2ZA5A

Crystal structure of human tryptase with potent non-peptide inhibitor
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
242
structure length
242
Chain Sequence
IVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVKVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Potent, nonpeptide inhibitors of human mast cell tryptase. Synthesis and biological evaluation of novel spirocyclic piperidine amide derivatives
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Tryptase beta 2
total genus 48
structure length 242
sequence length 242
chains with identical sequence B, C, D
ec nomenclature ec 3.4.21.59: Tryptase.
pdb deposition date 2007-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2za5A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2za5A01
3A89A 2QY0B 2Y80A 2AGIX 2XTTB 2ZFFH 1C5UA 1HCGA 2R3YA 1UCYK 3F9HA 1C5WB 1QRZA 4INHA 2NU4E 2AIPA 3RXEA 1TMTH 3ATKA 2VH6A 1AFEH 1F0UA 2QC2A 4BXWA 2FTLE 1BRCE 1FMGA 1O31A 4E7NA 1C9PA 1PPGE 2V35A 4AFUA 2QXHA 3QWCH 2G52A 1OWIA 2Y6TA 2W7SA 4X6MA 3SUFA 2A7HA 1ESBA 1O2SA 2NU0E 2BTCE 1C5SA 1JRSA 3P8GA 4IC5A 1TX8A 1GHYH 1BMLA 5JBCS 1BJUA 3UY9A 3QZRA 1YPHE 3O8CA 1FONA 1NRNH 3T2NA 1CBWB 4AFQA 4BXSA 1GI3A 1WQSA 1AQ7A 2VWMA 3RU4T 3GY7A 2AFQB 1RD3B 3I78A 1LVYA 3CS0A 1TGBA 3SV9A 1SFQB 1SGFG 1O3FA 1Z8RA 4Y7BA 2G81E 1A0HB 1QB9A 4ZXYH 5FBIA 4X2YA 1Z8GA 1C1RA 3CS7A 4DURA 1DVAH 4MPXA 3M3VA 1NTPA 1C2KA 3TGIE 2Y5HA 1O2OA 4NFFA 9LPRA 2OTVA 4ZHAA 2GCTB 3URDA 4K1SA 1THPB 1GI8B 4Y8XA 3MU0A 2GTBA 1O2QA 4Y0ZE 3KQCA 3GDVA 2STAE 2R0LA 1O38A 2B0FA 4UONA 5LPEA 3UPEA 1OWEA 1A5IA 2P3UB 1NFWA 3A84A 4IBLH 3PMJA 4AB8A 1VCPA 2LNCA 3B8JA 1IOEA 1EKBB 3A88A 1IQEA 1O5EH 3S7KB 2EC9H 2BDCA 1EAIA 1WTHD 1PPCE 1FAXA 1MU6B 2R0KA 1SB1H 3M37A 4JZFH 5C1UA 4AGKA 1ID5H 3ZYEA 1O3JA 1A0JA 1HB0B 2F9OA 1LVOA 1C2FA 3SV2H 1HPGA 1VR1H 1LVBA 1AU8A 3MOCA 2Z7FE 1QURH 1BRUP 1HJAC 3RXGA 4H42U 3QX5H 4D7GA 2FOEA 1SLWB 2PTNA 3EYDA 4CRGA 1QBVH 3SV7A 1O5GH 2FODA 3A81A 1BBRH 1MD7A 1P0SH 1PPZA 2BY6X 3UUZA 3FP6E 1DLEA 1GCTB 2XCFA 3DA9B 1MD8A 1CO7E 2Z3EA 3TK9A 2JH0D 2BY5X 3M3SA 2CXVA 2GVFA 2FTMA 2ZKSA 1W7GH 1TGNA 4I8LA 2W5EA 1ZSLA 1HUTH 4A5TS 1O2JA 2BQWB 1J8AA 2Q6DA 2R9PA 1V2UT 3ZV8A 1AO5A 3UR9A 1O2MA 1V2WT 2D26C 1TNJA 3IITA 1N1LA 4NA9H 1XXDA 1ZMLA 2ZGXH 3ATIA 3SGAE 2J95A 1LHEH 3HK6B 2HPQH 3ATWA 1GBIA 3OTJE 4ISLA 3UNSA 2ZGHA 1GJ4H 1OSSA 2ALVA 4JK5A 3P92A 3GYMA 1C2GA 1UK3A 2ZHEH 3S9BA 3T27A 1MKXK 5DP8A 1E0FD 3JZ1B 3PTBA 5JBTA 3LT3A 1BCUH 1NFXA 1FAKH 2BY9X 2QAAA 6CHAC 1V2TT 5L6NH 1BMNH 2QCYA 2ZDAH 1TMUH 1CE5A 1T8OA 3P95A 3UR6A 2Q6GA 2P8OC 3BG4B 1GHXH 1SQOA 2OCVB 1P9SA 2HALA 2UUFB 4BNRA 3DFLA 4RN6A 2G4UA 3EDXB 1N8OC 4GHTA 3P6ZB 4D9QA 3ZZ5A 2W7UA 1BMAA 2BDHA 1QJ7B 1ABIH 1LO6A 2FYRA 4I7YH 1DY9A 5FPTA 1HAYB 4FUDA 4ZH8A 1IQIA 1T32A 1C1WH 3PYHA 1GHBG 1THSH 1ANEA 1YKTA 2ZECA 3KIDU 1S81A 1J16A 3LJJA 6CHAB 4TWYA 2JH6D 1A0LA 1LVMA 2QXIA 1L1GA 2ZU1A 3PO1B 1P04A 3FP8E 1WYKA 4CRAA 1BMMH 5K0HA 1ZYOA 5FCRA 1W0ZU 1TBRH 4R0IA 4ABDA 3TJOA 3OY5U 4LK4A 2SNVA 1RTKA 4ABEA 1D3QB 4WMEA 1O3NA 1CA8B 2OD3B 3SU0A 3P8FA 4DGJA 1K1OA 2EI7A 2A4OA 4KP0A 1LDTT 2R2WU 1Y3YA 3M5LA 3SU5A 1ANDA 4LZ1H 1W14U 2Y81A 2B7DH 3QTOH 3MU8A 1OWJA 3L3TA 4WJG2 5EW2H 2ZHDA 1FNIA 2PUXB 4KGAA 2FDAA 3RXRA 1NFUA 1QL7A 1YC0A 2ZTZA 1GHVH 1GCTC 1SGQE 1WOFA 2K1QA 2H5DA 1SOZA 1Z6EA 4ZMAH 1ZPZA 2C3SA 4MNYA 3FANA 4Y10E 1GG6B 2AERH 2O8UA 3PLPA 3T26A 2F9NA 3SHCH 1NY22 1C5QA 4B2CA 1DSTA 2ANKH 4K8YA 4WXIA 3DUXH 3NCLA 1EJAA 3M5MA 1O30A 1F5KU 3E6PH 1NROH 4MPWA 1OX1A 1AZ8A 1VITH 1WQVH 3A7XA 1GDUA 1MTSA 1PQ8A 5FX5A 1BDAA 1C1SA 3SU6A 4BAOB 1VITG 3B23B 4KELA 3ATMA 4RKOB 5TJXA 1IHTH 1BTHH 1DSUA 3PLKA 3MH7A 2BVXH 3EA7A 4D8NA 3BIVH 4DT7B 2NU1E 2FI5E 1GBDA 2NU3E 4OS6A 3V13A 1Y5BT 3HPTB 1V2QT 5FBEA 1O2NA 3RMOH 2P94A 1ELVA 3D65E 1NRQH 1UVOA 2VNTA 3SI3H 3RU4E 3KHVA 1K21H 3P17H 2OC0A 3HKJB 3A7YA 2RA0A 2AH4X 4INKA 4I31A 1RIWB 9ESTA 5JBAS 2UWLA 3VB4A 1C1PA 1QY6A 2ZFRH 2D1JA 1GMDF 2WPHS 3ITIA 2OQUA 3MNSA 2VVCA 2P3FH 1TE0A 1UTNA 2FO9A 2UWOA 1HAVB 4XE4A 3ZZCA 2O9QA 1O2YA 1O33A 2GKVE 2HWLB 5GIBA 1QJ1B 3MH4A 3RXBA 1OWDA 4X8VH 2C4FH 2BD9A 1RS0A 3TPIZ 1O2WA 1GMDG 3U69H 1V3XA 2GCHG 3LGVA 5A0BA 3E16B 1AKSA 2CGAA 1QR3E 3AAUA 2J94A 1FIZA 4DY7B 1RIWC 2VB0A 2GDDA 3URCA 1SGCA 3F9GA 5GXPA 2ZG0H 1SI5H 1IQJA 3GYLB 1BT7A 2ULLA 3IG6B 4K60A 1O32A 4OGXA 3T29A 1P3CA 3V12A 1YCPM 4F4OC 5AF9H 4IN1A 3BEFB 4ASHA 5C3NA 1EJNA 3M7QA 4YT6H 1UJ1A 1IQGA 2H2ZA 2UUYA 1DUEA 5E2OA 1O5CB 4JZEH 1B5GH 2ZU2A 2ZPRA 3PO1C 3RMLH 1GMHF 2IOTA 3WY8A 2OP9A 3HGNA 1SOTA 2AIQA 4WMFA 2ZU5A 3KEEA 4OS7A 3RXTA 3RXDA 1AZZA 4AYVB 1Z6JH 1EXFA 2OC8A 1E36B 1AN1E 1Z8IB 4B76A 6LPRA 3A82A 1ZOMA 2Z3CA 4YESB 2GDEH 1GJ7B 1GBLA 3FAOA 5DP4A 1MKWH 3RUOA 1E38B 3ZZAA 1C5RA 4Q7YA 3ZVFA 1ARBA 3C1KA 2RDLA 1F5LA 1NESE 2OC7A 5EQRA 2FS9A 1A7SA 1GG6C 2TPIZ 3FZDA 1FPHH 1MKXH 2G4TA 2A4GA 1UCYE 1E37B 3RMNH 4CRCA 2H5CA 3GY2A 3TH4H 1SGFA 1KXCA 5FX6A 4A1TA 4A7IB 2PSYA 1SVPA 1G30B 3BTQE 2BDBA 3EQ0H 2D8WA 3FP7E 4U30A 1BTUA 1H4WA 5EGMA 3SO3A 1NO9H 4GHQA 1BRAA 3SOSA 3U1JB 1C4Y2 3UWJH 1C4U2 4X2VA 1TA6A 3GOVB 5K7RA 2ZFQH 4RKJB 3VPKA 1O5AB 1FQ3A 4JZIA 4ABHA 5C5NA 3V0XA 1KLIH 1GHAG 4OS1A 4WY3A 4BAMB 1P03A 4TWWA 4Y8YA 1Y8TA 1ZGVA 5DG6A 4ESTE 4CH8B 3QUMP 5AVDA 1P11E 2EI6A 3GCTG 2UWPA 5C1XA 1FY5A 3SZNA 4ISHH 5LPFA 2BD5A 2XW9A 2LPRA 4Y0YE 3L6PA 3DD2H 1GHAF 3PMAB 1GGDC 2CF8H 4NIWA 2KAIA 1HAOH 5ESTE 1ELTA 2SFAA 3M5NA 1FPCH 2FOBA 4IC6A 1SGNE 1VJ9U 2BLQA 5TCCA 3C27B 4MDSA 3VGCC 2JKHA 2XYAA 4D7FA 3LDXH 1ETSH 1EPTB 3RXSA 1G2MA 1MTNB 3MO9A 1QA7A 1O3GA 2P95A 1CT4E 1C2DA 2G00A 3VB6A 2R3UA 3E8LA 1TRMA 2ZDNA 2QGRA 5HMAA 4ABFA 2TIOA 2ZPQA 3GY3A 2TGTA 3TK6A 4MG3A 5H4IB 1SGRE 4ZUHA 2BVSH 4TPIZ 5JYIA 4NSYA 4U2WA 4GPGA 1FN6A 4UDWH 3STIA 1BA8B 1P01A 1DFPA 3PB1E 2A2XH 1FY3A 2AMDA 4ABJA 4B75A 1A3BH 3VGCB 1S82A 1MU8B 4XFQA 1VCQA 4YTAA 4AB9A 2V3HH 1TGCA 2FMJA 4Y7AA 2ZFSA 1AWHB 1EOJA 1V2RT 2CJIA 1D3PB 1O2ZA 2ZDKA 2ZDVH 1S83A 5EPYA 3RMMH 2AMPA 1P02A 1W0YH 1AFQB 2VGCB 2Z9KA 1AGJA 5EXMA 2ASUB 2PFEA 1UMAH 3ZZ8A 5HM9A 4YLQH 1EZXC 3A86A 3DT0H 1O3AA 4CR9A 2ZCLP 2J34A 1KLTA 5T6FA 1HLTH 4ABAA 1TPAE 2C8XB 2G5VA 1KYNA 1Z7KA 2HNTC 4MTBA 3GCHC 1DDJA 2WYGA 5L30H 3UQOA 1TRNA 1SFIA 2XC0A 3K6ZA 1V2OT 3TU7H 2VINA 3GCNA 2JETB 3E1XB 3ZZ6A 1ZGIA 2XRCA 1W7XH 3MWIU 1P09A 2FESH 1O37A 4MLFB 2UUKB 2ILNA 4BAQB 2TGAA 1EPTA 5DP7A 3TGJE 1YPLH 1KDQA 2SGAA 1CBWC 1KIGH 2Y5GA 1GL0E 4XBBA 1LTOA 3PLBA 4I8JA 3VXEH 1EAUA 1OOKB 5GWZA 1PJPA 3RP2A 1P10A 1GI9B 2BDGA 3QGNB 5EPNA 4OS5A 2A5AA 1ZRKA 1F5RA 3DFJA 4K8BA 4VGCB 4UFFH 1D3TB 1F0SA 1SGEE 1CA0B 4ISOA 5JB8S 5DPAA 1ORFA 2BLVA 3RU4D 1QQ4A 1GGDB 2OQ5A 2OINA 3BTWE 5PTPA 1LHDH 1JIRA 1ANCA 1FXYA 1XVOA 2I6QA 1GBBA 1AWFH 2VWNA 1DT2A 2A0QB 4JZDH 5C20A 3SUEA 2WUBA 1TA2A 5T3HA 1C1UH 1C5XB 1MZDA 1YPKH 2A32A 3UNQA 2BX4A 5GDSH 1GI4A 2VIWA 1UTKA 1O0DH 4FUIA 1RTLA 4NWLA 3CENA 4CH2B 3A83A 1A5GH 3RXOA 1UVUH 3TGKE 2QF0A 1SLXB 3GY4A 1G3CA 3PMBB 2GD4B 2M5TA 1OXGA 1WU1A 3U98H 1FY1A 2OC1A 3P8OA 4JYTA 3AW0A 1MTUA 2R2MB 1Y59T 1PQ5A 4YT7H 4MNWA 3ZVBA 1N6YA 3M5OA 4CBOA 3HKIB 1SR5C 1MTNC 4THNH 2AYWA 4U01A 5EG4A 3KCGH 2BVRH 3T25A 1K1LA 1EP5A 3RXLA 2TGDA 1GJ6A 2FYQA 3P8NA 1GJDB 2A4QA 3NWUA 1MBMA 4KKDA 3T5FH 4I8HA 5L2ZH 5T6DA 1F0TA 2GZ9A 2XBYA 3T62A 2H1UA 3O8BA 3RLYH 1TNGA 1OWHA 5ABWA 1KXBA 2I6SA 5F03A 1TNHA 5F8TA 5E0HA 2FLBH 1TMBH 1Z1JA 1C5YB 1YP9A 1AUTC 3MNXA 4ISNA 1K28D 3BV9B 1A3EH 1TIOA 1GCDA 4NWKA 2BXUH 1IQFA 3M3TA 5A2MH 1IQNA 1TOMH 2P3TB 3VB5A 4NIXA 1VJAU 3UFAA 7KMEH 3SGQE 2O8MA 1UHBA 1G32B 1DWEH 2EI8A 5A0AE 1EB1H 5EQQA 1ZTLA 3G01A 3S9AA 3O8RA 1DANH 1MBQA 1ZMNA 2F9VA 1ELFA 2ZF0H 1VITF 2ZU3A 1XUFA 2ZTYA 1XM1A 4O9VA 4CR5A 1L1NA 3EA8A 3D49H 3A7VA 2ZGJA 3LJOA 4H6SB 4ISIH 1WUNH 5CE1A 1RGQA 2HVXA 1HXFH 3DHKH 1CGHA 1TONA 1ELEE 3S0NA 1DOJA 3K6YA 3LKWA 4FU7A 1GBEA 3A8DA 3ZVCA 7LPRA 5DP3A 1DWDH 1UO6A 2CV3A 3UTUH 5DO4H 1CVWH 4CHAC 2YNAA 4X1SU 1AHTH 3BTKE 3ZVDA 6GCHF 3RM0H 2F9PA 2ZHWH 1OWKA 3OY6U 4M7GA 1TQ7B 4GCHF 1D4PB 2PR3A 1O2VA 2C93B 3KQDA 3SN8A 1N6XA 2XWBI 2ZC9H 4X8UH 2BHGA 3BTGE 4X2XA 1BIOA 2G8TA 4YZUA 1W3CA 2J4IA 3N7OA 1K1MA 4HZHA 1Y5AT 2H9HA 4J1YA 4AFZA 1TNLA 1O2IA 1TX7A 3AAVA 3RXQA 1O5BB 4FUGA 1TAWA 3U8OH 2F91A 2JH5D 1C2EA 1QGFA 2YNBA 1EX3A 4NIYA 5BPEA 1S84A 1T4UH 1Q31A 2FLRH 5F8XA 5CHAC 2Y82A 4E06H 3A7TA 4Q2KA 3A80A 1KXEA 1QHRB 3LH3A 3E3TA 4O03A 3TH2H 3P70B 2F3CE 2PKSB 1W8BH 4B73A 3SU4A 4NCYA 4LZ4B 1LPGB 2FI3E 4NZLA 4MVNA 5IYTA 1GJ8B 5A09A 1MH0A 3HATH 2QV1A 2THFB 5LH8A 1GDNA 5EOKA 4AX9H 1TGSZ 4YOGA 3W95A 1EQ9A 8GCHF 3T28A 3TVJB 3U9AH 1Q3XA 1A61H 2C90B 4CRFA 2CHAB 1LHFH 4KTUA 3R0FA 1B0EA 4WVPE 2ZHQH 1MAXA 1TPSA 4JMYA 1H9IE 1GBCA 3MMGA 3S9CA 4IW4E 4IMQA 4AN7A 2D2DA 5EODA 3FFGA 1S0QA 4FVBA 3M36A 3H5CB 2ZPSA 2FX4A 1YCPK 2PKSC 1O3HA 1NC6A 1SQTA 1UVPA 2QYIA 3E91A 1NPMA 1O2RA 4E7RG 3LGYA 4I33A 1O34A 1SGPE 2ZCHP 1ABJH 3R3GB 1H9HE 1HJ8A 5TCAA 3Q00A 3BTME 1QA0A 1HYLA 2EA3A 4LOYH 4YLUA 3SJ8A 1LPZB 3RXAA 1AY6H 1BUIA 4WMDA 1V2PT 1GPZA 4YOIA 1O3IA 1D9IA 1GI0A 3SJKA 2HNTE 1PPHE 4FUBA 5AFZH 3Q3XA 1CSOE 2SGEE 4ZKNU 2ANMH 4GSOA 1H8DH 4AG2A 1DS2E 1GBJA 1CT0E 1YBWA 1U6QA 1QNJA 1L4ZA 2Z3DA 5EXLA 3SW2B 3ESTA 2ZTXA 1KDQB 1BBRK 1MAYA 3F6UH 4X6OA 2XBWA 1TABE 3S7HB 1X7AC 3SNBA 3FZZA 1ELCA 4NFEA 3TNSA 4O3UA 4ZROA 1GVLA 2OBQA 1MZAA 1H1BA 1XVMA 1K1NA 3JZ2B 3KF2A 3A8BA 2EEKA 1F2SE 1GBFA 3M7UA 2HPPH 2ZEBA 2J92A 4GCHG 2G51A 4Q80A 2W3KA 1KXFA 1VZQH 2B9LA 5J4QA 3B9FH 1P8VC 2PV9B 1B7XB 1DLKB 1WAYB 4I8KA 1P2IA 1P3EA 1P2KA 2TRMA 3QLPH 1UK4A 5HXFA 2PGBB 4ABGA 2DUCA 3KL6A 4UFGH 3VFEA 4CBNA 1H9LB 2ZQ2A 1SMFE 4AOQA 3BTTE 2G55A 3SNDA 5C5OA 2ZFPH 1FUJA 3F9FA 3SORA 2UUJB 1TALA 5DP9A 5HYOA 1SHYA 1K22H 3GISB 1PQAA 3OSYA 2IPHA 3GCOA 4B1TA 4DOQA 2ZHFH 1PPFE 3GCHB 2PTCE 4NA7A 1Y3WA 4X0WU 1MCTA 4AZ2B 1O2LA 2ZQ1A 3SUGA 3UOUA 1UTQA 2OUAA 1Z1IA 1UTLM 3SV8A 1VGCC 1A1RA 1BHXF 7ESTE 1JXPA 1B0FA 3LC3A 1DXWA 5DGJA 4SGBE 1GMHG 2AGGX 3CP7A 4DW2U 5DK1A 1G3BA 3SNAA 1BJVA 1KTTB 1UTJA 1JWTA 1TB6H 1T4VH 1DX5M 2Q6FA 2Z9IA 3KNXA 1C9TA 4DJZB 3ZVAA 1NRRH 1XX9A 2HRVA 1O2UA 3M7TA 1RFNA 4MQAA 2ZI2H 2ODQA 3KGPA 2VH0A 1O3MA 5ETXA 4SGAE 1THRH 1A2CH 1EJMA 1IHSH 2FOGA 3O8DA 1C5LH 1WSSH 1O2PA 2Z9JA 1NT1A 1TPPA 1D3DB 3GDSA 1EZQA 2XBVA 3QDZB 3TK5A 1IAUA 1GBTA 1HGTH 2FOFA 2IN2A 3RXJA 1LKAA 4BAKB 1HXEH 2GMTC 4PROA 4BANB 2B5TB 1GBHA 4JZ1A 2BQ7B 1NZQH 3MU4A 3UIRA 1GVKB 1ZSJA 1GBAA 1SHHB 1YLDA 2VJ1A 2BOHB 1IQHA 1W11U 4NSVA 4WH8A 1C4V2 1C1TA 4F49A 2XCNA 2ZO3H 3LONA 1L2EA 4QT8C 5FHTA 5FPSA 1S6HA 3SJ9A 4H6TA 3AVZA 5GPIB 2BM2A 5GCHG 5EQSA 3MNBA 4ZXXH 2ZCKP 1Y3UA 1HIAB 1QBOA 1RRKA 4X1NU 1Z8JB 1Y5UT 1YPGH 2FPZA 3A7ZA 1PQ7A 1K1JA 1AVXA 2SGPE 3PV4A 3F9EA 1FIWA 1V2JT 3TJVA 1EAWA 3BTHE 4X1QU 3PWCA 3QTVH 4A92A 1MTVA 2VVVA 2G5NA 4UE7H 5AFYH 4Y8ZA 1AIXH 3A85A 3EAJA 3AASA 1ZMJA 2PKAA 1UTPA 3PROA 2GCHF 1NN6A 4ZAEA 3NPSA 3MHWU 1HAPH 2VIVA 1HRTH 2HNTF 1HBTH 3VXFH 5A8YA 3M61U 1XUHA 1OKXA 1QTFA 2VIPA 1C5NH 5CMXH 1PPBH 2TBSA 3VEQB 4E05H 4NA8A 1ZPCA 2J2UA 1GHZA 1G3EA 1QBNA 1OYTH 4IS5A 2ZIQH 2WPMS 2CMYA 1SL3A 1TNKA 1L0ZA 1FZZA 3NZIA 1O3BA 2GZ7A 1NRSH 1EOLA 2AGEX 3NK8A 4K3JA 4X6NA 2P16A 1C2HA 3MH6A 2GP9B 4NGAH 3TJNA 2H9TH 1TYNA 2Z9LA 5JDUB 3RC6A 1CHOG 2ZP0H 2ZGBH 1ZSKA 4BAHB 1PYTC 3K9XB 1O2TA 3Q76A 3TNTA 1GMCG 3U8TH 3BEIB 4WXVA 4HI3A 1HAXB 1XUJA 5DKMA 4O3TA 1Y3VA 2BY8X 1BTZA 1HIAA 1M9UA 2PHBA 1KXAA 2PGQB 5F8ZA 4JYVH 2HOBA 3TITA 2O8TA 2PKAB 4OS4A 1MKWK 3LH1A 3KQBA 1TBZH 5DJ7A 4U32A 1NM6A 4FUJA 3LGUA 4UEHH 2VVUA 1O5DH 1YPEH 1QJ6B 4X8SH 3ATLA 4Q7ZA 4Z0KA 3RM2H 4UFEH 3MH5A 4UD9H 1GJCB 2CHAC 4ZHMU 3BTEE 2BDIA 2FXRA 3BTFE 1LKBA 1C5TA 1QL9A 2BYAX 3NUMA 1HAIH 1J17T 2BXTH 4B2AA 1CGJE 1IQLA 3UOPA 5E0JA 4AGJA 2FEQH 1AB9C 2Q1JA 2HLCA 4FUHA 1O39A 1O3CA 4WWYA 2BD8A 4B2BA 1SLUB 2A5KA 1DPOA 3Q3YA 3ODDA 3MU5A 2F83A 2FX6A 1TNIA 3EE0B 1P2QA 4YM9A 4HGCA 2SGQE 2QF3A 1QRXA 4JCNA 1P57B 3A8AA 1LQEA 1LMWB 1UHBB 1QB1A 3RXMA 1BTWA 1SGDE 1JRTA 1WCZA 4BTUB 1S5SA 1BTYA 3K65B 1TFXA 2RCEA 2AEIH 3RXCA 1OYQA 1O2HA 1F7ZA 5I25A 4A6LA 4DCDA 1BHXB 3RXHA 2BDAA 1DICA 1A4WH 3BIUH 3KQEA 1EUFA 2P59A 1UVSH 2F9BH 2BX3A 5EW1H 3OU0A 1T8LA 1AVWA 1LQDB 4H4FA 2VU8E 1C1QA 5A0CA 3V7TA 1LHCH 5A8ZA 2PUQH 1V2LT 2ODYB 2QXGA 3I77A 1AMHA 2QN5T 1G9IE 3GY8A 3GICB 3QK1A 2OBOA 3ZZDA 2Z9GA 4YO9A 1HFDA 1C2IA 4J2YB 1AFQC 3VB3A 2FP7B 4DVAU 2BLOA 3LIWA 3LPRA 1V2KT 1GI6A 5JPMH 1FI8A 4GAWA 1QFKH 1SGTA 2WV5A 1XUGA 1AB9B 3RXKA 1G2LA 3BTDE 3M35A 7GCHF 1F92A 3PMHB 4X1RU 1W12U 5GJ4B 1CHOF 2XWAA 1ESTA 1MUEB 2BQ6B 1NS3A 2KAIB 1EZSC 1ZZZA 2V6NA 4K5ZA 2V0BA 2NU2E 1FN8A 2BY7X 2JETC 2P8OB 3BG4C 1GJ9B 3RDZA 4IGDA 4TY6A 2A7CA 2A7JA 3Q3KA 3MU1A 3QO6A 3W94A 1ZHPA 1GI2A 1ELAA 2FZZA 5FAHA 4Y76A 3E90B 1IQKA 2TGPZ 4AFSA 3UNRA 2BD2A 3UQVA 1Y3XA 2ANYA 2W26A 4BTIB 8GCHG 1CU1A 2PW8H 1DUAA 1HAVA 2ANWA 2ZDMA 2OXSA 5FPYA 2H9EH 3TH3H 2WPIS 2BOKA 3BSQA 1DWCH 3LGWA 1D6RA 3SUDA 4Y71A 3TJUA 4MNXA 2FOMB 1J9CH 1CGIE 1MQ6A 4BOHA 3MO6A 4K1TA 1XXFA 3RXVA 4GUXA 1HAHH 1O36A 1Z71A 3ODFA 3BN9A 2WINI 2NWNA 1NFYA 1N8OB 1P2MA 1LCYA 3UREA 1EB2A 1NRPH 3EA9A 1BBRE 3ELAH 1V6DA 3V3MA 3NXPA 3ENSB 1G37A 4VGCC 3OX7U 1L4DA 1UTMA 1C5ZB 4LXBH 3GDUA 3GY6A 5J4SA 1OS8A 1UVTH 1ARCA 2Y5FA 1H8IH 1G3DA 1SSXA 3SQHE 4JK6A 2PLXA 1O2KA 2IJOB 4HFPB 1DITH 1AUJA 2J38A 5AHGH 1TLDA 4XOJA 4CHAB 3GY5A 4XBCA 1ETTH 3MTYA 2FOAA 3LOXA 3ZVEA 1SBWA 4MPVA 3I29A 4K1EA 1HAGE 1AD8H 1W13U 2XC4A 1JOUB 1DXPA 4XDEA 5T6GA 1BRBE 2BMGB 1V2NT 3F68H 3SNCA 4A1VA 2VIDA 2ZZUH 1PYTD 1FLEE 1YPJH 4DIIH 2Z94A 1BTXA 1GJAB 2AS9A 1V2MT 2FOCA 1T7CA 1KLJH 3ZZ4A 3STJA 3K2UA 1CQQA 5LPRA 5C2ZA 1J15A 1BB0B 2FI4E 2WYJA 3ZZ7A 4D76A 2B8OH 3ZV9A 3RXPA 2WV4A 3EGKH 2H6MA 2HGTH 4R8TB 4Y6DA 3SU3A 3RXFA 2VIOA 2DE9A 1O2XA 1EZUC 1ZHRA 3A87A 2BD4A 1O2GH 2SGFE 1K2I1 1DM4B 1ACBE 5EXNA 1AI8H 1E35B 3Q77A 4Y11E 1DWBH 1ZTJA 1D6WA 1P2OA 2A4RA 4WF8A 5EU8A 5IDKA 2A2QH 1YM0A 3QN7A 2VIQA 3LGTA 1HAZB 2W3IA 1FV9A 1NU9A 1KSNA 3MI4A 1V2VT 3ZYDA 4X6PA 4BTTB 3RC5A 1YF4A 3A8CA 5I46H 1S0RA 1P05A 4TPYA 4Y79A 2BLWA 1OP2A 1TRYA 5FXLA 1ZLRA 3LC5A 1ELDE 1UCYH 1UTOA 1C1MA 5DP5A 5HGGA 2ODPA 3PWBA 5CHAB 1SG8B 4CRBA 1HV7A 1FY8E 1EATA 2VWOA 3SI4H 4K2YA 4OS2A 1KXDA 1JMOH 2CN0H 2STBE 1ZR0A 2BDYA 1WTGH 3MO3A 1C5PA 2SGDE 4KTSA 1O3DA 3RC4A 1SPJA 1GHWH 4AG1A 3SU1A 3BG8A 3U8RH 1VGCB 2F9UA 1LHGH 3LU9B 5BRRE 2RA3A 4INLA 1RXPA 5E8EH 2XC5A 2A31A 3GCTF 5LGOA 1P9UA 2GZ8A 1S85A 1O5FH 4XSKU 1V2ST 2Y7ZA 5GCHF 3FVFB 1G36A 4OGYA 3SGBE 2GV6A 2A5IA 2OLGA 4MNVA 2DE8A 1RTFB 1TGTA 3MYWA 3QZQA 4ABIA 1C2MA 2ZA5A 3SJOA 1P06A 1GVZA 1YYY1 1E34B 3SBKA 1C2JA 6ESTA 1AE5A 2RG3A 2GT7A 1O3LA 1JBUH 4NIVA 4AORA 1QIXB 5F6MA 3D62A 1K9OE 2BZ6H 1ZTKA 4O97A 4Z6AH 1SQAA 2Z6BD 1INCA 2GGVB 2QA9E 4FUFA 2ZDLA 4FUCA 1P2NA 4CRDA 2CF9H 1O35A 5JBBS 3RXUA 1HNEE 3E0PB 3SNEA 1GJBB 2C8WB 4X2WA 7GCHG 2FWWA 3SJIA 2QXJA 1GMCF 1BITA 1BOQA 1JIMA 1XKAC 2QIQA 1F0RA 1SGIB 1K1PA 2GX4A 1MTWA 1HDTH 4TY7A 4X1PU 3OYPA 1FJSA 3RXIA 4IMZA 2ZGCA 4GVUA 3NKKA 2VGCC 2ESTE 3SV6A 4FXGH 1MMJN 1KY9A 2ZNKH 1CA0C 1MQ5A 1BQYA 4KTCA 5SGAE 2P93A 1C2LA 3SU2A 3D23A 2C8YB 1QQUA 1GBKA 1SLVB 2SNWA 1GI7B 1GI5A 4B71A 2Y7XA 8KME2 1KTSB 1HJAB 2BZAA 1EP6A 2PWXA 2FS8A 3HK3B 3RLWH 2A45B 2V3OH 2FM2A 1XUIA 4HTCH 4ZKSU 1WBGB 4X8TH 3S69A 1DY8A 1A5HA 1HJ9A 3F1SB 1A46H 1L1JA 2XBXA 4XBDA 1GL1A 3ZZ3A 1TQ0B 1GI1A 1VCWA 5HM2A 1QB6A 2WPLS 3MNCA 1ELBA 1P2JA 4MPUA 1QCPA 4FU9A 3U1IB 1YGCH 1GWAA 1FY4A 6GCHG 5C1YA 1ZJKA 1ZRBA 2O8LA 4ZHLU 2GCTC 1AE8H 1EPTC 5DP6A 1XMNB 1SGYE 3MFJA 4I32A 2ALPA 4WH6A 1S6FA 1TBQH 3L33A 3BF6H 3VB7A 5E0GA 1CHGA 1EAXA 3PTNA 4A1XA 1TWXB 1OP0A 1P12E 3QGJA 2XNIA 1YPHC 2BB4A 1ZPBA 4JYUH 5ESBA 4YOJA 1T31A 1ANBA 3A7WA 3ZZBA 1RJXB 2BD3A 2PSXA 5JB9S 2FIRH 1SC8U 1K1IA 1GBMA 3AW1A 1WV7H 4UFDH 3H7TA 3IWMA 1IQMA 2GV7A 1GDQA 1O3EA 8ESTE 3SHAH 1ELGA 5FCKA 2YOLA 2WUCA 1W2KH 1UK2A 1YCPH 1O3OA 1T8NA 1GHBF 1ZJDA 1OPHB 2AMQA 4ABBA 4DG4A 1QL8A 2ZFTA 3UWIA 3BEUA 4FUEA 1XUKA 1BZXE 2ZWLH 3LGIA 1ETRH 1ESAA 3ZVGA 2C8ZB 4NG9H 2GMTB 3ZZ9A 4AYYB 1J14A 1C1NA 5C67A 5E2PA 4FVDA 3E0NB 1TOCB 1TX6A 3HGPA 4DIHH 2BD7A 1LPKB 1BTPA 5A8XA 1FDPA 4TYDA 4NZQA 1C5MD 4ZKRU 1C1OA 1C5OH 5L2YH 4IN2A 4Q7XA 1AVGH 2VWLA 1Q2WA 1GJ5H 2ZU4A 4CREA 1ZHMA 2WPJS 8LPRA 1TPOA 1QRWA 5G4BA 1XKBC 3KN2A 1OP8A 1O3PB 4I8GA 3PM3A 1EASA 2A1DB 1O3KA 4RSPA 3TLOA 1PPEE 4FU8A 4K69A 1W10U 1C1VH 1DE7H 2XXLA 4ZKOU 1MCVA 1NU7B 3SQEE 4D9RA 1PFXC 3H7OA 1CT2E 2O8WA 1YLCA 2GT8A 2WPKS 1YPMH 1C5VA 4B74A 5B6OA 1T8MA 2FOHA 3TIUA 1AKSB 2J9NA 4GLYA
chains in the Genus database with same CATH superfamily
3A89A 2QY0B 2Y80A 2AGIX 2XTTB 2ZFFH 1C5UA 1HCGA 2R3YA 1UCYK 3F3BA 3F9HA 1C5WB 1QRZA 4INHA 2NU4E 2AIPA 3RXEA 1TMTH 3ATKA 2VH6A 1AFEH 1F0UA 2QC2A 4BXWA 1BMFD 2FTLE 1BRCE 3VG8A 1FMGA 1O31A 4E7NA 1C9PA 1PPGE 2V35A 4AFUA 2QXHA 3QWCH 2KM0A 2G52A 1OWIA 2LP6A 2Y6TA 2W7SA 4X6MA 3SUFA 2A7HA 1ESBA 1O2SA 2NU0E 2BTCE 1C5SA 1JRSA 3P8GA 4IC5A 5IK2D 5C0UA 1TX8A 1GHYH 1BMLA 2M2AA 5JBCS 1BJUA 3UY9A 5HKKD 3QZRA 1YPHE 3O8CA 1FONA 1NRNH 3T2NA 1CBWB 4AFQA 4BXSA 1GI3A 1WQSA 1AQ7A 2VWMA 3RU4T 3GY7A 2AFQB 5T1VA 1RD3B 3I78A 1LVYA 3CS0A 1TGBA 3SV9A 1SFQB 1SGFG 3NRLA 1O3FA 1Z8RA 4Y7BA 2G81E 1A0HB 1QB9A 4ZXYH 1YWUA 5FBIA 4X2YA 1Z8GA 1C1RA 3CS7A 4DURA 1DVAH 4MPXA 3M3VA 1NTPA 1C2KA 3TGIE 2Y5HA 1O2OA 4NFFA 9LPRA 2OTVA 4ZHAA 2GCTB 3URDA 4K1SA 1THPB 1WDIA 1GI8B 3F0OA 3MU0A 4Y8XA 2GTBA 1O2QA 4Y0ZE 3KQCA 3GDVA 2STAE 2R0LA 1O38A 2B0FA 4UONA 5LPEA 2KCPA 3UPEA 1OWEA 1A5IA 2P3UB 1NFWA 3A84A 4IBLH 3PMJA 4AB8A 1VCPA 2LNCA 3B8JA 1IOEA 1EKBB 3A88A 1IQEA 1O5EH 3KYFA 3S7KB 2EC9H 2BDCA 1EAIA 1WTHD 1PPCE 1FAXA 1MU6B 2R0KA 1SB1H 3M37A 4JZFH 5C1UA 4AGKA 1ID5H 3ZYEA 1O3JA 1A0JA 1HB0B 2F9OA 1LVOA 1C2FA 3SV2H 1HPGA 1VR1H 1LVBA 3WW7A 1AU8A 3MOCA 2Z7FE 1QURH 1BRUP 1HJAC 3RXGA 4H42U 3QX5H 4D7GA 1E1QD 2FOEA 1SLWB 2PTNA 3EYDA 4CRGA 1QBVH 3SV7A 1O5GH 2FODA 3A81A 1BBRH 1MD7A 1P0SH 1PPZA 2BY6X 3UUZA 3FP6E 1DLEA 1GCTB 2XCFA 3DA9B 1MD8A 1CO7E 2Z3EA 3TK9A 2JH0D 2BY5X 3M3SA 2CXVA 2GVFA 2FTMA 2ZKSA 1W7GH 1TGNA 4I8LA 2W5EA 1ZSLA 1HUTH 4A5TS 1O2JA 2BQWB 1J8AA 2Q6DA 2R9PA 1V2UT 5HIYA 5C94A 3ZV8A 1AO5A 3UR9A 1O2MA 1V2WT 2D26C 1TNJA 3IITA 1N1LA 4NA9H 1XXDA 5KEDA 1ZMLA 2ZGXH 3ATIA 5KGOA 3SGAE 2J95A 1LHEH 3HK6B 2HPQH 3ATWA 1GBIA 3OTJE 4ISLA 3UNSA 2ZGHA 1GJ4H 1OSSA 2ALVA 4JK5A 3P92A 2RFKC 3GYMA 1C2GA 1UK3A 2ZHEH 3S9BA 3T27A 1MKXK 5DP8A 1E0FD 3JZ1B 3PTBA 5JBTA 2AHME 3LT3A 1BCUH 1NFXA 1FAKH 2BY9X 2QAAA 6CHAC 1V2TT 5L6NH 1BMNH 2WV9A 2QCYA 2ZDAH 1TMUH 1CE5A 1T8OA 3P95A 3UR6A 2Q6GA 2P8OC 3BG4B 1GHXH 1SQOA 2OCVB 1P9SA 2HALA 2UUFB 4TSFD 4BNRA 3DFLA 2XOKD 4RN6A 3OEED 4HG6A 2G4UA 3EDXB 1N8OC 4GHTA 3P6ZB 4D9QA 3ZZ5A 2W7UA 1BMAA 2BDHA 1QJ7B 1ABIH 1LO6A 2FYRA 4I7YH 1DY9A 5FPTA 1HAYB 4FUDA 4ZH8A 1IQIA 1T32A 1C1WH 3PYHA 1GHBG 1THSH 2K0QA 1ANEA 1YKTA 2ZECA 3KIDU 1S81A 1J16A 3LJJA 6CHAB 4TWYA 2JH6D 1A0LA 1LVMA 2QXIA 1L1GA 2ZU1A 3PO1B 1P04A 2HVYB 3FP8E 1WYKA 4CRAA 1BMMH 5K0HA 1ZYOA 5FCRA 1W0ZU 1TBRH 4R0IA 4ABDA 3TJOA 3OY5U 4LK4A 2SNVA 1RTKA 4ABEA 1D3QB 4WMEA 1O3NA 1CA8B 2OD3B 3SU0A 3P8FA 4DGJA 1K1OA 2EI7A 2A4OA 4KP0A 1LDTT 2R2WU 1Y3YA 3M5LA 3SU5A 1ANDA 4I86A 4LZ1H 1W14U 2Y81A 2B7DH 3QTOH 3MU8A 1OWJA 3L3TA 4WJG2 5EW2H 3AK5A 2ZHDA 1FNIA 2PUXB 4KGAA 2FDAA 3RXRA 1NFUA 1QL7A 1YC0A 4P02A 2ZTZA 1GHVH 1GCTC 1SGQE 1WOFA 2K1QA 2H5DA 1SOZA 3N7EA 1Z6EA 4ZMAH 1ZPZA 2C3SA 4MNYA 3FANA 4Y10E 1GG6B 2AERH 2O8UA 3PLPA 3T26A 2F9NA 3SHCH 1NY22 1C5QA 4B2CA 3F2FA 1DSTA 2ANKH 4K8YA 4WXIA 3DUXH 3NCLA 1EJAA 3M5MA 1O30A 1F5KU 3E6PH 3SZEA 1NROH 4MPWA 1OX1A 1AZ8A 1VITH 1WQVH 3A7XA 1GDUA 1MTSA 1PQ8A 5FX5A 1BDAA 1C1SA 3SU6A 4BAOB 1VITG 3B23B 4KELA 3ATMA 4RKOB 5TJXA 3WWBA 1IHTH 1BTHH 1DSUA 3PLKA 3MH7A 2BVXH 3EA7A 4D8NA 3BIVH 4DT7B 2NU1E 2FI5E 1GBDA 2NU3E 4OS6A 3V13A 1Y5BT 3HPTB 1V2QT 5FBEA 1FX0B 1O2NA 3RMOH 2P94A 1ELVA 3D65E 2J97A 1NRQH 1UVOA 2VNTA 3SI3H 3RU4E 3KHVA 1K21H 3P17H 3WWFA 2OC0A 3HKJB 4F55A 3A7YA 2RA0A 2AH4X 4INKA 4I31A 1RIWB 9ESTA 5JBAS 2UWLA 3VB4A 1C1PA 1QY6A 5FL7D 2ZFRH 2D1JA 1GMDF 2WPHS 3ITIA 2OQUA 3MNSA 2VVCA 2P3FH 1TE0A 1UTNA 2FO9A 2UWOA 1HAVB 4XE4A 3ZZCA 2O9QA 1O2YA 1MABB 1O33A 1YLNA 2GKVE 2HWLB 5GIBA 1QJ1B 2JJ1D 3MH4A 3RXBA 1OWDA 4X8VH 2C4FH 2BD9A 1RS0A 3TPIZ 1O2WA 1GMDG 3DCLA 3U69H 1V3XA 2GCHG 3LGVA 5A0BA 3E16B 1AKSA 2CGAA 1QR3E 1SQRA 3AAUA 2J94A 1FIZA 2K8IA 4DY7B 3U28C 1RIWC 2VB0A 2GDDA 3URCA 1SGCA 3F9GA 5GXPA 2ZG0H 1SI5H 1IQJA 3GYLB 1BT7A 2ULLA 3IG6B 4K60A 1O32A 4OGXA 3T29A 1P3CA 3V12A 1YCPM 4F4OC 5AF9H 4IN1A 3BEFB 3OE7D 4ASHA 5C3NA 1EJNA 3M7QA 4YT6H 1UJ1A 1IQGA 2H2ZA 2UUYA 1DUEA 5E2OA 1O5CB 4JZEH 1B5GH 2ZU2A 2ZPRA 3PO1C 3RMLH 1GMHF 2IOTA 3WY8A 2OP9A 3HGNA 1SOTA 2AIQA 4WMFA 2ZU5A 3KEEA 4OS7A 3RXTA 3RXDA 1AZZA 4AYVB 1Z6JH 1EXFA 2OC8A 1E36B 4ZCNA 1AN1E 1Z8IB 4B76A 6LPRA 3FKSD 3A82A 1ZOMA 2Z3CA 2KCOA 4YESB 2GDEH 1GJ7B 3H09A 1GBLA 3FAOA 5DP4A 1MKWH 3RUOA 1E38B 3F2GA 3ZZAA 1C5RA 4Q7YA 3ZVFA 1ARBA 3C1KA 2RDLA 1W0KD 1F5LA 1NESE 3OTPA 2OC7A 1H8ED 5EQRA 2FS9A 1A7SA 1GG6C 2TPIZ 3FZDA 1FPHH 1MKXH 2G4TA 2A4GA 1UCYE 1E37B 3RMNH 4CRCA 2J98A 2H5CA 3GY2A 3TH4H 1SGFA 1KXCA 5FX6A 4A1TA 4A7IB 2PSYA 1SVPA 1G30B 3BTQE 2BDBA 2XNDD 3EQ0H 2D8WA 4RT0A 3FP7E 4U30A 1BTUA 1H4WA 5EGMA 3SO3A 1NO9H 4GHQA 1BRAA 3SOSA 3U1JB 1C4Y2 3DSOA 3UWJH 4ACAA 1C4U2 4X2VA 1TA6A 3GOVB 5K7RA 2ZFQH 4RKJB 3F0PA 3VPKA 1O5AB 2YMSD 1FQ3A 4JZIA 4ABHA 5C5NA 3V0XA 1KLIH 1GHAG 4OS1A 4WY3A 4BAMB 1P03A 2PP6A 4TWWA 4Y8YA 1Y8TA 1ZGVA 5DG6A 4ESTE 4CH8B 3QUMP 5AVDA 5EIYA 1P11E 2EI6A 3GCTG 2UWPA 5C1XA 1FY5A 3SZNA 4ISHH 5LPFA 2BD5A 2XW9A 2LPRA 4Y0YE 3L6PA 3DD2H 1GHAF 3PMAB 1GGDC 2CF8H 4NIWA 2KAIA 1HAOH 5ESTE 1ELTA 2SFAA 3M5NA 1FPCH 2FOBA 4IC6A 1SGNE 1VJ9U 2BLQA 5TCCA 3C27B 4MDSA 3VGCC 2JKHA 2XYAA 4D7FA 3LDXH 1ETSH 1EPTB 3RXSA 1G2MA 1MTNB 3MO9A 2QF5A 1QA7A 1O3GA 2P95A 1CT4E 1C2DA 2G00A 3VB6A 2R3UA 3E8LA 1TRMA 2ZDNA 2QGRA 5HMAA 4ABFA 2TIOA 2ZPQA 3GY3A 2TGTA 3TK6A 4MG3A 5H4IB 1SGRE 4ZUHA 2BVSH 4TPIZ 5JYIA 4NSYA 4YXWD 4U2WA 4GPGA 1FN6A 4UDWH 3STIA 1BA8B 1P01A 1DFPA 3PB1E 2A2XH 2IPQX 1FY3A 2AMDA 4ABJA 4B75A 1A3BH 3VGCB 1S82A 1MU8B 4XFQA 1VCQA 4YTAA 4AB9A 2V3HH 1TGCA 2FMJA 4Y7AA 2ZFSA 1AWHB 1EOJA 1V2RT 2CJIA 1D3PB 1O2ZA 2ZDKA 2ZDVH 1S83A 5EPYA 3RMMH 2AMPA 1P02A 1W0YH 1AFQB 2VGCB 2Z9KA 1AGJA 5EXMA 2ASUB 2PFEA 1UMAH 2W6JD 3ZZ8A 4YLQH 5F53A 5HM9A 1EZXC 3A86A 3DT0H 1O3AA 4CR9A 2ZCLP 2J34A 1KLTA 5T6FA 1HLTH 4ABAA 1TPAE 2C8XB 2EY4C 2G5VA 1KYNA 1Z7KA 2HNTC 4MTBA 3GCHC 4RT1A 1DDJA 2WYGA 5L30H 3UQOA 1TRNA 1SFIA 2XC0A 3K6ZA 1V2OT 3TU7H 2VINA 3GCNA 2JETB 3E1XB 3N99A 3ZZ6A 4XD7D 1ZGIA 2XRCA 1W7XH 3MWIU 1P09A 2FESH 1O37A 4MLFB 2UUKB 2ILNA 4BAQB 2TGAA 1EPTA 5DP7A 3TGJE 1YPLH 1KDQA 2SGAA 1CBWC 1KIGH 2Y5GA 1GL0E 4XBBA 1LTOA 3PLBA 4I8JA 3VXEH 1EAUA 1OOKB 5GWZA 1PJPA 4Z1MD 3RP2A 1P10A 1GI9B 2BDGA 2V3MA 3QGNB 5EPNA 4OS5A 2A5AA 1ZRKA 1F5RA 3DFJA 4K8BA 4VGCB 4UFFH 3UAIC 1D3TB 1F0SA 1SGEE 1CA0B 2KZ4A 4ISOA 5JB8S 5DPAA 1ORFA 2BLVA 3RU4D 1QQ4A 1GGDB 2OQ5A 2OINA 3BTWE 5EJZA 1LHDH 1JIRA 1ANCA 5PTPA 1FXYA 1XVOA 2I6QA 1GBBA 2KCAA 1AWFH 2VWNA 1DT2A 2A0QB 4JZDH 5C20A 3SUEA 2WUBA 1TA2A 5T3HA 1C1UH 1C5XB 1MZDA 1YPKH 2A32A 3UNQA 2BX4A 5GDSH 1GI4A 2VIWA 1UTKA 1O0DH 4FUIA 1RTLA 4NWLA 3CENA 4CH2B 3A83A 3OEHD 1A5GH 3RXOA 1UVUH 3TGKE 2QF0A 1SLXB 3GY4A 1G3CA 3PMBB 2GD4B 2M5TA 1OXGA 1WU1A 3U98H 1FY1A 5C0TA 2OC1A 3P8OA 4JYTA 3AW0A 1MTUA 1NBME 2R2MB 1Y59T 5HIZA 1PQ5A 4YT7H 4MNWA 3ZVBA 1N6YA 3M5OA 4CBOA 3HKIB 1SR5C 1MTNC 4THNH 2QF4A 2AYWA 4U01A 5EG4A 3KCGH 2BVRH 3T25A 1K1LA 1EP5A 5CDFE 3RXLA 2TGDA 1GJ6A 3DSPA 2FYQA 3P8NA 1GJDB 2A4QA 3NWUA 1MBMA 4KKDA 3T5FH 4I8HA 5L2ZH 5T6DA 1SKYE 1F0TA 2GZ9A 2XBYA 3T62A 2H1UA 3O8BA 3RLYH 1TNGA 1OWHA 5ABWA 1KXBA 2I6SA 5F03A 1TNHA 5F8TA 5E0HA 2FLBH 1TMBH 1Z1JA 1C5YB 1YP9A 1AUTC 3MNXA 4ISNA 1K28D 3BV9B 1A3EH 1TIOA 1GCDA 4NWKA 2BXUH 1IQFA 3M3TA 5A2MH 1IQNA 1TOMH 2P3TB 3VB5A 3F2HA 4NIXA 1VJAU 3UFAA 7KMEH 3SGQE 2O8MA 1UHBA 1G32B 2EI8A 1DWEH 4Q63A 5A0AE 1EB1H 5EQQA 1ZTLA 3G01A 3S9AA 3O8RA 1DANH 1MBQA 1ZMNA 2F9VA 1ELFA 3FN8A 2ZF0H 1VITF 2ZU3A 1XUFA 2ZTYA 1XM1A 3MQKC 4O9VA 4CR5A 1L1NA 3EA8A 3D49H 3A7VA 2ZGJA 3LJOA 4H6SB 4ISIH 1WUNH 5CE1A 1RGQA 2HVXA 1HXFH 3DHKH 1CGHA 1TONA 1ELEE 3S0NA 1DOJA 3K6YA 3LKWA 4FU7A 1GBEA 3A8DA 3ZVCA 7LPRA 5DP3A 3ZIAD 1DWDH 1UO6A 2CV3A 3UTUH 5DO4H 1CVWH 4CHAC 3KYGA 2YNAA 4X1SU 1AHTH 3BTKE 3ZVDA 6GCHF 3RM0H 2F9PA 2ZHWH 1OWKA 3OY6U 4M7GA 1TQ7B 4GCHF 1D4PB 2PR3A 1O2VA 2C93B 3KQDA 3SN8A 1N6XA 2XWBI 2ZC9H 4X8UH 2BHGA 3BTGE 4X2XA 1BIOA 2G8TA 4YZUA 1W3CA 2J4IA 3N7OA 1K1MA 4HZHA 1Y5AT 2H9HA 4J1YA 1H8HD 4AFZA 1TNLA 1O2IA 1UW7A 1TX7A 3AAVA 4DT4A 3RXQA 1O5BB 4FUGA 1TAWA 3OAAD 3U8OH 2F91A 2JH5D 1C2EA 1VKYA 4FETA 1QGFA 2JIZD 5GNDA 2YNBA 1EX3A 4NIYA 5BPEA 1S84A 1T4UH 1Q31A 2FLRH 5F8XA 5CHAC 2Y82A 4E06H 3A7TA 4Q2KA 3A80A 1KXEA 1QHRB 3LH3A 3E3TA 4O03A 3TH2H 3P70B 2F3CE 2PKSB 1W8BH 4B73A 3SU4A 4NCYA 4LZ4B 1LPGB 2FI3E 4NZLA 4MVNA 5IYTA 1GJ8B 5A09A 1MH0A 3HATH 2QV1A 2THFB 5LH8A 3DSGA 1GDNA 5EOKA 4AX9H 1TGSZ 4YOGA 3W95A 1EQ9A 8GCHF 3T28A 3TVJB 3U9AH 1Q3XA 1A61H 2C90B 4CRFA 2CHAB 1LHFH 4KTUA 3R0FA 1B0EA 4WVPE 2WSSD 1W0JD 2ZHQH 1MAXA 1TPSA 4JMYA 1H9IE 1GBCA 3MMGA 3S9CA 4XRNA 4IW4E 4IMQA 4AN7A 2D2DA 4B6FA 5EODA 3FFGA 3OFND 1S0QA 4FVBA 3M36A 3PRBA 3H5CB 2ZPSA 2FX4A 1YCPK 2PKSC 1O3HA 1NC6A 1SQTA 1UVPA 2QYIA 3E91A 1NPMA 1O2RA 4E7RG 3LGYA 4I33A 1O34A 1SGPE 2ZCHP 1ABJH 3R3GB 1H9HE 1HJ8A 5TCAA 3Q00A 3BTME 1QA0A 1HYLA 2EA3A 4LOYH 4YLUA 3SJ8A 1LPZB 3RXAA 1AY6H 1BUIA 4WMDA 1V2PT 1GPZA 4YOIA 1O3IA 1D9IA 1GI0A 2W6ID 3SJKA 2HNTE 1PPHE 4FUBA 5AFZH 3Q3XA 1CSOE 2V7QD 2SGEE 4ZKNU 1E79D 2ANMH 4GSOA 1H8DH 4AG2A 1DS2E 1GBJA 1EFRD 1CT0E 1YBWA 1U6QA 1QNJA 1L4ZA 2F4LA 2Z3DA 5EXLA 3SW2B 3ESTA 2ZTXA 1KDQB 1BBRK 1MAYA 2F43B 3F6UH 4X6OA 2XBWA 3CNRA 5CHBA 1TABE 3S7HB 1X7AC 3SNBA 5DN6D 5KECA 3FZZA 1ELCA 4NFEA 3TNSA 4O3UA 4ZROA 1GVLA 2OBQA 1MZAA 1H1BA 1XVMA 1K1NA 3JZ2B 3KF2A 3A8BA 2EEKA 1F2SE 1GBFA 3M7UA 2HPPH 2ZEBA 2J92A 4GCHG 2G51A 4Q80A 2W3KA 1KXFA 1VZQH 2B9LA 5J4QA 3B9FH 2JDID 1P8VC 2PV9B 1B7XB 1DLKB 1WAYB 4I8KA 1P2IA 2RDEA 1P3EA 1P2KA 2TRMA 3QLPH 1UK4A 5HXFA 1E1RD 2PGBB 4ABGA 2DUCA 3KL6A 4UFGH 3VFEA 4CBNA 1H9LB 2ZQ2A 1SMFE 4AOQA 3BTTE 2G55A 3SNDA 5C5OA 2ZFPH 1FUJA 3F9FA 3SORA 2UUJB 1TALA 5DP9A 5HYOA 1SHYA 1K22H 3GISB 1PQAA 3OSYA 2IPHA 3GCOA 4B1TA 4DOQA 2ZHFH 1PPFE 3GCHB 2PTCE 1QZ8A 4NA7A 1Y3WA 4X0WU 1MCTA 4AZ2B 1O2LA 2ZQ1A 3SUGA 3UOUA 1UTQA 2OUAA 1Z1IA 1UTLM 3SV8A 1VGCC 1A1RA 1BHXF 2KR7A 7ESTE 1JXPA 1B0FA 3LC3A 1DXWA 5DGJA 4SGBE 1GMHG 2AGGX 3CP7A 4DW2U 5DK1A 1G3BA 4ACBA 3SNAA 1BJVA 1KTTB 1UTJA 1JWTA 1TB6H 1T4VH 1DX5M 2Q6FA 2Z9IA 3KNXA 1C9TA 4DJZB 3ZVAA 1NRRH 1XX9A 2HRVA 1O2UA 1OHHD 3M7TA 1RFNA 4MQAA 2ZI2H 2ODQA 3KGPA 2VH0A 1O3MA 5ETXA 4SGAE 1THRH 1A2CH 1EJMA 1IHSH 2FOGA 3O8DA 1C5LH 1WSSH 1O2PA 2Z9JA 1NT1A 1TPPA 1D3DB 3GDSA 1EZQA 2XBVA 2YMSB 3QDZB 3TK5A 1IAUA 1GBTA 2JJ2D 1HGTH 2FOFA 2IN2A 3RXJA 1LKAA 4BAKB 1HXEH 2GMTC 4PROA 4BANB 2B5TB 1GBHA 4JZ1A 2BQ7B 1NZQH 4M9FA 3MU4A 3UIRA 1GVKB 1ZSJA 1GBAA 1SHHB 1YLDA 2VJ1A 2BOHB 1IQHA 1W11U 4TT3D 4NSVA 4WH8A 1C4V2 1C1TA 4F49A 2XCNA 2ZO3H 3LONA 1L2EA 4QT8C 5FHTA 5FPSA 1S6HA 5C17A 3SJ9A 4H6TA 3AVZA 5GPIB 2BM2A 5GCHG 5EQSA 3MNBA 4ZXXH 2ZCKP 1Y3UA 1HIAB 1QBOA 1RRKA 4X1NU 1Z8JB 1Y5UT 1YPGH 2FPZA 3A7ZA 1PQ7A 1K1JA 1AVXA 2SGPE 3PV4A 3F9EA 1FIWA 1V2JT 3TJVA 1EAWA 3BTHE 4X1QU 3PWCA 3QTVH 4A92A 1MTVA 2VVVA 2G5NA 3KQ5A 4UE7H 5AFYH 4Y8ZA 1AIXH 3A85A 3EAJA 3AASA 1ZMJA 2PKAA 1UTPA 3PROA 2GCHF 1NN6A 4ZAEA 3NPSA 3MHWU 1HAPH 5EJLA 2VIVA 1HRTH 2HNTF 1HBTH 3VXFH 5A8YA 3M61U 1XUHA 1OKXA 1QTFA 2VIPA 1C5NH 5CMXH 1PPBH 2TBSA 3VEQB 4E05H 4NA8A 1ZPCA 2J2UA 1GHZA 1G3EA 1QBNA 4AC9A 1OYTH 3FOAA 4IS5A 2ZIQH 2WPMS 2CMYA 1SL3A 2QE7D 1TNKA 1L0ZA 1FZZA 3NZIA 1O3BA 2GZ7A 1NRSH 1EOLA 2AGEX 3NK8A 4K3JA 4X6NA 2P16A 1C2HA 3MH6A 2GP9B 4NGAH 3TJNA 2H9TH 1TYNA 2Z9LA 5JDUB 3RC6A 1WXRA 1CHOG 2ZP0H 2ZGBH 1ZSKA 4BAHB 1PYTC 3K9XB 1O2TA 3Q76A 3TNTA 1GMCG 3U8TH 3BEIB 4WXVA 4HI3A 1HAXB 1XUJA 5DKMA 4O3TA 1Y3VA 2BY8X 1BTZA 1HIAA 1M9UA 2PHBA 1KXAA 2PGQB 5F8ZA 4JYVH 2HOBA 3TITA 2O8TA 2PKAB 4OS4A 1MKWK 3LH1A 3KQBA 1TBZH 5DJ7A 4U32A 1NM6A 4FUJA 3LGUA 4UEHH 2VVUA 1O5DH 1YPEH 1QJ6B 4X8SH 3ATLA 4Q7ZA 4Z0KA 3RM2H 4UFEH 3MH5A 4UD9H 1GJCB 2CHAC 4ZHMU 3BTEE 2BDIA 2FXRA 3BTFE 1LKBA 1C5TA 1QL9A 2BYAX 3SYJA 3NUMA 1HAIH 1J17T 2BXTH 4B2AA 1CGJE 1IQLA 3UOPA 5E0JA 4AGJA 2FEQH 1AB9C 2Q1JA 1COWD 2HLCA 4FUHA 1O39A 1O3CA 4WWYA 2BD8A 4B2BA 1SLUB 2A5KA 1DPOA 3Q3YA 3ODDA 3MU5A 2F83A 1S6LA 2FX6A 3UB0A 1TNIA 3EE0B 1P2QA 4YM9A 4HGCA 2SGQE 2QF3A 1QRXA 4JCNA 1P57B 3A8AA 1LQEA 1LMWB 1UHBB 1QB1A 3RXMA 1BTWA 1SGDE 1JRTA 1WCZA 4BTUB 1S5SA 1BTYA 3K65B 1TFXA 2RCEA 2AEIH 3RXCA 1OYQA 1O2HA 1F7ZA 5I25A 4A6LA 4DCDA 1BHXB 3RXHA 2BDAA 5B6LA 1DICA 1A4WH 3BIUH 3KQEA 1EUFA 2P59A 1UVSH 2F9BH 2BX3A 5EW1H 3OU0A 1T8LA 1AVWA 1LQDB 4H4FA 3GS9A 2VU8E 1C1QA 5A0CA 3V7TA 1LHCH 5A8ZA 2PUQH 1V2LT 2ODYB 2QXGA 3I77A 1AMHA 2QN5T 1G9IE 3GY8A 3GICB 3QK1A 2OBOA 3ZZDA 2Z9GA 4YO9A 1HFDA 1C2IA 4J2YB 1AFQC 3VB3A 2FP7B 4DVAU 2BLOA 3LIWA 3LPRA 1V2KT 4F48B 1GI6A 5JPMH 1FI8A 4GAWA 1QFKH 1SGTA 2WV5A 1XUGA 1AB9B 3RXKA 1G2LA 3BTDE 3M35A 7GCHF 1F92A 3PMHB 4X1RU 1W12U 5GJ4B 1CHOF 2XWAA 1ESTA 1MUEB 2BQ6B 1NS3A 2KAIB 1EZSC 1ZZZA 2V6NA 4K5ZA 2V0BA 2NU2E 1FN8A 2BY7X 2JETC 2P8OB 3BG4C 1GJ9B 3RDZA 4IGDA 4TY6A 2A7CA 2A7JA 3Q3KA 3MU1A 3QO6A 3W94A 1ZHPA 2KCYA 1GI2A 1ELAA 2FZZA 5FAHA 4Y76A 3E90B 1IQKA 2TGPZ 4AFSA 3UNRA 2BD2A 3UQVA 1Y3XA 2ANYA 2W26A 4BTIB 8GCHG 1CU1A 2PW8H 1DUAA 1HAVA 2ANWA 2ZDMA 2WHXA 2OXSA 5FPYA 2H9EH 3TH3H 2WPIS 2BOKA 3BSQA 1DWCH 3LGWA 1NBMD 1D6RA 3SUDA 4Y71A 3TJUA 4MNXA 2FOMB 1J9CH 1CGIE 2L6OA 1MQ6A 4BOHA 3MO6A 2OK5A 4K1TA 1XXFA 3RXVA 4GUXA 1HAHH 1O36A 1Z71A 3ODFA 3BN9A 2WINI 2NWNA 1NFYA 1N8OB 1P2MA 1K0HA 1LCYA 3UREA 1EB2A 1NRPH 3EA9A 1BBRE 3ELAH 1V6DA 3V3MA 3NXPA 3ENSB 1G37A 4VGCC 3OX7U 1L4DA 1UTMA 1C5ZB 4LXBH 3GDUA 3GY6A 5J4SA 1OS8A 3PV5A 1UVTH 1ARCA 2Y5FA 1H8IH 1G3DA 1SSXA 3SQHE 4JK6A 2PLXA 1O2KA 2IJOB 4HFPB 4RI0A 1DITH 1AUJA 2J38A 5AHGH 4B6EA 1TLDA 4XOJA 4CHAB 3GY5A 4XBCA 1ETTH 3MTYA 2FOAA 3LOXA 3ZVEA 1SBWA 4MPVA 3I29A 4K1EA 1HAGE 1AD8H 1W13U 2XC4A 1JOUB 1DXPA 4XDEA 5T6GA 1BRBE 2BMGB 1V2NT 3F68H 3SNCA 4A1VA 2VIDA 2ZZUH 1PYTD 1FLEE 1YPJH 2WPDD 4DIIH 2Z94A 1BTXA 1GJAB 2AS9A 1V2MT 2FOCA 1T7CA 1KLJH 3ZZ4A 3STJA 3K2UA 1CQQA 5LPRA 5C2ZA 1J15A 1BB0B 2FI4E 2WYJA 3ZZ7A 4D76A 2B8OH 3ZV9A 3RXPA 2WV4A 3EGKH 2H6MA 2HGTH 4R8TB 4Y6DA 3SU3A 3RXFA 2VIOA 2DE9A 1O2XA 1EZUC 1ZHRA 3A87A 2BD4A 3EE7A 1O2GH 2SGFE 1K2I1 1DM4B 1ACBE 5EXNA 1AI8H 1E35B 3Q77A 4Y11E 1DWBH 1ZTJA 1D6WA 1P2OA 2A4RA 4WF8A 5EU8A 5IDKA 2A2QH 1YM0A 3QN7A 2VIQA 3LGTA 1HAZB 1FV9A 1NU9A 2W3IA 1KSNA 3MI4A 1V2VT 3ZYDA 4X6PA 4BTTB 3RC5A 1YF4A 3A8CA 5I46H 1S0RA 1P05A 4TPYA 4Y79A 2BLWA 1OP2A 1TRYA 5FXLA 1ZLRA 3LC5A 1ELDE 1UCYH 1UTOA 1C1MA 5DP5A 5HGGA 2ODPA 2J5UA 3PWBA 5CHAB 1SG8B 4CRBA 1HV7A 1FY8E 1EATA 2VWOA 3SI4H 4K2YA 4OS2A 1KXDA 1JMOH 2CN0H 2STBE 1ZR0A 2BDYA 1WTGH 3MO3A 1C5PA 2SGDE 4KTSA 1O3DA 3RC4A 1SPJA 1GHWH 4AG1A 3SU1A 3BG8A 3U8RH 1VGCB 2F9UA 1LHGH 3LU9B 5BRRE 2RA3A 4INLA 1RXPA 5E8EH 2XC5A 2A31A 3GCTF 5LGOA 1P9UA 2GZ8A 1S85A 1O5FH 4XSKU 1V2ST 2Y7ZA 5GCHF 3FVFB 1G36A 4OGYA 3SGBE 2GV6A 2A5IA 2OLGA 4MNVA 2DE8A 1RTFB 1TGTA 3MYWA 3QZQA 2L74A 4ABIA 1C2MA 2ZA5A 3SJOA 1P06A 1GVZA 1YYY1 1E34B 3SBKA 1C2JA 6ESTA 1AE5A 2RG3A 2GT7A 1O3LA 1JBUH 4NIVA 4AORA 1QIXB 5F6MA 3D62A 1K9OE 2BZ6H 1ZTKA 4O97A 4Z6AH 1SQAA 2Z6BD 1INCA 2GGVB 2QA9E 4FUFA 5EJ1A 2ZDLA 4FUCA 1P2NA 4CRDA 2CF9H 1O35A 5JBBS 3RXUA 1HNEE 3E0PB 3SNEA 1GJBB 2CK3D 2C8WB 4X2WA 7GCHG 2FWWA 3SJIA 2QXJA 1GMCF 1BITA 1BOQA 1JIMA 1XKAC 2QIQA 3W1EA 1F0RA 1SGIB 1K1PA 2EQNA 2GX4A 1MTWA 1HDTH 4TY7A 1YY3A 4X1PU 3OYPA 1FJSA 3RXIA 4IMZA 2ZGCA 4GVUA 3NKKA 2VGCC 2ESTE 3SV6A 4FXGH 1MMJN 1KY9A 2ZNKH 1CA0C 1MQ5A 1BQYA 4KTCA 5SGAE 2IJD1 2P93A 1C2LA 3SU2A 3D23A 2C8YB 1QQUA 1GBKA 1SLVB 2SNWA 1GI7B 4OM9A 1GI5A 2VBCA 4B71A 2Y7XA 8KME2 1KTSB 1HJAB 2BZAA 3PRDA 1EP6A 2YMSC 2PWXA 2FS8A 3HK3B 3RLWH 2A45B 2V3OH 2WZQA 2FM2A 1XUIA 4HTCH 4ZKSU 1WBGB 4X8TH 3S69A 1DY8A 1A5HA 1KMHB 1HJ9A 3F1SB 1A46H 1L1JA 2XBXA 4Q4LA 4XBDA 1GL1A 3ZZ3A 1TQ0B 1GI1A 1VCWA 5HM2A 3PV2A 1QB6A 2WPLS 3MNCA 1ELBA 3N7DA 1P2JA 4MPUA 1QCPA 4FU9A 3U1IB 1YGCH 1GWAA 1FY4A 6GCHG 2J98B 1ZJKA 5C1YA 1ZRBA 2O8LA 4ZHLU 2GCTC 1AE8H 1EPTC 5DP6A 1XMNB 1SGYE 3MFJA 4I32A 2ALPA 4WH6A 1S6FA 1TBQH 3L33A 3BF6H 3VB7A 5E0GA 1CHGA 1EAXA 3PTNA 4A1XA 1TWXB 1OP0A 1P12E 3QGJA 2GJGA 2XNIA 1YPHC 2BB4A 1ZPBA 4JYUH 5ESBA 4YOJA 1T31A 1ANBA 3A7WA 3ZZBA 1RJXB 4ASUD 2BD3A 2PSXA 5JB9S 2FIRH 1SC8U 1K1IA 1GBMA 3AW1A 1WV7H 4UFDH 3H7TA 3IWMA 1IQMA 2LELA 2GV7A 1GDQA 1O3EA 8ESTE 3SHAH 1ELGA 5FCKA 2YOLA 2WUCA 1W2KH 1UK2A 1YCPH 1O3OA 1T8NA 2HLDD 1ZJDA 1GHBF 1OPHB 2AMQA 4ABBA 4DG4A 1QL8A 2ZFTA 3UWIA 3BEUA 4FUEA 1XUKA 1BZXE 2ZWLH 3LGIA 1ETRH 1ESAA 4P00A 3ZVGA 2C8ZB 4NG9H 2KX4A 2GMTB 3ZZ9A 4AYYB 1J14A 1C1NA 5C67A 5E2PA 4FVDA 3E0NB 1TOCB 1TX6A 3HGPA 4DIHH 2BD7A 1LPKB 1BTPA 5A8XA 1FDPA 4TYDA 4NZQA 1C5MD 4ZKRU 1C1OA 1C5OH 5L2YH 4IN2A 4Q7XA 1AVGH 2KFWA 2VWLA 1Q2WA 1GJ5H 2ZU4A 4CREA 1ZHMA 2WPJS 8LPRA 1TPOA 1QRWA 5G4BA 1XKBC 3KN2A 1OP8A 1O3PB 4I8GA 3PM3A 1EASA 2A1DB 1O3KA 4RSPA 3TLOA 1PPEE 4FU8A 4K69A 1W10U 1C1VH 1DE7H 2XXLA 4ZKOU 1MCVA 1NU7B 3SQEE 4D9RA 1PFXC 3H7OA 1CT2E 2O8WA 3FO8D 1YLCA 2GT8A 1YPMH 1C5VA 2WPKS 4B74A 5B6OA 1T8MA 2FOHA 4FOUC 3TIUA 1AKSB 2J9NA 5DSFA 4GLYA
chains in the Genus database with same CATH topology
3A89A 2QY0B 2Y80A 2AGIX 2XTTB 2ZFFH 1C5UA 1HCGA 2R3YA 1UCYK 3F9HA 1C5WB 1QRZA 4INHA 2NU4E 2AIPA 3RXEA 1TMTH 3ATKA 2VH6A 1AFEH 1F0UA 2QC2A 4BXWA 2FTLE 1BRCE 1FMGA 1O31A 4E7NA 1C9PA 1PPGE 2V35A 4AFUA 2QXHA 3QWCH 2G52A 1OWIA 2Y6TA 2W7SA 4X6MA 3SUFA 2A7HA 1ESBA 1O2SA 2NU0E 2BTCE 1C5SA 1JRSA 3P8GA 4IC5A 1TX8A 1GHYH 1BMLA 5JBCS 1BJUA 3UY9A 3QZRA 1YPHE 3O8CA 1FONA 1NRNH 3T2NA 1CBWB 4AFQA 4BXSA 1GI3A 1WQSA 1AQ7A 2VWMA 3RU4T 3GY7A 2AFQB 1RD3B 3I78A 1LVYA 3CS0A 1TGBA 3SV9A 1SFQB 1SGFG 1O3FA 1Z8RA 4Y7BA 2G81E 1A0HB 1QB9A 4ZXYH 5FBIA 4X2YA 1Z8GA 1C1RA 3CS7A 4DURA 1DVAH 4MPXA 3M3VA 1NTPA 1C2KA 3TGIE 2Y5HA 1O2OA 4NFFA 9LPRA 2OTVA 4ZHAA 2GCTB 3URDA 4K1SA 1THPB 1GI8B 4Y8XA 3MU0A 2GTBA 1O2QA 4Y0ZE 3KQCA 3GDVA 2STAE 2R0LA 1O38A 2B0FA 4UONA 5LPEA 3UPEA 1OWEA 1A5IA 2P3UB 1NFWA 3A84A 4IBLH 3PMJA 4AB8A 1VCPA 2LNCA 3B8JA 1IOEA 1EKBB 3A88A 1IQEA 1O5EH 3S7KB 2EC9H 2BDCA 1EAIA 1WTHD 1PPCE 1FAXA 1MU6B 2R0KA 1SB1H 3M37A 4JZFH 5C1UA 4AGKA 1ID5H 3ZYEA 1O3JA 1A0JA 1HB0B 2F9OA 1LVOA 1C2FA 3SV2H 1HPGA 1VR1H 1LVBA 1AU8A 3MOCA 2Z7FE 1QURH 1BRUP 1HJAC 3RXGA 4H42U 3QX5H 4D7GA 2FOEA 1SLWB 2PTNA 3EYDA 4CRGA 1QBVH 3SV7A 1O5GH 2FODA 3A81A 1BBRH 1MD7A 1P0SH 1PPZA 2BY6X 3UUZA 3FP6E 1DLEA 1GCTB 2XCFA 3DA9B 1MD8A 1CO7E 2Z3EA 3TK9A 2JH0D 2BY5X 3M3SA 2CXVA 2GVFA 2FTMA 2ZKSA 1W7GH 1TGNA 4I8LA 2W5EA 1ZSLA 1HUTH 4A5TS 1O2JA 2BQWB 1J8AA 2Q6DA 2R9PA 1V2UT 3ZV8A 1AO5A 3UR9A 1O2MA 1V2WT 2D26C 1TNJA 3IITA 1N1LA 4NA9H 1XXDA 1ZMLA 2ZGXH 3ATIA 3SGAE 2J95A 1LHEH 3HK6B 2HPQH 3ATWA 1GBIA 3OTJE 4ISLA 3UNSA 2ZGHA 1GJ4H 1OSSA 2ALVA 4JK5A 3P92A 3GYMA 1C2GA 1UK3A 2ZHEH 3S9BA 3T27A 1MKXK 5DP8A 1E0FD 3JZ1B 3PTBA 5JBTA 3LT3A 1BCUH 1NFXA 1FAKH 2BY9X 2QAAA 6CHAC 1V2TT 5L6NH 1BMNH 2QCYA 2ZDAH 1TMUH 1CE5A 1T8OA 3P95A 3UR6A 2Q6GA 2P8OC 3BG4B 1GHXH 1SQOA 2OCVB 1P9SA 2HALA 2UUFB 4BNRA 3DFLA 4RN6A 2G4UA 3EDXB 1N8OC 4GHTA 3P6ZB 4D9QA 3ZZ5A 2W7UA 1BMAA 2BDHA 1QJ7B 1ABIH 1LO6A 2FYRA 4I7YH 1DY9A 5FPTA 1HAYB 4FUDA 4ZH8A 1IQIA 1T32A 1C1WH 3PYHA 1GHBG 1THSH 1ANEA 1YKTA 2ZECA 3KIDU 1S81A 1J16A 3LJJA 6CHAB 4TWYA 2JH6D 1A0LA 1LVMA 2QXIA 1L1GA 2ZU1A 3PO1B 1P04A 3FP8E 1WYKA 4CRAA 1BMMH 5K0HA 1ZYOA 5FCRA 1W0ZU 1TBRH 4R0IA 4ABDA 3TJOA 3OY5U 4LK4A 2SNVA 1RTKA 4ABEA 1D3QB 4WMEA 1O3NA 1CA8B 2OD3B 3SU0A 3P8FA 4DGJA 1K1OA 2EI7A 2A4OA 4KP0A 1LDTT 2R2WU 1Y3YA 3M5LA 3SU5A 1ANDA 4LZ1H 1W14U 2Y81A 2B7DH 3QTOH 3MU8A 1OWJA 3L3TA 4WJG2 5EW2H 2ZHDA 1FNIA 2PUXB 4KGAA 2FDAA 3RXRA 1NFUA 1QL7A 1YC0A 2ZTZA 1GHVH 1GCTC 1SGQE 1WOFA 2K1QA 2H5DA 1SOZA 1Z6EA 4ZMAH 1ZPZA 2C3SA 4MNYA 3FANA 4Y10E 1GG6B 2AERH 2O8UA 3PLPA 3T26A 2F9NA 3SHCH 1NY22 1C5QA 4B2CA 1DSTA 2ANKH 4K8YA 4WXIA 3DUXH 3NCLA 1EJAA 3M5MA 1O30A 1F5KU 3E6PH 1NROH 4MPWA 1OX1A 1AZ8A 1VITH 1WQVH 3A7XA 1GDUA 1MTSA 1PQ8A 5FX5A 1BDAA 1C1SA 3SU6A 4BAOB 1VITG 3B23B 4KELA 3ATMA 4RKOB 5TJXA 1IHTH 1BTHH 1DSUA 3PLKA 3MH7A 2BVXH 3EA7A 4D8NA 3BIVH 4DT7B 2NU1E 2FI5E 1GBDA 2NU3E 4OS6A 3V13A 1Y5BT 3HPTB 1V2QT 5FBEA 1O2NA 3RMOH 2P94A 1ELVA 3D65E 1NRQH 1UVOA 2VNTA 3SI3H 3RU4E 3KHVA 1K21H 3P17H 2OC0A 3HKJB 3A7YA 2RA0A 2AH4X 4INKA 4I31A 1RIWB 9ESTA 5JBAS 2UWLA 3VB4A 1C1PA 1QY6A 2ZFRH 2D1JA 1GMDF 2WPHS 3ITIA 2OQUA 3MNSA 2VVCA 2P3FH 1TE0A 1UTNA 2FO9A 2UWOA 1HAVB 4XE4A 3ZZCA 2O9QA 1O2YA 1O33A 2GKVE 2HWLB 5GIBA 1QJ1B 3MH4A 3RXBA 1OWDA 4X8VH 2C4FH 2BD9A 1RS0A 3TPIZ 1O2WA 1GMDG 3U69H 1V3XA 2GCHG 3LGVA 5A0BA 3E16B 1AKSA 2CGAA 1QR3E 3AAUA 2J94A 1FIZA 4DY7B 1RIWC 2VB0A 2GDDA 3URCA 1SGCA 3F9GA 5GXPA 2ZG0H 1SI5H 1IQJA 3GYLB 1BT7A 2ULLA 3IG6B 4K60A 1O32A 4OGXA 3T29A 1P3CA 3V12A 1YCPM 4F4OC 5AF9H 4IN1A 3BEFB 4ASHA 5C3NA 1EJNA 3M7QA 4YT6H 1UJ1A 1IQGA 2H2ZA 2UUYA 1DUEA 5E2OA 1O5CB 4JZEH 1B5GH 2ZU2A 2ZPRA 3PO1C 3RMLH 1GMHF 2IOTA 3WY8A 2OP9A 3HGNA 1SOTA 2AIQA 4WMFA 2ZU5A 3KEEA 4OS7A 3RXTA 3RXDA 1AZZA 4AYVB 1Z6JH 1EXFA 2OC8A 1E36B 1AN1E 1Z8IB 4B76A 6LPRA 3A82A 1ZOMA 2Z3CA 4YESB 2GDEH 1GJ7B 1GBLA 3FAOA 5DP4A 1MKWH 3RUOA 1E38B 3ZZAA 1C5RA 4Q7YA 3ZVFA 1ARBA 3C1KA 2RDLA 1F5LA 1NESE 2OC7A 5EQRA 2FS9A 1A7SA 1GG6C 2TPIZ 3FZDA 1FPHH 1MKXH 2G4TA 2A4GA 1UCYE 1E37B 3RMNH 4CRCA 2H5CA 3GY2A 3TH4H 1SGFA 1KXCA 5FX6A 4A1TA 4A7IB 2PSYA 1SVPA 1G30B 3BTQE 2BDBA 3EQ0H 2D8WA 3FP7E 4U30A 1BTUA 1H4WA 5EGMA 3SO3A 1NO9H 4GHQA 1BRAA 3SOSA 3U1JB 1C4Y2 3UWJH 1C4U2 4X2VA 1TA6A 3GOVB 5K7RA 2ZFQH 4RKJB 3VPKA 1O5AB 1FQ3A 4JZIA 4ABHA 5C5NA 3V0XA 1KLIH 1GHAG 4OS1A 4WY3A 4BAMB 1P03A 4TWWA 4Y8YA 1Y8TA 1ZGVA 5DG6A 4ESTE 4CH8B 3QUMP 5AVDA 1P11E 2EI6A 3GCTG 2UWPA 5C1XA 1FY5A 3SZNA 4ISHH 5LPFA 2BD5A 2XW9A 2LPRA 4Y0YE 3L6PA 3DD2H 1GHAF 3PMAB 1GGDC 2CF8H 4NIWA 2KAIA 1HAOH 5ESTE 1ELTA 2SFAA 3M5NA 1FPCH 2FOBA 4IC6A 1SGNE 1VJ9U 2BLQA 5TCCA 3C27B 4MDSA 3VGCC 2JKHA 2XYAA 4D7FA 3LDXH 1ETSH 1EPTB 3RXSA 1G2MA 1MTNB 3MO9A 1QA7A 1O3GA 2P95A 1CT4E 1C2DA 2G00A 3VB6A 2R3UA 3E8LA 1TRMA 2ZDNA 2QGRA 5HMAA 4ABFA 2TIOA 2ZPQA 3GY3A 2TGTA 3TK6A 4MG3A 5H4IB 1SGRE 4ZUHA 2BVSH 4TPIZ 5JYIA 4NSYA 4U2WA 4GPGA 1FN6A 4UDWH 3STIA 1BA8B 1P01A 1DFPA 3PB1E 2A2XH 1FY3A 2AMDA 4ABJA 4B75A 1A3BH 3VGCB 1S82A 1MU8B 4XFQA 1VCQA 4YTAA 4AB9A 2V3HH 1TGCA 2FMJA 4Y7AA 2ZFSA 1AWHB 1EOJA 1V2RT 2CJIA 1D3PB 1O2ZA 2ZDKA 2ZDVH 1S83A 5EPYA 3RMMH 2AMPA 1P02A 1W0YH 1AFQB 2VGCB 2Z9KA 1AGJA 5EXMA 2ASUB 2PFEA 1UMAH 3ZZ8A 5HM9A 4YLQH 1EZXC 3A86A 3DT0H 1O3AA 4CR9A 2ZCLP 2J34A 1KLTA 5T6FA 1HLTH 4ABAA 1TPAE 2C8XB 2G5VA 1KYNA 1Z7KA 2HNTC 4MTBA 3GCHC 1DDJA 2WYGA 5L30H 3UQOA 1TRNA 1SFIA 2XC0A 3K6ZA 1V2OT 3TU7H 2VINA 3GCNA 2JETB 3E1XB 3ZZ6A 1ZGIA 2XRCA 1W7XH 3MWIU 1P09A 2FESH 1O37A 4MLFB 2UUKB 2ILNA 4BAQB 2TGAA 1EPTA 5DP7A 3TGJE 1YPLH 1KDQA 2SGAA 1CBWC 1KIGH 2Y5GA 1GL0E 4XBBA 1LTOA 3PLBA 4I8JA 3VXEH 1EAUA 1OOKB 5GWZA 1PJPA 3RP2A 1P10A 1GI9B 2BDGA 3QGNB 5EPNA 4OS5A 2A5AA 1ZRKA 1F5RA 3DFJA 4K8BA 4VGCB 4UFFH 1D3TB 1F0SA 1SGEE 1CA0B 4ISOA 5JB8S 5DPAA 1ORFA 2BLVA 3RU4D 1QQ4A 1GGDB 2OQ5A 2OINA 3BTWE 5PTPA 1LHDH 1JIRA 1ANCA 1FXYA 1XVOA 2I6QA 1GBBA 1AWFH 2VWNA 1DT2A 2A0QB 4JZDH 5C20A 3SUEA 2WUBA 1TA2A 5T3HA 1C1UH 1C5XB 1MZDA 1YPKH 2A32A 3UNQA 2BX4A 5GDSH 1GI4A 2VIWA 1UTKA 1O0DH 4FUIA 1RTLA 4NWLA 3CENA 4CH2B 3A83A 1A5GH 3RXOA 1UVUH 3TGKE 2QF0A 1SLXB 3GY4A 1G3CA 3PMBB 2GD4B 2M5TA 1OXGA 1WU1A 3U98H 1FY1A 2OC1A 3P8OA 4JYTA 3AW0A 1MTUA 2R2MB 1Y59T 1PQ5A 4YT7H 4MNWA 3ZVBA 1N6YA 3M5OA 4CBOA 3HKIB 1SR5C 1MTNC 4THNH 2AYWA 4U01A 5EG4A 3KCGH 2BVRH 3T25A 1K1LA 1EP5A 3RXLA 2TGDA 1GJ6A 2FYQA 3P8NA 1GJDB 2A4QA 3NWUA 1MBMA 4KKDA 3T5FH 4I8HA 5L2ZH 5T6DA 1F0TA 2GZ9A 2XBYA 3T62A 2H1UA 3O8BA 3RLYH 1TNGA 1OWHA 5ABWA 1KXBA 2I6SA 5F03A 1TNHA 5F8TA 5E0HA 2FLBH 1TMBH 1Z1JA 1C5YB 1YP9A 1AUTC 3MNXA 4ISNA 1K28D 3BV9B 1A3EH 1TIOA 1GCDA 4NWKA 2BXUH 1IQFA 3M3TA 5A2MH 1IQNA 1TOMH 2P3TB 3VB5A 4NIXA 1VJAU 3UFAA 7KMEH 3SGQE 2O8MA 1UHBA 1G32B 1DWEH 2EI8A 5A0AE 1EB1H 5EQQA 1ZTLA 3G01A 3S9AA 3O8RA 1DANH 1MBQA 1ZMNA 2F9VA 1ELFA 2ZF0H 1VITF 2ZU3A 1XUFA 2ZTYA 1XM1A 4O9VA 4CR5A 1L1NA 3EA8A 3D49H 3A7VA 2ZGJA 3LJOA 4H6SB 4ISIH 1WUNH 5CE1A 1RGQA 2HVXA 1HXFH 3DHKH 1CGHA 1TONA 1ELEE 3S0NA 1DOJA 3K6YA 3LKWA 4FU7A 1GBEA 3A8DA 3ZVCA 7LPRA 5DP3A 1DWDH 1UO6A 2CV3A 3UTUH 5DO4H 1CVWH 4CHAC 2YNAA 4X1SU 1AHTH 3BTKE 3ZVDA 6GCHF 3RM0H 2F9PA 2ZHWH 1OWKA 3OY6U 4M7GA 1TQ7B 4GCHF 1D4PB 2PR3A 1O2VA 2C93B 3KQDA 3SN8A 1N6XA 2XWBI 2ZC9H 4X8UH 2BHGA 3BTGE 4X2XA 1BIOA 2G8TA 4YZUA 1W3CA 2J4IA 3N7OA 1K1MA 4HZHA 1Y5AT 2H9HA 4J1YA 4AFZA 1TNLA 1O2IA 1TX7A 3AAVA 3RXQA 1O5BB 4FUGA 1TAWA 3U8OH 2F91A 2JH5D 1C2EA 1QGFA 2YNBA 1EX3A 4NIYA 5BPEA 1S84A 1T4UH 1Q31A 2FLRH 5F8XA 5CHAC 2Y82A 4E06H 3A7TA 4Q2KA 3A80A 1KXEA 1QHRB 3LH3A 3E3TA 4O03A 3TH2H 3P70B 2F3CE 2PKSB 1W8BH 4B73A 3SU4A 4NCYA 4LZ4B 1LPGB 2FI3E 4NZLA 4MVNA 5IYTA 1GJ8B 5A09A 1MH0A 3HATH 2QV1A 2THFB 5LH8A 1GDNA 5EOKA 4AX9H 1TGSZ 4YOGA 3W95A 1EQ9A 8GCHF 3T28A 3TVJB 3U9AH 1Q3XA 1A61H 2C90B 4CRFA 2CHAB 1LHFH 4KTUA 3R0FA 1B0EA 4WVPE 2ZHQH 1MAXA 1TPSA 4JMYA 1H9IE 1GBCA 3MMGA 3S9CA 4IW4E 4IMQA 4AN7A 2D2DA 5EODA 3FFGA 1S0QA 4FVBA 3M36A 3H5CB 2ZPSA 2FX4A 1YCPK