2ZA5A

Crystal structure of human tryptase with potent non-peptide inhibitor
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
242
structure length
242
Chain Sequence
IVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVKVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tryptase beta 2
publication title Potent, nonpeptide inhibitors of human mast cell tryptase. Synthesis and biological evaluation of novel spirocyclic piperidine amide derivatives
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 48
structure length 242
sequence length 242
chains with identical sequence B, C, D
ec nomenclature ec 3.4.21.59: Tryptase.
pdb deposition date 2007-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2za5A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2za5A01
3ZZ4A 2FX4A 1D3TB 4NSYA 1T7CA 1ZHMA 5FBEA 1RGQA 1HJAB 1NZQH 2FOBA 1DLEA 4VGCC 1UVTH 3N7OA 1A7SA 4ABGA 1C2JA 1ARBA 1JOUB 3PB1E 5PTPA 3W95A 1ZYOA 5EODA 5JBBS 4YO9A 1UVPA 1INCA 4UONA 1FJSA 2FZZA 1DUAA 4CRFA 1C1TA 1GL0E 1C4Y2 2BY5X 4DW2U 1NROH 3RXKA 3A7ZA 1DXWA 2UUYA 3BTEE 3H5CB 3UQOA 3OYPA 3E3TA 3TH4H 2GCHG 1SGRE 4CHAC 2R9PA 5A0CA 2FYQA 1LHEH 1G30B 3GYMA 4MNXA 1DOJA 4TY6A 1TE0A 4WMFA 2AGIX 1NRRH 2A2XH 1LHGH 2O8WA 3QWCH 1PPFE 3E91A 1MU6B 3STIA 4NA8A 2GGVB 2FXRA 1IQEA 5AFZH 1MH0A 4X1QU 4JZDH 1WTGH 3UNQA 3URCA 2BLOA 3TGJE 1MKXH 4ISOA 4AN7A 1AZZA 1V2QT 3VEQB 1UK4A 2ZA5A 3A7WA 3VPKA 4YT7H 2BY6X 2ZU4A 1SLVB 1LPGB 3BV9B 4E05H 1KDQB 3T62A 1L4DA 1XVOA 4FU9A 1DM4B 4Y8YA 4CRBA 1TPOA 2J34A 3RXAA 2BQ7B 3R0FA 1DWDH 1GJ7B 2WYGA 5C5OA 4K69A 1NY22 1BMNH 3EYDA 3FAOA 3SV9A 1W11U 1IQFA 1QNJA 3GYLB 3LONA 1DWCH 1LTOA 4FUHA 1T31A 4ZHLU 7KMEH 5HXFA 1WTHD 4AFUA 3CS0A 5LPEA 1C5PA 4A92A 1P3EA 3BIVH 2HVXA 4FU7A 4NSVA 1CBWB 3TK9A 1MQ6A 4F4OC 1AMHA 2BD2A 2NU2E 4MQAA 1GJ6A 1W7GH 1OOKB 4Y11E 1O3BA 1QB6A 2NWNA 8GCHF 1HAPH 2VGCB 3R3GB 4DY7B 5K7RA 1KXAA 1P9SA 2JKHA 2CV3A 3E90B 3ZVAA 4MLFB 1ZGIA 2GZ9A 2VNTA 3BTTE 3LGUA 5AHGH 3GY3A 4X6OA 3I29A 4NCYA 2VVVA 2F9OA 4D7FA 2ZG0H 4X8SH 2FOEA 1A2CH 1K1OA 1SGQE 3NPSA 4ZH8A 2BD4A 1GPZA 3SV7A 1HAZB 2GKVE 1TBRH 1ELCA 2QYIA 3KEEA 3TK6A 1NFWA 1K1NA 1ABJH 4A6LA 3SZNA 1GJ4H 2BZAA 2BDCA 3BEIB 3ATIA 1ETRH 2WV5A 1G2LA 2BDGA 1QGFA 1GJ9B 4KTSA 1EP6A 2QC2A 2Z9IA 3L3TA 1XMNB 1H1BA 4FUIA 2G51A 2NU3E 1MTNB 4CRDA 1O3GA 2XNIA 5L2ZH 1GJCB 1XXDA 4CH2B 1SL3A 5FCRA 2ZHDA 5F03A 1GMHF 1GHYH 1MTSA 3RXLA 1HAHH 2OBOA 2A2QH 3SJIA 1K1LA 4NA9H 3MNCA 1L4ZA 3UIRA 3UPEA 4KTCA 2VIOA 1GBAA 2ZFFH 1JIMA 5LGOA 4QT8C 3M3SA 1NPMA 3M3TA 3U98H 4ISLA 4UFGH 4NA7A 1GI0A 1K21H 1FXYA 2BX3A 1MBQA 1HAXB 2J38A 5L2YH 1VGCB 2BY8X 1A3BH 1P2IA 2BM2A 3LC5A 2Y82A 1VITH 2G81E 1P3CA 2H9HA 3BTGE 3UOUA 2CF8H 1T4UH 1ANEA 2J2UA 5DGJA 1RTFB 4GAWA 2ZFQH 2J4IA 1Y5BT 1YKTA 5A0AE 3ESTA 4Q7XA 5FX6A 2M5TA 3RUOA 3S9CA 1OX1A 1KY9A 3U69H 2Q6FA 1Y59T 3RXRA 2XWBI 1ZMNA 1DITH 5FXLA 1PYTC 9LPRA 4A1TA 1QHRB 1W13U 5DJ7A 4CRAA 3D49H 1A0HB 2BVRH 1QB9A 4NWKA 4MNYA 3RXCA 1LPKB 2W3KA 4I7YH 1DY9A 1NU7B 1UMAH 2FOGA 1T8NA 1ZR0A 3TH3H 1O3IA 3IG6B 5HM2A 4B1TA 3VGCC 2Z94A 3DT0H 1W8BH 4X8UH 1Y3VA 1DPOA 3MWIU 1O5AB 3AAVA 4LK4A 3SHAH 1ABIH 2HPPH 1O2GH 4ZKOU 4DOQA 3ZV8A 3A82A 2FMJA 1SR5C 1T8LA 3LH1A 2G8TA 1GMCG 3LU9B 4KP0A 2A4QA 2O8TA 2DE9A 1QL8A 2BLWA 1IQIA 2HNTF 1HCGA 3KGPA 1GBDA 2KAIB 3RXSA 1UTMA 3M5OA 2VU8E 1WBGB 1AVGH 2P94A 1BA8B 3K6ZA 5EQQA 5L30H 3ZYEA 1TLDA 1Z6JH 1YYY1 4E7RG 4I31A 2FTLE 3MU5A 3CENA 2GMTB 1SGNE 4AFSA 1O3NA 2ZHFH 5DPAA 1BQYA 3A85A 4YLUA 3RXIA 1N6YA 3SW2B 1L1GA 3L6PA 1K28D 2G5NA 3QN7A 7GCHF 1NM6A 1TABE 3U8RH 2G00A 1C1VH 1UCYK 1IQKA 1GHVH 1O2TA 3TJUA 1OPHB 2WV4A 5FAHA 4Z6AH 1CQQA 2Y5GA 1BIOA 4WF8A 1D6RA 1O2PA 5EQSA 1GHBG 2ASUB 5EQRA 3HK3B 1TGSZ 2PUQH 3MO9A 1C2MA 3SQEE 3FZDA 1YC0A 1PQ7A 4ZXXH 4ASHA 2QAAA 1ZMJA 1VR1H 3T29A 2GT7A 1ZPCA 2P8OB 1G2MA 1HLTH 1EUFA 1XKAC 3TVJB 4ABEA 2B7DH 4GPGA 3ZV9A 1ZSLA 1NC6A 2XCFA 1PPZA 2HNTC 3A88A 1AZ8A 3W94A 4X1PU 3URDA 5EXNA 1P09A 1MZAA 1OWKA 5TJXA 1SSXA 3ELAH 2HOBA 4O03A 3RC5A 2A45B 3PWCA 1EZSC 1TRNA 1TIOA 1S81A 3GY2A 2TGDA 2RG3A 4XOJA 1J17T 1A5HA 1ACBE 3V13A 1V2MT 1KDQA 2XTTB 1O2LA 1H9IE 1OYQA 1CGHA 1TGNA 2ALPA 1HYLA 1O38A 1K1PA 1WAYB 1AWHB 4ABFA 1BBRE 3T25A 2QXJA 1UJ1A 1E38B 2A32A 3RXGA 5GPIB 1GI3A 5A0BA 1CHOF 3GDVA 2AEIH 2WPHS 2XCNA 1M9UA 1YF4A 2AERH 3OY6U 3QX5H 3NZIA 3HPTB 1LDTT 2VH0A 1WV7H 2A5IA 1W14U 1DLKB 1RXPA 3RP2A 4KKDA 5DKMA 3ZZAA 3OSYA 3ZZCA 1QRXA 2C90B 5EOKA 2PKAB 3P92A 1ANBA 5E2OA 3EA7A 3PM3A 2ZKSA 4GUXA 3MMGA 5HMAA 3SO3A 2WPLS 2CHAC 1SGCA 1TMUH 2STAE 5BRRE 3OTJE 3LH3A 1FIZA 3TLOA 1KTTB 1MBMA 1FLEE 1HAOH 4BAQB 1X7AC 3GCHC 1B0FA 1RIWB 5LPRA 5HYOA 4X2YA 1GHXH 1UTQA 1S84A 1HAYB 1AI8H 2B0FA 1FDPA 2ZFTA 5DP7A 2OLGA 3KQCA 1TMBH 1QFKH 1N8OC 1ZHRA 4MNVA 1C1WH 3MH5A 1FY3A 6ESTA 2H9TH 3KNXA 4H42U 1O3AA 1GBBA 3GDUA 5AF9H 1BMLA 1D3QB 1JWTA 2SGQE 1QJ7B 1ZTLA 2TIOA 1T4VH 4OGYA 2V3OH 1PPBH 2Z9KA 3M7QA 3SV2H 4H4FA 4B74A 1VJ9U 1GG6B 3RXJA 2ANKH 4HFPB 3LGTA 3RLYH 2STBE 1W10U 2LPRA 4K60A 2ODYB 4AB8A 2A7JA 3RXPA 1OWJA 2WINI 3BSQA 1LVOA 1QL7A 5AFYH 2AMQA 2FX6A 3SU2A 1O5DH 1CA0B 2V35A 2W26A 1CT4E 1V2RT 1GBFA 5G4BA 1TOCB 1EPTB 4X1SU 1KIGH 1P2KA 1GDUA 1MKWK 2BMGB 5GIBA 2OC1A 3TITA 4A5TS 3M35A 4JYUH 1GHAF 4ABIA 1NU9A 1V3XA 2HGTH 1Y8TA 1IAUA 4FUCA 1BMAA 3LGWA 4D76A 3K2UA 1F2SE 3NWUA 5GDSH 1C5SA 1GBEA 3M3VA 4NZLA 4A1VA 2H5DA 2OD3B 3FZZA 5JBTA 3KIDU 1V2TT 3ATMA 2C8ZB 1O2ZA 1YPHE 2A1DB 1O2QA 1GL1A 3L33A 1MZDA 1KSNA 5FHTA 2BY7X 1Z1JA 2B8OH 2ZU3A 2BD9A 5T6DA 2EI8A 2PUXB 1GBJA 1AU8A 1EAIA 4UE7H 2A5AA 3UY9A 2BVXH 4ZUHA 1HXEH 5HM9A 1GGDB 1TNJA 3F68H 1O3FA 2Z9LA 4JZ1A 3BG8A 4DVAU 1LVYA 3HKJB 1EOJA 1ETTH 4JCNA 2H9EH 1TMTH 1UK3A 4DGJA 8GCHG 1O36A 4Y0ZE 2A5KA 2VWMA 1PFXC 2VJ1A 1W0ZU 1ESBA 5F6MA 1C5UA 2ZFPH 3ZVCA 1Y3YA 1P2JA 1JXPA 1OP2A 1GWAA 2JETB 2VVUA 1A1RA 1Q3XA 1V2KT 1KLIH 3LIWA 1V2UT 1ZOMA 4B2BA 1C2EA 1W12U 4WMEA 2XBYA 3AVZA 4Y10E 1C1PA 2HPQH 3SNEA 2XC0A 2AGEX 1C2DA 1KXDA 1O3CA 1MAXA 3SUFA 4NWLA 2BZ6H 2EEKA 1ELVA 1BJUA 2BDYA 4X6NA 3UUZA 5LH8A 2W7UA 2VINA 3SU0A 2F9UA 1V2VT 8KME2 1HAVB 2BD5A 3RXUA 2AYWA 2OUAA 1A0JA 1C2GA 4HTCH 1BTHH 1HUTH 4Y76A 4JYVH 1EZUC 2PLXA 3SI3H 1MTUA 3TJNA 1DXPA 1ZTJA 1NO9H 1GDNA 4NFFA 5I25A 1PQ8A 3BTDE 4XE4A 2Z6BD 2V0BA 1IQLA 1PQAA 1OWIA 1J15A 1EJAA 1SGEE 4M7GA 4O97A 1HIAA 3U8OH 4MVNA 3EA9A 3VB4A 2OC0A 1C5QA 2VIWA 1QURH 3PV4A 4NGAH 4F49A 2XW9A 3S0NA 2QF3A 2ZDLA 2DE8A 2VIDA 3U1IB 1LHCH 3UWJH 2BHGA 3GICB 3FFGA 2BVSH 4BOHA 1THSH 1ANDA 2D26C 1YPGH 1P01A 3RMLH 1ANCA 2FOHA 1GCDA 3A83A 3M61U 5T3HA 2VWNA 1AVWA 1T8OA 4YESB 3MH4A 3HGNA 3RXFA 1QRZA 5EU8A 2PFEA 1EJMA 1LVBA 2OP9A 4K1SA 1GJAB 5A09A 2UUKB 1P57B 2GCTB 1FNIA 4DIHH 1ZHPA 2C93B 3LGVA 1KXFA 2VIPA 1RRKA 1TRYA 2EC9H 4IC6A 1O37A 2F9NA 1GJ8B 3EA8A 1P06A 1O2VA 3UR6A 3DUXH 6GCHG 1UTKA 2QV1A 2PTCE 4U2WA 4D8NA 2QN5T 3FP6E 2ZCHP 3MO3A 1GI9B 1P2MA 2P3FH 4THNH 1O3PB 4UFDH 2CGAA 3SNAA 2BD7A 1XUIA 1VCPA 2FS9A 2SGPE 4YTAA 1IQGA 1V2PT 1RFNA 1XUHA 1SC8U 2ZHQH 3ZZDA 4TPYA 4CBOA 4GCHF 3TU7H 1YCPK 1O5CB 1GBKA 1VCQA 2AFQB 2Q1JA 4I32A 3SV6A 1SLXB 4GHQA 1OP0A 1B0EA 3VXEH 2GDEH 2SGAA 4ABJA 5GJ4B 2Z3EA 3SJ9A 1TNIA 4AYYB 1E34B 3ZVFA 1TBQH 2OINA 4WH6A 1FUJA 1F0SA 1O2JA 1YPMH 1ZZZA 1UHBB 5FPTA 3NXPA 1UCYE 4Y8ZA 1H4WA 4Y7AA 2Z3DA 3H7TA 5F8ZA 1H8IH 2RA3A 2XBVA 1Z8RA 2GD4B 2CHAB 1P11E 2AGGX 3LJOA 1TB6H 4YOJA 2ZGXH 1O3EA 1TRMA 2H1UA 6CHAB 3OY5U 4Q7YA 5CHAC 3RC4A 4Q80A 1GHWH 2XYAA 3BG4C 3KHVA 4YLQH 4SGBE 3SN8A 4MPVA 4ABDA 1AQ7A 1C1QA 4CREA 1WOFA 1GBHA 1V2LT 2HNTE 2BDBA 4AZ2B 5BPEA 1BTWA 4BXSA 5ETXA 2GCHF 3EDXB 4YZUA 3P8NA 1BZXE 4AFZA 4ZKRU 4KGAA 1O2UA 1FN6A 2ZO3H 4ZAEA 1W0YH 3O8DA 2ZPRA 1O5BB 1AY6H 2HALA 1GVZA 4NIVA 4MPUA 4PROA 3A8BA 4WMDA 3FANA 2FOMB 1DWEH 1IHSH 2A4OA 3UNRA 2QIQA 2IJOB 3VB6A 2G4TA 2XBWA 1EPTA 1AD8H 1FIWA 1C5XB 1C4U2 2HWLB 1AUJA 4LZ4B 4MDSA 2GZ8A 3HKIB 3GOVB 1D3PB 5EPNA 2WPIS 4ISHH 5E2PA 1BRUP 2ANMH 2FOAA 1PYTD 4X2XA 3WY8A 1EAUA 3E6PH 3NKKA 3EAJA 1LHDH 4WH8A 3NUMA 2XBXA 2JH5D 3SUDA 4GVUA 1XUFA 4AFQA 1IOEA 1O33A 1HAIH 1TWXB 5DP8A 4AG2A 1C5VA 1RJXB 1OXGA 1VCWA 4BTUB 1EAWA 1GBCA 2WUBA 2PKSC 5EG4A 1YPLH 1AGJA 4X1RU 2AH4X 2FWWA 2P3TB 2C8YB 1OKXA 5DP5A 3SHCH 1Y3UA 2FS8A 3RLWH 4ZMAH 1C2KA 5C3NA 2WUCA 1O3JA 2F83A 2QCYA 1G37A 1C2LA 2Y7ZA 5EW2H 1QQUA 1NRNH 4INKA 2ZGJA 2I6SA 1UVUH 3LOXA 1L0ZA 4J2YB 7ESTE 1HJAC 4Y0YE 5DG6A 4BTIB 1Z8JB 3PO1B 5CE1A 5DO4H 4XDEA 2BLVA 1UTNA 2FDAA 1AB9B 1BBRH 1HV7A 3LGIA 3PMAB 3D23A 3LT3A 1Y5UT 1A5IA 3RU4T 3RXDA 3STJA 1TNKA 1KTSB 1XUKA 3ZZ9A 3KF2A 3UWIA 2GZ7A 4FUEA 3O8RA 2OC8A 3AW1A 1F0TA 4IGDA 1TQ0B 4O9VA 4X1NU 4B76A 3NCLA 2PSXA 2UWPA 2A4GA 1FAKH 1BITA 1O2HA 1D3DB 3KQBA 3KL6A 1C2FA 2A7CA 2ZCKP 4VGCB 1O3LA 2ZWLH 1Z7KA 1OP8A 2VVCA 1SHYA 4IS5A 1ELEE 1NESE 2ZC9H 3SORA 4WWYA 2YNBA 3AASA 2R2WU 1AE5A 1B5GH 1QCPA 2D1JA 2ANYA 2BDIA 1GVLA 4DCDA 1DE7H 3UQVA 1A61H 3MTYA 2NU1E 1JRTA 1SQAA 1IQJA 2J94A 1OWEA 3SOSA 1UTJA 4TY7A 4X8TH 1OWDA 4CHAB 1BRCE 4CRCA 4IBLH 3RM2H 1QBOA 3TGIE 1H9HE 1JRSA 8ESTE 4FUBA 2LNCA 1GJDB 1QR3E 2J92A 1HXFH 1TBZH 1Z8GA 2C8XB 4K3JA 4R0IA 2V3HH 4NIXA 4BAOB 1K1MA 3SNDA 1AN1E 1Q2WA 1SPJA 3PWBA 1ZRBA 3LJJA 2QA9E 3LGYA 1Z8IB 2BD8A 4I8GA 3SUEA 1MUEB 3A8DA 1FONA 1S0QA 1C9TA 3PYHA 1E0FD 1EB1H 5JBCS 2O9QA 2ZU1A 1V2JT 3ODDA 1WSSH 3AAUA 3P8GA 4NFEA 3UFAA 5J4SA 4B73A 1P05A 4RSPA 4RKOB 3BTHE 1AE8H 2O8MA 4BAKB 3GDSA 1ELFA 1VZQH 3RU4E 1VITF 4OGXA 1FPCH 3OU0A 2ZF0H 3MNXA 3MU1A 4JZEH 4O3TA 4AX9H 1LO6A 1GI6A 1O3MA 1TAWA 1B7XB 3S7KB 3VB5A 1DS2E 4ZHMU 4DT7B 3GCTG 3S69A 1RS0A 1O30A 3LDXH 2Y80A 2ZHWH 1GMCF 1SGFG 1SMFE 1QB1A 4IMZA 1HGTH 1WCZA 4JK5A 1ELDE 1DICA 1FQ3A 1ZLRA 8LPRA 3NK8A 1G3EA 1OYTH 3FP8E 1S6HA 3E16B 1GCTC 3TH2H 1J14A 1C1RA 2SNWA 3RXMA 4LOYH 5C5NA 2BYAX 1ELTA 2BOKA 1MQ5A 4WY3A 2AIPA 1GBIA 2CJIA 4Y8XA 1ETSH 4E06H 4X0WU 2ZHEH 2RCEA 1KYNA 2D2DA 2BDAA 3HATH 1MTNC 1PQ5A 1P04A 1EKBB 2FIRH 1XKBC 1AIXH 1S5SA 2OCVB 2ZGHA 1CO7E 3SV8A 1PJPA 1S6FA 2V6NA 5LPFA 1UHBA 4DURA 2CN0H 3QTOH 5GWZA 1RTKA 1C9PA 3H7OA 1F7ZA 1PPCE 4WVPE 3T26A 2ZTYA 4D9QA 1YBWA 3ZZ8A 3BEUA 1BHXF 3F1SB 1TPAE 3MU4A 4ZKNU 1ZTKA 1MD8A 1D4PB 2P95A 1C1MA 2THFB 2XXLA 9ESTA 1AWFH 3TNTA 1A3EH 1VGCC 4UD9H 3O8BA 3ZZ7A 4IC5A 2B5TB 3QDZB 4Q7ZA 2VB0A 3SNCA 2PSYA 2BOHB 1C1NA 1DT2A 2C4FH 3PMJA 1NFUA 1SOTA 3ATKA 5ESBA 4IMQA 1G3BA 1O5FH 1TPSA 2HRVA 3BG4B 1ELBA 3Q77A 2OC7A 4K2YA 1G3DA 4K1TA 1A0LA 2ALVA 2ZU5A 3BTME 3ODFA 1AHTH 2PHBA 1BT7A 2GTBA 6LPRA 1O31A 4FU8A 1EASA 3ZVBA 1HBTH 3MH6A 1SGPE 1O2WA 1CGJE 2TRMA 4X2VA 1DSUA 1V2NT 1DX5M 1IQNA 1P03A 2UWLA 4I33A 4JZFH 1CGIE 1UTPA 1FV9A 1D6WA 1HB0B 3UREA 2W5EA 3P8OA 1O2MA 1Y3XA 2BX4A 1C5WB 3RMOH 1P2OA 4RN6A 1ARCA 4XFQA 4RKJB 3SU3A 2ZQ2A 1YP9A 1CSOE 2UUJB 5DK1A 2FI5E 5C1YA 1BOQA 1GJ5H 4BTTB 2PTNA 1YPEH 1YM0A 1UVSH 2VH6A 3TGKE 1QBVH 5E0HA 1NRSH 5C1UA 1ESTA 1LHFH 1BDAA 4OS4A 1C5OH 1W7XH 4HZHA 4ISIH 3VGCB 3V0XA 1WUNH 4OS2A 1P02A 5FPYA 3HK6B 3PTNA 1DVAH 1EAXA 2BXUH 2PGBB 3RU4D 2FYRA 4GSOA 2GMTC 5FPSA 4B2AA 1MCVA 3RC6A 2AMDA 4LZ1H 2ESTE 5DP4A 1LQDB 2KAIA 2VIQA 1AKSB 1GBLA 4INLA 1O2SA 2ZU2A 1THPB 1D9IA 3U1JB 5F8XA 4DG4A 2EI7A 1HAGE 2C8WB 3RXBA 3A86A 1EB2A 1ZSKA 3ZVDA 3A8AA 2QGRA 1FY8E 1MMJN 2ZP0H 1EQ9A 5A2MH 3RXEA 1K2I1 2P93A 2Y5FA 1ZJKA 2QXIA 4MPXA 4Y71A 2C3SA 4IN1A 2R3UA 3SI4H 3AW0A 3A84A 4ESTE 1O5GH 2IPHA 3P70B 1C5YB 1TNHA 4HI3A 4AG1A 1GI2A 3VFEA 1V2ST 2W7SA 1FY1A 2GT8A 3ITIA 1Q31A 1BTPA 3T2NA 1GMHG 4X6PA 1S85A 1V6DA 1JIRA 2P8OC 1O2OA 3EE0B 5J4QA 1ZJDA 4OS7A 2XC4A 3QO6A 4D9RA 3E0NB 1NRQH 3RXVA 3ZZ6A 1UK2A 1Y3WA 1VJAU 1BCUH 4OS1A 3DA9B 2B9LA 1UCYH 4TPIZ 3SGAE 1TA2A 3RMNH 3A7XA 5E8EH 3I78A 1ZPZA 1F5LA 1FMGA 1BTYA 2FM2A 3SGQE 4AB9A 1NTPA 2BXTH 3A81A 1GMDF 3P95A 1Z1IA 3OX7U 5I46H 4AYVB 1H8DH 4JZIA 2DUCA 2EI6A 1PPEE 3Q00A 4FVDA 1C1UH 5TCCA 2TGTA 2H5CA 3F6UH 1C5MD 2BTCE 3ZZBA 4B75A 1S0RA 2ZFSA 5JDUB 3T28A 2AS9A 1AFQC 1XXFA 1O2KA 5GCHF 3Q3KA 2JH6D 4A1XA 4MNWA 1L1JA 4XSKU 3TJOA 1DDJA 1BTUA 3P6ZB 2FPZA 1SGFA 2R3YA 4H6TA 1TGBA 2ZDAH 5L6NH 3IWMA 1CT0E 2BD3A 1KXEA 1UTOA 3ATWA 1K9OE 2FOFA 2PW8H 2BQWB 1QIXB 2ZEBA 4R8TB 4BAHB 4AOQA 1LVMA 2OBQA 3BF6H 1O2RA 3MU8A 1XM1A 2FESH 1QL9A 4XBBA 5FBIA 1YPHC 3GCOA 1V2WT 3M5NA 3ZZ5A 1ZGVA 3FP7E 2Z7FE 5IYTA 2TBSA 1EZQA 3RXQA 1GDQA 2SFAA 2IN2A 4B71A 4E7NA 2J9NA 4BXWA 1FAXA 1BUIA 4B2CA 1O5EH 1UVOA 4IW4E 3E0PB 1P2NA 3P17H 5GXPA 1E36B 2A31A 3JZ1B 4ISNA 1LKBA 1L2EA 1RIWC 2PKAA 4O3UA 1C2IA 3TJVA 3BTFE 1DUEA 1TNLA 5FX5A 3RMMH 4FVBA 2G55A 4X2WA 1SGYE 2WPJS 2FO9A 3LC3A 4MPWA 1SGDE 3TK5A 4DIIH 2TGPZ 3ZYDA 3PMBB 7GCHG 2FODA 1XX9A 4UFFH 1SOZA 1YPKH 2ZDKA 3DHKH 1K1JA 1AUTC 3SUGA 1PPGE 3A7VA 2O8LA 1GG6C 3PLKA 5C20A 5JB8S 2VWLA 1O3DA 4IN2A 1GCTB 2CMYA 2F9BH 3D62A 3DFLA 4D7GA 2Y6TA 3GCHB 4CBNA 1WU1A 1GBMA 4YOGA 2GDDA 1NFYA 1WQSA 5DP9A 1TX6A 1EJNA 3LKWA 1ESAA 1C5RA 1NFXA 3C1KA 1CA0C 3G01A 3QZQA 3UNSA 1N8OB 2Z9GA 3V7TA 1EPTC 1O32A 2Z3CA 1O3OA 4Y7BA 3LPRA 5C2ZA 2K1QA 3V12A 2ANWA 1SI5H 4Z0KA 5A8XA 2BLQA 1KLTA 3A87A 4Y79A 1BB0B 4OS6A 1QJ6B 1LCYA 2ZI2H 3UR9A 2AIQA 3JZ2B 1BJVA 2VIVA 2H6MA 2WPMS 3FVFB 3A7TA 3QLPH 5E0GA 1FY5A 1SLUB 2GP9B 4WJG2 4ABHA 1CU1A 1RTLA 1P12E 3B23B 5JYIA 2CXVA 4CR9A 1C5ZB 1G9IE 3SBKA 1ZSJA 1SGTA 1ELAA 1SFIA 2JH0D 3MFJA 5T6GA 3VXFH 1YPJH 4Y6DA 1SFQB 1U6QA 1GGDC 3GISB 1O0DH 3DFJA 1MAYA 2GX4A 3D65E 3MI4A 4TWWA 2PV9B 1EZXC 3QUMP 2UWOA 1UTLM 7LPRA 3RXHA 3PLBA 1C5LH 3SJOA 1CHOG 2J95A 1MKWH 1HDTH 4WXVA 2R0LA 1F0UA 5HGGA 1H9LB 3A8CA 3M36A 1MTWA 4TWYA 1VITG 4FUGA 4H6SB 3A80A 4FUFA 2F91A 2QXGA 2Y7XA 2Q6GA 1LMWB 1GBTA 3O8CA 2FI3E 3SU4A 4K8BA 2P3UB 2JETC 6GCHF 2QXHA 1DWBH 5C67A 1TGCA 5IDKA 1O3KA 2VWOA 2PGQB 3B8JA 1GI8B 1BRBE 4NIWA 2NU0E 1CA8B 1J9CH 4ABBA 1QQ4A 1A4WH 1BMMH 1Y5AT 2OXSA 2UUFB 1BHXB 1E35B 1T8MA 1LQEA 1JBUH 2ZPQA 2A7HA 4I8HA 1SQOA 1JMOH 3GCNA 1EATA 1TALA 3KQDA 3KN2A 5H4IB 3QGNB 1FI8A 4BNRA 4DJZB 1G3CA 3ATLA 1SHHB 1NT1A 3E8LA 1O34A 1CVWH 1AKSA 1J16A 2ZIQH 5SGAE 1XVMA 1YGCH 1BRAA 5DP6A 3BTWE 4NIYA 5FCKA 2ZZUH 3RXTA 1QBNA 4A7IB 1MKXK 1LKAA 1O35A 1EXFA 3A89A 5ABWA 2OTVA 2ZECA 1L1NA 1LPZB 1Z71A 1HAVA 1RD3B 1O3HA 2BQ6B 3MNBA 1EP5A 4U01A 3BTQE 3KCGH 1P9UA 1TOMH 2ODPA 4FUDA 3QGJA 4OS5A 3U9AH 1GI7B 4MG3A 2ZGBH 4MTBA 4X8VH 5EPYA 2H2ZA 2F9PA 4JK6A 3SJKA 1HIAB 4JMYA 4SGAE 3VB7A 2PR3A 1TYNA 2ZDVH 3UTUH 3UOPA 2G52A 4KTUA 1HFDA 3BIUH 1GHAG 2BY9X 3Q3XA 3F9FA 1Z6EA 5JB9S 3M37A 3V3MA 3TNSA 2Y5HA 1GJBB 1QTFA 1SLWB 1PPHE 1SVPA 1ZMLA 2TPIZ 3M5LA 4UDWH 1HJ8A 2FTMA 1S83A 1SB1H 3K6YA 5DP3A 5B6OA 4I8KA 1ZPBA 1IHTH 1TQ7B 2GCTC 3K65B 4ABAA 2TGAA 3S9AA 1FN8A 2FLBH 2QY0B 3SQHE 3Q76A 1QJ1B 3QK1A 3Q3YA 5K0HA 2F9VA 2NU4E 1O2XA 3SGBE 1EX3A 2EA3A 3PLPA 5TCAA 1V2OT 2G4UA 3CP7A 2ILNA 3EGKH 1NRPH 1CBWC 1F5KU 4CRGA 1T32A 2ZTZA 1GHZA 1NS3A 1KXBA 2ZTXA 1MU8B 2ODQA 1P8VC 2VGCC 2ZDMA 1KXCA 3BTKE 4WXIA 1HRTH 1GI4A 1K1IA 1QY6A 2SGDE 4YT6H 4ZROA 2ZCLP 5A8YA 2XWAA 3QZRA 1C5TA 5T6FA 1AFQB 1K22H 1F0RA 3GY5A 1P10A 4Q2KA 3ZVGA 4JYTA 3DD2H 5EGMA 1MCTA 3SU6A 3MO6A 3U8TH 3BN9A 1P2QA 2ZQ1A 3MNSA 5A8ZA 1UO6A 4K8YA 5ESTE 1ID5H 3S7HB 4GHTA 3GY4A 1TONA 1W3CA 2CF9H 1O2NA 3SJ8A 3RXOA 1C2HA 1ELGA 4NG9H 1CE5A 3RM0H 5EXMA 2BB4A 1SG8B 4LXBH 1TNGA 3F9GA 4J1YA 3I77A 1XUJA 1QRWA 2FI4E 4X6MA 2R0KA 2Q6DA 3K9XB 2GV6A 1QA7A 4U32A 4BANB 1SQTA 1C1OA 1A5GH 3GY6A 1BTZA 5AVDA 3GY7A 4K5ZA 1IQHA 1HPGA 1W2KH 2ULLA 3MU0A 4ZHAA 4AORA 1IQMA 6CHAC 5CMXH 3MHWU 1BTXA 1TPPA 1EOLA 3ENSB 2ZGCA 3MYWA 1FPHH 1J8AA 3SNBA 2FP7B 4K1EA 4I8LA 2W3IA 4GLYA 1YCPH 3BEFB 3KQEA 3S9BA 4U30A 4ZKSU 5JBAS 1TFXA 3B9FH 1WQVH 2GVFA 1C1SA 1GI5A 4AGKA 3P8FA 5EXLA 3A7YA 1C5NH 4CR5A 3E1XB 1NN6A 3SU5A 2XRCA 5E0JA 2YOLA 1G36A 1GHBF 1G32B 2SGFE 2WYJA 4NZQA 2PWXA 3F9EA 5F8TA 5CHAB 1F92A 2SGEE 1MD7A 1O2YA 3TPIZ 2ZDNA 2RDLA 4FXGH 2WPKS 1OWHA 1E37B 2A4RA 3PTBA 3M5MA 2FOCA 2F3CE 1TGTA 1ZRKA 1GMDG 1A46H 3M7TA 1FZZA 5JPMH 4KELA 1GVKB 1TA6A 2G5VA 2P16A 5C1XA 4I8JA 5EW1H 1AVXA 1TX8A 3HGPA 1DANH 3MOCA 1AFEH 3QTVH 2AMPA 1N6XA 2P59A 2RA0A 1DY8A 4INHA 4XBCA 5GCHG 1GI1A 2QF0A 4BAMB 1CHGA 1OS8A 1N1LA 1XUGA 1O2IA 1YLCA 3F9HA 1SGIB 1KLJH 2D8WA 1HNEE 2SNVA 4UFEH 1SBWA 4ZXYH 3T5FH 2R2MB 2IOTA 3TIUA 3T27A 3PMHB 2HLCA 2O8UA 1YLDA 1BBRK 1DFPA 2BDHA 1P0SH 1HJ9A 3ZZ3A 3RDZA 1C4V2 1ORFA 3EQ0H 1THRH 3ZVEA 3M7UA 4GCHG 3PO1C 4UEHH 2ZPSA 1FY4A 3GY8A 3SU1A 1TX7A 2ZNKH 2XC5A 1OSSA 1AB9C 2A0QB 1MTVA 2I6QA 2OQ5A 2Y81A 3MH7A 3CS7A 3IITA 1DSTA 4CH8B 3PROA 2FLRH 1WYKA 4FUJA 1AO5A 1QA0A 1YCPM 2PKSB 4XBDA 1O39A 3VB3A 3GCTF 2FEQH 4YM9A 2ZFRH 2GV7A 2YNAA 4AGJA 1S82A 2OQUA 4TYDA 4YOIA 3C27B 1CT2E 1F5RA 2Z9JA 4HGCA
chains in the Genus database with same CATH superfamily
3ZZ4A 2FX4A 1D3TB 4NSYA 1T7CA 1ZHMA 5FBEA 1RGQA 4TSFD 1HJAB 1NZQH 2FOBA 1DLEA 4VGCC 1UVTH 3N7OA 1A7SA 4ABGA 1C2JA 1ARBA 1JOUB 3PB1E 5PTPA 3W95A 1ZYOA 5EODA 3N99A 5JBBS 4YO9A 3F2GA 1UVPA 1INCA 4UONA 1FJSA 2FZZA 1DUAA 4CRFA 1C1TA 1GL0E 1C4Y2 2BY5X 4DW2U 1NROH 3RXKA 3A7ZA 3FKSD 1DXWA 2UUYA 3BTEE 3H5CB 3UQOA 3OYPA 3E3TA 3TH4H 2GCHG 1SGRE 4CHAC 2R9PA 5A0CA 2FYQA 1LHEH 1G30B 3GYMA 4MNXA 1DOJA 4TY6A 1TE0A 4WMFA 2AGIX 1NRRH 2A2XH 1LHGH 2O8WA 3QWCH 1PPFE 3E91A 1MU6B 3STIA 4NA8A 5B6LA 2GGVB 2FXRA 1IQEA 5AFZH 1MH0A 3F0PA 4X1QU 4JZDH 1WTGH 3UNQA 3URCA 2BLOA 3TGJE 1MKXH 4ISOA 4AN7A 1AZZA 1V2QT 3VEQB 1UK4A 2ZA5A 3A7WA 3VPKA 4YT7H 2BY6X 2ZU4A 1SLVB 1LPGB 3BV9B 4E05H 3F2FA 1KDQB 5DN6D 3T62A 1L4DA 1XVOA 4FU9A 1DM4B 4Y8YA 4CRBA 1TPOA 2J34A 3RXAA 2BQ7B 2W6JD 3R0FA 1DWDH 1GJ7B 2WYGA 5C5OA 4K69A 1NY22 1BMNH 3EYDA 3FAOA 3SV9A 1W11U 1IQFA 1QNJA 3GYLB 3KYFA 3LONA 1DWCH 2YMSD 1LTOA 4FUHA 1T31A 4ZHLU 7KMEH 5HXFA 1WTHD 4AFUA 3CS0A 2J5UA 5LPEA 1C5PA 4A92A 1P3EA 3BIVH 2HVXA 1MABB 4FU7A 1CBWB 4NSVA 3TK9A 1MQ6A 4F4OC 1AMHA 2BD2A 2NU2E 4MQAA 1GJ6A 1W7GH 1OOKB 4Y11E 1O3BA 1QB6A 2NWNA 8GCHF 1HAPH 2VGCB 3R3GB 4DY7B 5K7RA 1UW7A 1KXAA 1P9SA 2JKHA 2CV3A 3E90B 3ZVAA 4MLFB 1ZGIA 2GZ9A 2VNTA 3BTTE 3LGUA 3WW7A 5AHGH 3GY3A 4X6OA 3I29A 4NCYA 2VVVA 2F9OA 4D7FA 2V3MA 2ZG0H 4X8SH 2FOEA 1A2CH 1K1OA 1SGQE 3NPSA 4ZH8A 2BD4A 1GPZA 3SV7A 1HAZB 2GKVE 3UB0A 1TBRH 1ELCA 2QYIA 3KEEA 3TK6A 1NFWA 1K1NA 2KCOA 1ABJH 4A6LA 3VG8A 3SZNA 1GJ4H 2BZAA 2BDCA 3BEIB 3ATIA 1ETRH 2WV5A 1G2LA 2BDGA 3OEHD 1QGFA 1GJ9B 4KTSA 1EP6A 2QC2A 2Z9IA 3L3TA 1XMNB 1H1BA 4FUIA 2G51A 2NU3E 1MTNB 4CRDA 1O3GA 2XNIA 5L2ZH 1GJCB 1XXDA 4CH2B 1SL3A 2XNDD 5FCRA 2ZHDA 5F03A 1GMHF 1GHYH 1MTSA 3RXLA 1HAHH 1OHHD 2A2QH 2OBOA 3SJIA 3W1EA 1K1LA 4NA9H 3MNCA 1L4ZA 3UIRA 1H8HD 4KTCA 3UPEA 2VIOA 1GBAA 2ZFFH 1JIMA 5LGOA 4QT8C 3M3SA 1NPMA 3M3TA 3U98H 4ISLA 4UFGH 4NA7A 1GI0A 1K21H 1FXYA 2BX3A 1MBQA 1HAXB 2J38A 5L2YH 1VGCB 2BY8X 1A3BH 1P2IA 2BM2A 3LC5A 2Y82A 1VITH 2G81E 3H09A 1P3CA 2H9HA 3BTGE 4Q4LA 3UOUA 2CF8H 1T4UH 1ANEA 2J2UA 5DGJA 1RTFB 4GAWA 2ZFQH 2J4IA 1Y5BT 1YKTA 5A0AE 3ESTA 4Q7XA 5FX6A 2M5TA 3RUOA 4ASUD 3S9CA 1OX1A 1KY9A 3U69H 2Q6FA 1Y59T 3RXRA 2XWBI 1ZMNA 1DITH 5FXLA 1PYTC 9LPRA 3OE7D 4A1TA 1QHRB 1W13U 5DJ7A 5KGOA 4CRAA 3D49H 1KMHB 1A0HB 2BVRH 1QB9A 4NWKA 4MNYA 3RXCA 1LPKB 2LELA 2W3KA 4I7YH 1DY9A 1NU7B 1UMAH 2FOGA 1T8NA 1ZR0A 3TH3H 1EFRD 1O3IA 3IG6B 5HM2A 4B1TA 3VGCC 2Z94A 2RFKC 3DT0H 1W8BH 4X8UH 1Y3VA 1DPOA 3MWIU 1O5AB 3AAVA 4LK4A 3SHAH 1ABIH 2HPPH 1O2GH 4ZKOU 4DOQA 3ZV8A 3A82A 2FMJA 1SR5C 1T8LA 3LH1A 2G8TA 1GMCG 3LU9B 4KP0A 2A4QA 2WHXA 2O8TA 2DE9A 3PV5A 1QL8A 2BLWA 1IQIA 2HNTF 1HCGA 3KGPA 1GBDA 2KAIB 3RXSA 1UTMA 3M5OA 2VU8E 1WBGB 1AVGH 2P94A 1BA8B 3K6ZA 5EQQA 5L30H 3ZYEA 2AHME 1TLDA 1Z6JH 3F2HA 1YYY1 4E7RG 3F0OA 4I31A 2FTLE 3MU5A 3CENA 2GMTB 1SGNE 4AFSA 1O3NA 2ZHFH 5DPAA 1BQYA 2J98A 3A85A 4YLUA 3RXIA 1N6YA 3SW2B 1L1GA 3L6PA 1K28D 2G5NA 3QN7A 7GCHF 1NM6A 1TABE 3U8RH 2G00A 1C1VH 1UCYK 1IQKA 2WPDD 1GHVH 1O2TA 3TJUA 1OPHB 2WV4A 5FAHA 4Z6AH 1CQQA 2Y5GA 1BIOA 4WF8A 1D6RA 1O2PA 3DSPA 5EQSA 1GHBG 2ASUB 5EQRA 3HK3B 1TGSZ 2PUQH 3MO9A 1C2MA 3SQEE 3FZDA 1YC0A 1PQ7A 4ZXXH 4ASHA 2QAAA 1ZMJA 1VR1H 2KR7A 2GT7A 3T29A 1ZPCA 2P8OB 1G2MA 1HLTH 1EUFA 1XKAC 3TVJB 4ABEA 2B7DH 4GPGA 3ZV9A 1ZSLA 1NC6A 2XCFA 1PPZA 3ZIAD 2HNTC 3A88A 1AZ8A 3W94A 4X1PU 3URDA 5EXNA 1P09A 1MZAA 1OWKA 5TJXA 1SSXA 3ELAH 2HOBA 1E79D 4O03A 3RC5A 2A45B 3PWCA 4B6EA 1EZSC 1TRNA 1TIOA 1S81A 3GY2A 2TGDA 2RG3A 4XOJA 1J17T 1A5HA 1ACBE 3V13A 5EJZA 1V2MT 1KDQA 2XTTB 1O2LA 1H9IE 1OYQA 1CGHA 1TGNA 2ALPA 1HYLA 1O38A 1K1PA 1WAYB 1AWHB 4ABFA 1BBRE 3T25A 2QXJA 1UJ1A 1E38B 2A32A 3RXGA 5GPIB 1GI3A 5A0BA 1CHOF 3GDVA 2AEIH 2WPHS 2XCNA 1M9UA 1YF4A 2AERH 3OY6U 3QX5H 3NZIA 3HPTB 1LDTT 2VH0A 1WV7H 2A5IA 1W14U 1DLKB 1RXPA 3RP2A 4KKDA 5DKMA 3ZZAA 3OSYA 3ZZCA 1QRXA 2C90B 5EOKA 2PKAB 3P92A 1ANBA 5E2OA 3EA7A 3PM3A 2ZKSA 4GUXA 3MMGA 5HMAA 1VKYA 3SO3A 2WPLS 2CHAC 3UAIC 1SGCA 1TMUH 2STAE 5BRRE 3OTJE 3LH3A 1FIZA 3TLOA 1KTTB 2CK3D 1MBMA 1FLEE 1HAOH 4BAQB 1X7AC 1K0HA 3GCHC 1B0FA 1RIWB 5LPRA 5HYOA 4X2YA 1GHXH 1UTQA 1S84A 1HAYB 1AI8H 2B0FA 1FDPA 2ZFTA 5DP7A 2OLGA 3KQCA 1TMBH 1QFKH 1N8OC 1ZHRA 4MNVA 3FN8A 1C1WH 3MH5A 3N7DA 1FY3A 6ESTA 2H9TH 3KNXA 4H42U 1O3AA 1GBBA 3GDUA 5AF9H 2KCPA 1BMLA 1D3QB 1JWTA 2SGQE 1QJ7B 1ZTLA 2TIOA 1T4VH 4OGYA 2V3OH 1PPBH 2Z9KA 3M7QA 3SV2H 4H4FA 4B74A 1VJ9U 1GG6B 3RXJA 2JDID 2ANKH 4HFPB 3LGTA 3RLYH 2STBE 1W10U 2LPRA 4K60A 2ODYB 4AB8A 2A7JA 3RXPA 1OWJA 2WINI 3BSQA 3PRDA 1LVOA 1QL7A 5AFYH 2AMQA 2FX6A 3SU2A 1O5DH 1CA0B 2V35A 2W26A 1CT4E 1V2RT 1GBFA 5G4BA 1TOCB 1EPTB 4X1SU 1KIGH 1P2KA 1GDUA 1MKWK 2BMGB 5GIBA 2OC1A 3TITA 4A5TS 3M35A 4JYUH 1GHAF 4ABIA 1NU9A 1V3XA 5C17A 2HGTH 1Y8TA 1IAUA 4FUCA 1BMAA 3LGWA 4D76A 3K2UA 1F2SE 3NWUA 5GDSH 1C5SA 1GBEA 3M3VA 4NZLA 4A1VA 2H5DA 2OD3B 3FZZA 5JBTA 3KIDU 1V2TT 3ATMA 2C8ZB 1W0JD 1O2ZA 1YPHE 2A1DB 1O2QA 1GL1A 3L33A 1MZDA 1KSNA 5FHTA 2BY7X 1Z1JA 2B8OH 2ZU3A 2BD9A 5T6DA 2EI8A 2PUXB 1GBJA 1AU8A 1EAIA 4UE7H 2A5AA 3UY9A 2BVXH 4ZUHA 1HXEH 5HM9A 1GGDB 1TNJA 3F68H 1O3FA 2Z9LA 4JZ1A 3BG8A 4DVAU 1LVYA 3AK5A 3HKJB 1EOJA 1ETTH 4JCNA 2H9EH 1TMTH 1YLNA 3FOAA 1UK3A 4DGJA 2GJGA 8GCHG 1O36A 4Y0ZE 2A5KA 3SYJA 2VWMA 1PFXC 2VJ1A 1W0ZU 1ESBA 5F6MA 1C5UA 1E1QD 2ZFPH 3ZVCA 1Y3YA 1P2JA 1JXPA 1OP2A 1GWAA 5GNDA 2JETB 2VVUA 1A1RA 1Q3XA 1V2KT 1KLIH 3LIWA 1V2UT 1ZOMA 4B2BA 1C2EA 1W12U 4WMEA 2XBYA 3AVZA 4Y10E 1C1PA 2HPQH 3SNEA 2XC0A 2AGEX 3KQ5A 1C2DA 1KXDA 1O3CA 1MAXA 3SUFA 4NWLA 2BZ6H 2EEKA 1ELVA 1BJUA 2BDYA 4X6NA 3UUZA 5LH8A 2W7UA 2VINA 4XD7D 3SU0A 2F9UA 1V2VT 8KME2 1HAVB 2BD5A 3RXUA 2AYWA 2OUAA 1A0JA 1C2GA 4HTCH 1BTHH 1HUTH 4Y76A 5HIZA 4JYVH 1EZUC 2PLXA 3SI3H 1MTUA 3TJNA 1DXPA 1ZTJA 1NO9H 1GDNA 4NFFA 5I25A 1PQ8A 3BTDE 4XE4A 2Z6BD 2V0BA 1IQLA 1PQAA 1OWIA 1J15A 1EJAA 1SGEE 4M7GA 4O97A 1HIAA 3U8OH 4MVNA 3EA9A 3VB4A 2OC0A 1C5QA 2VIWA 1QURH 3PV4A 4NGAH 4F49A 2XW9A 3S0NA 2QF3A 2ZDLA 2DE8A 2VIDA 3U1IB 1LHCH 3UWJH 2BHGA 3GICB 3FFGA 2BVSH 4BOHA 1THSH 1ANDA 2KCYA 2D26C 1YPGH 1P01A 3RMLH 1ANCA 2FOHA 4ACBA 1GCDA 3A83A 3M61U 5T3HA 2VWNA 1AVWA 1T8OA 4YESB 3MH4A 3HGNA 3RXFA 1QRZA 5EU8A 2PFEA 1EJMA 1LVBA 2OP9A 4K1SA 1GJAB 5A09A 2UUKB 1P57B 2GCTB 1FNIA 4DIHH 1ZHPA 2C93B 3FO8D 3LGVA 1KXFA 2VIPA 1RRKA 1TRYA 2EC9H 4IC6A 1O37A 2F9NA 1GJ8B 3EA8A 5KECA 1P06A 1O2VA 3UR6A 2YMSC 3DUXH 6GCHG 1UTKA 2QV1A 2PTCE 4U2WA 4D8NA 2QN5T 3FP6E 2ZCHP 2K0QA 3MO3A 1GI9B 1P2MA 2P3FH 4THNH 1O3PB 4UFDH 2CGAA 3SNAA 2BD7A 1XUIA 1VCPA 2FS9A 2SGPE 4YTAA 1IQGA 1V2PT 1RFNA 1XUHA 1SC8U 2ZHQH 3ZZDA 4TPYA 4CBOA 4GCHF 3TU7H 2KZ4A 4ACAA 1YCPK 1O5CB 1GBKA 1VCQA 2AFQB 2Q1JA 4I32A 3SV6A 1SLXB 4GHQA 1OP0A 1B0EA 3VXEH 2GDEH 2SGAA 4ABJA 5GJ4B 2Z3EA 3SJ9A 1TNIA 4AYYB 1E34B 3ZVFA 1TBQH 2OINA 4WH6A 1FUJA 1F0SA 1O2JA 1YPMH 1ZZZA 1UHBB 5FPTA 3NXPA 1UCYE 4Y8ZA 1H4WA 4Y7AA 1NBME 2Z3DA 3H7TA 5F8ZA 1H8IH 2RA3A 2VBCA 2XBVA 1Z8RA 2GD4B 2CHAB 1P11E 2AGGX 3LJOA 1TB6H 4YOJA 2ZGXH 1O3EA 1TRMA 2H1UA 2JJ2D 3OY5U 4Q7YA 5CHAC 6CHAB 3RC4A 4Q80A 1GHWH 2XYAA 3BG4C 3KHVA 4YLQH 4SGBE 3SN8A 2WSSD 4MPVA 4ABDA 1AQ7A 1C1QA 4CREA 1WOFA 1GBHA 1V2LT 2HNTE 2BDBA 4AZ2B 5BPEA 1BTWA 4BXSA 5ETXA 2GCHF 3EDXB 1SQRA 4YZUA 3P8NA 1BZXE 4AFZA 4ZKRU 4KGAA 1O2UA 1YY3A 1FN6A 2ZO3H 4ZAEA 1W0YH 3O8DA 2ZPRA 1O5BB 1AY6H 2HALA 1GVZA 4NIVA 4MPUA 4PROA 3A8BA 4WMDA 3FANA 2FOMB 1DWEH 1IHSH 2A4OA 3UNRA 2QIQA 2IJOB 3VB6A 2G4TA 2XBWA 1EPTA 1AD8H 1FIWA 3NRLA 1C5XB 1C4U2 2HWLB 1AUJA 4LZ4B 4MDSA 2GZ8A 3HKIB 3GOVB 1D3PB 5EPNA 2KX4A 2WPIS 4ISHH 5E2PA 1BRUP 2ANMH 2FOAA 1PYTD 4X2XA 3WY8A 1EAUA 4P02A 3E6PH 3NKKA 3EAJA 1LHDH 4WH8A 3NUMA 2XBXA 2JH5D 3SUDA 4GVUA 1XUFA 2L74A 1IOEA 1O33A 1HAIH 1TWXB 4FOUC 5DP8A 4AFQA 4AG2A 1W0KD 1C5VA 1RJXB 1OXGA 1VCWA 4BTUB 1EAWA 1GBCA 2WUBA 2PKSC 5EG4A 1YPLH 1AGJA 4X1RU 2AH4X 2FWWA 2P3TB 2C8YB 1OKXA 5DP5A 3SHCH 5EIYA 1Y3UA 2FS8A 3RLWH 4ZMAH 1C2KA 5C3NA 2WUCA 1O3JA 2F83A 2QCYA 1G37A 1C2LA 2Y7ZA 5EW2H 1QQUA 1NRNH 4INKA 2ZGJA 2KFWA 2I6SA 1UVUH 3LOXA 1L0ZA 4J2YB 7ESTE 1HJAC 4Y0YE 5DG6A 4BTIB 1Z8JB 3PO1B 5CE1A 5DO4H 4XDEA 2BLVA 1UTNA 2FDAA 1AB9B 1BBRH 1HV7A 3LGIA 3PMAB 3D23A 3LT3A 1Y5UT 1A5IA 3RU4T 3RXDA 3STJA 1TNKA 3OFND 1KTSB 1XUKA 3ZZ9A 3KF2A 3UWIA 2GZ7A 4FUEA 3O8RA 2OC8A 3AW1A 1F0TA 4IGDA 1TQ0B 4O9VA 4X1NU 4B76A 3NCLA 2PSXA 2UWPA 2A4GA 1FAKH 1BITA 1O2HA 1D3DB 3KQBA 3KL6A 1C2FA 2A7CA 2ZCKP 4VGCB 2W6ID 1O3LA 2ZWLH 1Z7KA 1OP8A 2VVCA 1SHYA 4IS5A 1NBMD 1ELEE 1NESE 2ZC9H 3SORA 4WWYA 2YNBA 3AASA 2R2WU 1AE5A 1B5GH 1QCPA 2D1JA 2ANYA 2BDIA 1GVLA 2HLDD 4DCDA 1DE7H 3UQVA 1A61H 3MTYA 1COWD 2NU1E 1JRTA 1SQAA 1IQJA 2J94A 1OWEA 3SOSA 1UTJA 4TY7A 4X8TH 1OWDA 4CHAB 1BRCE 4CRCA 4IBLH 3RM2H 1QBOA 3TGIE 1H9HE 3OAAD 1JRSA 8ESTE 4FUBA 2LNCA 1GJDB 1QR3E 2J92A 1HXFH 1TBZH 1Z8GA 2C8XB 4K3JA 4R0IA 2V3HH 4NIXA 2JJ1D 4BAOB 1K1MA 3SNDA 1AN1E 1Q2WA 1SPJA 3PWBA 1ZRBA 2J97A 2QA9E 3LGYA 3LJJA 1Z8IB 2BD8A 4I8GA 3SUEA 1MUEB 3A8DA 1FONA 1S0QA 1C9TA 3PYHA 1E0FD 1EB1H 2RDEA 5JBCS 2O9QA 2ZU1A 1V2JT 3ODDA 1WSSH 3AAUA 3P8GA 4NFEA 3UFAA 5J4SA 3WWBA 4B73A 1P05A 4RSPA 4RKOB 3BTHE 1AE8H 2O8MA 4BAKB 3GDSA 5T1VA 1ELFA 1VZQH 3RU4E 1VITF 3DSOA 4OGXA 5KEDA 2KCAA 5C0UA 1FPCH 3OU0A 2ZF0H 3MNXA 3MU1A 4JZEH 4O3TA 4AX9H 1LO6A 3PV2A 1GI6A 1O3MA 1TAWA 1B7XB 3S7KB 3VB5A 1DS2E 4ZHMU 4DT7B 3GCTG 3S69A 1RS0A 1O30A 3LDXH 2Y80A 2ZHWH 4RT0A 1GMCF 1SGFG 1SMFE 1QB1A 4IMZA 1HGTH 1WCZA 4JK5A 1ELDE 4F48B 1DICA 1FQ3A 1ZLRA 8LPRA 3NK8A 1G3EA 1OYTH 3FP8E 1S6HA 3E16B 1GCTC 3TH2H 1J14A 2QE7D 1C1RA 2SNWA 3RXMA 4LOYH 5C5NA 2BYAX 1ELTA 2BOKA 1MQ5A 4WY3A 2AIPA 1GBIA 3F3BA 2CJIA 4Y8XA 1ETSH 4E06H 4X0WU 2ZHEH 2RCEA 1KYNA 2D2DA 2BDAA 3HATH 1MTNC 3N7EA 1PQ5A 1WXRA 1P04A 1EKBB 2FIRH 1XKBC 1AIXH 1S5SA 2OCVB 2ZGHA 1CO7E 3SV8A 1PJPA 2HVYB 1S6FA 2V6NA 5LPFA 1UHBA 4DURA 4XRNA 2CN0H 3QTOH 2EY4C 5GWZA 1RTKA 1C9PA 3H7OA 1F7ZA 1PPCE 4WVPE 5EJLA 2ZTYA 3T26A 1YBWA 3ZZ8A 4D9QA 3BEUA 1BHXF 3F1SB 1TPAE 3MU4A 4ZKNU 1ZTKA 1MD8A 1D4PB 2P95A 1C1MA 2THFB 2XXLA 9ESTA 1AWFH 3TNTA 1A3EH 1VGCC 4UD9H 3O8BA 3ZZ7A 4IC5A 2B5TB 3QDZB 4Q7ZA 2VB0A 3SNCA 2PSYA 2BOHB 1C1NA 1DT2A 2C4FH 3PMJA 1NFUA 4B6FA 1SOTA 3ATKA 5ESBA 4IMQA 1G3BA 1O5FH 1TPSA 1FX0B 2HRVA 3BG4B 1ELBA 3Q77A 2OC7A 4K2YA 1G3DA 4K1TA 1A0LA 2ALVA 2ZU5A 3BTME 3ODFA 1AHTH 2PHBA 4RT1A 1BT7A 2GTBA 6LPRA 1O31A 4FU8A 1EASA 3ZVBA 1HBTH 3MH6A 1SGPE 1O2WA 1CGJE 2TRMA 4X2VA 1DSUA 1V2NT 1DX5M 1IQNA 1P03A 2UWLA 4I33A 4JZFH 1CGIE 1UTPA 1FV9A 1D6WA 1HB0B 3UREA 2W5EA 3P8OA 1O2MA 1Y3XA 2BX4A 1C5WB 3DCLA 3RMOH 4TT3D 1P2OA 4RN6A 1ARCA 4XFQA 4RKJB 3SU3A 2ZQ2A 1YP9A 1CSOE 2UUJB 5DK1A 2FI5E 5C1YA 1BOQA 1GJ5H 4BTTB 5IK2D 2PTNA 1YPEH 1YM0A 1UVSH 2VH6A 3TGKE 2QF4A 1QBVH 3DSGA 4P00A 5E0HA 1NRSH 5C1UA 1ESTA 1LHFH 1BDAA 4OS4A 1C5OH 3CNRA 2JIZD 1W7XH 4HZHA 4ISIH 3VGCB 3V0XA 1WUNH 4OS2A 1P02A 5FPYA 3HK6B 3PTNA 1DVAH 1EAXA 2BXUH 2PGBB 3RU4D 2FYRA 4GSOA 2GMTC 5FPSA 4B2AA 1MCVA 3RC6A 2AMDA 4DT4A 4LZ1H 2ESTE 3OEED 5DP4A 1LQDB 2KAIA 5DSFA 2VIQA 1AKSB 1GBLA 4INLA 1O2SA 2ZU2A 1THPB 1D9IA 3U1JB 2PP6A 5F8XA 4DG4A 2EI7A 1HAGE 2C8WB 3RXBA 3A86A 1EB2A 1ZSKA 3ZVDA 3A8AA 2QGRA 1FY8E 1MMJN 2ZP0H 1EQ9A 5A2MH 3RXEA 1K2I1 2P93A 2Y5FA 1ZJKA 2QXIA 4MPXA 4Y71A 2C3SA 4IN1A 2M2AA 2R3UA 3SI4H 3AW0A 3A84A 4ESTE 1O5GH 2IPHA 3P70B 5CHBA 3GS9A 4AC9A 1C5YB 1TNHA 4HI3A 4AG1A 1GI2A 3VFEA 1V2ST 2W7SA 1FY1A 2GT8A 3ITIA 2IJD1 1Q31A 1BTPA 3T2NA 1GMHG 4X6PA 1S85A 1V6DA 1JIRA 2P8OC 1O2OA 3EE0B 5J4QA 1ZJDA 4OS7A 2EQNA 2XC4A 3QO6A 4D9RA 5HKKD 3E0NB 1NRQH 3RXVA 3ZZ6A 1UK2A 1Y3WA 1VJAU 1BCUH 4OS1A 3DA9B 2B9LA 1UCYH 4TPIZ 3SGAE 1TA2A 3RMNH 3A7XA 3U28C 5E8EH 3I78A 1ZPZA 1F5LA 1FMGA 1BTYA 3SZEA 4M9FA 2FM2A 3SGQE 4AB9A 1NTPA 2BXTH 3A81A 1GMDF 3P95A 1Z1IA 3OX7U 5I46H 5F53A 4AYVB 1H8DH 4JZIA 2DUCA 2EI6A 3EE7A 1PPEE 3Q00A 4FVDA 1C1UH 5TCCA 2TGTA 2H5CA 3F6UH 1C5MD 2BTCE 3ZZBA 4B75A 1S0RA 2ZFSA 5JDUB 3T28A 2AS9A 2WZQA 1AFQC 1XXFA 1O2KA 5GCHF 3Q3KA 2JH6D 4A1XA 4MNWA 1L1JA 4XSKU 2OK5A 3TJOA 1DDJA 1BTUA 3P6ZB 2FPZA 1SGFA 2R3YA 4H6TA 1TGBA 2ZDAH 5L6NH 3IWMA 1CT0E 2BD3A 1KXEA 1UTOA 3ATWA 1K9OE 2FOFA 2PW8H 5FL7D 2BQWB 1QIXB 2ZEBA 4R8TB 4BAHB 4AOQA 1LVMA 2OBQA 3BF6H 1O2RA 3MU8A 1XM1A 2FESH 1QL9A 4XBBA 5FBIA 1YPHC 3GCOA 1V2WT 3M5NA 3ZZ5A 1ZGVA 3FP7E 2Z7FE 2F43B 2TBSA 1EZQA 5IYTA 3RXQA 1GDQA 2SFAA 2IN2A 4B71A 4E7NA 2J9NA 4BXWA 1FAXA 1BUIA 4B2CA 1O5EH 1UVOA 4IW4E 3E0PB 1P2NA 3P17H 5GXPA 1E36B 2A31A 3JZ1B 4ISNA 1LKBA 1L2EA 1YWUA 1RIWC 2PKAA 4O3UA 1C2IA 3TJVA 4ZCNA 3BTFE 1DUEA 1TNLA 5FX5A 3RMMH 4FVBA 2G55A 4X2WA 1SGYE 2WPJS 2FO9A 2WV9A 3LC3A 4MPWA 1SGDE 3TK5A 4DIIH 2TGPZ 3ZYDA 3PMBB 7GCHG 2FODA 1XX9A 4UFFH 1SOZA 1YPKH 2ZDKA 3DHKH 1K1JA 1AUTC 3SUGA 1PPGE 3A7VA 2O8LA 1GG6C 3PLKA 5C20A 5JB8S 2IPQX 1O3DA 2VWLA 4IN2A 1GCTB 2CMYA 2F9BH 3D62A 3DFLA 4D7GA 2Y6TA 3GCHB 4CBNA 1WU1A 1GBMA 4YOGA 2GDDA 1NFYA 1WQSA 5DP9A 1TX6A 1EJNA 3LKWA 5C94A 1ESAA 1C5RA 1NFXA 3C1KA 1CA0C 3G01A 3QZQA 3UNSA 1N8OB 2Z9GA 3V7TA 1EPTC 1O32A 2Z3CA 1O3OA 4Y7BA 1H8ED 3LPRA 5C2ZA 2K1QA 3V12A 2ANWA 2KM0A 1SI5H 4Z0KA 5A8XA 2BLQA 1KLTA 3A87A 4Y79A 1BB0B 4OS6A 1QJ6B 1LCYA 2ZI2H 3UR9A 2AIQA 3JZ2B 1BJVA 2VIVA 2H6MA 2WPMS 3FVFB 3A7TA 3QLPH 5E0GA 1FY5A 1SLUB 2GP9B 4WJG2 4ABHA 1CU1A 1RTLA 1P12E 3B23B 5JYIA 2CXVA 4CR9A 1C5ZB 1G9IE 3SBKA 1ZSJA 1SGTA 1ELAA 1SFIA 2JH0D 3MFJA 5T6GA 3VXFH 1YPJH 4Y6DA 1SFQB 1U6QA 4YXWD 1GGDC 3GISB 1O0DH 3DFJA 1MAYA 2GX4A 3D65E 3MI4A 4TWWA 2PV9B 1EZXC 3QUMP 2UWOA 1UTLM 3OTPA 7LPRA 3RXHA 3PLBA 1C5LH 3SJOA 1CHOG 2J95A 4F55A 1MKWH 1HDTH 4WXVA 2R0LA 1F0UA 5HGGA 1H9LB 3A8CA 3M36A 1MTWA 4TWYA 1VITG 4FUGA 4H6SB 3A80A 2L6OA 4FUFA 1QZ8A 2F91A 2QXGA 2Y7XA 2Q6GA 1LMWB 1GBTA 3O8CA 2FI3E 3SU4A 4K8BA 2P3UB 2JETC 6GCHF 2QXHA 1DWBH 5C67A 1TGCA 5IDKA 1O3KA 2VWOA 2PGQB 3B8JA 1GI8B 1BRBE 4NIWA 2NU0E 1CA8B 1J9CH 4ABBA 1QQ4A 1A4WH 1BMMH 1Y5AT 2OXSA 2UUFB 1BHXB 1E35B 1T8MA 1LQEA 1JBUH 2ZPQA 2A7HA 4I8HA 1SQOA 1JMOH 3GCNA 1EATA 1TALA 3KQDA 3KN2A 5H4IB 5EJ1A 3QGNB 1FI8A 1SKYE 4BNRA 4DJZB 1G3CA 3ATLA 1SHHB 1NT1A 3E8LA 1O34A 1CVWH 3KYGA 1AKSA 1J16A 2ZIQH 5SGAE 1XVMA 1YGCH 1BRAA 2LP6A 5DP6A 3BTWE 4NIYA 5FCKA 2ZZUH 3RXTA 1QBNA 4A7IB 1MKXK 1LKAA 1O35A 1EXFA 3A89A 5ABWA 2OTVA 2ZECA 4RI0A 1WDIA 1L1NA 1LPZB 1Z71A 1HAVA 1RD3B 1O3HA 2V7QD 2BQ6B 2F4LA 3MNBA 1EP5A 4U01A 3BTQE 3KCGH 1P9UA 1TOMH 2ODPA 2K8IA 4FUDA 3QGJA 4HG6A 4OS5A 4Q63A 3U9AH 1GI7B 4MG3A 2ZGBH 4MTBA 4X8VH 5EPYA 2H2ZA 2F9PA 4JK6A 3SJKA 1HIAB 4JMYA 4SGAE 3VB7A 2PR3A 1TYNA 2ZDVH 3UTUH 3UOPA 2G52A 4KTUA 1HFDA 3BIUH 1GHAG 2BY9X 3Q3XA 4Z1MD 3F9FA 1Z6EA 5JB9S 3M37A 3V3MA 3TNSA 2Y5HA 1GJBB 1QTFA 1SLWB 1PPHE 1SVPA 1ZMLA 2TPIZ 3M5LA 4UDWH 1HJ8A 2FTMA 1S83A 1SB1H 3K6YA 1E1RD 5DP3A 5B6OA 4I8KA 1ZPBA 1IHTH 1TQ7B 2GCTC 3K65B 4ABAA 2TGAA 3S9AA 1FN8A 2FLBH 2QY0B 3SQHE 3Q76A 1QJ1B 3QK1A 3Q3YA 5K0HA 2F9VA 2NU4E 1O2XA 3PRBA 3SGBE 1EX3A 2EA3A 3PLPA 5TCAA 1V2OT 2G4UA 3CP7A 2ILNA 3EGKH 1NRPH 1CBWC 1F5KU 4CRGA 1T32A 2ZTZA 1GHZA 1NS3A 1KXBA 2ZTXA 1MU8B 2ODQA 1P8VC 2VGCC 2ZDMA 1KXCA 3BTKE 4WXIA 1HRTH 1GI4A 1K1IA 1QY6A 2SGDE 4YT6H 4ZROA 2ZCLP 5A8YA 2XWAA 3QZRA 1C5TA 5T6FA 1AFQB 1K22H 1F0RA 3GY5A 1P10A 4Q2KA 3ZVGA 4JYTA 3DD2H 5EGMA 1MCTA 3SU6A 3MO6A 3U8TH 3BN9A 2YMSB 1P2QA 2ZQ1A 3MNSA 5A8ZA 1UO6A 4OM9A 4K8YA 5ESTE 1ID5H 3S7HB 4GHTA 3GY4A 1TONA 1W3CA 2CF9H 1O2NA 3WWFA 3SJ8A 3RXOA 1C2HA 1ELGA 4NG9H 1CE5A 3RM0H 5CDFE 4I86A 5EXMA 2BB4A 1SG8B 4LXBH 1TNGA 3F9GA 4J1YA 3I77A 1XUJA 1QRWA 2FI4E 4X6MA 2R0KA 2Q6DA 3K9XB 2GV6A 1QA7A 4U32A 4BANB 1SQTA 1C1OA 1A5GH 3GY6A 1BTZA 5AVDA 3GY7A 4K5ZA 1IQHA 1HPGA 1W2KH 2ULLA 3MU0A 4ZHAA 4AORA 1IQMA 1S6LA 6CHAC 5CMXH 3MHWU 1BTXA 1TPPA 1EOLA 3ENSB 2ZGCA 3MYWA 1FPHH 1J8AA 3SNBA 2FP7B 4K1EA 4I8LA 2W3IA 4GLYA 2QF5A 1YCPH 3BEFB 3KQEA 3S9BA 4U30A 4ZKSU 5JBAS 1TFXA 3B9FH 1WQVH 2GVFA 1C1SA 1GI5A 4AGKA 3P8FA 5EXLA 3A7YA 1C5NH 4CR5A 3E1XB 1NN6A 3SU5A 2XRCA 5E0JA 2YOLA 2XOKD 1G36A 1GHBF 1G32B 2SGFE 2WYJA 4NZQA 2PWXA 3F9EA 5F8TA 5CHAB 1F92A 2SGEE 1MD7A 1O2YA 3TPIZ 2ZDNA 2RDLA 4FXGH 2WPKS 1OWHA 1E37B 2A4RA 5HIYA 3PTBA 3M5MA 2FOCA 2F3CE 1TGTA 1ZRKA 1GMDG 1A46H 3M7TA 1FZZA 5JPMH 5C0TA 4KELA 1GVKB 1TA6A 2G5VA 2P16A 5C1XA 4I8JA 5EW1H 1AVXA 1TX8A 3HGPA 1DANH 3MOCA 1AFEH 3QTVH 2AMPA 1N6XA 2P59A 2RA0A 1DY8A 4INHA 4XBCA 5GCHG 1GI1A 2QF0A 4BAMB 1CHGA 1OS8A 1N1LA 1XUGA 1BMFD 1O2IA 1YLCA 3F9HA 1SGIB 1KLJH 2D8WA 1HNEE 2SNVA 4UFEH 1SBWA 4ZXYH 3T5FH 2R2MB 2IOTA 3TIUA 3T27A 3PMHB 2HLCA 2O8UA 1YLDA 1BBRK 4FETA 1DFPA 2BDHA 1P0SH 1HJ9A 3ZZ3A 3RDZA 1C4V2 1ORFA 3EQ0H 1THRH 3ZVEA 3MQKC 3M7UA 4GCHG 3PO1C 4UEHH 2ZPSA 1FY4A 3GY8A 3SU1A 1TX7A 2ZNKH 2XC5A 1OSSA 1AB9C 2A0QB 1MTVA 2I6QA 2OQ5A 2Y81A 3MH7A 3CS7A 3IITA 1DSTA 4CH8B 3PROA 2FLRH 1WYKA 4FUJA 1AO5A 1QA0A 1YCPM 2PKSB 4XBDA 1O39A 3VB3A 3GCTF 2FEQH 4YM9A 2ZFRH 2GV7A 2YNAA 4AGJA 1S82A 2OQUA 2J98B 4TYDA 4YOIA 3C27B 1CT2E 1F5RA 2Z9JA 4HGCA
chains in the Genus database with same CATH topology
3ZZ4A 2FX4A 1D3TB 4NSYA 1T7CA 1ZHMA 5FBEA 1RGQA 1HJAB 1NZQH 2FOBA 1DLEA 4VGCC 1UVTH 3N7OA 1A7SA 4ABGA 1C2JA 1ARBA 1JOUB 3PB1E 5PTPA 3W95A 1ZYOA 5EODA 5JBBS 4YO9A 1UVPA 1INCA 4UONA 1FJSA 2FZZA 1DUAA 4CRFA 1C1TA 1GL0E 1C4Y2 2BY5X 4DW2U 1NROH 3RXKA 3A7ZA 1DXWA 2UUYA 3BTEE 3H5CB 3UQOA 3OYPA 3E3TA 3TH4H 2GCHG 1SGRE 4CHAC 2R9PA 5A0CA 2FYQA 1LHEH 1G30B 3GYMA 4MNXA 1DOJA 4TY6A 1TE0A 4WMFA 2AGIX 1NRRH 2A2XH 1LHGH 2O8WA 3QWCH 1PPFE 3E91A 1MU6B 3STIA 4NA8A 2GGVB 2FXRA 1IQEA 5AFZH 1MH0A 4X1QU 4JZDH 1WTGH 3UNQA 3URCA 2BLOA 3TGJE 1MKXH 4ISOA 4AN7A 1AZZA 1V2QT 3VEQB 1UK4A 2ZA5A 3A7WA 3VPKA 4YT7H 2BY6X 2ZU4A 1SLVB 1LPGB 3BV9B 4E05H 1KDQB 3T62A 1L4DA 1XVOA 4FU9A 1DM4B 4Y8YA 4CRBA 1TPOA 2J34A 3RXAA 2BQ7B 3R0FA 1DWDH 1GJ7B 2WYGA 5C5OA 4K69A 1NY22 1BMNH 3EYDA 3FAOA 3SV9A 1W11U 1IQFA 1QNJA 3GYLB 3LONA 1DWCH 1LTOA 4FUHA 1T31A 4ZHLU 7KMEH 5HXFA 1WTHD 4AFUA 3CS0A 5LPEA 1C5PA 4A92A 1P3EA 3BIVH 2HVXA 4FU7A 4NSVA 1CBWB 3TK9A 1MQ6A 4F4OC 1AMHA 2BD2A 2NU2E 4MQAA 1GJ6A 1W7GH 1OOKB 4Y11E 1O3BA 1QB6A 2NWNA 8GCHF 1HAPH 2VGCB 3R3GB 4DY7B 5K7RA 1KXAA 1P9SA 2JKHA 2CV3A 3E90B 3ZVAA 4MLFB 1ZGIA 2GZ9A 2VNTA 3BTTE 3LGUA 5AHGH 3GY3A 4X6OA 3I29A 4NCYA 2VVVA 2F9OA 4D7FA 2ZG0H 4X8SH 2FOEA 1A2CH 1K1OA 1SGQE 3NPSA 4ZH8A 2BD4A 1GPZA 3SV7A 1HAZB 2GKVE 1TBRH 1ELCA 2QYIA 3KEEA 3TK6A 1NFWA 1K1NA 1ABJH 4A6LA 3SZNA 1GJ4H 2BZAA 2BDCA 3BEIB 3ATIA 1ETRH 2WV5A 1G2LA 2BDGA 1QGFA 1GJ9B 4KTSA 1EP6A 2QC2A 2Z9IA 3L3TA 1XMNB 1H1BA 4FUIA 2G51A 2NU3E 1MTNB 4CRDA 1O3GA 2XNIA 5L2ZH 1GJCB 1XXDA 4CH2B 1SL3A 5FCRA 2ZHDA 5F03A 1GMHF 1GHYH 1MTSA 3RXLA 1HAHH 2OBOA 2A2QH 3SJIA 1K1LA 4NA9H 3MNCA 1L4ZA 3UIRA 3UPEA 4KTCA 2VIOA 1GBAA 2ZFFH 1JIMA 5LGOA 4QT8C 3M3SA 1NPMA 3M3TA 3U98H 4ISLA 4UFGH 4NA7A 1GI0A 1K21H 1FXYA 2BX3A 1MBQA 1HAXB 2J38A 5L2YH 1VGCB 2BY8X 1A3BH 1P2IA 2BM2A 3LC5A 2Y82A 1VITH 2G81E 1P3CA 2H9HA 3BTGE 3UOUA 2CF8H 1T4UH 1ANEA 2J2UA 5DGJA 1RTFB 4GAWA 2ZFQH 2J4IA 1Y5BT 1YKTA 5A0AE 3ESTA 4Q7XA 5FX6A 2M5TA 3RUOA 3S9CA 1OX1A 1KY9A 3U69H 2Q6FA 1Y59T 3RXRA 2XWBI 1ZMNA 1DITH 5FXLA 1PYTC 9LPRA 4A1TA 1QHRB 1W13U 5DJ7A 4CRAA 3D49H 1A0HB 2BVRH 1QB9A 4NWKA 4MNYA 3RXCA 1LPKB 2W3KA 4I7YH 1DY9A 1NU7B 1UMAH 2FOGA 1T8NA 1ZR0A 3TH3H 1O3IA 3IG6B 5HM2A 4B1TA 3VGCC 2Z94A 3DT0H 1W8BH 4X8UH 1Y3VA 1DPOA 3MWIU 1O5AB 3AAVA 4LK4A 3SHAH 1ABIH 2HPPH 1O2GH 4ZKOU 4DOQA 3ZV8A 3A82A 2FMJA 1SR5C 1T8LA 3LH1A 2G8TA 1GMCG 3LU9B 4KP0A 2A4QA 2O8TA 2DE9A 1QL8A 2BLWA 1IQIA 2HNTF 1HCGA 3KGPA 1GBDA 2KAIB 3RXSA 1UTMA 3M5OA 2VU8E 1WBGB 1AVGH 2P94A 1BA8B 3K6ZA 5EQQA 5L30H 3ZYEA 1TLDA 1Z6JH 1YYY1 4E7RG 4I31A 2FTLE 3MU5A 3CENA 2GMTB 1SGNE 4AFSA 1O3NA 2ZHFH 5DPAA 1BQYA 3A85A 4YLUA 3RXIA 1N6YA 3SW2B 1L1GA 3L6PA 1K28D 2G5NA 3QN7A 7GCHF 1NM6A 1TABE 3U8RH 2G00A 1C1VH 1UCYK 1IQKA 1GHVH 1O2TA 3TJUA 1OPHB 2WV4A 5FAHA 4Z6AH 1CQQA 2Y5GA 1BIOA 4WF8A 1D6RA 1O2PA 5EQSA 1GHBG 2ASUB 5EQRA 3HK3B 1TGSZ 2PUQH 3MO9A 1C2MA 3SQEE 3FZDA 1YC0A 1PQ7A 4ZXXH 4ASHA 2QAAA 1ZMJA 1VR1H 3T29A 2GT7A 1ZPCA 2P8OB 1G2MA 1HLTH 1EUFA 1XKAC 3TVJB 4ABEA 2B7DH 4GPGA 3ZV9A 1ZSLA 1NC6A 2XCFA 1PPZA 2HNTC 3A88A 1AZ8A 3W94A 4X1PU 3URDA 5EXNA 1P09A 1MZAA 1OWKA 5TJXA 1SSXA 3ELAH 2HOBA 4O03A 3RC5A 2A45B 3PWCA 1EZSC 1TRNA 1TIOA 1S81A 3GY2A 2TGDA 2RG3A 4XOJA 1J17T 1A5HA 1ACBE 3V13A 1V2MT 1KDQA 2XTTB 1O2LA 1H9IE 1OYQA 1CGHA 1TGNA 2ALPA 1HYLA 1O38A 1K1PA 1WAYB 1AWHB 4ABFA 1BBRE 3T25A 2QXJA 1UJ1A 1E38B 2A32A 3RXGA 5GPIB 1GI3A 5A0BA 1CHOF 3GDVA 2AEIH 2WPHS 2XCNA 1M9UA 1YF4A 2AERH 3OY6U 3QX5H 3NZIA 3HPTB 1LDTT 2VH0A 1WV7H 2A5IA 1W14U 1DLKB 1RXPA 3RP2A 4KKDA 5DKMA 3ZZAA 3OSYA 3ZZCA 1QRXA 2C90B 5EOKA 2PKAB 3P92A 1ANBA 5E2OA 3EA7A 3PM3A 2ZKSA 4GUXA 3MMGA 5HMAA 3SO3A 2WPLS 2CHAC 1SGCA 1TMUH 2STAE 5BRRE 3OTJE 3LH3A 1FIZA 3TLOA 1KTTB 1MBMA 1FLEE 1HAOH 4BAQB 1X7AC 3GCHC 1B0FA 1RIWB 5LPRA 5HYOA 4X2YA 1GHXH 1UTQA 1S84A 1HAYB 1AI8H 2B0FA 1FDPA 2ZFTA 5DP7A 2OLGA 3KQCA 1TMBH 1QFKH 1N8OC 1ZHRA 4MNVA 1C1WH 3MH5A 1FY3A 6ESTA 2H9TH 3KNXA 4H42U 1O3AA 1GBBA 3GDUA 5AF9H 1BMLA 1D3QB 1JWTA 2SGQE 1QJ7B 1ZTLA 2TIOA 1T4VH 4OGYA 2V3OH 1PPBH 2Z9KA 3M7QA 3SV2H 4H4FA 4B74A 1VJ9U 1GG6B 3RXJA 2ANKH 4HFPB 3LGTA 3RLYH 2STBE 1W10U 2LPRA 4K60A 2ODYB 4AB8A 2A7JA 3RXPA 1OWJA 2WINI 3BSQA 1LVOA 1QL7A 5AFYH 2AMQA 2FX6A 3SU2A 1O5DH 1CA0B 2V35A 2W26A 1CT4E 1V2RT 1GBFA 5G4BA 1TOCB 1EPTB 4X1SU 1KIGH 1P2KA 1GDUA 1MKWK 2BMGB 5GIBA 2OC1A 3TITA 4A5TS 3M35A 4JYUH 1GHAF 4ABIA 1NU9A 1V3XA 2HGTH 1Y8TA 1IAUA 4FUCA 1BMAA 3LGWA 4D76A 3K2UA 1F2SE 3NWUA 5GDSH 1C5SA 1GBEA 3M3VA 4NZLA 4A1VA 2H5DA 2OD3B 3FZZA 5JBTA 3KIDU 1V2TT 3ATMA 2C8ZB 1O2ZA 1YPHE 2A1DB 1O2QA 1GL1A 3L33A 1MZDA 1KSNA 5FHTA 2BY7X 1Z1JA 2B8OH 2ZU3A 2BD9A 5T6DA 2EI8A 2PUXB 1GBJA 1AU8A 1EAIA 4UE7H 2A5AA 3UY9A 2BVXH 4ZUHA 1HXEH 5HM9A 1GGDB 1TNJA 3F68H 1O3FA 2Z9LA 4JZ1A 3BG8A 4DVAU 1LVYA 3HKJB 1EOJA 1ETTH 4JCNA 2H9EH 1TMTH 1UK3A 4DGJA 8GCHG 1O36A 4Y0ZE 2A5KA 2VWMA 1PFXC 2VJ1A 1W0ZU 1ESBA 5F6MA 1C5UA 2ZFPH 3ZVCA 1Y3YA 1P2JA 1JXPA 1OP2A 1GWAA 2JETB 2VVUA 1A1RA 1Q3XA 1V2KT 1KLIH 3LIWA 1V2UT 1ZOMA 4B2BA 1C2EA 1W12U 4WMEA 2XBYA 3AVZA 4Y10E 1C1PA 2HPQH 3SNEA 2XC0A 2AGEX 1C2DA 1KXDA 1O3CA 1MAXA 3SUFA 4NWLA 2BZ6H 2EEKA 1ELVA 1BJUA 2BDYA 4X6NA 3UUZA 5LH8A 2W7UA 2VINA 3SU0A 2F9UA 1V2VT 8KME2 1HAVB 2BD5A 3RXUA 2AYWA 2OUAA 1A0JA 1C2GA 4HTCH 1BTHH 1HUTH 4Y76A 4JYVH 1EZUC 2PLXA 3SI3H 1MTUA 3TJNA 1DXPA 1ZTJA 1NO9H 1GDNA 4NFFA 5I25A 1PQ8A 3BTDE 4XE4A 2Z6BD 2V0BA 1IQLA 1PQAA 1OWIA 1J15A 1EJAA 1SGEE 4M7GA 4O97A 1HIAA 3U8OH 4MVNA 3EA9A 3VB4A 2OC0A 1C5QA 2VIWA 1QURH 3PV4A 4NGAH 4F49A 2XW9A 3S0NA 2QF3A 2ZDLA 2DE8A 2VIDA 3U1IB 1LHCH 3UWJH 2BHGA 3GICB 3FFGA 2BVSH 4BOHA 1THSH 1ANDA 2D26C 1YPGH 1P01A 3RMLH 1ANCA 2FOHA 1GCDA 3A83A 3M61U 5T3HA 2VWNA 1AVWA 1T8OA 4YESB 3MH4A 3HGNA 3RXFA 1QRZA 5EU8A 2PFEA 1EJMA 1LVBA 2OP9A 4K1SA 1GJAB 5A09A 2UUKB 1P57B 2GCTB 1FNIA 4DIHH 1ZHPA 2C93B 3LGVA 1KXFA 2VIPA 1RRKA 1TRYA 2EC9H 4IC6A 1O37A 2F9NA 1GJ8B 3EA8A 1P06A 1O2VA 3UR6A 3DUXH 6GCHG 1UTKA 2QV1A 2PTCE 4U2WA 4D8NA 2QN5T 3FP6E 2ZCHP 3MO3A 1GI9B 1P2MA 2P3FH 4THNH 1O3PB 4UFDH 2CGAA 3SNAA 2BD7A 1XUIA 1VCPA 2FS9A 2SGPE 4YTAA 1IQGA 1V2PT 1RFNA 1XUHA 1SC8U 2ZHQH 3ZZDA 4TPYA 4CBOA 4GCHF 3TU7H 1YCPK 1O5CB 1GBKA 1VCQA 2AFQB 2Q1JA 4I32A 3SV6A 1SLXB 4GHQA 1OP0A 1B0EA 3VXEH 2GDEH 2SGAA 4ABJA 5GJ4B 2Z3EA 3SJ9A 1TNIA 4AYYB 1E34B 3ZVFA 1TBQH 2OINA 4WH6A 1FUJA 1F0SA 1O2JA 1YPMH 1ZZZA 1UHBB 5FPTA 3NXPA 1UCYE 4Y8ZA 1H4WA 4Y7AA 2Z3DA 3H7TA 5F8ZA 1H8IH 2RA3A 2XBVA 1Z8RA 2GD4B 2CHAB 1P11E 2AGGX 3LJOA 1TB6H 4YOJA 2ZGXH 1O3EA 1TRMA 2H1UA 6CHAB 3OY5U 4Q7YA 5CHAC 3RC4A 4Q80A 1GHWH 2XYAA 3BG4C 3KHVA 4YLQH 4SGBE 3SN8A 4MPVA 4ABDA 1AQ7A 1C1QA 4CREA 1WOFA 1GBHA 1V2LT 2HNTE 2BDBA 4AZ2B 5BPEA 1BTWA 4BXSA 5ETXA 2GCHF 3EDXB 4YZUA 3P8NA 1BZXE 4AFZA 4ZKRU 4KGAA 1O2UA 1FN6A 2ZO3H 4ZAEA 1W0YH 3O8DA 2ZPRA 1O5BB 1AY6H 2HALA 1GVZA 4NIVA 4MPUA 4PROA 3A8BA 4WMDA 3FANA 2FOMB 1DWEH 1IHSH 2A4OA 3UNRA 2QIQA 2IJOB 3VB6A 2G4TA 2XBWA 1EPTA 1AD8H 1FIWA 1C5XB 1C4U2 2HWLB 1AUJA 4LZ4B 4MDSA 2GZ8A 3HKIB 3GOVB 1D3PB 5EPNA 2WPIS 4ISHH 5E2PA 1BRUP 2ANMH 2FOAA 1PYTD 4X2XA 3WY8A 1EAUA 3E6PH 3NKKA 3EAJA 1LHDH 4WH8A 3NUMA 2XBXA 2JH5D 3SUDA 4GVUA 1XUFA 4AFQA 1IOEA 1O33A 1HAIH 1TWXB 5DP8A 4AG2A 1C5VA 1RJXB 1OXGA 1VCWA 4BTUB 1EAWA 1GBCA 2WUBA 2PKSC 5EG4A 1YPLH 1AGJA 4X1RU 2AH4X 2FWWA 2P3TB 2C8YB 1OKXA 5DP5A 3SHCH 1Y3UA 2FS8A 3RLWH 4ZMAH 1C2KA 5C3NA 2WUCA 1O3JA 2F83A 2QCYA 1G37A 1C2LA 2Y7ZA 5EW2H 1QQUA 1NRNH 4INKA 2ZGJA 2I6SA 1UVUH 3LOXA 1L0ZA 4J2YB 7ESTE 1HJAC 4Y0YE 5DG6A 4BTIB 1Z8JB 3PO1B 5CE1A 5DO4H 4XDEA 2BLVA 1UTNA 2FDAA 1AB9B 1BBRH 1HV7A 3LGIA 3PMAB 3D23A 3LT3A 1Y5UT 1A5IA 3RU4T 3RXDA 3STJA 1TNKA 1KTSB 1XUKA 3ZZ9A 3KF2A 3UWIA 2GZ7A 4FUEA 3O8RA 2OC8A 3AW1A 1F0TA 4IGDA 1TQ0B 4O9VA 4X1NU 4B76A 3NCLA 2PSXA 2UWPA 2A4GA 1FAKH 1BITA 1O2HA 1D3DB 3KQBA 3KL6A 1C2FA 2A7CA 2ZCKP 4VGCB 1O3LA 2ZWLH 1Z7KA 1OP8A 2VVCA 1SHYA 4IS5A 1ELEE 1NESE 2ZC9H 3SORA 4WWYA 2YNBA 3AASA 2R2WU 1AE5A 1B5GH 1QCPA 2D1JA