A;  1BUJ A;  1G02 A;  7GSP A;  6RNT A;  3WHO A;  1TTO A;  1BNI A;  1RGK A;  3RNT A;  3AGO A;  1B2X A;  1BNJ A;  1RMS A;  2RBI A;  4BU4 A;  3D4A A;  1LRA A;  1RNT A;  7RNT A;  1FUT A;  1BU4 A;  1HZ1 A;  1CH0 A;  1BRS A;  1I2E A;  1BAO A;  2KF5 A;  2SAR A;  1I0X A;  1GMQ A;  1YVS A;  3D5I A;  2KF4 A;  1UCI A;  4GHO A;  2RNT A;  1B2S A;  2HOH A;  1A2P A;  1HYF A;  1RSN A;  3GSP A;  1RCK A;  1X1U A;  1T2H A;  5HOH A;  1B2M A;  1BNF A;  2AAD A;  1JBR A;  1B3S A;  1UCJ A;  1R4Y A;  3BIR A;  1RN1 A;  3DGY A;  1IYY A;  1BSC A;  1BAN A;  1RTU A;  5GSP A;  1FUS A;  4J5K A;  1RGH A;  4RNT A;  1I2F A;  1RLS A;  3DH2 A;  1B27 A;  1Q9E A;  1AQZ A;  1ZGX A;  1RGC A;  3A5E A;  1BOX A;  1BSE A;  1BRJ A;  1SAR A;  2C4B A;  1RGA A;  2KAA A;  1RDS A;  1B2Z A;  6GSP A;  4J5G A;  1PYL A;  1RGE A;  1YGW A;  1X1X A;  2AAE A;  5BU4 A;  1BGS A;  1UCL A;  8RNT A;  1I70 A;  1FW7 A;  1RGF A;  4HOH A;  2GSP A;  3SYU A;  1BNE A;  1BNS A;  1I2G A; 
#chains in the Genus database with same CATH topology
 2XGL A;  4HJL B;  4HVN A;  3LTC A;  4NPB A;  2L4V A;  4HM6 B;  2W56 B;  4N6U A;  5KP3 A;  2Z6B A;  1LOW A;  1E3V A;  1IVU A;  1VQN 3;  4ZM8 A;  1BRH A;  1LQM B;  1Q40 B;  5EEO A;  2LYX A;  4RZM A;  1B20 A;  3F7S A;  4AEQ A;  1GOV A;  4WFO A;  2F98 A;  4U13 A;  1IDP A;  4L8O A;  1GMR A;  3G8Z A;  3TDG A;  2IY2 A;  1V57 A;  1DE3 A;  1JV2 B;  1TRQ A;  1B21 A;  3RGR A;  1YJ9 3;  1MGR A;  2C10 A;  4TX4 A;  1O7G B;  2BU4 A;  3L0R A;  1WMP A;  3K0Z A;  3KCH A;  2GEX A;  4RNZ A;  4FCJ A;  1JN5 B;  4STD A;  2CWV A;  1GOY A;  3OV4 A;  1Q7H A;  4RBN A;  1DYU A;  3DM8 A;  4LZI A;  5JBS A;  3G6E 3;  1CYU A;  1BRK A;  1QVF 2;  3K63 A;  2L1S A;  1OPY A;  1OHO A;  2WGO A;  3EC9 A;  5G1K A;  1VQK 3;  1DMQ A;  3EN1 B;  1LNI A;  1S72 3;  2D42 A;  4EV5 A;  5AI1 A;  3BU4 A;  1ZX2 A;  2YFI B;  4OVM A;  5FGO A;  3D5G A;  4BIR A;  3BB9 A;  4EXR A;  4XM4 A;  1ROA A;  1JBS A;  1CQS A;  3H3H A;  1W4N A;  4HM5 B;  1ZS7 A;  4CCV A;  1UW1 A;  1E97 A;  1G0T A;  5CLK A;  1BSA A;  1WQL B;  4HBR A;  1V58 A;  1BSB A;  3AGN A;  1RRL A;  2B24 B;  3PZW A;  5IG0 A;  2OQE A;  1BUJ A;  3FLJ A;  7GSP A;  5IG5 A;  4BTW A;  3LT9 A;  6RNT A;  6STD A;  3CCS 3;  2QGU A;  3SX1 A;  2CIU A;  1Q40 A;  1RGK A;  2UUG C;  1IVV A;  4KZ1 A;  4O2H A;  1AV4 A;  2P05 A;  1B2X A;  1LQG C;  2CHC A;  1RMS A;  4N6N B;  8CHO A;  3ECF A;  1YVB I;  5KP1 A;  1YIT 3;  3NUV A;  4DKI A;  3DY5 A;  1TU5 A;  3MPH A;  4H3U A;  5ELU A;  3LYG A;  4R4K A;  2K0M A;  1Q7Y 4;  4HM4 B;  3CXC 2;  3EBY A;  3UNL A;  1K9M 4;  1CH0 A;  1FGQ A;  4NHF A;  1UI7 A;  2OTL 3;  2W6J H;  1M9G A;  1YVS A;  3MWZ A;  3NBB A;  1TP6 A;  4N6T A;  2HMO B;  2O9U X;  1UCI A;  4GHO A;  2IMJ A;  1B2S A;  1OH0 A;  5DRE A;  3J7Y d;  3GSP A;  2BMO B;  1W02 A;  2WOF A;  1RCK A;  1X1U A;  3ALA A;  4BL2 A;  1AVK A;  1NU3 A;  3NXJ A;  3I56 3;  2CKF B;  2F99 A;  3NM2 A;  4GL6 A;  4FMB A;  5IEN A;  1JZO A;  2XEP A;  2C11 A;  3JUN A;  1RN7 A;  1BSC A;  3DGO A;  3FCS B;  3SXX A;  5JPU A;  3FG3 A;  1BAN A;  1NNV A;  5BXQ A;  2RCD A;  1KQS 2;  1RLS A;  1MNL A;  1W2Z A;  1B27 A;  1Q9E A;  1BSE A;  1BRJ A;  3WDG B;  1FA3 A;  3Q2P A;  1GS3 A;  1JZD A;  1QAL A;  1RDS A;  3EE1 A;  3CCQ 3;  4J5G A;  4XDW A;  1PYL A;  3RGA A;  1RGE A;  1EEJ A;  1SQW A;  3GZY B;  5TGN A;  1K73 4;  5BU4 A;  3HK4 A;  3NV0 B;  1FW7 A;  1GY6 A;  1IQ8 A;  2P0X A;  1RKY A;  1VQM 3;  3S67 A;  2CFG A;  2HMM B;  1T2I A;  2RFR A;  4K1V A;  2K54 A;  2XSO B;  3A76 A;  3FGY A;  2KXG A;  1GD4 A;  5AYR B;  5IER A;  4JF8 A;  3V92 A;  3X40 A;  5CF1 A;  3S5C A;  4KFF A;  3G0K A;  4HZB B;  2Z76 A;  1ULI B;  1U5O A;  2OOV C;  4EV2 A;  3Q3F A;  1RCL A;  2GBW B;  2F56 A;  1FZU A;  2CH9 A;  5AEW B;  1VQ9 3;  1HKX A;  1ZO2 A;  3WMD A;  1IQX A;  4IPB A;  3M8C A;  5A0O B;  1DVC A;  2STD A;  4LGQ A;  4N6O B;  3T8U A;  5IW9 A;  3KSE D;  1FGM A;  3VF1 A;  1JRQ A;  5M18 A;  1C7H A;  3JVC A;  4HYZ A;  1BVI A;  3WA2 X;  2CFK A;  3NBR A;  1AY7 A;  7STD A;  3X3Z A;  2BMR B;  3Q1C A;  2I9W A;  5CXO A;  1M90 4;  4XBX A;  3MSO A;  1GYB A;  5EVH A;  3FF0 A;  5AIG A;  1UI8 A;  5EQL A;  3S29 A;  1NWW A;  2M7O A;  4LSO A;  3EHC A;  3F8X A;  3AMO A;  1FGT A;  1YNV X;  1NDO B;  3MKI A;  3URP A;  2CX1 A;  4L7K A;  5M19 A;  3CC2 3;  3BLZ A;  3CCV 3;  1RHL A;  2W04 A;  1GMP A;  1UUW B;  1GOU A;  2BT3 A;  2ZHX B;  3AHS A;  2V1L A;  2PZV A;  1PY3 A;  4NRE A;  3FSD A;  1NJI 4;  3KN4 A;  2MC8 A;  4X2O A;  1TTO A;  3OXA A;  3UL5 A;  2E2U A;  4HKV B;  3FH1 A;  1BNI A;  3CD6 3;  3KSP A;  2CK3 H;  1D6Y A;  3AGO A;  2BNG A;  2XRX B;  3GZB A;  2W9P A;  2Y74 A;  1YI2 3;  2K3D A;  1BNJ A;  3X41 A;  1LVN A;  3PXM A;  1GD3 A;  1Q86 4;  5STD A;  4HM1 B;  1HU9 A;  3B7C A;  2FNQ A;  5M1A A;  1VQP 3;  3HZP A;  4X2H A;  3T8N A;  3LH4 A;  2XR8 B;  4WYK B;  5CF2 A;  2W2C A;  1BU4 A;  3EBT A;  3IJE B;  1BRS A;  3WOE B;  1S5A A;  3B8L A;  2ZL8 A;  1WMN A;  4N6L A;  2KF5 A;  3QRD A;  3U1W A;  1I0X A;  1W2B 2;  1GMQ A;  4MMY B;  2F86 B;  2E2V A;  2W56 A;  4MMX B;  3MG1 A;  4WP5 A;  1HYF A;  4HM3 B;  1UGI A;  1SIH A;  2RSX A;  1Q42 A;  2XH9 A;  2UGI A;  3JUM A;  3KII A;  5BVB A;  1D6U A;  3N8B A;  5I97 A;  1W01 A;  2W03 A;  4KVH A;  1B2M A;  1OF5 B;  3N9H A;  3NHX A;  4BTY A;  3UL6 A;  1B3S A;  2J8X B;  1UCJ A;  1VQ8 3;  1R4Y A;  2O3O A;  3WOF B;  1RN1 A;  1STD A;  2HML B;  3HI7 A;  1IYY A;  2HMK B;  3OWY A;  4BL3 A;  2PNC A;  3BNB A;  3CPW 2;  1N9J A;  3BNE A;  1I2F A;  2GU3 A;  1QAK A;  1AQZ A;  3A5E A;  2P38 A;  3G71 3;  1TIJ A;  1OGZ A;  1YJW 3;  2C4B A;  3CPO A;  1F8N A;  2OOV A;  2HMJ B;  4AKY A;  4BTX A;  3DZL A;  5AEU B;  1JN5 A;  3FG4 A;  2BO9 B;  2R41 A;  1T3B A;  2KCD A;  1EG9 B;  1YGE A;  3SLU A;  1TFO A;  1Z1S A;  1MWS A;  1IK3 A;  3VSY A;  3PCS A;  3ZG0 A;  4LEH A;  3SYU A;  2CW9 A;  5D81 A;  2WO0 A;  3X3X A;  1I2G A;  1I3F A;  1JNQ A;  1X1Y A;  2BIR A;  2KF3 A;  2KRT A;  3EQQ B;  3N54 B;  3NBJ A;  3PYJ A;  4GSP A;  4J8T A;  5BIR A;  2UX0 A;  3B4O A;  1OUN A;  3JUP A;  5KP4 A;  4IIA A;  3LTD A;  1RNB A;  1LOX A;  1JB4 A;  2ZA4 A;  4R80 A;  1Q81 4;  3DXO A;  9RNT A;  1QMA A;  5LC6 A;  2H0H A;  2F5W A;  1BRI A;  4HM2 B;  4XBY A;  3CCL 3;  3MHE A;  4PEJ A;  3WR2 A;  5AYS C;  3FG1 A;  3Q90 A;  1X1W A;  1OF5 A;  4XBT A;  1IU7 A;  3EN8 A;  4FCM A;  5D82 A;  1IT8 A;  1LOV A;  2FGT A;  2OWP A;  3ER7 A;  3S28 A;  4HM0 B;  1UUV B;  3MG2 A;  4H61 A;  3UJM A;  3CCE 3;  1T5Y A;  3I0Y A;  3FZW A;  1W5Z A;  3F14 A;  4FR9 A;  3SOY A;  4WWU C;  1O7P B;  2F4Y A;  1DMN A;  1GSP A;  2H0I A;  4KFD A;  3HII A;  1D6Z A;  4HM7 B;  4CJN A;  4HM8 B;  1BSD A;  4Q53 A;  1K41 A;  4GB5 A;  4XB5 A;  4OUQ A;  1BRG A;  3F9S A;  5HGR A;  1BNR A;  1EUI C;  1A2V A;  1ASK A;  1I3I A;  1E3R A;  4OK0 A;  2XSH B;  1JB2 A;  3GAX A;  2ZDJ A;  4HAA A;  3CNM A;  3D9R A;  1I8V A;  2W9Q A;  1DET A;  1I0V A;  3AHW A;  3DGL A;  4IT7 A;  1TUH A;  3FKA A;  1B2U A;  2F5M A;  1FYS A;  5IG3 A;  1RGG A;  2BMQ B;  4ORL A;  3DGM A;  1MGW A;  1O7N B;  2CG0 A;  3LT8 A;  1RJO A;  1RN4 A;  4FMC A;  1WTH A;  1GY5 A;  1W6Y A;  2WGQ A;  3LTB A;  3H51 A;  3FF2 A;  1G02 A;  1NB5 I;  2CWT A;  3BND A;  3ZG5 A;  2CWU A;  2IYJ A;  2CX0 A;  1VQ6 3;  4JRF A;  2YFJ B;  3EJV A;  1NB3 I;  4BU4 A;  3D4A A;  3NM7 A;  1O7W B;  1RNT A;  2CC3 A;  2GU1 A;  4N6V 0;  3MYT A;  7RNT A;  1A90 A;  3LXU X;  2IUJ A;  1M1X B;  4MMZ B;  1HZ1 A;  3NV0 A;  3VGN A;  1I2E A;  2D1W A;  3F40 A;  2SAR A;  4WHA A;  1EKM A;  2LQV A;  3CMA 3;  1ULJ B;  3LML A;  2RGQ A;  2R4I A;  3HIG A;  2RNT A;  3QK9 A;  2ML5 A;  1A2P A;  2IUK A;  3CCM 3;  1RSN A;  3I55 3;  3NX0 A;  3IPT A;  5HOH A;  3CCU 3;  1M1K 4;  2AAD A;  2XF3 A;  3V98 A;  1JBR A;  4FCZ A;  2INX A;  1JKG B;  3EB8 A;  3DGY A;  2YX9 A;  1N8R 4;  2OTJ 3;  3LZA A;  1FUS A;  4J5K A;  4FMA A;  4CDL A;  1RGH A;  5CK6 A;  4RNT A;  3SVA A;  5G2G A;  3JUQ A;  5JPP A;  1ZGX A;  1WNH A;  4FMD A;  2FXT A;  1FUW A;  3KE7 A;  4LYL B;  1SAR A;  2OCT A;  1ISK A;  5AIF A;  1MOL A;  1Q82 4;  3PGB A;  6GSP A;  2GXF A;  2Z77 A;  3S27 A;  3JUO A;  3KFQ C;  1X1X A;  1RRH A;  3MG3 A;  1A67 A;  1W6G A;  3OX9 A;  1GY7 A;  1G96 A;  1JB5 A;  4LMI A;  8RNT A;  1I70 A;  2CFD A;  1SJW A;  1DVD A;  4I5Q A;  1RGF A;  3HX8 A;  5ELJ A;  1MWR A;  1PFP A;  3K9M C;  4HOH A;  3RDE A;  1BNS A;  4CPK A;  2XFT A;  3HOH A;  1UGH I;  3D79 A;  3F7X A;  1TRP A;  1KSI A;  2H0G A;  1N5P A;  1N8Q A;  1BNG A;  1FGO A;  4RNY A;  3KZT A;  5D83 A;  2A15 A;  2P0M A;  4AKZ A;  3E99 A;  5RNT A;  1RGL A;  1BIR A;  3IMA B;  1Y4K A;  1BRN L;  4XDV A;  2WOH A;  1W7C A;  3OWU A;  1US1 A;  1ROV A;  3GRD A;  4ILF A;  1AVL A;  4I4K A;  1JKG A;  4L8P A;  5IG4 A;  3X3Y A;  4EBG A;  3GZR A;  2QIY A;  2GBX B;  1A2K A;  1QAF A;  1R4C A;  4K1U A;  1MWU A;  4J9A A;  4K61 A;  3F8H A;  2CG1 A;  2QA4 3;  1JBT A;  1OGX A;  1UDI I;  2Q07 A;  4G1M B;  1LOY A;  5G1L A;  1N5H A;  3GWR A;  2KF6 A;  4WYK A;  1VQ5 3;  3SED A;  5FW5 A;  3STD A;  1CEW I;  1L5G B;  1W00 A;  2BHM A;  1YIJ 3;  1MWT A;  3B4P A;  3U97 A;  3ZFZ A;  1V74 A;  2E2T A;  4KFE A;  5DRV A;  3EF8 A;  1C54 A;  3KKG A;  1KWI A;  1VQ7 3;  4R9L A;  4N6M A;  1UCK A;  5IEO A;  3K7C A;  3CNX A;  2XGN A;  1QVG 2;  1LNH A;  1J2B A;  3EX9 A;  1U8C B;  1O7H B;  3WHO A;  1NO3 A;  1W6C A;  2SBL A;  2IA7 A;  3DMC A;  4K90 B;  5IF6 A;  2ML6 A;  5AII A;  3CC4 3;  1IT7 A;  1OAC A;  1N9E A;  1SII A;  3RNT A;  1CYV A;  5LC7 A;  1PU4 A;  3T0U A;  2RBI A;  4N3V A;  3CC7 3;  2B1X B;  1LRA A;  1IVW A;  3BNC A;  2HMN B;  2MF7 A;  3V99 A;  3DUK A;  2Z7A A;  1STF I;  2CFL A;  3G16 A;  3LTA A;  2YFL B;  1TFK A;  2JDI H;  1FUT A;  3WA3 A;  3CCJ 3;  3OWS A;  4MEI A;  1OHP A;  3AMO B;  1YHQ 3;  1BAO A;  1IVX A;  3GZX B;  1FGR A;  1IV7 A;  3D5I A;  3PCR A;  2KF4 A;  3PS8 A;  1TJD A;  1VQL 3;  3O8Y A;  4R9K A;  4KT3 B;  1IV9 A;  1K28 A;  2HOH A;  2OQE C;  2XFS A;  3CME 3;  2QEX 3;  1EA2 A;  1VQO 3;  1T2H A;  2W0Q A;  3D3L A;  1K8A 4;  3OW2 2;  1EQK A;  3K5T A;  1BNF A;  4QWT A;  1KD1 4;  3UB1 A;  1QJG A;  3CU3 A;  1WMO A;  3LOY A;  4EYC A;  1LXE A;  2GEY A;  5AIH A;  3BIR A;  4HZ9 B;  3SOA A;  1VQQ A;  4O02 B;  1O7M B;  1RTU A;  5GSP A;  3G4S 3;  1YJN 3;  1KC8 4;  1UUG B;  2JQ5 A;  3CCR 3;  3X42 A;  2P09 A;  3DH2 A;  1AR0 A;  1OCV A;  1RGC A;  5IEP A;  1BOX A;  4EC6 A;  1IQY A;  3NQZ A;  1RGA A;  2KAA A;  3DGN A;  3ROB A;  1B2Z A;  1VQ4 3;  1OHS A;  2CFW A;  1BUQ A;  1SPU A;  4MJD A;  1VZZ A;  1YGW A;  3WOD G;  4EW5 A;  2AAE A;  1BGS A;  1UCL A;  4O3V A;  1DMM A;  1JJ2 2;  2Y73 A;  4O8S A;  4R1K A;  2GSP A;  1BNE A;  3NQY A; 
#chains in the Genus database with same CATH homology
 1I3F A;  1T2I A;  1X1Y A;  2BIR A;  2KF3 A;  4GSP A;  3HOH A;  5BIR A;  1LOW A;  1TRP A;  1RNB A;  1BNG A;  2ZA4 A;  1BRH A;  9RNT A;  2F5W A;  1BRI A;  1B20 A;  3Q3F A;  5RNT A;  1RGL A;  1RCL A;  1BIR A;  3WR2 A;  2F56 A;  1BRN L;  1FZU A;  1GOV A;  1X1W A;  1GMR A;  1LOV A;  1DE3 A;  1TRQ A;  1B21 A;  1MGR A;  2BU4 A;  3KCH A;  1BVI A;  1JBT A;  1AY7 A;  2F4Y A;  1LOY A;  1GSP A;  1GOY A;  2KF6 A;  1BRK A;  1BSD A;  1BRG A;  1BNR A;  1LNI A;  1I3I A;  1YNV X;  3BU4 A;  4HAA A;  3D5G A;  3URP A;  4BIR A;  1I8V A;  1DET A;  1I0V A;  3AHW A;  1RHL A;  1JBS A;  1B2U A;  1GMP A;  2F5M A;  1GOU A;  1FYS A;  1C54 A;  1RGG A;  3AHS A;  1MGW A;  1UCK A;  1BSA A;  1RN4 A;  1BSB A;  1PY3 A;  3AGN A;  1BUJ A;  1G02 A;  7GSP A;  6RNT A;  3WHO A;  1TTO A;  1BNI A;  1RGK A;  3RNT A;  3AGO A;  1B2X A;  1BNJ A;  1RMS A;  2RBI A;  4BU4 A;  3D4A A;  1LRA A;  1RNT A;  7RNT A;  1FUT A;  1BU4 A;  1HZ1 A;  1CH0 A;  1BRS A;  1I2E A;  1BAO A;  2KF5 A;  2SAR A;  1I0X A;  1GMQ A;  1YVS A;  3D5I A;  2KF4 A;  1UCI A;  4GHO A;  2RNT A;  1B2S A;  2HOH A;  1A2P A;  1HYF A;  1RSN A;  3GSP A;  1RCK A;  1X1U A;  1T2H A;  5HOH A;  1B2M A;  1BNF A;  2AAD A;  1JBR A;  1B3S A;  1UCJ A;  1R4Y A;  3BIR A;  1RN1 A;  3DGY A;  1IYY A;  1BSC A;  1BAN A;  1RTU A;  5GSP A;  1FUS A;  4J5K A;  1RGH A;  4RNT A;  1I2F A;  1RLS A;  3DH2 A;  1B27 A;  1Q9E A;  1AQZ A;  1ZGX A;  1RGC A;  3A5E A;  1BOX A;  1BSE A;  1BRJ A;  1SAR A;  2C4B A;  1RGA A;  2KAA A;  1RDS A;  1B2Z A;  6GSP A;  4J5G A;  1PYL A;  1RGE A;  1YGW A;  1X1X A;  2AAE A;  5BU4 A;  1BGS A;  1UCL A;  8RNT A;  1I70 A;  1FW7 A;  1RGF A;  4HOH A;  2GSP A;  3SYU A;  1BNE A;  1BNS A;  1I2G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...