2ZABA

Crystal structure of family 7 alginate lyase a1-ii' y284f in cmplex with product (ggg)
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
226
structure length
226
Chain Sequence
AAAPGKNFDLSHWKLQLPDANTTEISSANLGLGYTSQYFYTDTDGAMTFWAPTTGGTTANSSYPRSELREMLDPSNSKVNWGWQGTHTMKLSGKTVQLPSSGKIIVAQIHGIMDDGTNAPPLVKAVFQDGQLDMQVKQNSDGTGSDVHNYFTGIKLGDLYNMEIRVTDGVAYVTMNGDTRSVDFVGKDAGWKNLKYYFKAGNFVQDNTSTGGSAIAKLYSLSVSHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alginate lyase
publication title Substrate Recognition in Tunnel of Family 7 Alginate Lyase from Sphingomonas sp. A1
rcsb
source organism Sphingomonas sp.
molecule tags Lyase
total genus 56
structure length 226
sequence length 226
ec nomenclature ec 4.2.2.3: Mannuronate-specific alginate lyase.
pdb deposition date 2007-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08787 Alginate_lyase2 Alginate lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2zabA00
4LBMA 2ZHKA 2GNBA 1VALA 2R0HA 4GXLA 3AX4A 5GJ6A 3LCPA 2JECA 3L2YA 1MS4A 3R4SA 2P3IA 1ENSA 4YGEA 2PHRA 1DQ2A 4XDQA 4AVTA 1EPWA 1LOBA 2EXJA 4Y22A 4Y1UA 1MR5A 3AP5A 4CTEA 2CTVA 1N47A 1LULA 1ULFA 3UL2A 1WW5A 2E7TA 2P34A 5DG2A 1ENRA 4FOWA 5EYXA 3RMXA 3O5SA 5GLUA 1YIFA 3AYDA 1SFYA 3IPVA 4FOVA 2DVGA 2VW0A 1F5FA 4UW5A 2OVUA 2A5ZA 4Y1ZA 1MACA 1Z0HA 2DWRA 2A6XA 5E88A 1CIWA 2V73A 3D4KA 5IK7A 2AREA 3T2TA 4P9YA 3ZSMA 1CONA 1IS6A 1MS3A 4AWDA 2E6VA 2P3JA 2ZMLA 4LBJA 3ATGA 1FNYA 2W68A 3D6EA 1S0DA 1N1VA 1W0OA 1W6OA 3ZSKA 5F5QA 4R9BA 3WDTA 1IS4A 5BYNA 2YZ4A 1GZWB 2VH9A 4XXAA 2ZACA 1LHVA 3WDWA 2D3PA 1VLNA 5T54A 1V6KA 3IMNA 4Y26A 2OW4A 1QGLA 3USUA 3AZYA 1G9AA 4FPOB 2YROA 1QNYA 1BQPA 2E53A 3RSJA 1DHKB 2PELA 2E7QA 1FYUA 1HLCA 2ENRA 2GN7A 4SLIA 1OKQA 3M2MA 2YXSA 3N7LA 3R05A 5GLVA 4K1ZA 2YMZA 3WDUA 1UMZA 1UL9A 5HCFA 1LHOA 2WKKA 4JRAA 2GNTA 1FAYA 1MVEA 1D0HA 2UURA 1KJRA 1IKPA 2GDFA 2OUJA 1BXHA 2P37A 4XYXA 4YW2A 3PMEA 5GZFA 4Q26A 3OGGA 1AJOA 2D6LX 5GZCA 1S0CA 3ASIA 1A8DA 3WDYA 1V6NA 1W6QA 3NV1A 4Q1RA 3V0BA 1IS5A 4FPGA 1Q8VA 1LODA 1Z78A 2R49A 2JKBA 4M01A 2GNDA 2ZGNA 2LTNA 3ZPYA 3RQ0A 3WCSA 1QU0A 2AENA 2EF6A 3WDXA 1JOJA 4Y20A 1SBDA 1LHWA 1Q8QA 2UU8A 2JD4A 3BODA 3OYWB 4YW4A 4W65A 3AYEA 2ZGSA 4PCRA 4XILA 1V6LA 1LOCA 3O0VA 5HCBA 3ZVXA 1CJPA 1MS8A 1LOEA 1DQ1A 1UPSA 3A0NA 1SBEA 4XOGA 4YM1A 3A4UA 3V0AB 5SV8A 4YGBA 5FREA 2GMEA 2CY6A 1W6PB 3N36A 4LBQA 1DQ4A 1QMJA 4C1WA 4DS0A 5KXCA 1JN2P 2A71A 5HCAA 4YG6A 1G9CA 1S0GA 2WNEA 4NO4A 3POYA 2ZGOA 2Z42A 1QNWA 3ILRA 2A7AA 1QDCA 1JHNA 1SBFA 2EALA 4FP3A 5CNAA 1LHNA 3U4XA 1VIWB 1LJ7A 2JE9A 4PBOA 1LEMA 3INAA 1FNZA 1WW7A 3PJQA 1S0JA 2V5YA 1DYPA 4Y24A 3ENRA 4K20A 3WV6A 3T1LA 4AVSA 1MS9A 1APNA 1IOAA 1BZWA 3AJZA 1WBLA 4BMBA 1ULDA 1YYNA 4XMAA 1JXNA 2WJSA 2HYKA 3M1HA 1A3KA 1V6IA 1HQWA 2C9AA 3AK0A 1AX2A 2A6VA 1W6NA 2DYCA 3WLUA 4M3CB 2JDZA 1V6MA 5JMCA 2ZGUA 2ZA9A 2ARBA 3VKFC 1N3PA 3BOPA 3OBTA 4DQAA 4YZ4A 1CVNA 4FPJA 4AYUA 2D44A 2A3XA 2AR6A 3QCWA 3OY8B 4XIKA 4ASMB 1JYIA 2PHWA 1QKQA 3ILFA 4FPEA 1AX0A 5JVVA 1LTEA 4H55A 2R1DA 4YM2A 4BLIA 5T5PA 4RA0A 2DTYA 5T55A 2DVAA 2FHRA 4XJUA 1WD4A 1KQRA 1UZZA 5DZGA 3WHTA 5GLWA 1G7YA 3I4IA 1O4ZA 1WLWA 2DURA 2WLQA 2ES3A 2ZGRA 2DUQA 5DZEA 1LECA 2A3YA 1N1TA 1AXYA 3D5OA 2H0BA 2ZMNA 4XXPA 5IUQA 1LESA 3MW3A 4YW3A 3NV4A 4BLJA 2CNAA 2I2SA 4MYEA 2E51A 1YO8A 2A3WA 2ZGKA 3WUDA 1RINA 3TAYA 1ENQA 2B7YA 1G9DA 4YGDA 4AGVA 1SACA 4Z8BA 1MS0A 1N1YA 5DXDA 3ZYPA 2A6WA 3PVOA 2WT0A 1SCSA 5GZGA 1LU1A 5H9SA 3SISA 1GZ9A 5JOZA 1F9KA 2GMPA 2D7FA 1UN1A 4U2AA 5EYYA 1S0IA 4DRRA 1LOFA 4R9DA 1O4YA 4XHXA 3B3QE 2CL2A 3AXDA 2YY1A 5IK8A 4XTPA 2VW1A 1QF3A 1WBFA 1S0EA 2D6NA 1W6MB 2VXRA 3WZ1A 5CBLA 1U0AA 3SLIA 1BYHA 4YM3A 4GWNA 1IS3A 1URXA 2W08A 4Y1XA 3WG4A 1Q8OA 4CZSA 3AYCA 4UW4A 3AJYA 2DU0A 4XMIA 5DUWA 1GZWA 2VUAA 1PZ9A 4WVWA 2R16A 5GM0A 3WG1A 4YW1A 3VKOA 3GNEA 2P2KA 2PHUA 1UZYA 4L8QA 4PBPA 3N7MA 1N1SA 4WZFA 1JYCA 3AP7A 2ZGLA 1XQNA 1AXKA 4Y1YA 5GLZA 3FLTA 1VAMA 1ONAA 3M3CA 5IT6A 3UK9A 1KDKA 4LBQD 1GYKA 4XJWA 1JUIA 3V64A 3ZSLA 3B01A 1FV2A 4KBBA 3AZZA 1I1EA 1DGLA 3RMYA 2ZBJA 4FQZA 2SBAA 1YXWA 2UWBA 4DFSA 2DUOA 4BQ1A 1V6OA 2D3SA 3GALA 1DQ6A 2W39A 1Q56A 2NZ9A 4TZDA 1A78A 1S0FA 2D6OX 1ULCA 3MW2A 2ZKNA 1MS5A 4FOQA 1GNHA 2DUPA 1Q8PA 2XG3A 3M3OA 1UX6A 1V6JA 5IK4A 4YM0A 3WCRA 1LOGA 1LCLA 3KM5A 1ULGA 1KITA 1R1ZA 1N3QA 3N35A 2R0FA 5DUVA 5DUUA 4XZPA 2D6MA 3WDVA 4PF5A 1AF9A 2NP0A 4GKYA 1AVBA 1QOSA 3AYAA 1CN1A 1GNZA 3N3HA 4UW3A 1DBNA 3UJOA 1AZDA 1D2SA 2ZMKA 4XBLA 4JC1A 4FPHA 4M00A 1GV9A 1X50A 1CQ9A 3OYWA 3VKLA 5CA6A 1LGCA 1LGNA 2R1BA 2WQZC 4PQ9A 2BQPA 5AVAA 5GLTA 3A0KA 3RRDA 4FPKA 3WUCA 2GN3A 2D6PA 2A75A 3HR9A 1RIRA 3V0AA 4Y1VA 1W6PA 3APBA 1GZCA 5EXOA 3POWA 3MEPA 2GMMA 2NMNA 1FX5A 1IKQA 1MVQA 4FP2A 3FBYA 1WUVA 3MW4A 3DUIA 4YZ2A 3VKNA 5E89A 1N3OA 2DVBA 3B00A 3W58A 1HDKA 1I3HA 3NWKA 2LALA 4K1YA 4XJAA 2G4IA 2WSUA 3Q9OA 1AJKA 2VU9A 2P3KA 5LK5A 3N7JA 3ZYRA 2SLIA 4FQ4A 3HMYA 1WW4A 2EXHA 3O0WA 1B09A 3ZSJA 4K21A 4D69A 1HQLA 4FOYA 1Q8SA 5JDBA 4YZ1A 2D6KA 4XJ9A 4YG3A 4CRQA 4Y22B 4Q1PA 3ZXJA 4M3CA 2UWAA 1GSLA 2NM1A 3SH4A 3JU9A 1CR7A 1V00A 3ZXFA 5KXBA 1ULEA 1DYKA 4LBKA 2ZHLA 2JJ6A 2AYHA 4FPLA 4GKXA 1BKZA 3IPVB 4XJ8A 3M3EA 1SLBA 3UJQA 2WT1A 4ATEA 2RHPA 1GICA 1JW6A 3OY8A 1LU2A 3BIWE 4I30A 4Q2FA 4ZKTB 1WCSA 2A6ZA 5H9QA 5CAZA 1OFSA 2ZABA 3LSEA 3QLQA 1G86A 2ZGQA 4BM8A 1PZ8A 1C4RA 3RG0A 3CNAA 3VKMA 5H9PA 2EAKA 2ARXA 3RS6A 1MZ6A 1SLTA 5IK5A 1W6OB 2WT2A 4XE9A 5H9RA 4XHBA 3LSDA 2ZHMA 3B69A 5KXEA 2FMDA 3POSA 5FRAA 2GALA 3PVEA 2EXIA 1HKDA 3I8TA 2PHFA 3ILNA 1KDMA 3AZVA 1LOFC 4GWMA 3SH5A 4YW5A 1GBGA 3AXEA 4LBOA 4ISQA 1J1TA 1W0PA 3R4UA 1CPMA 3AP6A 3USUB 1FATA 2WSVA 3B9CA 2ZAAA 5DG1A 5GZDA 1C57A 2CWSA 1DIWA 1LENA 3C2UA 4FVVA 4P9WA 4C1XA 4XBNA 1GANA 5T50A 1H30A 2NN8A 5GALA 2CYFA 1S1AA 1UAIA 2W52A 5T5LA 1MZ5A 1WLDA 3OJBA 4M3CE 2AUYA 5T5JA 4F83A 3TB0A 3AP9A 1H9PA 4LBLA 1RITA 4M3CF 2Q5TA 2ZGMA 3OPZA 4P14A 4Q8LA 4FPYA 4R9AA 1C1LA 1KRIA 3HN1A 1LOAA 4OZXA 4AGRA 1DQ0A 3H0OA 4YFZA 2UWCA 2ERFA 1W6MA 1ZA4A 1NLSA 2EXKA 3M3QA 4AGGA 1SLAA 3MPPG 4ITCA 1W6QB 5T5OA 3BTAA 3V0BB 2A6YA 2OUHA 3SNMA 1SCRA 4DPNA 2YV8A 5JLVA 2NMOA 1QOTA 3JUUA 2C5DA 4XTMA 1LHUA 1F31A 2KM2A 2ZGTA 3AZXA 4XJZA 4YG0A 1SLCA 3AP4A 3O0XA 4JCKA 1GLHA 1JBCA 3FUQA 4YFWA 2VY0A 5DZFA 1G9BA 3IKWA 4RL7A 4Y20B 4DRVA 5CB7A 4YZ5A 2ZZJA 1H9WA 2PHTA 2XB6C 1G8WA 4HANA 2ZHNA 1YRZA 4ISRA 3WOGA 4YLZA 4BMEA 1BJQA 3WG2A 3FLPA 2D43A 2DU1A 4ZXKA 4U36A 4Q8KA 2VW2A 3V65A 2GNMA 4XIOA 1DQ5A 2NYYA 4Q27A 3SITA 4LBQB 2DVDA 3AZWA 3IM0A 1AXZA 4FPFA 1NXD1 1WW6A 5JOWA 1CESA 3SH3A 4TYSA 2ZGPA 2AGSA 2JE7A 4WVVA 5E8AA 5KXDA 4ATFA 3OBRA 3N7KA 4P9XA 1Y7BA 3T1MA 4R9CA 3AFKA 1GKBA 4XBQA 1QOOA 1WLCA 3KQRA 4AVVA 5JOXA 1DZQA 2PHXA 1UKGA 2DV9A 4GALA 2CWMA 1CPNA 3VUOA 3ZXLA 1G9FA 3WNXA 1W6NB 2DVFA 1FV3A 2TEPA 4LBNA 2A70A 1LEDA 4WV8A 1S0BA 3WHUA 3NV3A 3PVNA 1AX1A 3WG3A 1PZ7A 4BOWA 1KJLA 3FLRA 3FFZA 1ZM1A 3ZXEA 4BPZA 1MS1A 3IN9A 4UW6A 5L73A 2AH2A 4HL0A 3FUOA 3ZXKA 5F9TA 2DTWA 5EWSA 5GZEA 4NOTA 5T52A 4FPCA 5DUXA 1WD3A 2EIGA 3VV1A 4YZ3A 2D3RA 1DLLA 3DGTA 3O12A 4GA9A 4IQPA 5JOYA 1DFQA 3W59A 1VAVA 3WVJA 1C1FA 1YI7A 3NV2A 1TEIA 1SLIA 4YGCA 1OQ1A 1LGBA 1QDOA 1SLLA
chains in the Genus database with same CATH superfamily
4LBMA 2ZHKA 2HWD3 5CFDA 4GXLA 1ZX5A 4MHRA 2EAAA 3LCPA 4A6SA 2NQYA 2R7EB 1TQ5A 2JECA 3I3DA 3L2YA 1AR63 3R4SA 4S2FA 4QPIC 1ENSA 2HYXA 1JYTA 3K4DA 3BTXA 2EXJA 5CG8A 4Y22A 4W6WA 4WM8C 1TMF3 2BWAA 3IAQA 3J9SA 1WW5A 5JWPA 4J1WA 3TEWA 5FZ8A 3O5SA 3BOWA 1UIJA 2LUWA 4IGPA 3QH6A 2B9UA 2GP5A 5ACA3 3JB8A 1Z0HA 5A6QA 1M4WA 5E88A 2ZS6B 3GXUA 5FZBA 3T2TA 4P9YA 2HWF2 2Q1MA 3WT3A 4KL1A 4KMQA 4LBJA 3POBA 3KT1A 4DIQA 5K9YA 2W68A 1S0DA 1F5JA 1W0OA 4JVAA 1HRI1 1YEWA 5L7OB 4PT6A 1O5LA 2DFBA 2AEYA 4R9BA 5L9RA 2RDNA 3HOBA 1E5SA 3RFRA 3WQ7A 1A34A 1W99A 4LIVA 2VXJA 4QPYA 4C0BA 3T08A 1SMVA 4XACA 2WO1A 2QZ3A 2F4LA 2Z5WA 3AVSA 3IMNA 2OW4A 3LEGA 1QGLA 1L7QA 4Y26A 4Q4W1 4JDOA 4FPOB 3ZMOA 4MX3A 1QJY1 3NVCA 1VBB1 4C90A 2ZJCA 4C8DA 1FXZA 2HEWF 2E7QA 4KQ7A 5A7PA 5I0RA 3S0MA 1E5IA 1OQDA 2ENRA 1P8JA 3M2MA 1AL0G 3N7LA 4SLIA 2RR11 3POEA 4K1ZA 4N9IA 5KBFA 1W06A 5AC91 3HBZA 1UL9A 4W8JA 5HCFA 1BEV2 1HX6A 1LHOA 2J1TA 1AL22 2WKKA 1AYN3 1RUF3 3DECA 4JRAA 1MVEA 1KJRA 1IKPA 2GDFA 4LKSA 4L2NA 1NA1B 3OEBA 3H9AA 1QQP3 3VBUA 1E57A 4TSVA 3PLQA 1QJU3 2V5DA 3ZIWA 4B8EA 2Y6JA 3ASIA 5J3UA 4K8FA 3WDYA 1DU3D 1V6NA 4I02A 5HCHA 1O3QA 1HV0A 1O3SA 1UD1A 2JB4A 1Z78A 2PHLA 1W9SA 2JKBA 4K3UA 4M01A 4ZPIA 3VBSB 4CUBA 2XJTA 4QU2A 2LTNA 3ZPYA 4AEDB 2RJLA 5EFUA 3H3ZA 1QU0A 2EF6A 3HWJA 3TEYA 1PNFA 4BHPA 4MO3M 1SDDB 4K8RB 4AI3A 2JD4A 4YW4A 2RS52 3LIHA 2WFF2 5DPNA 4CDWB 3EQEA 5K0UC 4RHV2 3RPQA 3ACFA 3ZVXA 1SFPA 5FP8A 4B7EA 5LRRA 1AR72 3A0NA 1SBEA 3RDIA 3SMHA 4YGBA 5FREA 2GMEA 1W6PB 4BH9A 3N36A 1QMJA 4DS0A 3WSOA 2FCTA 2R062 2A71A 3HIFA 1O7FA 1C5HA 4LHSA 2X5IB 4QX0A 1KFXL 2QCSB 2TNFA 1S0GA 2HBTA 3JBG1 4NO4A 1Y43B 2ZGOA 4M0NA 3ILRA 3W9AA 4QAWA 5FZ3A 4E8CA 3WR0A 3VDAA 1Z7S3 1B35B 3MBWA 4FFFA 2QKDA 1UXZA 5FQ0B 2RM22 2QQWA 1FNZA 3PJQA 1RUG1 4MH0E 4RD7A 1S0JA 1DYPA 2V4VA 4HXCA 1MS9A 3MV11 4PHZA 1APNA 1BZWA 2XL7A 1AR93 4QXKA 4LA3A 5ABJB 1CAVB 4KWJA 3Q8AA 3MFAA 1A3KA 2L9LA 1GQPA 1V6IA 4CEYB 1GP5A 2Y0OA 3PTYA 3M8LA 1W6NA 2P6CA 5TSWA 1KS4A 1BBT1 3OUHA 2VQAA 4DY5A 5FR3A 3VKFC 5I93A 3OBTA 4YZ4A 1CVNA 2WS92 5GKAC 2QUOA 5FZ9A 2VTFA 2VCAA 5F5IA 5FPAA 2H6BA 5FY5A 4MXWA 2HWC3 2X8KA 4BB3A 2Q30A 5IVEA 1QKQA 2YB7A 3ILFA 4FPEA 4QPGC 5FP4A 4O9EA 5FPXA 2Y6KA 2DTYA 4MADA 4QX1A 3WF0A 4Z92B 2W95A 4Q0SA 2DURA 2E31A 2BFUS 2WLQA 3KMHA 5DN2A 5JSOA 2FDGA 4HBNA 1YI9A 3E6CC 1MQTA 2A3YA 2FDIA 1N1TA 4Y5TA 3UT0A 5FYMA 4CPBA 4Q4Y2 1R083 2ZMNA 4XXPA 4CEWA 2JG8A 1OD5A 1HXS3 1VBE2 1LESA 3S30A 5FYYA 2EICA 2I2SA 2O14A 2XBO3 4KH9A 4MYEA 3WW1A 5BNNA 1NCQA 2ZCWA 4FFIA 4FCAA 3SKJE 4OLLA 2BTVC 3U10A 3WUDA 5HV0A 3WW3A 3J8F2 5D21A 1ENQA 4YGDA 3AKPA 1GNYA 1JOBA 2BRTA 1GQGA 3OSDA 1SACA 2VZVA 1MS0A 3LA3A 2IZWA 4COZA 3O1MA 2BV4A 3USSA 2YBKA 5FKBA 3PVOA 1DZRA 1E5HA 1SCSA 4N7UA 3K48A 1ZZ6A 3OD0A 1TME3 3DYOA 3MV01 5IVYA 2D7FA 5EYYA 3DXTA 5FPLA 2VTXJ 5B4NA 1O4YA 1F35A 4UFLA 1AUYA 2CL2A 3AXDA 4E4DX 2BPA2 1ZRDA 3PIJA 4ES9A 3ETQA 4I2OA 1UPIA 5J36A 1OF3A 3OG2A 3RWKX 5HI0A 1HJFA 1WBFA 1AR61 2ZAHA 3K77A 1UZWA 5FUPA 5A32B 1XYOA 4Y3OA 5FPBA 4NROA 4ZU7A 1U0AA 1DGRA 3WY6A 5IVCA 1PM4A 1Q3EA 4D0QA 2K2SA 4R52A 1HN1A 4Y1XA 5L7OA 3OUJA 1VBA1 4O9GA 4UW4A 3TEZA 2YU2A 5DUWA 4LLFA 1RHI3 2WC2A 4WVWA 1RUOA 2R16A 3AMPA 4XFIA 4YW1A 4CCDA 4WM7C 5JIUA 1UZYA 5LA0A 4B4RA 4IL7A 2Q4SA 1YCIA 3BI3A 1X8MA 4OI4A 1AXKA 4QGLA 4QX2A 5BNPB 2IXIA 1PO22 2VQ0A 4GAZA 3ALQA 1ONAA 5IT6A 4L97A 2VZQA 3JZVA 2XWJB 4XJWA 1HRV3 1JUIA 2WZR3 1U5IA 4L9BA 2XOMA 4W6XA 4OUSA 1ODMA 3V64A 3ZSLA 2O8QA 4CP1A 3VBRC 2MEV2 4E27A 4FQZA 3ZYJB 3IDAA 3L9JT 1YXWA 4XF4A 3LOIA 4BQ1A 1V6OA 3GALA 1NA1A 1KXGA 4ZS2A 3DKWA 1S0FA 4CDQC 3J4UH 4FOQA 5K0UB 5F3CA 1RUH2 2PMWB 3M3OA 3O1UA 4E2SA 1V6JA 3ON7A 3M3IA 2JX9A 1EYBA 3KB5A 2WFPA 4J1XA 5DUVA 3N35A 3DYPA 1DP0A 4UF0B 5DUUA 1AF9A 5FYIA 3VBSA 1H1MA 4Q0UA 1POV1 4AEDA 1AYN1 1RUF1 1VBC2 2VMHA 1WZXA 5FYCA 2O8OA 1JMUB 4ES8A 4UW3A 4D7YA 2ZMKA 4XBLA 4NVPA 3FX3A 1IG3A 1OXCA 1XXNA 3HNYM 4M00A 5KHJA 1GV9A 4KU7A 3W5MA 5CA6A 4I3GA 4S2DA 3I49A 2XUEA 5AVAA 4CDWA 3UGHA 2GN3A 3OPWA 2D6PA 2JKXA 1FMD3 2A75A 3CJXA 1PMIA 3ACHA 3J7NA 4QQOA 4CU6A 5IVJA 5FXXA 1W6PA 2XQRA 5EXOA 1GOHA 4DUXA 4BQWA 1IPKA 4QXCA 1OLQA 2WBKA 3C3VA 4R4ZA 1MVQA 2X5IA 3MW4A 3PHMA 4W4ZA 5CEHA 2FCUA 3OTFA 3AKTA 5E89A 4BISA 1HDKA 3NWKA 4K1YA 2LALA 3ZFGC 3E97A 4XJAA 5A3WA 3VZNA 2G4IA 2E33A 5F6LB 1B35A 2XQXA 3MIEA 1BK0A 2P3KA 5FQ0A 4QPGB 3VZKA 4A7ZA 3NKTA 3WNKA 4CXYA 4IEQA 3N7JA 5I0DA 5CFDC 3ZN5A 3HMYA 2EXHA 5JMOA 3PNAA 1B09A 5CKNA 5ABJA 1CAVA 3X29B 2WLPA 1AYM3 1JUHA 1R092 3D0JA 4KI5M 4QWNA 4CEYA 2VQUA 4CUGA 3C7FA 3I54A 2R073 3ZXJA 5A7WB 4KNCA 2TBVA 3GZAA 4AOCA 4OUEA 5C7GA 4L92A 4ZHNA 4XF9A 5KXBA 3SEEA 4FPLA 1C8NA 1RVF2 1Y3TA 3M3EA 5HV4A 1S2BA 1W8ZA 4ATEA 4BYYA 2RHPA 1UOFA 1GICA 3RJ2X 3W5NA 4GH4B 4Q2FA 3SCGA 1WCSA 2A6ZA 1UOGA 4AI8A 1AR91 1OFSA 1ZZ9A 3LSEA 4BM8A 1YJLA 3HPNA 1C4RA 4DUVA 3VZOA 4D7TA 5IK5A 1EV11 4LK7A 1KGYA 1W6OB 2WT2A 4IEPA 5H9RA 3WNPA 3B69A 3IIAA 4HONA 4A3ZA 2HEYF 2VMIA 1CZVA 2X09A 1HKDA 4WZCA 1SG3A 3I8TA 3CU7A 2YDEA 2JEMA 1PMJX 1XE0A 4FT8A 2HWC1 4YW5A 4IETA 4QX8A 4ISQA 1XE7A 3USUB 3B9CA 5GZDA 4HOOA 1NT0A 3OD4A 2ZX1A 4NE9A 1H30A 3KHBA 2C24A 3KF5A 4OHXA 5T5LA 3WP5A 2BNNA 4QQ2A 1MEC2 3WF1A 4LKDA 1GMMA 1JZ4A 2AUYA 1YQ6A 3LKJA 1E5RA 1QJX2 1JZ7A 2LW8A 3ZKUA 1L7RA 4YYOA 3KHCA 1C3HA 1HXS1 2YGLA 3A21A 2RS32 1OH3A 4M3CF 5FPUA 3J7MA 2XBO1 5FK8A 2IVJA 4Q8LA 1C1LA 4DXZA 4ZS3A 1KRIA 4CVUA 4V2VA 1WCQA 3I2HA 1R64A 2BJSA 2PQQA 4AFDA 4PIYA 5G04L 4PLNA 1RUD2 3VLBB 3M3QA 1JU3A 5A32A 1NLSA 1PGW2 1UMHA 1SLAA 3MPPG 4QXHA 2R042 3ETPA 2ORXA 4TXWA 5IYYA 3V0BB 4CCOA 5A6ZA 1H8TC 1YQ2A 2YV8A 4MGSA 1UWWA 1TME1 1QOTA 3I2GA 5JLVA 4BIFA 4YG0A 4XJZA 4A45A 3M4FA 2YUEA 3O0XA 2WUHA 4JCKA 1GLHA 1JBCA 2W2IA 5FP9A 1MZEA 4IEOA 4LIUA 4UOJA 3ECQA 4CDQB 1UOBA 1ZBA3 2XB6C 1US3A 2ZZJA 4NJ4A 3LIGA 4YZ5A 4IUGA 1G8WA 4JRLA 4HANA 3A22A 1PO12 5BNPA 3WOGA 2WQ4A 4YLZA 1OHFA 1BJQA 1JODA 3DN7A 3KVAA 2D43A 4OFGA 4U36A 4O7XA 4GD4A 3MF9A 2NYYA 3ZYHA 1YQ5A 4IE5A 4LBQB 3T30A 2G19A 3UKNA 3U0ZA 4DINB 3IM0A 4FPFA 1RHI1 4FFHA 1RMU1 2WWJA 4TYSA 4UXAA 4B7KA 3LZZA 3OGRA 2AGSA 5FYTA 4EE2A 1EAH1 2P1BA 4H7MA 4ATFA 2CV6A 5CVRA 3N7KA 3PL0A 1Y7BA 3T1MA 4R9CA 4RQPB 3AFKA 2FMYA 1JYNA 5A3NA 4XDOA 5EZWA 5K0UA 4R8HA 4Q4W2 1WLCA 4AVVA 5JOXA 4DB5A 1QJY2 3HD8B 1RTVA 1VBB2 4QB2A 1HRV1 2WZR1 4Q4X3 5CFCB 1OA3A 4JAAA 4UF0A 3BTYA 4PIXA 2OZ6A 4BWOA 4IEWA 4QKDA 4B3NA 5JI7A 1LEDA 2CHHA 1S0BA 3NV3A 2GC2A 3I2KA 5ANNA 1X9PA 4UFMA 1KJLA 2D5FA 3FLRA 4YVSC 4NR1A 3OGVA 3KV6A 3IN9A 3JB4C 3PURA 5FDBA 3T0DA 1I6XA 2AH2A 3FUOA 3ZXKA 5F9TA 3WQ1A 1NYWA 2AC1A 2DTWA 2ZX2A 5GZEA 4CCLA 5FZGA 1TVGA 1SPPB 1OSGA 4OYUA 3RYKA 2Y26A 1OVSA 4FPCA 5T52A 3RZZA 3MF6A 2R30A 5F2SA 4QXBA 4ORFA 5FZIA 2YFUA 4DMIA 1HRI3 5JOYA 4IQPA 1DFQA 3GGLA 4DXSA 3ZSEA 3HN3A 4CUAA 2WL1A 4CEWC 2JG8C 4XQWA 1TEIA 1SLIA 1WMDA 4H7LA 1RC6A 1QDOA 5EJZB 4D69A 4QPGA 5BNNC 4IEZA 1NCQC 2R0HA 1AR81 1JYWA 4UAPA 3AX4A 3EO6A 1EUTA 1RUNA 3RI8A 1FMD1 1MS4A 4CDXB 2P3IA 3MFCA 2PHRA 3SCHA 4AVTA 3WQBA 3FHQA 4I01A 2J1SA 4QM9A 1ZBE1 4YW7A 4EV0A 5A7WA 5C3QA 1N47A 2RR13 2XVKA 4COUA 5DG2A 1NCRC 5AC93 1ENRA 1IGOA 5FY7A 1W3VA 4QMAA 3C8XA 1KD7A 1SFYA 4LT5A 4AQTA 1F5FA 3KGLA 4Y1ZA 4LHLA 3C7GA 4MSVA 3B5LB 3JD71 4GH4A 3MIHA 2DWRA 1COV3 2A6XA 4YRDA 1CIWA 2VUCA 5JXIA 3D4KA 2AREA 3OEAA 5LATA 1H4GA 3URFA 1AYM1 5BXXA 2BVBA 4AQ6A 1OA4A 4KG8A 2R071 1W6OA 3P3PA 4OQ9A 4AVBA 5IWFA 1BBT2 5L7OC 2JD9A 1UYYA 4L11A 2Q0AA 4NRMA 1JOPA 4E8DA 3LEMA 2J1AA 2ZACA 1LHVA 3WDWA 1NY71 2D3PA 1VLNA 5T54A 1V6KA 3DCQA 4Y5Z0 5FYVA 3USUA 1RUC2 2VVEA 2VULA 1H0BA 1X82A 2WO3A 4FTBA 3I3BA 4YVWC 4A4AA 5K8SA 1HLCA 1H8TB 3LPGA 4AFBA 1OKQA 2YXSA 3K46A 3OBZA 4TWTA 2BNOA 2YMZA 4CCNA 3WDUA 4K40A 1NUKA 3POGA 3JBG3 3ABZA 2UURA 1D0HA 3ZPOA 4MOAA 3SEPA 3ZM8A 1BXHA 2JDAA 4XYXA 3POJA 5FO9B 3PTRB 1NA1C 5J37A 3THTA 1DG6A 4MLOA 5FXZA 3ZO0B 1RUG3 4L0PA 4GB32 5IHRA 1S0CA 1YNAA 4RN5A 2HLEA 1A8DA 4GMP0 4JHZA 4Y4YA 4EQVA 4AG4A 5IAXA 3NV1A 4QDQA 3PU3A 3V0BA 2HBUA 5L19A 4FPGA 5A7QA 1HV1A 1Q8VA 2W1SA 2R49A 4MZUA 4ZZ5A 1EP0A 1QH7A 4RS5B 3NW4A 3AL5A 5DABA 3LAGA 2AENA 3AFGA 3ZXAC 4M0HA 1JOJA 1Q8QA 4CDQA 4XF0A 5BPXA 3KWVA 2UU8A 2HWD2 2B5HA 2H0VA 4W65A 3AYEA 3VHNA 1UY4A 2X10A 2VO5A 1LOCA 2UYAA 1AR62 4AF9A 3THDA 1CAXB 1MS8A 4YM1A 4XOGA 3A4UA 3V0AB 4LUMA 2ZPXA 5FMOS 1F4HA 5SV8A 3I2OA 3GCXA 3H3UA 1W39A 4LBQA 1TMF2 3B94A 5HCAA 4YG6A 2XJVA 4LOTA 2WNEA 4LTAA 2X5IC 4LHNA 3WXPA 4CUCA 1QNWA 4QKFA 3U4XA 2EALA 1ZBA1 4YVSB 1CAWB 3LDKA 4Q4V3 1K5JA 4PBOA 2RE9A 3KV4A 2J1UA 4RQPA 1WW7A 5FLIA 5ACA2 1GP6A 4AVSA 3ENRA 4XAEA 3T1LA 5B4XA 2BEOA 1OF4A 2GC1A 3K3NA 3AJZA 4A44A 2Z2SB 4NIIA 3VL9A 1YYNA 1O4TA 3M1HA 2FCVA 5ABJC 3MLJA 3T0AA 3AMMA 5CFCA 3I3EA 1O6UA 2C9AA 2DYCA 4JTNA 4CEYC 3WLUA 2BVVA 2JDZA 4AAPA 2YBSA 5D8AC 3UV9A 2ZGUA 5BY5A 2ZA9A 1LR5A 1N3PA 3BOPA 5C33A 4FPJA 4AYUA 5LZ6A 3KZ4C 1XB9A 4KG0A 1OT5A 2KXLA 3UKVA 2AZ5A 2A3XA 4XIKA 4S2HA 2C1FA 4Z82A 5FZOB 1JYIA 2ARAA 3I2DA 5BNOC 1LTEA 1DGWA 2D40A 2R1DA 4YM2A 1SPPA 3KGZA 2DVAA 3BN6A 4Q4X1 1WD4A 1KQRA 3MICA 4PDWB 5GLWA 4D6QA 2IXCA 3I4IA 3WF3A 1WLWA 1UF2C 2PQSA 2ES3A 4YSFA 5DZEA 1NCRB 3MLLA 1AXYA 1VBA3 2W46A 1K5MC 1AYN2 1RUF2 2H0BA 4CDUB 4OHWA 5IUQA 1RL3A 2VUJA 3MW3A 3NV4A 4BLJA 2CNAA 1GOFA 1PM7A 1QQP2 2E51A 1O8SA 4CCMA 1UY0A 1JYXA 1YO8A 3NNJA 2ZGKA 3I97A 1XPWA 5D2AA 1HJGA 3WNMA 1QJU2 2XH6A 4PI2A 3H8UA 1G9DA 2QNKA 3CBNA 3JQXA 4CDXA 2E7AA 1VAKA 1H2LA 5FP7A 5DXDA 4IXLA 1LU1A 2BERA 3KCXA 1XOYA 2CGPA 3UETA 1F9KA 5JOZA 2E9QA 1D4M3 2ZX0A 4Y5SA 5SV5A 4EZHA 3B3QE 5IFPA 3CZJA 2BZDA 4OMCA 4XFFA 3VZLA 3BPSA 2ZX4A 1M06G 1QF3A 1UY2A 1S0EA 1XRUA 1W6MB 4H14A 4XFCA 3BB6A 4YVWB 5FZ0A 3Q8FA 5LBCA 4G9SB 4B29A 5F2WA 3PUIA 3BU7A 3MGUA 1IS3A 1BK1A 1URXA 3OGJA 2W08A 1PX4A 4LOSA 1BMV1 4XMIA 5FWJA 3F2ZA 3FFQA 4ZXEA 1POV3 1PZ9A 4HG6B 1YUDA 2XLGA 5DDJ1 1JZ6A 1Z7S2 4L8QA 4WZFA 1UYZA 3N7MA 4PBPA 4AFCA 4GQ7A 2D93A 1LKNA 2VBDA 3H1WA 5E16A 5C71A 1COV1 4HK9A 5GLZA 1AR92 2V4AA 5BNPC 3M3CA 4QM8A 3H7YA 3VBHB 3UK9A 2DCYA 1GYKA 4EWAA 4N43B 1H8TA 3VDCA 2UY8A 1VRH3 2G1MA 2IC1A 4IV3B 1YQ8A 3ZXDA 3AZZA 2ET1A 4LEJA 2VMFA 3FMGA 4RGKA 3D3AA 5IAVA 4PI0A 4AXOA 1D7PM 1DQ6A 1RUJ1 1FPN3 1LRHA 3CDZB 1J59A 1DDLA 1A78A 2HWC2 2WWSA 2D6OX 3UYJA 3KF3A 3MW2A 2DUPA 3NNGA 4B4QA 2XG3A 4D6SA 3B7MA 4XF3A 3R6SA 5FYSA 1AHSA 4YM0A 1W2UA 1YIPA 2GH2A 3JCIA 2WQ8A 3TEXA 2R0FA 2BBAA 1F15A 1S55A 2JENA 4XZPA 3UESA 5FV3A 1U12A 1W8HA 4PF5A 4XABA 3TNPB 3N4MA 1GQHA 2NP0A 4RS5A 1R082 4GKYA 5LASA 4ET7A 3D8CA 1VB2A 1HXS2 1R1A3 2HJIA 4HETA 1VMJA 2XBO2 4FPHA 4AR2A 3GYDA 4F8AA 4NUBA 1CQ9A 3LWCA 1LGCA 1ZRIA 1S2KA 1TZOA 3FZ3A 4FPKA 4NAMA 3RRDA 1CAXA 4LMFA 5FZDA 3V0AA 5FLHA 2OPWA 2B45X 3APBA 3PUHA 1A8MA 2WYSA 3POWA 3MEPA 4QB6A 4CPBD 1XSQA 5D8AB 1XU2A 1EV13 1RJ8A 1FX5A 1IKQA 3POIA 4KWUA 4QHBA 1NX9A 1C8M1 5CKQA 4AI2A 2DVBA 3B00A 3RYRA 5HPOA 4N90A 1AL23 3P3NA 3ZYFA 4UWDA 1K42A 4YVSA 1V9U3 1CAWA 3O1TA 4BK4A 1QJEA 2XHKA 1GOGA 1UZVA 2VU9A 5BNOB 4AL9A 5KC5A 1TE1B 1GP4A 3ZYRA 4FQ4A 1OMIA 1SHWB 4MGZE 3ZSJA 4MXVA 4I3PA 4XQ4A 1QH6A 5A7SA 3L2HA 1CAUB 1O8PA 2JDKA 4FOYA 5JDBA 1IG0A 4CRQA 5A3PA 4Q1PA 2Y64A 4I0AA 3BVCA 1YFUA 1WGPA 2NM1A 2FDFA 1K5MB 1RUI3 1V00A 1RHI2 3ZXFA 1H2MA 5I0TA 3AMNA 1XNTA 1GU3A 2XVLA 2JJ6A 4HKWA 4Q4V1 1PK6B 1BKZA 3IPVB 4HLTA 2Y0IA 3ZDVA 4EWDA 3UJQA 2WT1A 1ENXA 4EYUA 4IGQA 3GBGA 4MUVA 3BIWE 2IXJA 5FZOA 5FP3A 3IWZA 5FTTC 1JZ5A 4GH4C 5CAZA 1C5IA 3QLQA 1G86A 3O1RA 2PLV1 4PDWA 1HRV2 2HWE3 2WZR2 5FY9A 3VKMA 3VD3A 5C5UA 3RZJA 3RS6A 3T2OA 1WMXA 4OUMA 1NZIA 4XE9A 4XHBA 3LSDA 1NCRA 5ERLA 2FMDA 2W1UA 3GJAA 5F3IA 1PGL1 4P9LA 4A6OA 2W47A 4W50A 2EXIA 1K45A 4X6RB 3UGFA 4CDUA 5KHGA 3NKGA 3TYJA 2XXZA 4QHOA 2Q8CA 1GBGA 1RB8G 1ASJ3 4LBOA 1J1TA 3AP6A 4NPLA 1FATA 2WSVA 3VBOC 1VBD3 1C57A 2WRAA 4N53B 4FVVA 4XBNA 4RR3C 2NN8A 2CYFA 2CU5A 5I0SA 1UAIA 5LA2A 3ZOIA 1W2AX 1PGSA 1PIV3 2BUKA 4M3CE 3K2OA 2YBPA 3AP9A 3TB0A 2RV9A 3IZOA 2VOTA 5JCTA 2HWB1 1OLRA 1RMU3 1CIYA 2G9FA 2WZ8A 2MPFA 3OPZA 4FPYA 3DKQA 2NLRA 1EAH3 4LKEA 4MGYE 4UYBA 3HN1A 1PVC3 4COYA 1LOAA 5F7UA 3H50A 4OZXA 4YFZA 4YVWA 2ERFA 2EXKA 1W6MA 1WCUA 2MNGA 4NIHA 3RGBA 4AGGA 1FMD2 2WA4A 4ITCA 3S5AA 1W6QB 1ZVFA 3VDBA 3BTAA 5FY8A 4Z2AA 4JX0A 2OUHA 4LO4B 3SNMA 2QQUA 4DXRA 4QHZA 1XNBA 3ROUA 2NMOA 3JUUA 3CZUA 4JKKA 1F31A 1REEA 1D4M1 4GWIA 2ET7A 1NOVA 3R0RA 3U14A 3FUQA 5C6CA 1UU6A 4LR4A 3FHAA 3CEWA 3DV8A 4Y20B 4IV1B 2QQKA 2WZPP 5CB7A 4OQ8A 1H9WA 2PHTA 4INDA 3T3YA 2VZOA 5JSPA 2XJUA 4Q0PA 4CCCA 1OLME 4BMEA 2RMU3 3ES4A 3KLSA 2FZ1A 2JIGA 1ND3C 4UBGA 1WWYA 3VHRA 4Q29A 4TLGA 4OHYA 4P00B 3VGIA 4HN1A 2E63A 2VW2A 3ZYIB 4BK5A 1AYM2 2BFUL 2GNMA 4N43A 1DQ5A 1JTZX 4UFJA 2R072 1KEXA 4IV3A 2DVDA 2ORZA 4D6RA 1NXD1 5JOWA 3LOBA 3SH3A 2VZRA 2ZGPA 4BDVB 1BVP1 2R32A 3OGSA 5KXDA 4H2AA 1ND2B 2Y38A 4P9XA 4MV2A 5FBJA 1GKBA 4JZRA 4XBQA 2W0XA 3LEIA 3R4DB 4RQPC 3N9PA 2QE3A 3LQCA 1AR83 2XMLA 2VVDA 2WNOA 5CKMA 4IDZA 1H2NA 1QJZA 4G3YC 1XYNA 1VRH1 3ZXLA 3WNXA 1YFXA 5CFCC 1LB2A 2VAUA 2PA7A 4LBNA 1W8OA 1ZBE3 2A70A 1W0NA 3D82A 4QT6A 4WV8A 5FZEA 5G05L 3WHUA 3CJIC 3PVNA 5FAXA 1JS9A 2H6CA 1CZTA 1FPN1 4AHYA 5AFEA 1NXMA 4BOWA 3RZLA 4IGOA 4D7SA 5A3TA 1BCXA 5DAQA 3PDQA 4UBHA 1MS1A 3ZXGA 4NHMA 4HL0A 3HBKA 5A1LA 1O5UA 5FMDA 3JD73 4I0WB 3AMHA 2HWF1 3NJXA 2DBNA 2Y6FA 5DUXA 2GP3A 4EN9B 2D98A 2WO2A 3VV1A 5D8AA 4YZ3A 4QKBA 3K75B 1UU5A 2PFWA 3O12A 4GA9A 3U11A 4QQLA 5EJ1B 5FMBA 4Y33A 1R1A1 5FJKA 4AI1A 3WVJA 2VZSA 3PJYA 3FJSA 4MGKE 4JDNA 4NPMA 4FAGA 1LGBA 1DYKA 1Y9GA 1SLLA 4XUNA 5BNOA 1X9TA 4ARYA 1VALA 5FZLA 2YC0A 1W8TA 2VZTA 2ADDA 1OQEA 4CDXC 1CAUA 3K3OA 1NE4A 1UZ0A 4YGEA 4AHZA 4XDQA 1DQ2A 1SDWA 3AM2A 1LOBA 1ZNPA 3O7OA 2IXHA 4A7YA 2XPJA 2CTVA 3HJRA 1K5MA 3LEKA 4LA2A 3ZDSA 2ZEXA 4B4PA 2E7TA 2P34A 5BV6A 5EYXA 4FOWA 1AL21 2JWPA 4AAXA 5GLUA 5FZ4A 1V9U1 1YIFA 3ZKYA 1PK6A 2JXAA 3IPVA 2ZEWA 1XNAA 2DVGA 1W8UA 2VW0A 2OVUA 3I3MA 2A5ZA 3M7AA 3GJBA 3VBOB 1MACA 1NQJA 4LO5B 3TN93 2RDRA 4RR3B 2V73A 5IK7A 1J3QA 1UW8A 4K9SA 1Y9QA 1MS3A 2RS13 4AWDA 2YHJA 1FNYA 4CU9A 2AEZA 3D6EA 1WA4A 2C6SA 2W91A 3ZSKA 1RUI1 3MHZA 1DYOA 2YG0A 5F5QA 2JDYA 3WDTA 1IS4A 2KR2A 5C3RA 2YZ4A 5FZCA 3CKHA 4Z2WA 4GJZA 4Q5OA 3KS7A 4BQ5A 1XBFA 2VH9A 2ZX3A 1ULOA 4JHTA 4CSWA 3OPTA 4PQQA 2WIIB 2RS51 5FZ7A 5BNQA 4QGMA 2VMCA 3NRUA 3AZYA 3NNFA 1D2QA 4FFGA 2VCMA 4N53A 5EHDA 4AK3A 4FAHA 4URAA 1G9AA 1QNYA 3J7LA 1BQPA 2E53A 2HWE1 4Q4X2 1DHKB 2PELA 2B39A 3H8OA 1FYUA 3SKVA 2GN7A 5FO7B 3KV5A 4XUOA 5AVPA 3LFMA 1UMZA 3MUY1 4Y4RA 4DEQA 5LWBA 3S7IA 1UY3A 1ASJ1 3IMMA 4KGQA 2Y6GA 5GZFA 2MHFA 3OGGA 3SXWA 1AJOA 1VBD1 1ODNA 1ND3B 3LD8A 5GZCA 3WQ0A 4DO0A 3VD4A 3H8XA 2W5FA 3C7HA 1W6QA 4QQHA 1PIV1 4XFAA 4OHZA 3T2QA 1I5ZA 2EA7A 2RJKA 1REFA 4NHXA 4E9KA 5C8WA 3ORJA 4IESA 3O1PA 1HRI2 4HZFA 2VZPA 3NSTA 2GNDA 2QFEA 4Q0VA 2ZGNA 1OI6A 3FL7A 4ZU5A 4HKOA 4RS5C 4XCAA 5J7MA 2WS91 4N7IA 2JICA 4Y20A 2O0OA 4IV1A 4YNIA 1PVC1 1W3XA 1ZRFA 1V0AA 1GZTA 3HNBM 1H1IA 2QQIA 4RGGA 5F5AA 1Q43A 2XLAA 3BODA 1WCKA 3OYWB 3S5QA 3FE5A 4XILA 1V6LA 3O0VA 5HCBA 2ILMA 3Q8EA 2JDHA 5FO8B 4GJYA 4ZY9A 3KSCA 2YFZA 2CY6A 2B42B 3DEMA 2JDNA 1DQ4A 4C1WA 5KXCA 3VD5A 2RR12 5AFBA 1U5ZA 2QQJA 4DZGA 2BOJA 4XUPA 1BMV2 5AC92 4LJHA 3CJIB 4P9JA 2B9VA 5FPVA 4FI9A 1UXXX 4EWEA 5CG9A 2A7AA 4FP3A 1ND2A 1LHNA 5CNAA 1LJ7A 2JE9A 1LEMA 1D0GA 1OC1A 3HT1A 3ES1A 2VOXA 3INAA 1XU1A 1YFYA 4JGZC 4P5HA 5FKCA 2C9KA 1COV2 1JHJA 1QY4A 2RMU1 1POQA 2VM9A 1VMFA 3J8F1 2DFCA 4V1PA 3WV6A 4ZZ8A 5C3PA 1JZ8A 2VR4A 1WBLA 1ZZBA 1ULDA 2HEVF 5CZKA 2XONA 1JXNA 2HYKA 5T3NA 1F4AA 1AX2A 2YC4A 4A42A 1OVPA 1Q5OA 4BE3A 5JMCA 3LPFA 1MZFA 2VZ3A 2ARBA 5HBAA 3WX5A 4DQAA 4MVTA 3GZTB 1XSRA 3NAPC 3QCWA 2PAMA 2BWCA 5ANQA 5J96B 4ASMB 2OIIA 3I59B 2PHWA 5EJ3A 4C0HA 3ZN6B 5APAA 3T0BA 4BLIA 3ZMNA 5T5PA 4RA0A 2FHRA 4XJUA 3KT7A 5DZGA 2I45A 1UZZA 3WHTA 3WF2A 2VC9A 1HW5A 2QQOA 2K9ZA 4PDWC 2XR4A 2DUQA 1LECA 4LQRA 4CXXA 2DCKA 3VB9A 4FXGB 4LPLA 3JBG2 1X7NA 5IW0A 1W2TA 3B9IA 2PYTA 4CDUC 5DDJ3 1NKGA 3NNMA 5FZ6A 1QWRA 1WKYA 1RUG2 1RINA 2B7YA 1H6YA 5A7NA 3DL3A 3KV9A 2VZ1A 4IEVA 3VL8A 5IFTA 1N1YA 2J7MA 2VNVA 4KGGA 3ZYPA 5A1AA 3GHNA 2OKXA 2WT0A 2IFWA 5FBZA 1IQAA 1NE6A 2MEV1 5H9SA 3GBWA 4XFHA 1YHFA 5GZGA 4OHVA 3PVBB 2GH8A 2JDUA 2GMPA 3M70A 4U2AA 4DRRA 1S0IA 5HXVA 4EN6B 2NPIA 5FLJA 2BP6A 4MHUA 3NL1A 2P17A 3NMBA 4XHXA 1RUJ3 4YWAA 3VBOA 5IK8A 4XTPA 1RUH1 4FTEA 1UYPA 2VW1A 4IW3A 4RR3A 2D6NA 3WZ1A 1V70A 3HNMA 3S7EA 4ASKA 4EJRA 5CBLA 5FUNA 3BYWA 3VD9A 2K46A 4YM3A 2WNUB 5FOBB 1XYPA 4GWNA 5K4LA 2XKOA 3WG4A 4CZSA 3AYCA 4A2UA 3KCCA 4JQTA 2UYBA 2DU0A 2F6BA 5FZHA 4HSJA 3K51A 5CU1A 5A7OA 3TOJA 2I74A 2W1WA 3TBDA 3WG1A 1RUE3 2RJ2A 4Q4V2 1NQDA 4Q8KA 5I8SA 2PHUA 1OA2A 3H8RA 4AVCA 2ZGLA 5JPNB 1XQNA 3TN91 4AHWA 4DY3A 2FDKA 1XJAA 3FLTA 1VAMA 2RS11 3QBQA 4XETA 5JR2A 1SFNA 3P6BA 5FYBA 4LBQD 5A6YA 4GULA 1DLCA 3VBHC 1HQNA 1IPSA 4CU8A 1NAEA 2VQTA 4N43C 4WVMB 1O91A 2DCZA 3NO8A 2VE1A 4UFKA 4X8NA 1DGLA 4JQRA 2ZBJA 3AB0A 4IV3C 3RWNA 1JYVA 2UWBA 1C8M3 5ISLA 5A33B 2D3SA 1I9RA 1Q56A 2ZXQA 3SC7X 3VZJA 4CP2A 4TZDA 1ULCA 1EY2A 5LBEA 2ZKNA 1MS5A 1GNHA 2WYFA 1ND3A 1Q8PA 4HSLA 5I8YA 1CX1A 1UX6A 2J1VA 5A80A 4GZ9A 5LEKA 3WCRA 1LOGA 1LCLA 1R091 1N3QA 2OS2A 4OULA 4QX3A 4HPKB 4COVA 3WDVA 1VBA2 2J22A 1F8VA 3DXUA 1Y9MA 1QOSA 3AYAA 1CN1A 2BNMA 1GNZA 5J98B 3UJOA 1DBNA 2RDSA 1AZDA 4BCUA 4JC1A 4JGZB 3VZMA 2W92A 2EIBA 4QDSA 4FBFA 5F1RA 3OYWA 3VKLA 2WQZC 2BGOA 2ZTNA 1H8VA 5IVFA 3U1XA 3WUCA 4BXSV 4SBVA 1HB3A 4NWVA 3HR9A 4LKFA 4LO8A 2PLV3 4E2QA 1POV0 2D5HA 5A1FA 2FBEA 1NZCA 1UIKA 2GMMA 1UX7A 4IE6A 2DBIA 3N9LA 1PMHX 1W28A 3CJIA 3BUCA 5A3LA 4BA6A 1D4M2 5I0UA 3VKNA 4AW7A 5JZGB 3O1SA 5FY1A 4CP9B 5F8PA 3NAPB 2YU1A 1I3HA 2Z79A 3W58A 5JI9A 2WO7A 1EPZA 4QKNA 4C91A 1UY1A 2IFRA 1AJKA 4HKLA 5LK5A 1SEFA 3BCWA 5F39A 2XJQA 5IVBA 2XL9A 4PF1A 5C8CB 5KHHA 4K21A 1JZ2A 1ULPA 4RSUA 3VBFC 1HQLA 2BDRA 2FDHA 5LA9A 2UWAA 1GSLA 1QJX1 4AEKA 1OBNA 2KD7A 1CR7A 2FQPA 4F7ZA 3OF1A 4GKXA 2VNGA 4XJ8A 1X8EA 2HWB3 2W87A 4QD2A 2VVFA 3IIIA 1PK6C 3VHPA 3WW2A 4CCKA 1CWPA 4H3WA 5F37A 1JW6A 1YC61 1ZRRA 1LU2A 2ZOEB 3I59A 4I30A 3WW4A 2GZWA 1RUD1 5H9QA 4RFRB 3ZN6A 1PGW1 2JG9B 2XJPA 3MIGA 1XNCA 1PX3A 1PZ8A 1W8NA 2R041 3H42B 4NIGA 4EN7B 1GWKA 3HEIA 3NQHA 1VRH2 2EAKA 3KVBA 2ARXA 1OUXA 1SLTA 5H9PA 3UGGA 5LEJA 4EN0A 4UT5A 2VBBA 1IQDC 1GWLA 4UFIA 3N9NA 4GMP3 1ZREA 3EHKA 1XE8A 5FRAA 2GALA 2W94A 2YPDA 4TLFA 4LE4A 1FPN2 5KHKA 1LOFC 2WN2A 3E5UA 3OUIA 3SH5A 3AXEA 2D97A 4NRPA 5L36A 1W0PA 3R4UA 5F3EA 1FOD3 1PO11 1G6NA 1DCSA 2DDUA 2VJXA 2IVIB 4XVHA 2CWSA 3VDDB 3RYPA 4N53C 5T50A 3HQRA 5LBBA 5FMOL 3WINE 2BYVE 2W52A 4HVQA 3DPRB 1WLDA 2X05A 4J25A 4IEXA 3FWEA 3ACIA 2Y8KA 4F83A 5D1IA 5JPMB 1OUSA 4A7KA 4G4FA 4J6GA 1R1A2 2G9ZA 2QTWB 1RITA 1GWMA 2Y34A 4P14A 4R9AA 5LBFA 1EUUA 1Y4WA 4QGNA 1DQ0A 3H0OA 4Z1VA 1UCXA 2KA3A 2X53S 5J09A 1JI6A 1OURA 4QX5A 1UKRA 2CAVA 2XJRA 3AKSA 2WNUA 3AMQA 1J58A 4IEUA 4LORA 3ZFEC 3ZYBA 5JXGA 4DPNA 1EV12 4NWWA 4QPWA 2C5DA 3RI9A 1LHUA 3PUQA 1S4CA 3ELNA 1TNFA 3AP4A 3ZR5A 3MIDA 2CGOA 2VY0A 1V9U2 5DZFA 2GAUA 3IKWA 4RL7A 1G9BA 4DRVA 4IV1C 4RGAA 5A3UA 3H3LA 5FZMA 2ZHNA 4R4XA 3WG2A 1OOPC 3FLPA 2Z4FA 4UI9L 1OD3A 2VECA 2R6QA 4LULA 2HWF3 5EPAA 3H1MA 3V65A 3MDPA 4XIOA 4NHYA 1HB2A 2WWUA 4WVMA 5L9VA 3BTZA 2LRPA 3B02A 1RUI2 4TN7A 1QJFA 1CESA 2OA2A 4IERA 3WP3A 1RUE1 1UMIA 2WZEA 3OCPA 2TUNA 5A33A 2JDPA 2JE7A 1T6GC 5E8AA 2J1EA 2V72A 4XQDA 1IHMA 1T2XA 1T6BX 1ND2C 2N7GA 5LW9A 4LK6A 4LLOA 2PXJA 3WEZA 1QOOA 1X33A 3KQRA 4AQSA 3PMSA 2PHXA 2YGMA 2YC2A 3MYXA 3CIHA 1OPMA 2HWE2 2DV9A 3ITQA 1CPNA 2VBPA 3GZEA 3VUOA 1G9FA 2BBVA 3ZFFB 3IAPA 2VG9A 1HIXA 2QDRA 2DVFA 4HPKA 2EIEA 1TME2 3IBMA 2WA3A 2W1QA 4GIQA 2DCTA 2LS6A 2VNOA 1BEV3 4P02B 1HB1A 3EMRA 4NIAA 1PZ7A 1STMA 2CDPA 5FPZA 4JGZA 4QX7A 1ASJ2 3FFZA 3ZXEA 1O3RA 4XDPA 4UW6A 2LROA 2Q8OA 1VBD2 1RJ7A 3BIEA 3CF6E 4JTOA 3KCYA 4OVEA 5B2GB 1UO9A 2W9XA 5EWSA 3VBFB 2JE8A 5C5TA 1GUIA 4XF1A 2BGPA 1PIV2 2PTMA 5FUIA 2VOKA 2Q1ZB 4PJYA 1W9TA 1DLLA 3DGTA 5KC6A 3J7HA 5JZGA 1RMU2 3W59A 4CP9A 1VJ2A 3NAPA 1VAVA 1C1FA 2ATFA 1L3JA 1YI7A 2WR9A 3IT8A 1EAH2 4CU7A 1PVC2 2C0ZA 1N1VA 1OQ1A 2BOIA 5LB6A 2GNBA 3LA2A 2RS53 1RUC1 2VD7A 2WFF3 5GJ6A 4NMIA 3P5BA 4AFAA 5C8CA 3CL1A 4QPIB 4RHV3 2B4KA 3K4ZA 1GR3A 4I0BA 5LK7B 1AR73 4JGYC 1UQXA 3NJYA 1QXPA 3DF0A 1EPWA 1XC6A 4JKLA 4WM8B 1W8WA 4Y1UA 4AFMA 1MR5A 3AP5A 4XW3A 4CTEA 4LNVA 1LULA 1WMFA 1ULFA 2R063 4PIZA 3UL2A 3LDRA 1FT9A 3RMXA 2VMGA 5F32A 3RZGA 4B1LA 3AYDA 1TG7A 4AI9A 4FOVA 4BQ2A 5L9BA 1LNSA 4UW5A 5DMYA 3IDCB 2BW8A 2VOWA 2RM23 2VGDA 3TWIA 3ACGA 2RMU2 4GB31 2B46X 2JG9A 2IWGB 3ZSMA 3HQUA 1CONA 1IS6A 4N8MA 2E6VA 2P3JA 5JUVA 2ZMLA 3ATGA 4NAOA 3I2IA 2LM3A 2OQ6A 3HAGA 3RNSA 1VPHA 4AE2A 3JQWA 4NN0A 4WVZA 5BYNA 1OH4A 1RXGA 1GZWB 3CQOA 2Q8DA 3RJRA 1H2KA 2WS93 4XXAA 2IXKA 2HWD1 3T4VA 3OB8A 4NPRA 5C4WC 5JR7B 3POFA 1AR82 3VDDA 2YROA 1VP6A 2WAOA 2ZZQA 5FYUA 5C9AC 3RSJA 1W9YA 3OBAA 3T2PA 3ZFEB 3DPRA 3E1F1 4LE3A 2QQLA 4XEZA 3E5XA 3R05A 1TMF1 5GLVA 4GMP1 1ZBE2 2XKPA 3NNLA 1IPJA 4BQYA 2P5BA 5A70A 3UKTA 2Q1FA 4BQ4A 1ALYA 1RYYA 4NHLA 2GNTA 4Q4Y3 1FAYA 4AI0A 3EB7A 4D94A 1ST8A 1VBE3 2OUJA 2BU9A 4IE0A 3EXUA 2P37A 3BPZA 3D0SA 4YW2A 2WN3A 3W21A 1H1AA 3PMEA 1FOD1 4Q26A 4ZONA 4CE8A 5ACA1 4I09A 3ZR6A 4E4SA 3JD72 1OOPB 2D6LX 4CYDA 3MI8A 3J8F3 3QOPA 4D8MA 4XUTA 3VBHA 2F17A 4BQXA 1KFUL 3C7EA 3EJKA 4Q1RA 5FZAA 3HQXA 1PVXA 1IS5A 2OQ7A 1LODA 4OMDA 4CCJA 2DCJA 3RZMA 2B8MA 4RFT0 3RQ0A 1LAJA 3WCSA 3LE0A 3WDXA 1YQCA 1UYXA 1SBDA 2XHNA 1LHWA 4LUKA 3KQ4B 5FY4A 1JH5A 2FD8A 2X29A 1NY72 4N9HA 3FC0A 5FJHA 4XFBA 2ZGSA 1GFF2 4PCRA 4YPJA 4AHXA 2VUDA 1CJPA 5K7PA 1LOEA 1DQ1A 1H4HA 1UPSA 4ONUA 3I2FA 2VCCA 4B1MA 5BNNB 5I8TA 1JN2P 2WNVC 4ZU4A 1G9CA 2QZ2A 2VPVA 5DAVA 5LY2A 3POYA 2Z42A 3ME2A 1QDCA 1JHNA 1SBFA 2OX0A 2W3JA 1QQP1 5CYYA 3TNQA 1VIWB 1CGPA 5C3SA 3OOXA 3TN92 1YJKA 2V5YA 4Y24A 1QJU1 4K20A 1IOAA 1PO23 2XLFA 3RVHA 2RS12 1WLTA 1NLRA 4P9GA 4BMBA 2CGNA 2WJSA 3LDBA 2QJVA 4QB1A 4XMAA 5EQUA 3T4HB 3ZFFA 1HQWA 3AK0A 2A6VA 4M3CB 1RXFA 1V6MA 2GC3A 2MEV3 4P5YA 3K4AA 4MGQA 5KHIA 3FN9A 3NJVA 1XNDA 2D44A 4NHKA 4F3JA 1VMHA 2Y6LA 1NG0A 3ZYGA 2AR6A 2ZKLA 5A3OA 4Z07A 3OY8B 4DOUA 5JVVA 1AX0A 3LA7A 4H55A 4O65A 1RUH3 2XJSA 1W03A 4JGYB 3VBFA 5T55A 4XZUG 3CO2A 4IE7A 4Q0QA 5C70A 1G7YA 5FZKA 1REDA 1O4ZA 3IB3A 4E2GA 3AKRA 3G7DA 2ZGRA 2DF7A 2CSGA 1NLQA 3D5OA 1BEV1 4DXTA 5J48A 1VBC3 3E5QA 4YW3A 3W20A 1Z7S1 1ZBA2 3BU0A 1PNGA 1VRBA 4NIDA 3MIBA 1SQ4A 2A3WA 5LA1A 3TAYA 4QDRA 3VN4A 3GDBA 3U07A 5F6KA 4AGVA 4QPIA 3G6JB 2IXLA 4Z8BA 1DF0A 1TNRA 1CZSA 4D3WA 2A1XA 2ARCA 2A6WA 2EIDA 2UY9A 4WM8A 1XNKA 1W9FA 4WBBA 3SISA 1SZBA 5DQ0A 4HK8A 1GZ9A 1OFNA 4LHKA 1UN1A 4XC9A 2QVSB 1LOFA 4R9DA 3V56A 1FI2A 1DZTA 5C4WB 2Y33A 4KWKA 2YY1A 3I2JA 2WFF1 3A23A 3AL6A 4RHV1 4AVAA 2VXRA 3F95A 5C9AB 5M0TA 1AR71 2VNRA 1W05A 1ACCA 4LO6B 3WNNA 3SLIA 1BYHA 2PHDA 1PHMA 4XFGA 1R093 2WNUC 3GBFA 1Q8OA 2R061 2JB8A 3AJYA 4ARXA 1R081 3S57A 1GZWA 2VUAA 5GM0A 2E32A 3BGAA 3EYPA 4WM7B 3WP4A 3TRSB 4E4HA 2JIJA 3GNEA 3VKOA 2P2KA 1RVF3 1W8FA 4AQ2A 5LCWL 2O1QA 1N1SA 1JYCA 3AP7A 2RM21 1ZZCA 2XDVA 4EZ4A 5IATA 1L7LA 1JU4A 2XUMA 2XGXA 4Y1YA 3VBUC 4LITA 3WD5A 3KD4A 1S2EA 4MG2A 1KDKA 3ZFEA 3I7DA 3IDEA 3AVRA 5A3MA 4OCTA 3C7OA 3HVDA 4QQPA 3B01A 1FV2A 4KBBA 3VBRB 5CADA 3H1YA 3RMYA 1I1EA 2YYOA 2ZEZA 3E6DA 3LFIA 5FZ1A 2SBAA 3ZX7A 4DFSA 2DUOA 3N9QA 4EROA 2W39A 1H6XA 5A6XA 2NZ9A 4W6YA 4UFHA 3THCA 5EIYB 2XVGA 1D4VB 2QBXA 5FXVA 5BUVA 2WABA 3AC0A 2ID4A 3WF4A 1O3TA 1OOPA 4K6BA 2RDQA 4HMZA 1QHDA 3N9OA 3SCFA 5FFOC 1UU4A 4JDMA 5IK4A 2A73B 2GU9A 3KM5A 4P08A 3WNOA 1ULGA 1KITA 1R1ZA 4OI1A 2WNVB 1MEC3 2HH9A 2VTXA 2D6MA 3Q8CA 3H7JA 3PU8A 4CA9A 1W9WA 1W2OA 1QJX3 2HKXA 1AVBA 4Q4Y1 4BZ4A 1VB4A 2WAAA 1VBE1 5FIXA 3N3HA 5DDJ2 2RS33 3MPBA 1D2SA 2C26A 3MLKA 3GZUC 4AEMA 1X50A 3MUZ1 1LGNA 3PUSA 2R1BA 1O59A 4PQ9A 2BQPA 5DAXA 1I5PA 5GLTA 3ZIXA 3A0KA 4MGTA 2Z69A 1RUD3 4XURA 1VR3A 2R043 1RIRA 5E6HA 1ZA7A 4Y1VA 4OI0A 2WDBA 1GZCA 5DAWA 4CXWA 4DEVA 1HN0A 2NMNA 4FP2A 3FBYA 1WUVA 3O1OA 3DUIA 4YZ2A 3ZFGB 1N3OA 3U78A 3VD7A 4DUWA 3P1IA 5JZGC 2C4XA 1WCDJ 1YFWA 2FDJA 1MPXA 1BVVA 1RUJ2 2WSUA 5FMCA 3Q9OA 4XCBA 4BXFA 5CFDB 5F5CA 3SHRA 1QXRA 2SLIA 3S6PA 1PO13 1WW4A 3U75A 4HFSA 3O0WA 4KU8A 4TTGA 4M4RA 4OZOA 3EBRA 5C8CC 1Q8SA 4YZ1A 2D6KA 4XJ9A 4YG3A 3U37A 4Y22B 4M3CA 3SH4A 3JU9A 3LB9A 3QACA 1MQTC 5EV7A 1CX4A 3LF7A 3MO4A 1K3IA 1RUE2 1DGRN 1ULEA 2ZHLA 4LBKA 2AYHA 5F3GA 1SLBA 5CISA 3B93A 3OY8A 2RVAA 2VMDA 2VOVA 4ZKTB 1PO21 2ZEYA 3DYMA 2QDNA 4Q4W3 1VE0A 2ZABA 4COWA 4CP0A 2E26A 4JGYA 2ZGQA 2JG9C 1QJY3 1VBB3 3RG0A 3CNAA 4JKMA 4QU1A 1MZ6A 3BALA 3QH7A 2P4EA 4O61A 2VZUA 1IZ3A 2F4PA 1DGWX 2IUWA 2ZHMA 5IJRA 5KXEA 3UNPA 3POSA 1BHGA 5C3OA 1C8M2 3I3QA 3PVEA 2P3YA 1OPOA 2PAEA 1J1LA 2OT7A 3CLPA 2PHFA 3ILNA 1YLLA 3FHIB 3NJZA 2XWBB 2P6HA 4BU2A 1KDMA 5KWRA 4GWMA 1W2NA 4IEYA 4L99A 1U5XA 1CPMA 2OZJA 3LGRA 4AZZA 2ZAAA 5DG1A 1QIQA 4C1XA 1DIWA 1LENA 3C2UA 4IE4A 4LXLA 1OLMA 4P9WA 4XAAA 1GANA 4URTA 3VDDC 4CCEA 2Y6HA 5GALA 2YPJA 1S1AA 3Q8BA 4GWJA 3WNLA 1ZRCA 1MZ5A 1US2A 2QQNA 3OJBA 3DPRC 5T5JA 4M4PA 3A7QA 2I07B 2JDMA 3IDBB 2ETEA 3T09A 1VBC1 1H9PA 1A6CA 4LBLA 4BJ0A 1F2NA 4S2GA 2Q5TA 2ZGMA 1UOJA 1C28A 5C4WA 3ZLIA 2GC0A 4V2WA 3FBMA 3VBUB 2QQPA 5FXWA 3RZKA 3U4SA 4XUQA 4AGRA 5C9AA 2OPKA 2UWCA 1ZA4A 4EN8B 3ST7A 2Y60A 2J42A 2PAKA 4MGIE 5FCCA 2PLV2 3RZHA 5T5OA 3MIFA 1CD3G 2A6YA 5IVVA 4OI2A 1SCRA 4LO7A 3CMGA 4XTMA 4FO9A 3N9MA 2ZGTA 2KM2A 3AZXA 5FYZA 4BQ3A 5FOJB 1PGL2 1SLCA 4FTSA 4A41A 1UNBA 4YFWA 4WM7A 5KR7A 3GM8A 5FY0A 3HT2A 2GSYA 5FWEA 4JV4A 2AACA 2BGCA 3WP6A 1CJDA 5FZFA 1YRZA 4ISRA 1K12A 4BIOA 2DU1A 1ZZ8A 4YW6A 4ZXKA 3GCWA 2K0GA 1J84A 4E4ZA 3GHMA 4HVRA 2Q8EA 4Q27A 3KT4A 3VBRA 3SITA 2G9GA 3AZWA 4RYDA 4AEJA 4FSJA 1AXZA 4HVOA 4X8PA 2CAUA 4XPVA 1WW6A 3VBSC 3O1VA 1BBT3 1ZZ7A 3AKQA 4YARA 2WINB 1ZYBA 2HWB2 4AEDC 1RVF1 1J3PA 1WA6X 4WVVA 3OBRA 5JAXA 3PIGA 1KS5A 3CHXA 3E6BA 4K7JA 1QEXA 2EVXA 2RG4A 1RUC3 1DZQA 4PLOA 4CDWC 3PUAA 3SQOA 1UKGA 3BKZA 2QQVA 4GALA 2CWMA 4KWLA 2WNVA 4DNYA 5LY1A 1W6NB 3ZFFC 1FV3A 2J1RA 2TEPA 4NRQA 3O14A 4FXKB 3THPA 2CDOA 1BLZA 3VHOA 1AX1A 3GF6A 5CIRA 4PLMA 2ADEA 3WG3A 5I91A 4HN0A 4HT1T 1W90A 1ZM1A 2VMEA 4BPZA 4MXWB 1FOD2 1QXJA 1B35C 1W04A 5L73A 5FYHA 1J3RA 1HB4A 1JZ3A 2QQMA 5JXJA 1YWKA 3J26N 1RGSA 4GB33 2FZ2A 2OXBA 5FK7A 2VCBA 4NOTA 5JIAA 1X36A 5DAPA 3ACLA 2OYZA 4ASLA 5HXMA 3MZHA 1MEC1 1WD3A 2EIGA 5E1RA 5JXHA 4A3XA 2VL4A 1J83A 3QD6A 2D3RA 1MQTB 5JSRA 1OKOA 4KBZA 5LRSA 3ZFGA 3ZN4A 4META 2RS31 4X6QB 5EP9A 1WMEA 2JG8B 4CEWB 1U5YA 3NV2A 2PN5A 3JXSA 5J1XA 4YGCA 3AZVA 2V09A 1NCQB 4P9IA
chains in the Genus database with same CATH topology
4LBMA 2ZHKA 2HWD3 5CFDA 4GXLA 1ZX5A 2EAAA 3LCPA 2NQYA 1TQ5A 2JECA 3L2YA 1AR63 3R4SA 4S2FA 4QPIC 1ENSA 2EXJA 5CG8A 4Y22A 4W6WA 4WM8C 1TMF3 2BWAA 3J9SA 1WW5A 5JWPA 4J1WA 3O5SA 3BOWA 1UIJA 2LUWA 3QH6A 2B9UA 5ACA3 3JB8A 1Z0HA 1M4WA 5E88A 2ZS6B 3T2TA 4P9YA 2HWF2 2Q1MA 3WT3A 4KL1A 4LBJA 5K9YA 3KT1A 2W68A 1S0DA 1F5JA 1W0OA 4JVAA 1HRI1 5L7OB 1O5LA 2DFBA 4R9BA 3WQ7A 4QPYA 4C0BA 1SMVA 2QZ3A 2Z5WA 3IMNA 4Y26A 2OW4A 1QGLA 4Q4W1 4JDOA 4FPOB 3ZMOA 4MX3A 1QJY1 3NVCA 1VBB1 4C90A 2ZJCA 1FXZA 2HEWF 2E7QA 4KQ7A 3S0MA 5I0RA 1OQDA 2ENRA 4SLIA 4XFHA 3M2MA 1AL0G 3N7LA 5KBFA 2RR11 4K1ZA 4N9IA 5AC91 3HBZA 1UL9A 5HCFA 1BEV2 1HX6A 1LHOA 1AL22 2WKKA 1AYN3 1RUF3 4JRAA 1MVEA 1KJRA 1IKPA 2GDFA 4L2NA 1NA1B 3H9AA 1QQP3 3VBUA 1E57A 4TSVA 3PLQA 1QJU3 3ZIWA 4B8EA 3ASIA 5J3UA 4K8FA 3WDYA 1DU3D 1V6NA 4I02A 1O3QA 1HV0A 1O3SA 1UD1A 1Z78A 2PHLA 2JKBA 4K3UA 4M01A 3VBSB 2XJTA 4QU2A 2LTNA 3ZPYA 4AEDB 2RJLA 5EFUA 3H3ZA 1QU0A 2EF6A 3HWJA 1PNFA 4BHPA 4AI3A 2JD4A 4YW4A 2RS52 2WFF2 4CDWB 3EQEA 5K0UC 4RHV2 3RPQA 3ZVXA 4B7EA 5LRRA 1AR72 3A0NA 1SBEA 3RDIA 3SMHA 4YGBA 5FREA 2GMEA 1W6PB 4BH9A 3N36A 1QMJA 4DS0A 2R062 2A71A 3HIFA 1O7FA 1C5HA 2X5IB 1KFXL 2QCSB 2TNFA 1S0GA 3JBG1 4NO4A 1Y43B 2ZGOA 4M0NA 3ILRA 3W9AA 3WR0A 1Z7S3 1B35B 2QKDA 5FQ0B 2RM22 1FNZA 3PJQA 1RUG1 4MH0E 4RD7A 1S0JA 1DYPA 1MS9A 1APNA 1BZWA 2XL7A 1AR93 4QXKA 4LA3A 5ABJB 1CAVB 4KWJA 3MFAA 1A3KA 4CEYB 1V6IA 2Y0OA 3PTYA 3M8LA 1W6NA 5TSWA 1KS4A 1BBT1 2VQAA 4DY5A 3VKFC 5I93A 3OBTA 4YZ4A 1CVNA 2WS92 5GKAC 2QUOA 2H6BA 4MXWA 2HWC3 2X8KA 2Q30A 1QKQA 3ILFA 4FPEA 4QPGC 4O9EA 5FPXA 2DTYA 4Z92B 4Q0SA 2DURA 2BFUS 2WLQA 3KMHA 5JSOA 4HBNA 1YI9A 3E6CC 1MQTA 2A3YA 1N1TA 4Q4Y2 1R083 2ZMNA 4XXPA 4CEWA 2JG8A 1OD5A 1HXS3 1VBE2 1LESA 3S30A 2I2SA 2XBO3 4KH9A 4MYEA 3WW1A 5BNNA 1NCQA 2ZCWA 4FCAA 3U10A 4OLLA 2BTVC 3WUDA 3WW3A 3J8F2 1ENQA 4YGDA 3AKPA 1GQGA 1SACA 3LA3A 1MS0A 2IZWA 4COZA 3USSA 3PVOA 1DZRA 1SCSA 4N7UA 3K48A 1ZZ6A 3OD0A 1TME3 2D7FA 5EYYA 1O4YA 1AUYA 2CL2A 3AXDA 4E4DX 2BPA2 1ZRDA 4ES9A 3ETQA 4I2OA 1UPIA 5J36A 5HI0A 2ZAHA 1WBFA 1AR61 5A32B 1XYOA 4ZU7A 1U0AA 1DGRA 3WY6A 1Q3EA 2K2SA 4R52A 4Y1XA 5L7OA 1VBA1 4O9GA 4UW4A 5DUWA 4LLFA 1RHI3 2WC2A 4WVWA 1RUOA 2R16A 3AMPA 4XFIA 4YW1A 4WM7C 5JIUA 1UZYA 4B4RA 4IL7A 2Q4SA 1YCIA 1X8MA 4OI4A 1AXKA 4QGLA 5BNPB 2IXIA 1PO22 2VQ0A 3ALQA 1ONAA 5IT6A 4L97A 3JZVA 2XWJB 4XJWA 1HRV3 1JUIA 2WZR3 1U5IA 4L9BA 4W6XA 3V64A 4OUSA 3ZSLA 4CP1A 2O8QA 3VBRC 2MEV2 4E27A 4FQZA 3ZYJB 3L9JT 1YXWA 4XF4A 3LOIA 4BQ1A 1V6OA 3GALA 1NA1A 1KXGA 3DKWA 1S0FA 4CDQC 3J4UH 4FOQA 5K0UB 1RUH2 3M3OA 4E2SA 1V6JA 3M3IA 2JX9A 1EYBA 3KB5A 2WFPA 4J1XA 5DUVA 3N35A 5DUUA 1AF9A 3VBSA 1H1MA 4Q0UA 1POV1 4AEDA 2VMHA 1AYN1 1RUF1 1VBC2 2O8OA 4ES8A 4UW3A 4D7YA 2ZMKA 4XBLA 4NVPA 3FX3A 1XXNA 4M00A 5KHJA 1GV9A 4KU7A 5CA6A 4I3GA 4S2DA 5AVAA 4CDWA 2GN3A 2D6PA 1FMD3 2A75A 3CJXA 1PMIA 4QQOA 1W6PA 5EXOA 1IPKA 1OLQA 3C3VA 4R4ZA 1MVQA 2X5IA 3MW4A 3PHMA 3AKTA 5E89A 1HDKA 3NWKA 4K1YA 2LALA 3ZFGC 3E97A 4XJAA 3VZNA 2G4IA 5F6LB 1B35A 3MIEA 2P3KA 5FQ0A 4QPGB 3VZKA 4A7ZA 3NKTA 4IEQA 3N7JA 5CFDC 3ZN5A 3HMYA 2EXHA 3PNAA 1B09A 5ABJA 1CAVA 3X29B 2WLPA 1AYM3 1JUHA 1R092 3D0JA 4CEYA 3ZXJA 3I54A 2R073 4KNCA 2TBVA 3GZAA 4L92A 4XF9A 5KXBA 4FPLA 1C8NA 1RVF2 1Y3TA 3M3EA 1S2BA 4ATEA 4BYYA 2RHPA 1GICA 3RJ2X 4GH4B 4Q2FA 3SCGA 1WCSA 2A6ZA 4AI8A 1AR91 1OFSA 1ZZ9A 3LSEA 4BM8A 1YJLA 1C4RA 3VZOA 4D7TA 5IK5A 1EV11 1W6OB 2WT2A 4IEPA 5H9RA 3B69A 3IIAA 2HEYF 2VMIA 4WZCA 1HKDA 3I8TA 3CU7A 2YDEA 2JEMA 4FT8A 2HWC1 4YW5A 4IETA 4ISQA 1XE7A 3USUB 3B9CA 5GZDA 3OD4A 2ZX1A 1H30A 4OHXA 5T5LA 3WP5A 2BNNA 4QQ2A 1MEC2 2AUYA 3LKJA 1QJX2 4YYOA 1C3HA 1HXS1 2YGLA 2RS32 4M3CF 2XBO1 4Q8LA 1C1LA 4DXZA 1KRIA 2PQQA 4AFDA 4PIYA 4PLNA 1RUD2 3VLBB 3M3QA 5A32A 1NLSA 1PGW2 1SLAA 3MPPG 2R042 3V0BB 1H8TC 2YV8A 5JLVA 1TME1 1QOTA 4BIFA 4YG0A 4XJZA 3M4FA 2YUEA 3O0XA 4JCKA 1GLHA 1JBCA 1MZEA 4IEOA 3ECQA 4CDQB 1ZBA3 2ZZJA 2XB6C 4YZ5A 1G8WA 4JRLA 4HANA 1PO12 5BNPA 3WOGA 2WQ4A 4YLZA 1OHFA 1BJQA 3DN7A 2D43A 4OFGA 4U36A 3MF9A 2NYYA 4LBQB 3UKNA 3U0ZA 4DINB 3IM0A 4FPFA 1RHI1 1RMU1 4TYSA 4UXAA 4B7KA 3LZZA 2AGSA 1EAH1 4H7MA 4ATFA 2CV6A 5CVRA 3N7KA 3T1MA 1Y7BA 4R9CA 4RQPB 3AFKA 2FMYA 5EZWA 5K0UA 4R8HA 4Q4W2 1WLCA 4AVVA 5JOXA 4DB5A 1QJY2 3HD8B 1RTVA 1VBB2 1HRV1 2WZR1 4Q4X3 5CFCB 1OA3A 4JAAA 4PIXA 2OZ6A 4BWOA 4IEWA 4B3NA 5JI7A 1LEDA 1S0BA 3NV3A 2GC2A 1KJLA 2D5FA 3FLRA 4YVSC 4NR1A 3IN9A 3JB4C 5FDBA 1I6XA 2AH2A 3FUOA 3ZXKA 5F9TA 3WQ1A 1NYWA 2DTWA 2ZX2A 5GZEA 1OSGA 3RYKA 2Y26A 5T52A 4FPCA 3RZZA 3MF6A 2R30A 4ORFA 4DMIA 1HRI3 5JOYA 4IQPA 1DFQA 3ZSEA 2WL1A 4CEWC 2JG8C 1TEIA 1SLIA 1WMDA 4H7LA 1RC6A 1QDOA 4D69A 4QPGA 5BNNC 4IEZA 1NCQC 2R0HA 1AR81 3AX4A 3EO6A 1RUNA 3RI8A 1FMD1 1MS4A 4CDXB 2P3IA 3MFCA 2PHRA 3SCHA 4AVTA 4I01A 4QM9A 1ZBE1 4EV0A 1N47A 2RR13 2XVKA 4COUA 5DG2A 1NCRC 5AC93 1ENRA 1IGOA 4QMAA 1KD7A 1SFYA 4LT5A 4AQTA 1F5FA 3KGLA 4Y1ZA 4LHLA 4MSVA 3B5LB 3JD71 4GH4A 3MIHA 2DWRA 1COV3 2A6XA 4YRDA 1CIWA 3D4KA 2AREA 1H4GA 3URFA 1AYM1 5BXXA 2BVBA 4AQ6A 1OA4A 4KG8A 2R071 1W6OA 3P3PA 4AVBA 1BBT2 5L7OC 4L11A 2Q0AA 2ZACA 1LHVA 3WDWA 1NY71 2D3PA 1VLNA 5T54A 1V6KA 3USUA 4Y5Z0 1RUC2 2VVEA 2VULA 1H0BA 1X82A 4FTBA 4YVWC 5K8SA 1HLCA 1H8TB 4AFBA 1OKQA 2YXSA 4TWTA 2BNOA 2YMZA 3WDUA 4K40A 3JBG3 2UURA 1D0HA 1BXHA 4XYXA 5FO9B 1NA1C 5J37A 3THTA 1DG6A 4MLOA 3ZO0B 1RUG3 4GB32 1S0CA 1YNAA 1A8DA 4GMP0 4Y4YA 4AG4A 3NV1A 3V0BA 5L19A 4FPGA 1HV1A 1Q8VA 2R49A 4MZUA 1EP0A 1QH7A 4RS5B 3NW4A 3LAGA 2AENA 3AFGA 3ZXAC 4M0HA 1JOJA 1Q8QA 4CDQA 4XF0A 5BPXA 2UU8A 2HWD2 2B5HA 2H0VA 4W65A 3AYEA 3VHNA 1LOCA 2UYAA 1AR62 4AF9A 1CAXB 1MS8A 4YM1A 4XOGA 3A4UA 3V0AB 4LUMA 2ZPXA 5FMOS 5SV8A 3H3UA 1W39A 4LBQA 1TMF2 3B94A 5HCAA 4YG6A 2XJVA 2WNEA 4LTAA 2X5IC 4LHNA 3WXPA 1QNWA 3U4XA 2EALA 1ZBA1 4YVSB 1CAWB 4Q4V3 4PBOA 2RE9A 4RQPA 1WW7A 5FLIA 5ACA2 4AVSA 3ENRA 3T1LA 2BEOA 2GC1A 3AJZA 2Z2SB 3VL9A 1YYNA 1O4TA 3M1HA 5ABJC 3MLJA 3AMMA 5CFCA 2C9AA 2DYCA 4JTNA 4CEYC 3WLUA 2BVVA 2JDZA 5D8AC 3UV9A 2ZGUA 5BY5A 2ZA9A 1LR5A 1N3PA 3BOPA 5C33A 4FPJA 4AYUA 3KZ4C 4KG0A 3UKVA 2KXLA 2AZ5A 2A3XA 4XIKA 4S2HA 2C1FA 4Z82A 1JYIA 5BNOC 3I2DA 1LTEA 1DGWA 2D40A 2R1DA 4YM2A 3KGZA 2DVAA 4Q4X1 1WD4A 1KQRA 3MICA 4PDWB 5GLWA 2IXCA 3I4IA 1WLWA 1UF2C 2ES3A 4YSFA 5DZEA 1NCRB 3MLLA 1AXYA 1VBA3 1K5MC 1AYN2 1RUF2 2H0BA 4CDUB 4OHWA 5IUQA 1RL3A 2VUJA 3MW3A 3NV4A 4BLJA 2CNAA 1PM7A 1QQP2 2E51A 1YO8A 2ZGKA 1QJU2 2XH6A 3H8UA 1G9DA 2QNKA 3JQXA 4CDXA 2E7AA 1VAKA 1H2LA 5DXDA 4IXLA 1LU1A 3KCXA 2CGPA 5JOZA 1F9KA 2E9QA 1D4M3 2ZX0A 5SV5A 3B3QE 4XFFA 3VZLA 2ZX4A 1M06G 1QF3A 4YVWB 1S0EA 1XRUA 1W6MB 4H14A 4XFCA 3BB6A 4B29A 4G9SB 3BU7A 3MGUA 1IS3A 1BK1A 1URXA 3OGJA 2W08A 1BMV1 4XMIA 3FFQA 1POV3 1PZ9A 1YUDA 2XLGA 5DDJ1 1Z7S2 4L8QA 4WZFA 4PBPA 3N7MA 4AFCA 4GQ7A 2D93A 1LKNA 3H1WA 5E16A 1COV1 4HK9A 5GLZA 1AR92 5BNPC 3M3CA 4QM8A 3H7YA 3VBHB 3UK9A 2DCYA 1GYKA 4EWAA 4N43B 1H8TA 2UY8A 1VRH3 2IC1A 4IV3B 3ZXDA 3AZZA 2ET1A 4LEJA 3FMGA 4AXOA 1RUJ1 1DQ6A 1FPN3 1LRHA 1J59A 1DDLA 1A78A 2HWC2 2WWSA 2D6OX 3MW2A 2DUPA 4B4QA 2XG3A 3B7MA 4XF3A 3R6SA 1AHSA 4YM0A 1W2UA 1YIPA 2GH2A 3JCIA 2R0FA 1S55A 2JENA 4XZPA 1U12A 4PF5A 3TNPB 3N4MA 1GQHA 2NP0A 4RS5A 1R082 4GKYA 3D8CA 1VB2A 1HXS2 1R1A3 2HJIA 4HETA 2XBO2 4FPHA 3GYDA 4F8AA 1CQ9A 3LWCA 1LGCA 1S2KA 3FZ3A 3RRDA 4FPKA 1CAXA 3V0AA 5FLHA 2B45X 3APBA 1A8MA 3POWA 3MEPA 5D8AB 1EV13 1XU2A 1RJ8A 1FX5A 1IKQA 4QHBA 1C8M1 4AI2A 2DVBA 3B00A 3RYRA 4N90A 1AL23 3P3NA 4YVSA 1V9U3 1CAWA 2XHKA 2VU9A 5BNOB 5KC5A 1TE1B 3ZYRA 4FQ4A 1OMIA 4MGZE 3ZSJA 4MXVA 4I3PA 4XQ4A 1QH6A 3L2HA 1CAUB 4FOYA 5JDBA 4CRQA 4Q1PA 4I0AA 1YFUA 1WGPA 2NM1A 1K5MB 1RUI3 1V00A 1RHI2 3ZXFA 1H2MA 5I0TA 3AMNA 2XVLA 4HKWA 2JJ6A 4Q4V1 1PK6B 1BKZA 3IPVB 4HLTA 2Y0IA 4EWDA 3UJQA 2WT1A 1ENXA 3GBGA 4MUVA 3BIWE 2IXJA 3IWZA 5FTTC